BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c38786_g1_i1 len=546 path=[524:0-545]

Length=546
                                                                      Score     E

ref|XP_010314971.1|  PREDICTED: separase isoform X2                     194   4e-53   
ref|XP_010314969.1|  PREDICTED: separase isoform X1                     194   4e-53   
ref|XP_006349439.1|  PREDICTED: separase-like                           192   2e-52   
ref|XP_009777791.1|  PREDICTED: separase isoform X1                     187   1e-50   
ref|XP_009589674.1|  PREDICTED: separase isoform X2                     187   1e-50   
ref|XP_009777792.1|  PREDICTED: separase isoform X2                     186   2e-50   
ref|XP_009589664.1|  PREDICTED: separase isoform X1                     181   9e-49   
ref|XP_009589680.1|  PREDICTED: separase isoform X3                     181   1e-48   
emb|CDO97522.1|  unnamed protein product                                159   4e-41   
ref|XP_006491875.1|  PREDICTED: separase-like isoform X1                155   2e-39   
ref|XP_006491876.1|  PREDICTED: separase-like isoform X2                155   2e-39   
ref|XP_006491877.1|  PREDICTED: separase-like isoform X3                155   2e-39   
ref|XP_010657825.1|  PREDICTED: separase isoform X4                     154   3e-39   
emb|CBI23880.3|  unnamed protein product                                154   4e-39   
ref|XP_010657824.1|  PREDICTED: separase isoform X3                     154   5e-39   
ref|XP_002273874.2|  PREDICTED: separase isoform X2                     154   5e-39   Vitis vinifera
ref|XP_010657823.1|  PREDICTED: separase isoform X1                     154   5e-39   
gb|KDO41134.1|  hypothetical protein CISIN_1g0001101mg                  153   6e-39   
ref|XP_006431950.1|  hypothetical protein CICLE_v10000008mg             152   1e-38   
ref|XP_006431949.1|  hypothetical protein CICLE_v10000008mg             152   1e-38   
ref|XP_008218969.1|  PREDICTED: separase                                151   3e-38   
ref|XP_002303173.2|  hypothetical protein POPTR_0003s01610g             149   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011008695.1|  PREDICTED: separase                                149   2e-37   
ref|XP_007225661.1|  hypothetical protein PRUPE_ppa000043mg             148   4e-37   
ref|XP_010439037.1|  PREDICTED: separase-like isoform X2                141   7e-37   
ref|XP_010439035.1|  PREDICTED: separase-like isoform X1                141   2e-36   
ref|XP_008361643.1|  PREDICTED: separase-like                           145   3e-36   
ref|XP_008339285.1|  PREDICTED: separase                                145   3e-36   
ref|XP_007041565.1|  Separase, putative                                 144   1e-35   
ref|XP_010448800.1|  PREDICTED: separase isoform X5                     143   2e-35   
ref|XP_010448799.1|  PREDICTED: separase isoform X4                     143   3e-35   
ref|XP_010445194.1|  PREDICTED: separase-like                           142   3e-35   
ref|XP_010448798.1|  PREDICTED: separase isoform X3                     142   3e-35   
ref|XP_010448795.1|  PREDICTED: separase isoform X1                     142   3e-35   
ref|XP_010448796.1|  PREDICTED: separase isoform X2                     142   3e-35   
ref|NP_001190804.1|  separase-like protein                              140   2e-34   
ref|NP_194028.2|  separase-like protein                                 140   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004295930.1|  PREDICTED: uncharacterized protein LOC101294643    138   1e-33   
gb|KFK39266.1|  hypothetical protein AALP_AA3G222100                    135   7e-33   
ref|XP_010540479.1|  PREDICTED: separase isoform X2                     135   8e-33   
ref|XP_010540470.1|  PREDICTED: separase isoform X1                     135   8e-33   
emb|CDY41265.1|  BnaA01g12740D                                          135   1e-32   
ref|XP_009136537.1|  PREDICTED: separase isoform X2                     135   1e-32   
ref|XP_008445506.1|  PREDICTED: separase isoform X1                     135   1e-32   
ref|XP_009136528.1|  PREDICTED: separase isoform X1                     135   1e-32   
ref|XP_002867740.1|  hypothetical protein ARALYDRAFT_492569             135   1e-32   
ref|XP_004163947.1|  PREDICTED: uncharacterized LOC101203087            134   2e-32   
ref|XP_004144269.1|  PREDICTED: uncharacterized protein LOC101203087    134   3e-32   
ref|XP_007148477.1|  hypothetical protein PHAVU_006G212000g             133   4e-32   
ref|XP_006286190.1|  hypothetical protein CARUB_v10007755mg             133   5e-32   
ref|XP_008445507.1|  PREDICTED: separase isoform X2                     132   1e-31   
gb|ABN08434.1|  peptidase , related                                     129   4e-31   Medicago truncatula
gb|KGN47608.1|  hypothetical protein Csa_6G364113                       130   7e-31   
gb|KFK31931.1|  hypothetical protein AALP_AA6G177700                    129   9e-31   
ref|XP_011088127.1|  PREDICTED: separase                                129   1e-30   
emb|CDY10832.1|  BnaC01g14470D                                          129   1e-30   
ref|XP_006585470.1|  PREDICTED: separase-like isoform X2                129   2e-30   
ref|XP_006585469.1|  PREDICTED: separase-like isoform X1                129   2e-30   
gb|KHN26699.1|  Separin                                                 129   2e-30   
gb|AES63348.2|  separase-like protein                                   127   5e-30   
ref|XP_006413594.1|  hypothetical protein EUTSA_v10024187mg             125   2e-29   
ref|XP_004486240.1|  PREDICTED: uncharacterized protein LOC101501526    125   2e-29   
gb|KHN33472.1|  Separin                                                 125   2e-29   
ref|XP_003547059.2|  PREDICTED: separase-like                           125   2e-29   
ref|XP_009137707.1|  PREDICTED: separase-like                           124   7e-29   
emb|CDX98781.1|  BnaA03g45660D                                          124   1e-28   
ref|XP_002529003.1|  separase, putative                                 123   1e-28   Ricinus communis
ref|XP_010245920.1|  PREDICTED: separase isoform X4                     122   2e-28   
ref|XP_010245919.1|  PREDICTED: separase isoform X3                     122   2e-28   
ref|XP_010245917.1|  PREDICTED: separase isoform X1                     122   3e-28   
ref|XP_010245918.1|  PREDICTED: separase isoform X2                     122   3e-28   
emb|CDX94142.1|  BnaC07g37760D                                          122   3e-28   
gb|KEH21880.1|  separase-like protein                                   122   4e-28   
gb|EYU18539.1|  hypothetical protein MIMGU_mgv1a018611mg                121   6e-28   
ref|XP_003593097.1|  Separin                                            114   2e-25   
ref|XP_006396846.1|  hypothetical protein EUTSA_v10029518mg             108   1e-23   
emb|CAA19812.1|  putative protein                                       107   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010671406.1|  PREDICTED: separase                                107   5e-23   
ref|XP_008378851.1|  PREDICTED: separase-like                           105   8e-23   
gb|KCW63049.1|  hypothetical protein EUGRSUZ_G00634                     105   3e-22   
ref|XP_010433961.1|  PREDICTED: separase-like                           104   3e-22   
ref|XP_010068188.1|  PREDICTED: separase                                105   3e-22   
ref|XP_008776341.1|  PREDICTED: separase                                104   4e-22   
ref|XP_006829069.1|  hypothetical protein AMTR_s00001p00258830          100   1e-20   
emb|CDY68508.1|  BnaCnng59290D                                        98.2    5e-20   
emb|CDY67480.1|  BnaCnng55190D                                        96.3    2e-19   
ref|XP_010236897.1|  PREDICTED: separase                              90.9    2e-17   
ref|XP_004955230.1|  PREDICTED: uncharacterized protein LOC101777770  90.5    2e-17   
ref|XP_008679271.1|  PREDICTED: separase isoform X3                   85.9    9e-16   
ref|XP_008679270.1|  PREDICTED: separase isoform X2                   85.5    1e-15   
ref|XP_008679269.1|  PREDICTED: separase isoform X1                   85.5    1e-15   
ref|XP_009417821.1|  PREDICTED: separase-like                         81.6    2e-14   
ref|XP_010103846.1|  hypothetical protein L484_024148                 81.3    3e-14   
emb|CCG89179.1|  separase protein                                     79.7    1e-13   
ref|XP_010908771.1|  PREDICTED: separase                              74.3    1e-12   
gb|EMS65712.1|  Separin                                               63.2    2e-08   
gb|EEE57877.1|  hypothetical protein OsJ_08535                        60.1    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74078.1|  hypothetical protein OsI_09098                        59.7    3e-07   Oryza sativa Indica Group [Indian rice]
gb|AFW64316.1|  hypothetical protein ZEAMMB73_008938                  57.4    1e-06   
ref|XP_001759110.1|  predicted protein                                51.6    1e-04   
ref|XP_002454624.1|  hypothetical protein SORBIDRAFT_04g034460        51.2    2e-04   Sorghum bicolor [broomcorn]



>ref|XP_010314971.1| PREDICTED: separase isoform X2 [Solanum lycopersicum]
Length=2038

 Score =   194 bits (493),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 135/183 (74%), Gaps = 5/183 (3%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            +KII++L+++VY ++D YL + R L+ K E LRA+G  Y  +CI CLSEAI+T+E     
Sbjct  721  LKIIALLIQEVYVSKDSYLQRCRFLLVKGEVLRARGFQYLKDCIQCLSEAIATVESTLKQ  780

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
            K R GE L+C + A H+ AYAYC RALC+ EIEP+SK  YEDIRAA R+WM  + CH+  
Sbjct  781  K-RYGENLACTNSASHLAAYAYCARALCSSEIEPDSKRLYEDIRAAARLWMSLNHCHTHD  839

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            QC M S  +LNML+QI+D LS+KG L++H +I+EMMI++F  K+I LE  +SLLW++RRL
Sbjct  840  QCRM-SETILNMLHQIVDFLSLKGYLEIHPDIYEMMIQIF-MKNIPLEKSVSLLWRYRRL  897

Query  11   GHA  3
             HA
Sbjct  898  SHA  900



>ref|XP_010314969.1| PREDICTED: separase isoform X1 [Solanum lycopersicum]
Length=2128

 Score =   194 bits (493),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 135/183 (74%), Gaps = 5/183 (3%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            +KII++L+++VY ++D YL + R L+ K E LRA+G  Y  +CI CLSEAI+T+E     
Sbjct  721  LKIIALLIQEVYVSKDSYLQRCRFLLVKGEVLRARGFQYLKDCIQCLSEAIATVESTLKQ  780

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
            K R GE L+C + A H+ AYAYC RALC+ EIEP+SK  YEDIRAA R+WM  + CH+  
Sbjct  781  K-RYGENLACTNSASHLAAYAYCARALCSSEIEPDSKRLYEDIRAAARLWMSLNHCHTHD  839

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            QC M S  +LNML+QI+D LS+KG L++H +I+EMMI++F  K+I LE  +SLLW++RRL
Sbjct  840  QCRM-SETILNMLHQIVDFLSLKGYLEIHPDIYEMMIQIF-MKNIPLEKSVSLLWRYRRL  897

Query  11   GHA  3
             HA
Sbjct  898  SHA  900



>ref|XP_006349439.1| PREDICTED: separase-like [Solanum tuberosum]
Length=2148

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 134/183 (73%), Gaps = 5/183 (3%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            +KII++LL++VY ++D YL + R LI K E LRA+G  Y  +CI CLSEAI+T+E     
Sbjct  738  LKIIALLLQEVYVSKDSYLQRCRSLIVKGEVLRARGFQYLKDCIQCLSEAIATVEITLKW  797

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
            K  G E LSC + A H+ AYAYC RALCT EIEP+SK  YEDIRAA R+WM  + CH+  
Sbjct  798  KNYG-ENLSCANSASHLAAYAYCARALCTSEIEPDSKRLYEDIRAASRLWMSLNHCHAPD  856

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            QC M S   LNML+QI+DLLS+KG L++H +I+EMMI++F  K+I LE  +SLLW++RRL
Sbjct  857  QCRM-SETKLNMLHQIVDLLSLKGYLEIHPDIYEMMIQIF-MKNIPLEKSVSLLWRYRRL  914

Query  11   GHA  3
             HA
Sbjct  915  RHA  917



>ref|XP_009777791.1| PREDICTED: separase isoform X1 [Nicotiana sylvestris]
Length=2148

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 129/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KII +LL+KVY ++D YL + R+LI K E LRA G     +CI CLSE I+ +E     
Sbjct  735  LKIIGLLLQKVYVSKDSYLQRCRVLIVKGEVLRANGFENLKDCIQCLSEGIAIVESSLKQ  794

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
            K      L+C + A H+ AYAYC RALCT EIEPNSK  YEDI AA R+WM  H CH+  
Sbjct  795  KNCVA-NLACTNSASHLAAYAYCARALCTSEIEPNSKRLYEDIHAAARLWMSNH-CHAPD  852

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            QC M S  MLNML+QI+DLLS+KG L+LH +I+EMMI++F+ K+I LE  +SLLW++RRL
Sbjct  853  QCRM-SDIMLNMLHQIVDLLSLKGYLELHPDIYEMMIQIFR-KNIPLEKSVSLLWRYRRL  910

Query  11   GHA  3
             HA
Sbjct  911  SHA  913



>ref|XP_009589674.1| PREDICTED: separase isoform X2 [Nicotiana tomentosiformis]
Length=2150

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 130/183 (71%), Gaps = 5/183 (3%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KII +LL+KVY ++D YL + R+LI K E LRA G     +CI CL++ I+ +E     
Sbjct  738  LKIIGVLLQKVYVSKDSYLQRCRVLIVKGEVLRANGFENLKDCIQCLTDGIAIVESSLKQ  797

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
            K      L+CM+ A H+ AYAYC RALCT EIEPNSK  YEDI AA R+WM  + CH+  
Sbjct  798  K-YCVANLACMNSASHLAAYAYCARALCTSEIEPNSKKLYEDIHAAARLWMSLNHCHAPD  856

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            QC M S  MLNML+QI+DLLS+KG L++H +I+EMMI++F+ K+I LE  +SLLW++RRL
Sbjct  857  QCRM-SDIMLNMLHQIVDLLSLKGYLEIHPDIYEMMIQIFR-KNIPLEKSVSLLWRYRRL  914

Query  11   GHA  3
             HA
Sbjct  915  SHA  917



>ref|XP_009777792.1| PREDICTED: separase isoform X2 [Nicotiana sylvestris]
Length=1784

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 129/183 (70%), Gaps = 6/183 (3%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KII +LL+KVY ++D YL + R+LI K E LRA G     +CI CLSE I+ +E     
Sbjct  371  LKIIGLLLQKVYVSKDSYLQRCRVLIVKGEVLRANGFENLKDCIQCLSEGIAIVESSLKQ  430

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
            K      L+C + A H+ AYAYC RALCT EIEPNSK  YEDI AA R+WM  H CH+  
Sbjct  431  KNCVA-NLACTNSASHLAAYAYCARALCTSEIEPNSKRLYEDIHAAARLWMSNH-CHAPD  488

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            QC M S  MLNML+QI+DLLS+KG L+LH +I+EMMI++F+ K+I LE  +SLLW++RRL
Sbjct  489  QCRM-SDIMLNMLHQIVDLLSLKGYLELHPDIYEMMIQIFR-KNIPLEKSVSLLWRYRRL  546

Query  11   GHA  3
             HA
Sbjct  547  SHA  549



>ref|XP_009589664.1| PREDICTED: separase isoform X1 [Nicotiana tomentosiformis]
Length=2156

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 131/189 (69%), Gaps = 11/189 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KII +LL+KVY ++D YL + R+LI K E LRA G     +CI CL++ I+ +E     
Sbjct  738  LKIIGVLLQKVYVSKDSYLQRCRVLIVKGEVLRANGFENLKDCIQCLTDGIAIVESSLKQ  797

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLP------YEDIRAALRVWMRPH  210
            K      L+CM+ A H+ AYAYC RALCT EIEPNSK+       YEDI AA R+WM  +
Sbjct  798  K-YCVANLACMNSASHLAAYAYCARALCTSEIEPNSKVLQHKKKLYEDIHAAARLWMSLN  856

Query  209  QCHSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLL  30
             CH+  QC M S  MLNML+QI+DLLS+KG L++H +I+EMMI++F+ K+I LE  +SLL
Sbjct  857  HCHAPDQCRM-SDIMLNMLHQIVDLLSLKGYLEIHPDIYEMMIQIFR-KNIPLEKSVSLL  914

Query  29   WKHRRLGHA  3
            W++RRL HA
Sbjct  915  WRYRRLSHA  923



>ref|XP_009589680.1| PREDICTED: separase isoform X3 [Nicotiana tomentosiformis]
Length=1838

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 131/189 (69%), Gaps = 11/189 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KII +LL+KVY ++D YL + R+LI K E LRA G     +CI CL++ I+ +E     
Sbjct  420  LKIIGVLLQKVYVSKDSYLQRCRVLIVKGEVLRANGFENLKDCIQCLTDGIAIVESSLKQ  479

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLP------YEDIRAALRVWMRPH  210
            K      L+CM+ A H+ AYAYC RALCT EIEPNSK+       YEDI AA R+WM  +
Sbjct  480  K-YCVANLACMNSASHLAAYAYCARALCTSEIEPNSKVLQHKKKLYEDIHAAARLWMSLN  538

Query  209  QCHSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLL  30
             CH+  QC M S  MLNML+QI+DLLS+KG L++H +I+EMMI++F+ K+I LE  +SLL
Sbjct  539  HCHAPDQCRM-SDIMLNMLHQIVDLLSLKGYLEIHPDIYEMMIQIFR-KNIPLEKSVSLL  596

Query  29   WKHRRLGHA  3
            W++RRL HA
Sbjct  597  WRYRRLSHA  605



>emb|CDO97522.1| unnamed protein product [Coffea canephora]
Length=2165

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 122/184 (66%), Gaps = 9/184 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KII ILLEK+Y + D Y+ +SRILI K EE R  G+    ECI CL +AI  L  +   
Sbjct  725  MKIIGILLEKIYVSSDTYVQRSRILITKGEEYRELGIESLDECIQCLCDAILLLRDFCDR  784

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIE-IEPNSKLPYEDIRAALRVWMRPHQCHSS  195
              +   +      A H++A AYC+RAL   E IE NSK+ +EDI AA+ +W+  HQ  +S
Sbjct  785  NSKYDGQ------ALHLMACAYCLRALSAQEKIEANSKVYFEDIHAAVNLWLHRHQSIAS  838

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
              CN L  +ML +LY ++D L+IKG +++HA+I+E++I+LFKWK + LE +L +LW+ RR
Sbjct  839  NHCNTLEDSMLKLLYHVLDFLAIKGYMEIHADIYEIIIQLFKWKKLPLEEVLIMLWRSRR  898

Query  14   LGHA  3
            +GHA
Sbjct  899  VGHA  902



>ref|XP_006491875.1| PREDICTED: separase-like isoform X1 [Citrus sinensis]
Length=2215

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 116/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ VY + + Y  +SRIL+ K   LRA+G     +CI CLSEAI  +      
Sbjct  750  MKISTILLQSVYNSRNSYFQRSRILLRKGRALRARGTEGLKDCIQCLSEAICVM------  803

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
             +  G+        CH +A AYC+RALCT E EPNSK   EDI AAL +W+    C  S 
Sbjct  804  NDISGDMSQHETLHCHQLAVAYCLRALCTQEAEPNSKQVIEDIGAALNLWLSVSICFESE  863

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            +CNM+S   + +LY ++DLLS+KG ++ H  I+++M+RLFK K++ LE  LS+LW+ RRL
Sbjct  864  RCNMVSENTMLLLYNVVDLLSLKGFIEFHNNIYKLMLRLFKCKNVPLEKYLSILWESRRL  923

Query  11   GHA  3
             HA
Sbjct  924  SHA  926



>ref|XP_006491876.1| PREDICTED: separase-like isoform X2 [Citrus sinensis]
Length=2214

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 116/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ VY + + Y  +SRIL+ K   LRA+G     +CI CLSEAI  +      
Sbjct  749  MKISTILLQSVYNSRNSYFQRSRILLRKGRALRARGTEGLKDCIQCLSEAICVM------  802

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
             +  G+        CH +A AYC+RALCT E EPNSK   EDI AAL +W+    C  S 
Sbjct  803  NDISGDMSQHETLHCHQLAVAYCLRALCTQEAEPNSKQVIEDIGAALNLWLSVSICFESE  862

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            +CNM+S   + +LY ++DLLS+KG ++ H  I+++M+RLFK K++ LE  LS+LW+ RRL
Sbjct  863  RCNMVSENTMLLLYNVVDLLSLKGFIEFHNNIYKLMLRLFKCKNVPLEKYLSILWESRRL  922

Query  11   GHA  3
             HA
Sbjct  923  SHA  925



>ref|XP_006491877.1| PREDICTED: separase-like isoform X3 [Citrus sinensis]
Length=2213

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 116/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ VY + + Y  +SRIL+ K   LRA+G     +CI CLSEAI  +      
Sbjct  750  MKISTILLQSVYNSRNSYFQRSRILLRKGRALRARGTEGLKDCIQCLSEAICVM------  803

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
             +  G+        CH +A AYC+RALCT E EPNSK   EDI AAL +W+    C  S 
Sbjct  804  NDISGDMSQHETLHCHQLAVAYCLRALCTQEAEPNSKQVIEDIGAALNLWLSVSICFESE  863

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            +CNM+S   + +LY ++DLLS+KG ++ H  I+++M+RLFK K++ LE  LS+LW+ RRL
Sbjct  864  RCNMVSENTMLLLYNVVDLLSLKGFIEFHNNIYKLMLRLFKCKNVPLEKYLSILWESRRL  923

Query  11   GHA  3
             HA
Sbjct  924  SHA  926



>ref|XP_010657825.1| PREDICTED: separase isoform X4 [Vitis vinifera]
Length=1945

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 121/186 (65%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ V+ T+D  L KSRILI K + LRA G     +CI C SEAIST+   +  
Sbjct  763  MKIFNILLQDVFITKDSCLQKSRILIRKGKALRACGTEGLKDCIHCFSEAISTINDMY--  820

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPH--QCHS  198
                GE  S   P CH +A +YC+RALC  E EP SK   +DI AAL +W+  H  +C S
Sbjct  821  ----GETCSRDIPVCHQLAVSYCLRALCIQEAEPTSKRVLQDIHAALNLWLSIHIPECSS  876

Query  197  SG-QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
            +  Q ++LS   + +LY I+DLLS+KG    H +I++++IRLFKWK++ LE  L++LW++
Sbjct  877  TADQHDLLSKNTMLLLYNIVDLLSLKGYTKFHLDIYKLIIRLFKWKNVPLEKCLAILWEY  936

Query  20   RRLGHA  3
            RR+ HA
Sbjct  937  RRINHA  942



>emb|CBI23880.3| unnamed protein product [Vitis vinifera]
Length=2158

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 121/186 (65%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ V+ T+D  L KSRILI K + LRA G     +CI C SEAIST+   +  
Sbjct  709  MKIFNILLQDVFITKDSCLQKSRILIRKGKALRACGTEGLKDCIHCFSEAISTINDMY--  766

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPH--QCHS  198
                GE  S   P CH +A +YC+RALC  E EP SK   +DI AAL +W+  H  +C S
Sbjct  767  ----GETCSRDIPVCHQLAVSYCLRALCIQEAEPTSKRVLQDIHAALNLWLSIHIPECSS  822

Query  197  SG-QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
            +  Q ++LS   + +LY I+DLLS+KG    H +I++++IRLFKWK++ LE  L++LW++
Sbjct  823  TADQHDLLSKNTMLLLYNIVDLLSLKGYTKFHLDIYKLIIRLFKWKNVPLEKCLAILWEY  882

Query  20   RRLGHA  3
            RR+ HA
Sbjct  883  RRINHA  888



>ref|XP_010657824.1| PREDICTED: separase isoform X3 [Vitis vinifera]
Length=2197

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 121/186 (65%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ V+ T+D  L KSRILI K + LRA G     +CI C SEAIST+   +  
Sbjct  763  MKIFNILLQDVFITKDSCLQKSRILIRKGKALRACGTEGLKDCIHCFSEAISTINDMY--  820

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPH--QCHS  198
                GE  S   P CH +A +YC+RALC  E EP SK   +DI AAL +W+  H  +C S
Sbjct  821  ----GETCSRDIPVCHQLAVSYCLRALCIQEAEPTSKRVLQDIHAALNLWLSIHIPECSS  876

Query  197  SG-QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
            +  Q ++LS   + +LY I+DLLS+KG    H +I++++IRLFKWK++ LE  L++LW++
Sbjct  877  TADQHDLLSKNTMLLLYNIVDLLSLKGYTKFHLDIYKLIIRLFKWKNVPLEKCLAILWEY  936

Query  20   RRLGHA  3
            RR+ HA
Sbjct  937  RRINHA  942



>ref|XP_002273874.2| PREDICTED: separase isoform X2 [Vitis vinifera]
Length=2197

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 121/186 (65%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ V+ T+D  L KSRILI K + LRA G     +CI C SEAIST+   +  
Sbjct  762  MKIFNILLQDVFITKDSCLQKSRILIRKGKALRACGTEGLKDCIHCFSEAISTINDMY--  819

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPH--QCHS  198
                GE  S   P CH +A +YC+RALC  E EP SK   +DI AAL +W+  H  +C S
Sbjct  820  ----GETCSRDIPVCHQLAVSYCLRALCIQEAEPTSKRVLQDIHAALNLWLSIHIPECSS  875

Query  197  SG-QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
            +  Q ++LS   + +LY I+DLLS+KG    H +I++++IRLFKWK++ LE  L++LW++
Sbjct  876  TADQHDLLSKNTMLLLYNIVDLLSLKGYTKFHLDIYKLIIRLFKWKNVPLEKCLAILWEY  935

Query  20   RRLGHA  3
            RR+ HA
Sbjct  936  RRINHA  941



>ref|XP_010657823.1| PREDICTED: separase isoform X1 [Vitis vinifera]
Length=2198

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 121/186 (65%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ V+ T+D  L KSRILI K + LRA G     +CI C SEAIST+   +  
Sbjct  763  MKIFNILLQDVFITKDSCLQKSRILIRKGKALRACGTEGLKDCIHCFSEAISTINDMY--  820

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPH--QCHS  198
                GE  S   P CH +A +YC+RALC  E EP SK   +DI AAL +W+  H  +C S
Sbjct  821  ----GETCSRDIPVCHQLAVSYCLRALCIQEAEPTSKRVLQDIHAALNLWLSIHIPECSS  876

Query  197  SG-QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
            +  Q ++LS   + +LY I+DLLS+KG    H +I++++IRLFKWK++ LE  L++LW++
Sbjct  877  TADQHDLLSKNTMLLLYNIVDLLSLKGYTKFHLDIYKLIIRLFKWKNVPLEKCLAILWEY  936

Query  20   RRLGHA  3
            RR+ HA
Sbjct  937  RRINHA  942



>gb|KDO41134.1| hypothetical protein CISIN_1g0001101mg, partial [Citrus sinensis]
Length=1462

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 115/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ VY + + Y  +S IL+ K   LRA+G     +CI CLSEAI  +      
Sbjct  695  MKISTILLQSVYNSRNSYFQRSGILLRKGRALRARGTEGLKDCIQCLSEAICVM------  748

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
             +  G+        CH +A AYC+RALCT E EPNSK   EDI AAL +W+    C  S 
Sbjct  749  NDISGDMSQHETLHCHQLAVAYCLRALCTQEAEPNSKQVIEDIGAALNLWLSVSICFESE  808

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            +CNM+S   + +LY ++DLLS+KG ++ H  I+++M+RLFK K++ LE  LS+LW+ RRL
Sbjct  809  RCNMVSENTMLLLYNVVDLLSLKGFIEFHNNIYKLMLRLFKCKNVPLEKYLSILWESRRL  868

Query  11   GHA  3
             HA
Sbjct  869  SHA  871



>ref|XP_006431950.1| hypothetical protein CICLE_v10000008mg [Citrus clementina]
 gb|ESR45190.1| hypothetical protein CICLE_v10000008mg [Citrus clementina]
Length=1584

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 115/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ VY + + Y  +S IL+ K   LRA+G     +CI CLSEAI  +      
Sbjct  294  MKISTILLQSVYNSRNSYFQRSGILLRKGRALRARGTEGLKDCIQCLSEAICVM------  347

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
             +  G+        CH +A AYC+RALCT E EPNSK   EDI AAL +W+    C  S 
Sbjct  348  NDISGDMSQHETLHCHQLAVAYCLRALCTQEAEPNSKQVIEDIGAALNLWLSVSICFESE  407

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            +CNM+S   + +LY ++DLLS+KG ++ H  I+++M+RLFK K++ LE  LS+LW+ RRL
Sbjct  408  RCNMVSENTMLLLYNVVDLLSLKGFIEFHNNIYKLMLRLFKCKNVPLEKYLSILWESRRL  467

Query  11   GHA  3
             HA
Sbjct  468  SHA  470



>ref|XP_006431949.1| hypothetical protein CICLE_v10000008mg [Citrus clementina]
 gb|ESR45189.1| hypothetical protein CICLE_v10000008mg [Citrus clementina]
Length=2168

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 115/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ VY + + Y  +S IL+ K   LRA+G     +CI CLSEAI  +      
Sbjct  703  MKISTILLQSVYNSRNSYFQRSGILLRKGRALRARGTEGLKDCIQCLSEAICVM------  756

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
             +  G+        CH +A AYC+RALCT E EPNSK   EDI AAL +W+    C  S 
Sbjct  757  NDISGDMSQHETLHCHQLAVAYCLRALCTQEAEPNSKQVIEDIGAALNLWLSVSICFESE  816

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            +CNM+S   + +LY ++DLLS+KG ++ H  I+++M+RLFK K++ LE  LS+LW+ RRL
Sbjct  817  RCNMVSENTMLLLYNVVDLLSLKGFIEFHNNIYKLMLRLFKCKNVPLEKYLSILWESRRL  876

Query  11   GHA  3
             HA
Sbjct  877  SHA  879



>ref|XP_008218969.1| PREDICTED: separase [Prunus mume]
Length=2212

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 120/186 (65%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLC--YECIPCLSEAISTLEKYFAA  372
            +KII I+L+ V+ T D ++ KSRIL+ K   LR  G+     CI CLS+AIS+L + +  
Sbjct  745  MKIIDIVLQYVHVTPDSWIQKSRILLRKGRALRLSGISGLKGCIQCLSDAISSLNEMY--  802

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWM---RPHQCH  201
             E    ++S     CH +A AYC+RALCT E EPNSK   EDI +A+ +W+    P+ C 
Sbjct  803  DETYIHEIS----PCHQLAVAYCLRALCTQEAEPNSKQVLEDISSAINLWLGISTPNNCS  858

Query  200  SSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
               +C+M+S  ++ +LY +IDLLSIKG +D H +I  +MIRLFKW+++ LE  ++ LW+ 
Sbjct  859  PDDKCSMVSENIMLLLYNVIDLLSIKGCMDFHNDIHRLMIRLFKWRNVPLEKCVARLWEC  918

Query  20   RRLGHA  3
            RR+ H 
Sbjct  919  RRISHG  924



>ref|XP_002303173.2| hypothetical protein POPTR_0003s01610g [Populus trichocarpa]
 gb|EEE78152.2| hypothetical protein POPTR_0003s01610g [Populus trichocarpa]
Length=2202

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 119/186 (64%), Gaps = 15/186 (8%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +++I ILL+ VY T D +L KSR+LI K   LR+ G     +CI CLSEAIS +      
Sbjct  764  MEVIDILLKDVYVT-DSHLQKSRVLIRKGRALRSCGSEGLEDCIQCLSEAISVIND----  818

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR---PHQCH  201
                 E  S   PACH +A  YC+RALCT E+EPNSK  ++DI+AAL +W+    P    
Sbjct  819  -----ESCSHGTPACHHLAVTYCLRALCTQEVEPNSKQVFQDIKAALDLWLSIPIPDYGI  873

Query  200  SSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
            +  +  M   + L  LY I+DLL++KG+++ H +I+++MIRLF+WK++ LE  LS+LW+ 
Sbjct  874  AYDEGIMSPDSALLFLYNIVDLLAMKGSMEFHNDIYKLMIRLFEWKNVQLEMCLSILWES  933

Query  20   RRLGHA  3
            RRL HA
Sbjct  934  RRLTHA  939



>ref|XP_011008695.1| PREDICTED: separase [Populus euphratica]
Length=2205

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 119/186 (64%), Gaps = 15/186 (8%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +++I ILL+ VY T D +L KSR+LI K   LR+ G     +CI CLSEAIS +      
Sbjct  764  MEVIDILLKDVYVT-DSHLQKSRVLIRKGRALRSCGSEGLEDCIQCLSEAISVIND----  818

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR---PHQCH  201
                 E  S   PACH +A  YC+RALCT E+EPNSK  ++DI+AAL +W+    P    
Sbjct  819  -----ESCSHGTPACHHLAVTYCLRALCTQEVEPNSKQVFQDIKAALDLWLSIPIPDYGI  873

Query  200  SSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
            +  +  M   + L  LY I+DLL++KG+++ H +I+++MIRLF+WK++ LE  LS+LW+ 
Sbjct  874  AYDEGIMSPDSALLFLYNIVDLLAMKGSMEFHNDIYKLMIRLFEWKNVQLEMCLSILWES  933

Query  20   RRLGHA  3
            RRL HA
Sbjct  934  RRLTHA  939



>ref|XP_007225661.1| hypothetical protein PRUPE_ppa000043mg [Prunus persica]
 gb|EMJ26860.1| hypothetical protein PRUPE_ppa000043mg [Prunus persica]
Length=2170

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 118/186 (63%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLC--YECIPCLSEAISTLEKYFAA  372
            +KII ILL+ V+ T D  L KSRIL+ K   LR  G+     CI CLS+AIS+L + +  
Sbjct  702  MKIIDILLQYVHVTPDSCLQKSRILLRKGRALRLSGISGLKGCIQCLSDAISSLNEMY--  759

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWM---RPHQCH  201
             E    ++S     CH +A AYC+RALCT E EPNSK   EDI +A+ +W+     + C 
Sbjct  760  DETYIHEIS----PCHQLAVAYCLRALCTQEAEPNSKQVLEDISSAINLWLGISTRNNCS  815

Query  200  SSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
               +C+M+S +++ +LY  IDLLSIKG +D H +I  +MIRLFKW+D+ LE  ++ LW+ 
Sbjct  816  PDDKCSMVSESIMLLLYNAIDLLSIKGCMDFHNDIHRLMIRLFKWRDVPLEKCVARLWEC  875

Query  20   RRLGHA  3
            RR+ H 
Sbjct  876  RRISHG  881



>ref|XP_010439037.1| PREDICTED: separase-like isoform X2 [Camelina sativa]
Length=348

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            + I  ILL  VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L++    
Sbjct  14   ITIADILLNDVYVTEDMHIERARILIWKARMTRTSGTEHLNECICLLSEAISILDEVHHG  73

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P+ H++  AYC+RA CT E EPNSK  ++DIR +L +W+R      SG
Sbjct  74   PNKEGT------PSSHMLPIAYCLRAFCTQEAEPNSKKVFQDIRTSLNLWLRILSLDDSG  127

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY + DL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW  RRL
Sbjct  128  D-SLPTENIIPLLYNMTDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWDCRRL  186

Query  11   GHA  3
             HA
Sbjct  187  SHA  189



>ref|XP_010439035.1| PREDICTED: separase-like isoform X1 [Camelina sativa]
 ref|XP_010439036.1| PREDICTED: separase-like isoform X1 [Camelina sativa]
Length=411

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            + I  ILL  VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L++    
Sbjct  14   ITIADILLNDVYVTEDMHIERARILIWKARMTRTSGTEHLNECICLLSEAISILDEVHHG  73

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P+ H++  AYC+RA CT E EPNSK  ++DIR +L +W+R      SG
Sbjct  74   PNKEGT------PSSHMLPIAYCLRAFCTQEAEPNSKKVFQDIRTSLNLWLRILSLDDSG  127

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY + DL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW  RRL
Sbjct  128  D-SLPTENIIPLLYNMTDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWDCRRL  186

Query  11   GHA  3
             HA
Sbjct  187  SHA  189



>ref|XP_008361643.1| PREDICTED: separase-like [Malus domestica]
Length=2217

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 118/187 (63%), Gaps = 13/187 (7%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELR---AKGLCYECIPCLSEAISTLEKYFA  375
            +KII  LL+ VY T + +L KSRIL+ K   LR   +KGL  +CI CLS+AI  L + + 
Sbjct  741  MKIIDFLLKDVYVTPNSWLQKSRILLKKGRALRLSGSKGL-KDCIQCLSDAICLLSEIY-  798

Query  374  AKERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWM---RPHQC  204
              E    ++S     CH +A AYC+RAL T E EPNSK   EDI AA+ +W+    P  C
Sbjct  799  -DETCTHEIS----PCHQLAVAYCLRALSTQEAEPNSKRVLEDISAAINLWLGISTPANC  853

Query  203  HSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWK  24
              + +C+MLS   + +LY +IDLLS KG +D H +I ++MIRLFKW+++ LE  ++  W+
Sbjct  854  SPADKCSMLSENTMLLLYNVIDLLSAKGCMDFHNDIHKLMIRLFKWRNVPLEKCVARFWE  913

Query  23   HRRLGHA  3
             RR+ HA
Sbjct  914  CRRISHA  920



>ref|XP_008339285.1| PREDICTED: separase [Malus domestica]
Length=2217

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 118/187 (63%), Gaps = 13/187 (7%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELR---AKGLCYECIPCLSEAISTLEKYFA  375
            +KII  LL+ VY T + +L KSRIL+ K   LR   +KGL  +CI CLS+AI  L + + 
Sbjct  741  MKIIDFLLKDVYVTPNSWLQKSRILLKKGRALRLSGSKGL-KDCIQCLSDAICLLSEIY-  798

Query  374  AKERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWM---RPHQC  204
              E    ++S     CH +A AYC+RAL T E EPNSK   EDI AA+ +W+    P  C
Sbjct  799  -DETCTHEIS----PCHQLAVAYCLRALSTQEAEPNSKRVLEDISAAINLWLGISTPANC  853

Query  203  HSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWK  24
              + +C+MLS   + +LY +IDLLS KG +D H +I ++MIRLFKW+++ LE  ++  W+
Sbjct  854  SPADKCSMLSENTMLLLYNVIDLLSAKGCMDFHNDIHKLMIRLFKWRNVPLEKCVARFWE  913

Query  23   HRRLGHA  3
             RR+ HA
Sbjct  914  CRRISHA  920



>ref|XP_007041565.1| Separase, putative [Theobroma cacao]
 gb|EOX97396.1| Separase, putative [Theobroma cacao]
Length=2198

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 114/185 (62%), Gaps = 11/185 (6%)
 Frame = -2

Query  542  KIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAAK  369
            K+I +L++ VY TE+  L K+RILI K   LR  G+     CI CLSEAIS ++ ++   
Sbjct  739  KVIDLLMQDVYATENSPLWKARILIRKGRALRINGIEALKNCILCLSEAISIMKNFY---  795

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR---PHQCHS  198
               GE       ACH +A AYC+RALCT E EPNS+  Y+DI AAL +W+    P  C  
Sbjct  796  ---GETPILGTTACHQLAAAYCLRALCTQEAEPNSEQVYQDICAALDMWLSIFVPDSCSM  852

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
              +  M+SG  L +LY I+DLLS+KG   LH+ I +++IRL+K  ++ +   L+ LW+ R
Sbjct  853  DDEFKMVSGNTLPLLYNILDLLSVKGWTKLHSNIHQLIIRLYKQNNMQIGKCLANLWECR  912

Query  17   RLGHA  3
            RL HA
Sbjct  913  RLSHA  917



>ref|XP_010448800.1| PREDICTED: separase isoform X5 [Camelina sativa]
Length=1783

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 115/183 (63%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            + I  ILL+ VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L++    
Sbjct  741  ITIADILLKDVYVTEDMHIERARILIWKARMTRTSGTEHLNECICLLSEAISILDEVHHG  800

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P+ H++  AYC+RA CT E EPNSK  ++DIR +L +W+R      SG
Sbjct  801  PNKEGT------PSSHMLPIAYCLRAFCTQEAEPNSKKVFQDIRTSLNLWLRIISLDDSG  854

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW+ RRL
Sbjct  855  D-SLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWECRRL  913

Query  11   GHA  3
             HA
Sbjct  914  SHA  916



>ref|XP_010448799.1| PREDICTED: separase isoform X4 [Camelina sativa]
Length=2167

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 115/183 (63%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            + I  ILL+ VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L++    
Sbjct  741  ITIADILLKDVYVTEDMHIERARILIWKARMTRTSGTEHLNECICLLSEAISILDEVHHG  800

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P+ H++  AYC+RA CT E EPNSK  ++DIR +L +W+R      SG
Sbjct  801  PNKEGT------PSSHMLPIAYCLRAFCTQEAEPNSKKVFQDIRTSLNLWLRIISLDDSG  854

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW+ RRL
Sbjct  855  D-SLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWECRRL  913

Query  11   GHA  3
             HA
Sbjct  914  SHA  916



>ref|XP_010445194.1| PREDICTED: separase-like [Camelina sativa]
Length=1974

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 114/183 (62%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            + I  ILL  VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L++    
Sbjct  518  ITIADILLNDVYVTEDMHIERARILIWKARMTRTSGTEHLNECICLLSEAISILDEVHHG  577

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P+ H++  AYC+RA CT E EPNSK  ++DIR +L +W+R      SG
Sbjct  578  PNKEGT------PSSHMLPIAYCLRAFCTQEAEPNSKKVFQDIRTSLNLWLRILSLDDSG  631

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW+ RRL
Sbjct  632  D-SLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWECRRL  690

Query  11   GHA  3
             HA
Sbjct  691  SHA  693


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 8/101 (8%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            + I  ILL  VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L++    
Sbjct  368  ITIADILLNDVYVTEDMHIERARILIWKARMTRTSGTEHLNECICLLSEAISILDEVHHG  427

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYE  249
              + G       P+ H++  AYC+RA CT E EPNSK+  E
Sbjct  428  PNKEGT------PSSHMLPIAYCLRAFCTQEAEPNSKIERE  462



>ref|XP_010448798.1| PREDICTED: separase isoform X3 [Camelina sativa]
Length=2185

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 115/183 (63%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            + I  ILL+ VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L++    
Sbjct  741  ITIADILLKDVYVTEDMHIERARILIWKARMTRTSGTEHLNECICLLSEAISILDEVHHG  800

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P+ H++  AYC+RA CT E EPNSK  ++DIR +L +W+R      SG
Sbjct  801  PNKEGT------PSSHMLPIAYCLRAFCTQEAEPNSKKVFQDIRTSLNLWLRIISLDDSG  854

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW+ RRL
Sbjct  855  D-SLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWECRRL  913

Query  11   GHA  3
             HA
Sbjct  914  SHA  916



>ref|XP_010448795.1| PREDICTED: separase isoform X1 [Camelina sativa]
Length=2197

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 115/183 (63%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            + I  ILL+ VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L++    
Sbjct  741  ITIADILLKDVYVTEDMHIERARILIWKARMTRTSGTEHLNECICLLSEAISILDEVHHG  800

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P+ H++  AYC+RA CT E EPNSK  ++DIR +L +W+R      SG
Sbjct  801  PNKEGT------PSSHMLPIAYCLRAFCTQEAEPNSKKVFQDIRTSLNLWLRIISLDDSG  854

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW+ RRL
Sbjct  855  D-SLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWECRRL  913

Query  11   GHA  3
             HA
Sbjct  914  SHA  916



>ref|XP_010448796.1| PREDICTED: separase isoform X2 [Camelina sativa]
Length=2194

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 115/183 (63%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            + I  ILL+ VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L++    
Sbjct  741  ITIADILLKDVYVTEDMHIERARILIWKARMTRTSGTEHLNECICLLSEAISILDEVHHG  800

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P+ H++  AYC+RA CT E EPNSK  ++DIR +L +W+R      SG
Sbjct  801  PNKEGT------PSSHMLPIAYCLRAFCTQEAEPNSKKVFQDIRTSLNLWLRIISLDDSG  854

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW+ RRL
Sbjct  855  D-SLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWECRRL  913

Query  11   GHA  3
             HA
Sbjct  914  SHA  916



>ref|NP_001190804.1| separase-like protein [Arabidopsis thaliana]
 gb|AEE84687.1| separase-like protein [Arabidopsis thaliana]
Length=2177

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 115/184 (63%), Gaps = 11/184 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTL-EKYFA  375
            +KI  ILL+ VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L E +  
Sbjct  736  IKIADILLKDVYVTEDMHIERARILIWKARMTRTSGTEHITECICFLSEAISILGELHHG  795

Query  374  AKERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSS  195
              E G        P+ H++  AYC+RA CT E +PNSK  ++DI  +L +W+R      S
Sbjct  796  PNEEGS-------PSSHMLPIAYCLRAFCTQEADPNSKKVFQDISTSLNLWLRILSLDDS  848

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
            G  ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW+ RR
Sbjct  849  GD-SLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWECRR  907

Query  14   LGHA  3
            L HA
Sbjct  908  LSHA  911



>ref|NP_194028.2| separase-like protein [Arabidopsis thaliana]
 sp|Q5IBC5.1|ESP1_ARATH RecName: Full=Separase; AltName: Full=Protein EXTRA SPINDLE POLES; 
Short=AtESP; AltName: Full=Protein RADIALLY SWOLLEN 4 
[Arabidopsis thaliana]
 gb|AAW32909.1| separase [Arabidopsis thaliana]
 gb|AEE84686.1| separase-like protein [Arabidopsis thaliana]
Length=2180

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 115/184 (63%), Gaps = 11/184 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTL-EKYFA  375
            +KI  ILL+ VY TED ++ ++RILI K    R  G  +  ECI  LSEAIS L E +  
Sbjct  736  IKIADILLKDVYVTEDMHIERARILIWKARMTRTSGTEHITECICFLSEAISILGELHHG  795

Query  374  AKERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSS  195
              E G        P+ H++  AYC+RA CT E +PNSK  ++DI  +L +W+R      S
Sbjct  796  PNEEGS-------PSSHMLPIAYCLRAFCTQEADPNSKKVFQDISTSLNLWLRILSLDDS  848

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
            G  ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW+ RR
Sbjct  849  GD-SLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWECRR  907

Query  14   LGHA  3
            L HA
Sbjct  908  LSHA  911



>ref|XP_004295930.1| PREDICTED: uncharacterized protein LOC101294643 [Fragaria vesca 
subsp. vesca]
Length=2166

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 116/186 (62%), Gaps = 7/186 (4%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++II+ILL+ VY T D +L K++IL+ K   L+  G+    +CI CL+EAI+ L     +
Sbjct  733  MQIINILLQDVYVTPDSWLQKAKILVRKGRWLKLYGINGLKDCICCLTEAITLLVSN-QS  791

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWM---RPHQCH  201
            K  G   +    P  H +A AYC+RALCT E EP S+  ++DIRAAL  W+       C 
Sbjct  792  KTYGNTSIHETSPR-HELAVAYCLRALCTQEDEPQSEKMFQDIRAALDAWLGISTIDMCS  850

Query  200  SSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
               +C M+S + + +LY I DLLSIKG++D + +I+ ++IRL+ WK+I LE  L  LW+ 
Sbjct  851  PDDKCFMVSESTMTLLYNIFDLLSIKGHMDYYHDIYRILIRLYNWKNIPLEKCLVRLWEC  910

Query  20   RRLGHA  3
            RR+ HA
Sbjct  911  RRVSHA  916



>gb|KFK39266.1| hypothetical protein AALP_AA3G222100 [Arabis alpina]
Length=2167

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            ++I  ILL+ VY TED ++ ++RILI K    R  G  +  +CI  LSEAIS L K    
Sbjct  706  IEISDILLKDVYVTEDMHVERARILIWKARVTRTSGTEHLADCIRFLSEAISILGKVHHG  765

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P  H +  AYC+RALC  E EPNSK  +EDI  +L +W+R    + +G
Sbjct  766  PNKKGT------PYSHQLPIAYCLRALCIQEAEPNSKNVFEDISTSLNLWLRIPSIYETG  819

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFKWK+I LE  L++LW+ RR 
Sbjct  820  D-SLPTENIIPLLYNMIDLMSVKGCTELHHAIYQLIFRLFKWKNIKLEVCLAMLWECRRH  878

Query  11   GHA  3
             HA
Sbjct  879  SHA  881



>ref|XP_010540479.1| PREDICTED: separase isoform X2 [Tarenaya hassleriana]
Length=2187

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 112/184 (61%), Gaps = 11/184 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++   ILL+ VY T D ++ ++RILI K    R  G     +CI CLSEAIS L   ++ 
Sbjct  722  METADILLKDVYVTVDMHIERARILIWKARMNRTSGTERLRDCIQCLSEAISILGDVYSE  781

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR-PHQCHSS  195
                G        +CH +  AYC+RALC  E EPNSK  ++DI A+L +W+  P+     
Sbjct  782  PTNRGST------SCHQLPVAYCLRALCIQETEPNSKQVFQDISASLSLWLSIPNPVDRD  835

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
               +ML   M+ +LY IIDL+S+KG  +LH ++++++ +LFKWK++ +E  L++LW+ RR
Sbjct  836  N--SMLPENMIPLLYNIIDLMSMKGCSELHHQLYQLIFKLFKWKNVKMEVCLAMLWEFRR  893

Query  14   LGHA  3
            L HA
Sbjct  894  LNHA  897



>ref|XP_010540470.1| PREDICTED: separase isoform X1 [Tarenaya hassleriana]
Length=2187

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 112/184 (61%), Gaps = 11/184 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++   ILL+ VY T D ++ ++RILI K    R  G     +CI CLSEAIS L   ++ 
Sbjct  722  METADILLKDVYVTVDMHIERARILIWKARMNRTSGTERLRDCIQCLSEAISILGDVYSE  781

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR-PHQCHSS  195
                G        +CH +  AYC+RALC  E EPNSK  ++DI A+L +W+  P+     
Sbjct  782  PTNRGST------SCHQLPVAYCLRALCIQETEPNSKQVFQDISASLSLWLSIPNPVDRD  835

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
               +ML   M+ +LY IIDL+S+KG  +LH ++++++ +LFKWK++ +E  L++LW+ RR
Sbjct  836  N--SMLPENMIPLLYNIIDLMSMKGCSELHHQLYQLIFKLFKWKNVKMEVCLAMLWEFRR  893

Query  14   LGHA  3
            L HA
Sbjct  894  LNHA  897



>emb|CDY41265.1| BnaA01g12740D [Brassica napus]
Length=2139

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCYE--CIPCLSEAISTLEKYFAA  372
            ++I  ILL+ VY TED ++ ++ +LI K    RA G  ++  CI  LSEAI+ L +    
Sbjct  705  IEIADILLKNVYVTEDMHIERATVLIWKARMTRASGTEHQADCIRFLSEAITILSEVHHG  764

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              +GG      DP+ H +  AYC+RA CT E EPNSK  ++DI  +L +W+       SG
Sbjct  765  PNKGG------DPSSHQLPIAYCLRAFCTHEAEPNSKTVFQDISTSLNLWLGMPSLEDSG  818

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY IIDL+S+KG  +LH  I+ ++ RLFK K + LET L++LW+ RRL
Sbjct  819  D-SLPTEDIIPLLYNIIDLMSLKGCTELHHHIYLLIFRLFKQKHVKLETCLAMLWECRRL  877

Query  11   GHA  3
             HA
Sbjct  878  SHA  880



>ref|XP_009136537.1| PREDICTED: separase isoform X2 [Brassica rapa]
Length=2188

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCYE--CIPCLSEAISTLEKYFAA  372
            ++I  ILL+ VY TED ++ ++ +LI K    RA G  ++  CI  LSEAI+ L +    
Sbjct  732  IEIADILLKNVYVTEDMHIERATVLIWKARMTRASGTEHQADCIRFLSEAITILSEVHHG  791

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              +GG      DP+ H +  AYC+RA CT E EPNSK  ++DI  +L +W+       SG
Sbjct  792  PNKGG------DPSSHQLPIAYCLRAFCTHEAEPNSKTVFQDISTSLNLWLGMPSLEDSG  845

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY IIDL+S+KG  +LH  I+ ++ RLFK K + LET L++LW+ RRL
Sbjct  846  D-SLPTEDIIPLLYNIIDLMSLKGCTELHHHIYLLIFRLFKQKHVKLETCLAMLWECRRL  904

Query  11   GHA  3
             HA
Sbjct  905  SHA  907



>ref|XP_008445506.1| PREDICTED: separase isoform X1 [Cucumis melo]
Length=2177

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 111/184 (60%), Gaps = 10/184 (5%)
 Frame = -2

Query  542  KIISILLEKVYTTEDDYLPKSRILIAKCEELR-AKGLCYE-CIPCLSEAISTLEKYFAAK  369
            KI+S LL +VY T D  L K+R+ + K   LR ++ +C + CI CLSEAIST+       
Sbjct  754  KILSTLLREVYVTPDHRLEKARVFMKKARVLRFSETVCLDDCIQCLSEAISTM------I  807

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHS--S  195
            E  G   S      H +A AY +RALCT E  PNSK    DI +AL +W+      S   
Sbjct  808  EAAGGTCSSGVLHSHQLAVAYFLRALCTHEAVPNSKQVLPDIASALGIWLEISNLDSLPD  867

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
            GQ  +LS  ML +LY   DLLS+KG +D +  I+ +MIRLFKWK++ LE LL+LLW+ RR
Sbjct  868  GQRLILSEYMLLLLYNAFDLLSMKGCMDYYNSIYSLMIRLFKWKNVQLEKLLALLWESRR  927

Query  14   LGHA  3
            + HA
Sbjct  928  MSHA  931



>ref|XP_009136528.1| PREDICTED: separase isoform X1 [Brassica rapa]
Length=2189

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCYE--CIPCLSEAISTLEKYFAA  372
            ++I  ILL+ VY TED ++ ++ +LI K    RA G  ++  CI  LSEAI+ L +    
Sbjct  732  IEIADILLKNVYVTEDMHIERATVLIWKARMTRASGTEHQADCIRFLSEAITILSEVHHG  791

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              +GG      DP+ H +  AYC+RA CT E EPNSK  ++DI  +L +W+       SG
Sbjct  792  PNKGG------DPSSHQLPIAYCLRAFCTHEAEPNSKTVFQDISTSLNLWLGMPSLEDSG  845

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY IIDL+S+KG  +LH  I+ ++ RLFK K + LET L++LW+ RRL
Sbjct  846  D-SLPTEDIIPLLYNIIDLMSLKGCTELHHHIYLLIFRLFKQKHVKLETCLAMLWECRRL  904

Query  11   GHA  3
             HA
Sbjct  905  SHA  907



>ref|XP_002867740.1| hypothetical protein ARALYDRAFT_492569 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43999.1| hypothetical protein ARALYDRAFT_492569 [Arabidopsis lyrata subsp. 
lyrata]
Length=2186

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            +KI  ILL+ VY TED ++ ++RILI K +  R  G  +  ECI  LSEAIS L      
Sbjct  738  IKITDILLKDVYVTEDMHIERARILIWKAQMTRTSGTEHITECICFLSEAISILGVLHHG  797

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P+  ++  AYC+RA CT E EPNSK  ++DI  +L +W++      SG
Sbjct  798  PNKEGS------PSSPMLPIAYCLRAFCTQEAEPNSKKVFQDISTSLNLWLKILSLDDSG  851

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFKWK + LE  L++LW+ RRL
Sbjct  852  D-SLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKWKKVKLEVCLAMLWECRRL  910

Query  11   GHA  3
             HA
Sbjct  911  SHA  913



>ref|XP_004163947.1| PREDICTED: uncharacterized LOC101203087 [Cucumis sativus]
Length=2165

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 111/184 (60%), Gaps = 10/184 (5%)
 Frame = -2

Query  542  KIISILLEKVYTTEDDYLPKSRILIAKCEELR-AKGLCYE-CIPCLSEAISTLEKYFAAK  369
            KI+S LL  VY T D  L K+R+ + K   LR ++ +C + CI CLSEAIST+       
Sbjct  754  KILSTLLRDVYVTPDHRLEKARVFMKKARVLRFSETVCLDDCIQCLSEAISTM------I  807

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHS--S  195
            E  G   S      H +A AY +RALCT E  PNSK   +DI +AL +W+      S   
Sbjct  808  ETAGGTCSSGVLHSHQLAVAYFLRALCTHEAVPNSKQVLQDIASALGIWLEISNLDSLPD  867

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
            GQ  +LS  ML +L+   DLLS+KG +D +  I+ +MIRLFKWK++ LE LL+LLW+ RR
Sbjct  868  GQRLILSEYMLLLLHNAFDLLSMKGCMDYYHSIYSLMIRLFKWKNVQLEKLLALLWESRR  927

Query  14   LGHA  3
            + HA
Sbjct  928  MSHA  931



>ref|XP_004144269.1| PREDICTED: uncharacterized protein LOC101203087 [Cucumis sativus]
Length=2142

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 111/184 (60%), Gaps = 10/184 (5%)
 Frame = -2

Query  542  KIISILLEKVYTTEDDYLPKSRILIAKCEELR-AKGLCYE-CIPCLSEAISTLEKYFAAK  369
            KI+S LL  VY T D  L K+R+ + K   LR ++ +C + CI CLSEAIST+       
Sbjct  715  KILSTLLRDVYVTPDHRLEKARVFMKKARVLRFSETVCLDDCIQCLSEAISTM------I  768

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHS--S  195
            E  G   S      H +A AY +RALCT E  PNSK   +DI +AL +W+      S   
Sbjct  769  ETAGGTCSSGVLHSHQLAVAYFLRALCTHEAVPNSKQVLQDIASALGIWLEISNLDSLPD  828

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
            GQ  +LS  ML +L+   DLLS+KG +D +  I+ +MIRLFKWK++ LE LL+LLW+ RR
Sbjct  829  GQRLILSEYMLLLLHNAFDLLSMKGCMDYYHSIYSLMIRLFKWKNVQLEKLLALLWESRR  888

Query  14   LGHA  3
            + HA
Sbjct  889  MSHA  892



>ref|XP_007148477.1| hypothetical protein PHAVU_006G212000g [Phaseolus vulgaris]
 gb|ESW20471.1| hypothetical protein PHAVU_006G212000g [Phaseolus vulgaris]
Length=1869

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 115/185 (62%), Gaps = 10/185 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLC--YECIPCLSEAISTLEKYFAA  372
            +KI  ILL+ +Y T D     ++IL+ K + +R +G+    ECI CLSEAI+ +      
Sbjct  435  MKITGILLQDIYITPDSRFQMAQILVRKGKAVRFRGISGLRECIQCLSEAIAIM------  488

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR-PHQCH-S  198
            KE  GE  +  +   H +  AYC+RA+CT E E NSK  +ED++AAL +W+   H  H  
Sbjct  489  KEISGEICTDNNSIHHQLGVAYCLRAICTQEAEANSKQIFEDVKAALDLWLSTSHLNHLE  548

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
             G C+ LS +++ + Y I+DL+ +KG ++L  + + ++I++FKWK++ +E  L+L+W+ R
Sbjct  549  EGDCSALSDSLMILFYNIVDLVQLKGFMELFNDAYRLVIKMFKWKNVPIEKWLTLMWESR  608

Query  17   RLGHA  3
             L HA
Sbjct  609  SLCHA  613



>ref|XP_006286190.1| hypothetical protein CARUB_v10007755mg [Capsella rubella]
 gb|EOA19088.1| hypothetical protein CARUB_v10007755mg [Capsella rubella]
Length=2190

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 112/185 (61%), Gaps = 12/185 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTL--EKYF  378
            + I  ILL  VY TED +  ++RILI K    R  G  +  ECI  LSEAIS L  E + 
Sbjct  738  INIADILLNDVYVTEDMHTERARILIWKARMTRTSGTEHLTECISFLSEAISILQGEVHH  797

Query  377  AAKERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHS  198
               + G        P+ H++  AYC+RA CT E EP+SK  ++DI  +L +W+R      
Sbjct  798  GPSKEGT-------PSSHMLPIAYCLRAFCTQEAEPSSKKVFQDISTSLNLWLRNLSLGD  850

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
            +G  ++ +  ++ +LY +IDL+S+KG  +LH  I++++ R+FKWK++ LE  L++LW+ R
Sbjct  851  NGD-SLPTENIIPLLYNMIDLMSVKGCTELHHHIYQLIFRVFKWKNVKLEVCLAMLWECR  909

Query  17   RLGHA  3
            RL HA
Sbjct  910  RLSHA  914



>ref|XP_008445507.1| PREDICTED: separase isoform X2 [Cucumis melo]
Length=2177

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 113/187 (60%), Gaps = 15/187 (8%)
 Frame = -2

Query  542  KIISILLEKVYTTEDDYLPKSRILIAKCEELR-AKGLCYE-CIPCLSEAISTLEKYFAAK  369
            KI+S LL +VY T D  L K+R+ + K   LR ++ +C + CI CLSEAIST+       
Sbjct  754  KILSTLLREVYVTPDHRLEKARVFMKKARVLRFSETVCLDDCIQCLSEAISTM------I  807

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSK---LPYEDIRAALRVWMRPHQCHS  198
            E  G   S      H +A AY +RALCT E  PNSK   LP  DI +AL +W+      S
Sbjct  808  EAAGGTCSSGVLHSHQLAVAYFLRALCTHEAVPNSKQQVLP--DIASALGIWLEISNLDS  865

Query  197  --SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWK  24
               GQ  +LS  ML +LY   DLLS+KG +D +  I+ +MIRLFKWK++ LE LL+LLW+
Sbjct  866  LPDGQRLILSEYMLLLLYNAFDLLSMKGCMDYYNSIYSLMIRLFKWKNVQLEKLLALLWE  925

Query  23   HRRLGHA  3
             RR+ HA
Sbjct  926  SRRMSHA  932



>gb|ABN08434.1| peptidase , related [Medicago truncatula]
Length=736

 Score =   129 bits (324),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 72/185 (39%), Positives = 113/185 (61%), Gaps = 10/185 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++I +ILL+ +Y T +    K++ ++ K + LR  G+    +CI CLSEAI  L      
Sbjct  425  IEITNILLQNIYITPNSCFQKAQTIVRKGKALRFCGIGGLSDCIQCLSEAIIIL------  478

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPH--QCHS  198
            KE  GE  +   P  + +  AYC+RALCT E EP+S+  +ED++AAL +W+      C  
Sbjct  479  KEISGEMCTNSIPIYNQLCVAYCLRALCTQEAEPSSQQIFEDVKAALDLWLGISCVDCFE  538

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
             G+C+ LS  +  +LY IIDL  +KG +DL  + + ++I++FK K +++E  L+LLW+ R
Sbjct  539  EGECSALSDNITILLYNIIDLSHLKGFMDLLNDAYRLVIKMFKLKSVSMEKWLTLLWESR  598

Query  17   RLGHA  3
            RL HA
Sbjct  599  RLSHA  603



>gb|KGN47608.1| hypothetical protein Csa_6G364113 [Cucumis sativus]
Length=2264

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 111/185 (60%), Gaps = 11/185 (6%)
 Frame = -2

Query  542  KIISILLEKVYTTEDDYLPKSRILIAKCEELR-AKGLCYE-CIPCLSEAISTLEKYFAAK  369
            KI+S LL  VY T D  L K+R+ + K   LR ++ +C + CI CLSEAIST+       
Sbjct  788  KILSTLLRDVYVTPDHRLEKARVFMKKARVLRFSETVCLDDCIQCLSEAISTM------I  841

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPY-EDIRAALRVWMRPHQCHS--  198
            E  G   S      H +A AY +RALCT E  PNSK    +DI +AL +W+      S  
Sbjct  842  ETAGGTCSSGVLHSHQLAVAYFLRALCTHEAVPNSKQQVLQDIASALGIWLEISNLDSLP  901

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
             GQ  +LS  ML +L+   DLLS+KG +D +  I+ +MIRLFKWK++ LE LL+LLW+ R
Sbjct  902  DGQRLILSEYMLLLLHNAFDLLSMKGCMDYYHSIYSLMIRLFKWKNVQLEKLLALLWESR  961

Query  17   RLGHA  3
            R+ HA
Sbjct  962  RMSHA  966



>gb|KFK31931.1| hypothetical protein AALP_AA6G177700 [Arabis alpina]
Length=1801

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 106/183 (58%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
             K   ILL+ V+ T+D  + + RILI K   +RA G  +  ECI  LSEAIS     F  
Sbjct  634  TKTTDILLKDVFITKDLLVERGRILIWKARTIRASGTEHLKECIHYLSEAISISGNIFNE  693

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
                G      +  CH +A AYC+RALC  E EP+SK  ++D+  +L +W+R      S 
Sbjct  694  STNHG------NLCCHQLAVAYCLRALCVHETEPDSKQVFQDLNTSLNLWLRIQTPCDSN  747

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
                L   M+ +L  +IDLLSIKG ++LH  ++E++ RLFKWK++ LE  L++LW  RRL
Sbjct  748  DTIPLEN-MIPLLCNVIDLLSIKGWIELHHHVYELLSRLFKWKNVKLEVCLAMLWDCRRL  806

Query  11   GHA  3
             HA
Sbjct  807  SHA  809



>ref|XP_011088127.1| PREDICTED: separase [Sesamum indicum]
Length=2081

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 113/189 (60%), Gaps = 19/189 (10%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            ++II +LLE+VY T D  + KS+ILI K + LRA GL    +C+ CLS AISTL   ++ 
Sbjct  742  MRIIDVLLEEVYITNDSDVKKSKILIEKAKVLRANGLARLDDCVQCLSNAISTLNSIYSG  801

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKL--P----YEDIRAALRVWMRPH  210
            K       SC     +++ + Y +RALCT E  PNS +  P     +DI AALR  + P 
Sbjct  802  K-------SCSSLVHNLLIHGYILRALCTQEAAPNSMVLSPRSDFVQDIYAALRFCLSPD  854

Query  209  QCHSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLL  30
              H+  Q       ML + YQ+IDLLSIKG L++H  +++++I+LF  K+  L  ++S L
Sbjct  855  HGHADDQYE----EMLYLWYQLIDLLSIKGYLEIHPSLYDVVIKLFNGKNFPLVKIMSDL  910

Query  29   WKHRRLGHA  3
            WK +RL HA
Sbjct  911  WKTKRLTHA  919



>emb|CDY10832.1| BnaC01g14470D [Brassica napus]
Length=2165

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 111/184 (60%), Gaps = 11/184 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKG---LCYECIPCLSEAISTLEKYFA  375
            ++I  ILL+ VY TED ++ ++ +LI K    RA G   L Y CI  LSEAIS L +   
Sbjct  704  IEIADILLKNVYVTEDMHIERATVLIWKARMARASGTEHLVY-CIRFLSEAISILSEVHH  762

Query  374  AKERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSS  195
               + G       P+ H +  AYC+RA CT E EPNSK+ ++DI  +L +W+       S
Sbjct  763  GPNKEGA------PSSHQLPIAYCLRAFCTHEAEPNSKIVFQDISTSLNLWLGMLSLDDS  816

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
            G  ++ +  ++ +LY +IDL+S+KG  +LH   ++++ RLFK K + LET L++LW+ RR
Sbjct  817  GD-SLPTEDIIPLLYNMIDLMSVKGCTELHHHTYQLIFRLFKQKHVKLETCLAMLWECRR  875

Query  14   LGHA  3
            L HA
Sbjct  876  LSHA  879



>ref|XP_006585470.1| PREDICTED: separase-like isoform X2 [Glycine max]
Length=2170

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 112/185 (61%), Gaps = 10/185 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI  ILL+ +Y T D    K++ L+ K + +R +G+    +CI CLSEAI+ L      
Sbjct  723  MKITDILLQDIYITPDSRFQKAQTLVRKGKAIRVRGIGGLRDCIQCLSEAITIL------  776

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR-PHQCH-S  198
            KE  GE  +  +P  H +   YC+RA+CT E E NSK  +ED++AAL +W+   H  H  
Sbjct  777  KEISGEICTDNNPIDHQLCVTYCLRAICTQEAEANSKQIFEDVKAALDLWLNISHLNHFE  836

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
             G C+ LS  ++ +LY ++DLL +KG ++L  +   ++I++FK K++ +E  L L+W+ R
Sbjct  837  EGDCSALSDNIMILLYNVVDLLQLKGFMELFNDASRLVIKMFKRKNVPIEKWLPLMWESR  896

Query  17   RLGHA  3
             L HA
Sbjct  897  SLSHA  901



>ref|XP_006585469.1| PREDICTED: separase-like isoform X1 [Glycine max]
Length=2171

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 112/185 (61%), Gaps = 10/185 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI  ILL+ +Y T D    K++ L+ K + +R +G+    +CI CLSEAI+ L      
Sbjct  724  MKITDILLQDIYITPDSRFQKAQTLVRKGKAIRVRGIGGLRDCIQCLSEAITIL------  777

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR-PHQCH-S  198
            KE  GE  +  +P  H +   YC+RA+CT E E NSK  +ED++AAL +W+   H  H  
Sbjct  778  KEISGEICTDNNPIDHQLCVTYCLRAICTQEAEANSKQIFEDVKAALDLWLNISHLNHFE  837

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
             G C+ LS  ++ +LY ++DLL +KG ++L  +   ++I++FK K++ +E  L L+W+ R
Sbjct  838  EGDCSALSDNIMILLYNVVDLLQLKGFMELFNDASRLVIKMFKRKNVPIEKWLPLMWESR  897

Query  17   RLGHA  3
             L HA
Sbjct  898  SLSHA  902



>gb|KHN26699.1| Separin [Glycine soja]
Length=2304

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 112/185 (61%), Gaps = 10/185 (5%)
 Frame = -2

Query  545   VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
             +KI  ILL+ +Y T D    K++ L+ K + +R +G+    +CI CLSEAI+ L      
Sbjct  884   MKITDILLQDIYITPDSRFQKAQTLVRKGKAIRVRGIGGLRDCIQCLSEAITIL------  937

Query  371   KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR-PHQCH-S  198
             KE  GE  +  +P  H +   YC+RA+CT E E NSK  +ED++AAL +W+   H  H  
Sbjct  938   KEISGEICTDNNPIDHQLCVTYCLRAICTQEAEANSKQIFEDVKAALDLWLNISHLNHFE  997

Query  197   SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
              G C+ LS  ++ +LY ++DLL +KG ++L  +   ++I++FK K++ +E  L L+W+ R
Sbjct  998   EGDCSALSDNIMILLYNVVDLLQLKGFMELFNDASRLVIKMFKRKNVPIEKWLPLMWESR  1057

Query  17    RLGHA  3
              L HA
Sbjct  1058  SLSHA  1062



>gb|AES63348.2| separase-like protein [Medicago truncatula]
Length=2182

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 113/185 (61%), Gaps = 10/185 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++I +ILL+ +Y T +    K++ ++ K + LR  G+    +CI CLSEAI  L      
Sbjct  727  IEITNILLQNIYITPNSCFQKAQTIVRKGKALRFCGIGGLSDCIQCLSEAIIIL------  780

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPH--QCHS  198
            KE  GE  +   P  + +  AYC+RALCT E EP+S+  +ED++AAL +W+      C  
Sbjct  781  KEISGEMCTNSIPIYNQLCVAYCLRALCTQEAEPSSQQIFEDVKAALDLWLGISCVDCFE  840

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
             G+C+ LS  +  +LY IIDL  +KG +DL  + + ++I++FK K +++E  L+LLW+ R
Sbjct  841  EGECSALSDNITILLYNIIDLSHLKGFMDLLNDAYRLVIKMFKLKSVSMEKWLTLLWESR  900

Query  17   RLGHA  3
            RL HA
Sbjct  901  RLSHA  905



>ref|XP_006413594.1| hypothetical protein EUTSA_v10024187mg [Eutrema salsugineum]
 gb|ESQ55047.1| hypothetical protein EUTSA_v10024187mg [Eutrema salsugineum]
Length=2189

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 108/183 (59%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++I  ILL+ VY TED +L ++RILI K    R  G     +CI  LSEAIS L +    
Sbjct  738  IEIADILLKDVYVTEDMHLERARILIWKARMTRTFGTERLTDCIDFLSEAISILSEVHHR  797

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G       P+ H +  AYC+RA C  E EPNSK   EDI  +L +W+       SG
Sbjct  798  PNKEGA------PSSHQLPIAYCLRAFCIQEAEPNSKKVLEDISTSLNLWLEISCLDDSG  851

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              ++ +  ++ +LY +IDL+S+KG  +LH  I++++ RLFK K++ LE  L++LW+ RRL
Sbjct  852  -ASLPTVDIIPLLYNMIDLMSVKGCTELHHHIYQLIFRLFKQKNVKLEVCLAMLWECRRL  910

Query  11   GHA  3
             HA
Sbjct  911  SHA  913



>ref|XP_004486240.1| PREDICTED: uncharacterized protein LOC101501526 [Cicer arietinum]
Length=2163

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 110/185 (59%), Gaps = 10/185 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELR--AKGLCYECIPCLSEAISTLEKYFAA  372
            +KI +ILL+ +Y T D    K++ L+ K + LR    G   +CI CLSEAI  +      
Sbjct  715  MKITNILLQDIYITHDSCFQKAQTLVRKGKALRFFGTGGLRDCIQCLSEAIIIM------  768

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPH--QCHS  198
            KE  G   +      H +  AYC+RALCT E EP S+  +ED++AAL +W+      C  
Sbjct  769  KEISGVMCTKAITFYHQLCVAYCLRALCTQEAEPCSEQTFEDVKAALDLWLEMFCVDCFE  828

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
             G+C  L  +++ +LY IIDLL +KG ++L  + + ++IR+FK K I++E  L+LLW+ R
Sbjct  829  EGECFPLCDSIVILLYNIIDLLYLKGFMELFNDAYRLVIRMFKLKSISIEKWLTLLWESR  888

Query  17   RLGHA  3
            RL HA
Sbjct  889  RLSHA  893



>gb|KHN33472.1| Separin [Glycine soja]
Length=2111

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 112/185 (61%), Gaps = 10/185 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI  ILL+ +Y T D    K++ L+ K + +R +G+    +CI CLSEAI+ + + F  
Sbjct  722  MKITDILLQDIYITLDSRFQKAQTLVRKGKAIRVRGIGGLRDCIQCLSEAITIMNEIF--  779

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCH--S  198
                GE  +  +P  H +   YC+RA+CT E E NSK  +ED++AAL +W+     +   
Sbjct  780  ----GEICTDNNPIHHQLCVTYCLRAICTQEAEANSKQIFEDVKAALDLWLSISHLNRFE  835

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
             G  + LS  ++ +LY ++DLL +KG ++L  + ++++I++FK K++ +E  L L+W+ R
Sbjct  836  EGDSSALSDNIMILLYNVVDLLQLKGFMELFNDAYQLLIKMFKRKNVPIEKWLPLMWESR  895

Query  17   RLGHA  3
             L HA
Sbjct  896  SLSHA  900



>ref|XP_003547059.2| PREDICTED: separase-like [Glycine max]
Length=2186

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 112/185 (61%), Gaps = 10/185 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +KI  ILL+ +Y T D    K++ L+ K + +R +G+    +CI CLSEAI+ + + F  
Sbjct  723  MKITDILLQDIYITLDSRFQKAQTLVRKGKAIRVRGIGGLRDCIQCLSEAITIMNEIF--  780

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCH--S  198
                GE  +  +P  H +   YC+RA+CT E E NSK  +ED++AAL +W+     +   
Sbjct  781  ----GEICTDNNPIHHQLCVTYCLRAICTQEAEANSKQIFEDVKAALDLWLSISHLNRFE  836

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
             G  + LS  ++ +LY ++DLL +KG ++L  + ++++I++FK K++ +E  L L+W+ R
Sbjct  837  EGDSSALSDNIMILLYNVVDLLQLKGFMELFNDAYQLLIKMFKRKNVPIEKWLPLMWESR  896

Query  17   RLGHA  3
             L HA
Sbjct  897  SLSHA  901



>ref|XP_009137707.1| PREDICTED: separase-like [Brassica rapa]
Length=2170

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 108/183 (59%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            ++I  ILL+ VY TED ++ ++RIL+ K    RA G  +  +CI  LSEAIS L +    
Sbjct  717  IEIADILLKNVYVTEDMHVERARILVWKARITRASGTEHLADCIRFLSEAISILSEVHHG  776

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G   S   P       AYC+RA CT E EPNSK  ++DI  +L +W+R      S 
Sbjct  777  TNKEGASSSYQLP------IAYCLRAFCTQEAEPNSKKVFQDISTSLNLWLRIPGLDDS-  829

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            + ++ +  ++ +LY + DL+S+KG  +LH  I++++ RLFK K + LE  L ++W+ RRL
Sbjct  830  EDSLPTENIVPLLYNMFDLMSVKGCTELHHHIYQLIFRLFKRKHVKLEVCLGMMWESRRL  889

Query  11   GHA  3
             HA
Sbjct  890  SHA  892



>emb|CDX98781.1| BnaA03g45660D [Brassica napus]
Length=2152

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 108/183 (59%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            ++I  ILL+ VY TED ++ ++RIL+ K    RA G  +  +CI  LSEAIS L +    
Sbjct  723  IEIADILLKNVYVTEDMHVERARILVWKARITRASGTEHLADCIRFLSEAISILSEVHHG  782

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G   S   P       AYC+RA CT E EPNSK  ++DI  +L +W+R      S 
Sbjct  783  TNKEGASSSYQLP------IAYCLRAFCTEEAEPNSKKVFQDISTSLNLWLRIPGLDDS-  835

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            + ++ +  ++ +LY + DL+S+KG  +LH  I++++ RLFK K + LE  L ++W+ RRL
Sbjct  836  EDSLPTENIVPLLYNMFDLMSVKGCTELHHHIYQLIFRLFKRKHVKLEVCLGMMWESRRL  895

Query  11   GHA  3
             HA
Sbjct  896  SHA  898



>ref|XP_002529003.1| separase, putative [Ricinus communis]
 gb|EEF33373.1| separase, putative [Ricinus communis]
Length=2153

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 113/183 (62%), Gaps = 14/183 (8%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++II ILL+ VY  +D  L +SR+L+ K   LRA G     +CI CL++AIS +    A 
Sbjct  705  LEIIDILLQDVYVMQDSCLERSRLLLRKGRALRAFGFNGLRDCIQCLTDAISVIN---AG  761

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
            K  GG       P    +A A+C+R LC  E EPNSK   +D++AA+ +W+       S 
Sbjct  762  KHGGGI------PTSLQLAMAHCLRGLCIQEAEPNSKQVLQDVQAAISIWL---SIPISD  812

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
              N+LSG+ L +LY I+DLL+ KG+++ H  ++++MIR+ + K++ LE  LS+LW+ RRL
Sbjct  813  DGNLLSGSGLILLYNIVDLLAAKGSMEFHYNVYKLMIRILELKNVPLEKFLSILWESRRL  872

Query  11   GHA  3
             HA
Sbjct  873  SHA  875



>ref|XP_010245920.1| PREDICTED: separase isoform X4 [Nelumbo nucifera]
Length=2193

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 11/185 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            ++I++ LL  VY T++++L KSRI I K    RA+G+ Y   CI CLSEAI  L      
Sbjct  789  LEIMNTLLLDVYVTKENWLQKSRIFIRKGGAFRAQGIEYLDSCIQCLSEAICIL------  842

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR--PHQCHS  198
             +   E  S      H +A AY +RALCT E EPNSKL   DI  A+++W+      C S
Sbjct  843  NDISREPSSSSCSVHHQLAIAYSLRALCTQETEPNSKLILHDIHHAVKLWLGIITQDCWS  902

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
            +  C  ++  ++ +LY+I DLL +KG++    +I++++I L K K+++LE   S+LW +R
Sbjct  903  N-HCEFVTENLITLLYRIADLLLLKGSMQFQCDIYKLIIILLKRKNVSLEKSFSMLWANR  961

Query  17   RLGHA  3
            RL HA
Sbjct  962  RLAHA  966



>ref|XP_010245919.1| PREDICTED: separase isoform X3 [Nelumbo nucifera]
Length=2226

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 11/185 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            ++I++ LL  VY T++++L KSRI I K    RA+G+ Y   CI CLSEAI  L      
Sbjct  780  LEIMNTLLLDVYVTKENWLQKSRIFIRKGGAFRAQGIEYLDSCIQCLSEAICIL------  833

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR--PHQCHS  198
             +   E  S      H +A AY +RALCT E EPNSKL   DI  A+++W+      C S
Sbjct  834  NDISREPSSSSCSVHHQLAIAYSLRALCTQETEPNSKLILHDIHHAVKLWLGIITQDCWS  893

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
            +  C  ++  ++ +LY+I DLL +KG++    +I++++I L K K+++LE   S+LW +R
Sbjct  894  N-HCEFVTENLITLLYRIADLLLLKGSMQFQCDIYKLIIILLKRKNVSLEKSFSMLWANR  952

Query  17   RLGHA  3
            RL HA
Sbjct  953  RLAHA  957



>ref|XP_010245917.1| PREDICTED: separase isoform X1 [Nelumbo nucifera]
Length=2235

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 11/185 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            ++I++ LL  VY T++++L KSRI I K    RA+G+ Y   CI CLSEAI  L      
Sbjct  789  LEIMNTLLLDVYVTKENWLQKSRIFIRKGGAFRAQGIEYLDSCIQCLSEAICIL------  842

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR--PHQCHS  198
             +   E  S      H +A AY +RALCT E EPNSKL   DI  A+++W+      C S
Sbjct  843  NDISREPSSSSCSVHHQLAIAYSLRALCTQETEPNSKLILHDIHHAVKLWLGIITQDCWS  902

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
            +  C  ++  ++ +LY+I DLL +KG++    +I++++I L K K+++LE   S+LW +R
Sbjct  903  N-HCEFVTENLITLLYRIADLLLLKGSMQFQCDIYKLIIILLKRKNVSLEKSFSMLWANR  961

Query  17   RLGHA  3
            RL HA
Sbjct  962  RLAHA  966



>ref|XP_010245918.1| PREDICTED: separase isoform X2 [Nelumbo nucifera]
Length=2234

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 11/185 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            ++I++ LL  VY T++++L KSRI I K    RA+G+ Y   CI CLSEAI  L      
Sbjct  788  LEIMNTLLLDVYVTKENWLQKSRIFIRKGGAFRAQGIEYLDSCIQCLSEAICIL------  841

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMR--PHQCHS  198
             +   E  S      H +A AY +RALCT E EPNSKL   DI  A+++W+      C S
Sbjct  842  NDISREPSSSSCSVHHQLAIAYSLRALCTQETEPNSKLILHDIHHAVKLWLGIITQDCWS  901

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
            +  C  ++  ++ +LY+I DLL +KG++    +I++++I L K K+++LE   S+LW +R
Sbjct  902  N-HCEFVTENLITLLYRIADLLLLKGSMQFQCDIYKLIIILLKRKNVSLEKSFSMLWANR  960

Query  17   RLGHA  3
            RL HA
Sbjct  961  RLAHA  965



>emb|CDX94142.1| BnaC07g37760D [Brassica napus]
Length=2176

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 107/183 (58%), Gaps = 9/183 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            ++I  ILL+ VY TED ++ ++RIL+ K    RA G  +  +CI  LSEAIS L +    
Sbjct  716  IEIADILLKNVYVTEDMHVERARILVWKARITRASGTEHLADCIRFLSEAISILSEVHHG  775

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              + G   S   P       AYC+RA CT E EPNSK  ++DI  +L +W+R      S 
Sbjct  776  PNKEGVSSSYQLP------IAYCLRAFCTQEAEPNSKKVFQDISTSLNLWLRIPSLDDS-  828

Query  191  QCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRL  12
            + ++ +  ++ +LY + DL+S+KG  + H  I++++ RLFK K + LE  L ++W+ RRL
Sbjct  829  EDSLPTENIVPLLYNMFDLMSVKGCTEFHHHIYQLIFRLFKRKHVKLEVCLGMMWESRRL  888

Query  11   GHA  3
             HA
Sbjct  889  SHA  891



>gb|KEH21880.1| separase-like protein [Medicago truncatula]
Length=2148

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 111/185 (60%), Gaps = 10/185 (5%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLC--YECIPCLSEAISTLEKYFAA  372
            +KI +ILL+K+Y T + +  K++ L+ K +  R  G+    +CI CLSEAI  +      
Sbjct  725  MKITNILLQKIYITPNSFFQKAQTLVRKGKAFRLYGIVGLRDCIQCLSEAIIIM------  778

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPH--QCHS  198
            KE  GE  +   P  H +  AYC+RALCT E  P S+  +ED++AAL +W+         
Sbjct  779  KEISGEMCTKSIPIYHELCVAYCLRALCTQEATPCSQQIFEDVKAALDLWLGISCLDHFE  838

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
             G+ + L   ++ +LY IIDLL +KG ++L  + + ++IRLFK K+++ E  L+LLW+ R
Sbjct  839  EGEYSALFDNIMILLYNIIDLLQLKGFMELFNDAYRLVIRLFKLKNVSTEKWLTLLWESR  898

Query  17   RLGHA  3
            RL +A
Sbjct  899  RLSYA  903



>gb|EYU18539.1| hypothetical protein MIMGU_mgv1a018611mg [Erythranthe guttata]
Length=2105

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 108/194 (56%), Gaps = 23/194 (12%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
            ++II ILLE+VY  +D  L KSRILI K + LR  GL    EC+ CLS+AISTL+  +  
Sbjct  735  MQIIDILLEEVYIAKDSNLKKSRILIEKGKVLRVHGLARLDECVQCLSDAISTLKLIY--  792

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPY-----------EDIRAALRV  225
                G K SC      ++ +AY + ALCT E  PNS                DI AAL +
Sbjct  793  ----GTKKSCSSRVHQLLIHAYLLHALCTQEASPNSMFLMLYLLCFDSDFLNDIHAALDL  848

Query  224  WMRPHQCHSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLET  45
            ++     H+  Q       ML + YQ+ID LSIKG L++H  +++++I+LF  K+  L  
Sbjct  849  YLSSDHGHADEQYE----DMLFLWYQLIDFLSIKGYLEIHPRLYDVVIKLFNEKNSPLAK  904

Query  44   LLSLLWKHRRLGHA  3
             +S LWK+RRL H 
Sbjct  905  TISELWKNRRLSHG  918



>ref|XP_003593097.1| Separin [Medicago truncatula]
Length=2216

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 114/211 (54%), Gaps = 36/211 (17%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++I +ILL+ +Y T +    K++ ++ K + LR  G+    +CI CLSEAI  L      
Sbjct  727  IEITNILLQNIYITPNSCFQKAQTIVRKGKALRFCGIGGLSDCIQCLSEAIIIL------  780

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSK------------LP---------  255
            KE  GE  +   P  + +  AYC+RALCT E EP+S+             P         
Sbjct  781  KEISGEMCTNSIPIYNQLCVAYCLRALCTQEAEPSSQVMRCLHNCQFLDFPLMYVEGFGN  840

Query  254  -----YEDIRAALRVWMRPH--QCHSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEI  96
                 +ED++AAL +W+      C   G+C+ LS  +  +LY IIDL  +KG +DL  + 
Sbjct  841  FIDQIFEDVKAALDLWLGISCVDCFEEGECSALSDNITILLYNIIDLSHLKGFMDLLNDA  900

Query  95   FEMMIRLFKWKDITLETLLSLLWKHRRLGHA  3
            + ++I++FK K +++E  L+LLW+ RRL HA
Sbjct  901  YRLVIKMFKLKSVSMEKWLTLLWESRRLSHA  931



>ref|XP_006396846.1| hypothetical protein EUTSA_v10029518mg, partial [Eutrema salsugineum]
 gb|ESQ38299.1| hypothetical protein EUTSA_v10029518mg, partial [Eutrema salsugineum]
Length=2098

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 105/184 (57%), Gaps = 11/184 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY--ECIPCLSEAISTLEKYFAA  372
             +I  ILL++V+ T+D  + ++RILI K    RA G  +  ECI  LSEAI      F +
Sbjct  724  TQIADILLKEVFITKDLAVERARILIWKARVRRASGTEHLKECIHYLSEAI------FIS  777

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQ-CHSS  195
                 E  +     CH +A AYC+RALC  E EP+SK  ++D+  +L  W+R    C S 
Sbjct  778  GNILNEPNNHGTLCCHQLAVAYCLRALCIQETEPDSKQVFQDVNTSLNFWLRIQTPCDSK  837

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
                + +   +++L  + DLLSIKG ++L   I+E++ RL K K++ LE  L++LW  RR
Sbjct  838  DSIPLEN--TIHLLCNVNDLLSIKGWIELQQHIYELIFRLCKGKNVKLEVCLAMLWDCRR  895

Query  14   LGHA  3
            L HA
Sbjct  896  LSHA  899



>emb|CAA19812.1| putative protein [Arabidopsis thaliana]
 emb|CAB79252.1| putative protein [Arabidopsis thaliana]
Length=1773

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = -2

Query  335  PACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSGQCNMLSGAMLNM  156
            P+ H++  AYC+RA CT E +PNSK  ++DI  +L +W+R      SG  ++ +  ++ +
Sbjct  590  PSSHMLPIAYCLRAFCTQEADPNSKKVFQDISTSLNLWLRILSLDDSGD-SLPTENIIPL  648

Query  155  LYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRLGHA  3
            LY +IDL+S+KG  +LH  I++++ RLFKWK++ LE  L++LW+ RRL HA
Sbjct  649  LYNMIDLMSVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWECRRLSHA  699



>ref|XP_010671406.1| PREDICTED: separase [Beta vulgaris subsp. vulgaris]
Length=2163

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 107/185 (58%), Gaps = 11/185 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++II ILL+KVY +    L +S IL+ K   LR  G+     CI CLSEAI +       
Sbjct  740  MQIIDILLQKVYHS-SLCLQRSIILVKKGMLLRTSGIEGLDNCIHCLSEAIESANGSCGL  798

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQ--CHS  198
                  K+S      + +A  Y +RAL T E  P SK  ++DIR A+++W+R     C S
Sbjct  799  THDFAAKMS------NQLAVVYGLRALSTHEANPTSKETFKDIRKAVKLWLRTDFPCCSS  852

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
            S  C++    +L +LY I DLLSIKG++ LH+++  ++I++ K  +I+L+  L +LW+ R
Sbjct  853  SCNCDVGCEYLLRLLYHIADLLSIKGDMTLHSDVLNVIIKVLKQINISLKKCLLILWESR  912

Query  17   RLGHA  3
            R+ HA
Sbjct  913  RVNHA  917



>ref|XP_008378851.1| PREDICTED: separase-like [Malus domestica]
Length=770

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 77/127 (61%), Gaps = 8/127 (6%)
 Frame = -2

Query  362  GGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKL----PYEDIRAALRVWM---RPHQC  204
            G +  +C  P CH +A AYC+ AL T E EPNSK       EDI AA+ +W+    P  C
Sbjct  382  GMQLFTCTSP-CHQLAVAYCLHALSTQETEPNSKTHEQRVLEDISAAINLWLGISTPDNC  440

Query  203  HSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWK  24
              + + +MLS   + +LY +IDLLSIKG  D H++I  +MIRLFKW ++ LE  +   W+
Sbjct  441  SPADKWSMLSENTILLLYNVIDLLSIKGCTDFHSDIHRLMIRLFKWSNVPLEKCVLRFWE  500

Query  23   HRRLGHA  3
             RR+ HA
Sbjct  501  CRRISHA  507



>gb|KCW63049.1| hypothetical protein EUGRSUZ_G00634 [Eucalyptus grandis]
Length=2157

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 105/192 (55%), Gaps = 23/192 (12%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLE-----  387
            +KII  LL+++Y  +     K+R+LI K   L+ +G      CI CLSEAIST++     
Sbjct  733  LKIIDELLQEIYFAKASGFQKARLLIKKGRILKCRGSDGLKSCIQCLSEAISTIDCVIKS  792

Query  386  -KYFAAKERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWM---  219
                A  ER            +++A AY +RALCT E EP SK   EDI AA+ +W+   
Sbjct  793  SSCSAVSER------------YLLASAYSLRALCTQEAEPKSKGILEDINAAMNLWLSIK  840

Query  218  RPHQCHSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLL  39
                C      ++L+   L +LY I+D+LS+KG      ++F++MI  FK K++  +  L
Sbjct  841  NSDGCTLDEDDSVLAEISLPLLYNIVDILSLKGCSSFSHKLFKLMIGYFKSKNLEPQKYL  900

Query  38   SLLWKHRRLGHA  3
            +LLW+ RR+ HA
Sbjct  901  TLLWESRRMSHA  912



>ref|XP_010433961.1| PREDICTED: separase-like [Camelina sativa]
Length=1387

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = -2

Query  311  AYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSGQCNMLSGAMLNMLYQIIDLL  132
            AYC+RA CT E EPNSK  ++DIR +L +W+R      SG  ++ +  ++ +LY +IDL+
Sbjct  5    AYCLRAFCTQEAEPNSKKVFQDIRTSLNLWLRILSLDDSGD-SLPTENIIPLLYNMIDLM  63

Query  131  SIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRRLGHA  3
            S+KG  +LH  I++++ RLFKWK++ LE  L++LW+ RRL HA
Sbjct  64   SVKGCTELHHHIYQLIFRLFKWKNVKLEVCLAMLWECRRLSHA  106



>ref|XP_010068188.1| PREDICTED: separase [Eucalyptus grandis]
Length=2225

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 105/192 (55%), Gaps = 23/192 (12%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLE-----  387
            +KII  LL+++Y  +     K+R+LI K   L+ +G      CI CLSEAIST++     
Sbjct  758  LKIIDELLQEIYFAKASGFQKARLLIKKGRILKCRGSDGLKSCIQCLSEAISTIDCVIKS  817

Query  386  -KYFAAKERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWM---  219
                A  ER            +++A AY +RALCT E EP SK   EDI AA+ +W+   
Sbjct  818  SSCSAVSER------------YLLASAYSLRALCTQEAEPKSKGILEDINAAMNLWLSIK  865

Query  218  RPHQCHSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLL  39
                C      ++L+   L +LY I+D+LS+KG      ++F++MI  FK K++  +  L
Sbjct  866  NSDGCTLDEDDSVLAEISLPLLYNIVDILSLKGCSSFSHKLFKLMIGYFKSKNLEPQKYL  925

Query  38   SLLWKHRRLGHA  3
            +LLW+ RR+ HA
Sbjct  926  TLLWESRRMSHA  937



>ref|XP_008776341.1| PREDICTED: separase [Phoenix dactylifera]
Length=1832

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 104/185 (56%), Gaps = 11/185 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +K+I+ILL +VYTT+D Y+ +SRI + K + +R  G+     CI CLSEAIS L      
Sbjct  356  LKVINILLNEVYTTKDYYIQRSRIFVRKGKVIRGCGVEGLSRCIECLSEAISLL------  409

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVW--MRPHQCHS  198
            K+  G          H +A  YC+ A C  E   + K+  ++++ A+++W  +    C +
Sbjct  410  KDISGNPSQRNASVLHQLAL-YCLLAQCAQEANQDGKIILDNVQYAIKLWSSIDIQSCSA  468

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHR  18
                   S  ++ +L  +IDLLS+KG L    +I ++MI L KW++I LE  +++LW  R
Sbjct  469  DSHLERASENVIPILCSVIDLLSLKGCLKFQNDIRQLMITLCKWENIPLEKCIAMLWSGR  528

Query  17   RLGHA  3
            RL H+
Sbjct  529  RLNHS  533



>ref|XP_006829069.1| hypothetical protein AMTR_s00001p00258830 [Amborella trichopoda]
 gb|ERM96485.1| hypothetical protein AMTR_s00001p00258830 [Amborella trichopoda]
Length=1441

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 11/186 (6%)
 Frame = -2

Query  542  KIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAAK  369
            KIISILL  +Y TE++YL +S+IL+ K    +A GL    +C+ CLSE+I  L    A  
Sbjct  545  KIISILLGDIYVTENNYLLRSKILLLKSRVAKASGLGGLNDCLQCLSESICLLNTKLAE-  603

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSGQ  189
                +   C    CH +A  YC+ ALCT E + NS++ + D+ +AL +W + +   SS  
Sbjct  604  ----DPAECNASLCHQLAMTYCLHALCTQEADQNSEVIHHDVSSALNLWAQIYVLGSSIL  659

Query  188  CNMLSGAMLN---MLYQIIDLLSIKGNLDLHAEIFEMMIR-LFKWKDITLETLLSLLWKH  21
             +     M N   +LY  +DLLS+K    L  +  E++++ L   K I L   L++ W  
Sbjct  660  DSHHELGMQNALPLLYHTVDLLSLKDFSKLSLKFHELILQSLCTRKKIPLGECLAVFWGD  719

Query  20   RRLGHA  3
            RRL HA
Sbjct  720  RRLNHA  725



>emb|CDY68508.1| BnaCnng59290D, partial [Brassica napus]
Length=1005

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 97/186 (52%), Gaps = 20/186 (11%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY-----ECIPCLSEAISTLEKY  381
            +KI  ILL  V+ T+D  L ++++L  K   +   G  +     EC+  LSE IS LE  
Sbjct  522  IKIADILLTDVFITKDLLLERAKVLTWKARLITTAGAEHLKAHKECVRHLSETISNLESI  581

Query  380  FAAKERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCH  201
            F                C  +   Y +RAL   E EP SK  +EDI  +L +W+      
Sbjct  582  FNESHE----------TCFQLIIIYFLRALYFQETEPESKQIFEDINKSLNLWVWIQSSE  631

Query  200  SSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
            +    N++      +L+ +IDL+SIKG ++LH  I+++M R+FK +++ L+  L++LW  
Sbjct  632  TIPLENVIP-----LLFNVIDLVSIKGWIELHQRIYDLMFRIFKGRNVRLKDALAMLWDC  686

Query  20   RRLGHA  3
            RRL HA
Sbjct  687  RRLSHA  692



>emb|CDY67480.1| BnaCnng55190D, partial [Brassica napus]
Length=1561

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 103/186 (55%), Gaps = 22/186 (12%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCYE---CIPCLSEAISTLEKYFA  375
            +KI  ILL+ V  T+D +L ++R+L  K    RA+    E   C+  LSE IS LE   +
Sbjct  515  IKIADILLKDVIITKDLFLERARVLTWKARIARAEQERVEKEYCVRHLSEGISNLE---S  571

Query  374  AKERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALR--VWMRPHQCH  201
                G E        C  +   Y +RAL   E +P SK  +EDI  +L   VW++     
Sbjct  572  ISNEGHE-------TCFQLTIIYFLRALYFQETKPESKQIFEDINKSLNLCVWIQ-----  619

Query  200  SSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
             SG+   L   ++ +L+ +IDL+SIKG ++LH  I+++M R+FK +++ L+  L++LW  
Sbjct  620  -SGETMPLEN-VIPLLFNVIDLVSIKGWIELHQRIYDLMFRIFKGRNVRLKDALAMLWDC  677

Query  20   RRLGHA  3
            RRL HA
Sbjct  678  RRLSHA  683



>ref|XP_010236897.1| PREDICTED: separase [Brachypodium distachyon]
Length=2249

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 99/183 (54%), Gaps = 11/183 (6%)
 Frame = -2

Query  539  IISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAAKE  366
            II ILL ++Y ++  YL +SR+L+ K   LRA G+     CI  LSEAIS L+       
Sbjct  771  IIDILLNELYCSKGYYLERSRVLVRKARVLRASGVQKISSCIESLSEAISLLQGILLDSS  830

Query  365  RGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSGQC  186
            RG   +       H +A  YC+ A C  E     K+ +++ R+A+ +W +    H S   
Sbjct  831  RGNAIV------IHELAITYCLHAHCAQEANLGGKVIFDNARSAVGLWSKMDTFHHSSPS  884

Query  185  NML---SGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKHRR  15
             +    S  ++ ++  ++DLL+IKG  +L  ++ ++++ ++K +++ LE L S+L+   R
Sbjct  885  MIFQPPSETLVPLICSLVDLLAIKGCFELQFDLCKLLVMIWKQENLPLEKLFSMLFTGGR  944

Query  14   LGH  6
            L H
Sbjct  945  LNH  947



>ref|XP_004955230.1| PREDICTED: uncharacterized protein LOC101777770 [Setaria italica]
Length=2215

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 109/186 (59%), Gaps = 16/186 (9%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +++I+ILL+++Y +++ +  +SR+L+ K   LRA+G+     C+  LSEAIS L+     
Sbjct  742  MRVINILLDEIYCSKECFRERSRVLVRKAGALRARGVQNISSCLDTLSEAISLLDL----  797

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              RG   ++      + +A A+C+ A C  E     ++ +E+ R AL +W R    H S 
Sbjct  798  -SRGDAIVT------NQLAIAHCLYAHCAQEGNLGGEVIFENARRALSLWSRVESFHHSD  850

Query  191  QCNML---SGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
               +L   S  ++ +L  ++DLLS+KG  +L  ++ E+MI ++K +++ LE L+SLL+ +
Sbjct  851  PGMVLQQPSRTIVPLLCSLVDLLSMKGCFELQFKLCEVMIMIWKQENLPLEKLMSLLFTN  910

Query  20   RRLGHA  3
             RL HA
Sbjct  911  GRLSHA  916



>ref|XP_008679271.1| PREDICTED: separase isoform X3 [Zea mays]
Length=1861

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 101/186 (54%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++II +LL K+Y T++ +L +SR+LI K   LRA G+     C+  L +AIS L+K    
Sbjct  394  IRIIDVLLHKIYCTKEHFLERSRVLIRKAGALRASGVENIKNCLESLRDAISLLQKISHD  453

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              R          A + +A AYC+ A C  E +   ++ ++    AL +W+       S 
Sbjct  454  STRTNTT------ANNQLAIAYCLYAQCAQEDKLGGEVIFDSAEKALNLWLDMEAFDHSS  507

Query  191  QCNML---SGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
               +L   S  ++ ++  ++DLLS+KG  +L  ++ ++MI ++K + + +E LLSLL+  
Sbjct  508  SDMVLQQPSKTIVPLICFLVDLLSMKGCFELQFKLCKVMIMIWKQEKLPIEKLLSLLFTS  567

Query  20   RRLGHA  3
             RL HA
Sbjct  568  GRLSHA  573



>ref|XP_008679270.1| PREDICTED: separase isoform X2 [Zea mays]
Length=2208

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 101/186 (54%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++II +LL K+Y T++ +L +SR+LI K   LRA G+     C+  L +AIS L+K    
Sbjct  742  IRIIDVLLHKIYCTKEHFLERSRVLIRKAGALRASGVENIKNCLESLRDAISLLQKISHD  801

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              R          A + +A AYC+ A C  E +   ++ ++    AL +W+       S 
Sbjct  802  STRTNTT------ANNQLAIAYCLYAQCAQEDKLGGEVIFDSAEKALNLWLDMEAFDHSS  855

Query  191  QCNML---SGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
               +L   S  ++ ++  ++DLLS+KG  +L  ++ ++MI ++K + + +E LLSLL+  
Sbjct  856  SDMVLQQPSKTIVPLICFLVDLLSMKGCFELQFKLCKVMIMIWKQEKLPIEKLLSLLFTS  915

Query  20   RRLGHA  3
             RL HA
Sbjct  916  GRLSHA  921



>ref|XP_008679269.1| PREDICTED: separase isoform X1 [Zea mays]
Length=2209

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 101/186 (54%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++II +LL K+Y T++ +L +SR+LI K   LRA G+     C+  L +AIS L+K    
Sbjct  742  IRIIDVLLHKIYCTKEHFLERSRVLIRKAGALRASGVENIKNCLESLRDAISLLQKISHD  801

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
              R          A + +A AYC+ A C  E +   ++ ++    AL +W+       S 
Sbjct  802  STRTNTT------ANNQLAIAYCLYAQCAQEDKLGGEVIFDSAEKALNLWLDMEAFDHSS  855

Query  191  QCNML---SGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
               +L   S  ++ ++  ++DLLS+KG  +L  ++ ++MI ++K + + +E LLSLL+  
Sbjct  856  SDMVLQQPSKTIVPLICFLVDLLSMKGCFELQFKLCKVMIMIWKQEKLPIEKLLSLLFTS  915

Query  20   RRLGHA  3
             RL HA
Sbjct  916  GRLSHA  921



>ref|XP_009417821.1| PREDICTED: separase-like [Musa acuminata subsp. malaccensis]
Length=1707

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 96/186 (52%), Gaps = 11/186 (6%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +K++  LL+ VYT++D  L +SR+L+ K    RA G     +C+ CLSEAIS L   F +
Sbjct  806  LKVMDFLLKDVYTSKDYNLQRSRVLVTKGRAFRAHGTEGLSKCLECLSEAISLLR--FIS  863

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPH---QCH  201
             +   +  S      H +A  Y + A C  E   +  +   ++  AL +W   +    C 
Sbjct  864  DDSSQDIAS----VSHQLALTYILYAHCAQEANQDCGVILHNVHCALNLWSEMNVQGYCS  919

Query  200  SSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLLWKH  21
             S      + ++L +L  ++DLLS+KG L    EI +++IR    +++  E  + +LW +
Sbjct  920  PSNYHQWGTMSILPLLCSMVDLLSLKGCLKFQLEICKVIIRFSMLENMLSEKCIFMLWSN  979

Query  20   RRLGHA  3
            RRL H+
Sbjct  980  RRLNHS  985



>ref|XP_010103846.1| hypothetical protein L484_024148 [Morus notabilis]
 gb|EXB97287.1| hypothetical protein L484_024148 [Morus notabilis]
Length=1414

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGLCY-ECIPCLSEAISTLEKYFAAK  369
            ++II  LLE VY T + +L +SRIL+ K   LR+ G C  +CI CLS+AIS+L      K
Sbjct  444  MQIIGYLLEDVYVTPESWLQRSRILVRKGRALRSYGHCLKDCIQCLSDAISSL--LLKQK  501

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLP  255
               G+  S     CH +A AYCIRA CT E EP+SK P
Sbjct  502  AMSGDPCSFGIQPCHQLAVAYCIRAFCTQETEPSSKDP  539



>emb|CCG89179.1| separase protein [Picea abies]
Length=2307

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 100/185 (54%), Gaps = 6/185 (3%)
 Frame = -2

Query  539  IISILLEKVYTTEDDYLPKSRILI--AKCEELRAKGLCYECIPCLSEAISTLEKYFAAKE  366
            I+ +LL+ VY  ++  L +SR+L+   K + L        C+ CLS+AI  L        
Sbjct  759  ILELLLDDVYVAKEFSLERSRVLLEQTKIDRLSGAAGLGRCMDCLSDAILLLRNVLNEDY  818

Query  365  RGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVW--MRPHQC-HSS  195
                  S +D   H +A  YC+ A+CT E   NS++  +DI  A+++W  +   QC   +
Sbjct  819  NPNGNSSFLDRVRHQLAITYCVHAICTQEANANSEVICDDISLAMKLWEQIDSFQCLELN  878

Query  194  GQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFK-WKDITLETLLSLLWKHR  18
            G+ + L+   + +L  +++LL++KG   L +++ E+++ +FK WK +  E   +LLW+  
Sbjct  879  GEKDWLTDTSIPLLLNMLELLALKGFTYLQSKLQELVLTIFKSWKKMASEECCALLWREN  938

Query  17   RLGHA  3
            RL HA
Sbjct  939  RLSHA  943



>ref|XP_010908771.1| PREDICTED: separase [Elaeis guineensis]
Length=340

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 77/146 (53%), Gaps = 10/146 (7%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            +K++ ILL +VYTT+D Y+ +SRI + K + +R  G+     CI CLSEAIS L      
Sbjct  199  LKVVDILLNEVYTTKDYYMQRSRIFVRKGKVIRGCGVEGLSRCIECLSEAISLLNDISGN  258

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVW--MRPHQCHS  198
              +G   +       H +A  YC+ A C  E   + K+  +++  AL++W  M    C +
Sbjct  259  PSQGNASV------LHHLALIYCLLAQCAQEANQDGKIILDNVGYALKLWLSMDIQSCSA  312

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIKG  120
                   S  ++ +L  ++DLLS+KG
Sbjct  313  DRCLERASENVIPILCAVVDLLSLKG  338



>gb|EMS65712.1| Separin [Triticum urartu]
Length=2089

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 74/145 (51%), Gaps = 11/145 (8%)
 Frame = -2

Query  542  KIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAAK  369
            +I+ ILL ++Y +++ YL +S++L+ K   LR  G+     C+  LSEAIS L+      
Sbjct  530  RIVDILLNEIYCSKEYYLDRSKVLVRKACILRGSGVQNISNCLESLSEAISLLQGILLDS  589

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRP---HQCHS  198
             +G   +       H +A AYC+ A C  E     K+ +++ R+ + +W +      C  
Sbjct  590  SQGNAIV------IHELAIAYCLHAHCAQEANHGGKVIFDNARSVVGLWSKMGTFDHCSP  643

Query  197  SGQCNMLSGAMLNMLYQIIDLLSIK  123
             G     S  ++ +L  ++DLL++K
Sbjct  644  GGIFQQQSKTLVPLLCSLVDLLAMK  668



>gb|EEE57877.1| hypothetical protein OsJ_08535 [Oryza sativa Japonica Group]
Length=2183

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 75/145 (52%), Gaps = 11/145 (8%)
 Frame = -2

Query  542  KIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAAK  369
            +I +ILL K+Y +++ YL +SR+L+ K   LR  G+     C+  LSEAIS L       
Sbjct  777  RITNILLNKIYCSKEYYLERSRVLVRKARVLRTCGVQSISSCLESLSEAISLLRDIPLDS  836

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVW--MRPHQCHSS  195
             +G        PA H +A AYC+ A C  E    +++ ++  +    +W  ++    +S 
Sbjct  837  SQGNA------PAIHQLAIAYCLHAHCAQEANLGAEVIFDSAQNVFGLWSKIKTFGYYSP  890

Query  194  GQCNML-SGAMLNMLYQIIDLLSIK  123
            G  +   S  ++ +L  ++DLL++K
Sbjct  891  GMISQQPSENLVPLLCSLVDLLAMK  915



>gb|EEC74078.1| hypothetical protein OsI_09098 [Oryza sativa Indica Group]
Length=2183

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 75/145 (52%), Gaps = 11/145 (8%)
 Frame = -2

Query  542  KIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAAK  369
            +I +ILL K+Y +++ YL +SR+L+ K   LR  G+     C+  LSEAIS L       
Sbjct  777  RITNILLNKIYCSKEYYLERSRVLVRKARVLRTCGVQSISSCLESLSEAISLLRDIPLDS  836

Query  368  ERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVW--MRPHQCHSS  195
             +G        PA H +A AYC+ A C  E    +++ ++  +    +W  ++    +S 
Sbjct  837  SQGNA------PAIHQLAIAYCLHAHCAQEANLGAEVIFDSAQNVFGLWSKIKTFGYYSP  890

Query  194  GQCNML-SGAMLNMLYQIIDLLSIK  123
            G  +   S  ++ +L  ++DLL++K
Sbjct  891  GMISQQPSENLVPLLCSLVDLLAMK  915



>gb|AFW64316.1| hypothetical protein ZEAMMB73_008938 [Zea mays]
Length=2092

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 84/177 (47%), Gaps = 41/177 (23%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++II +LL K+Y T++ +L +SR+LI K   LRA G+     C+  L +AIS LE     
Sbjct  708  IRIIDVLLHKIYCTKEHFLERSRVLIRKAGALRASGVENIKNCLESLRDAISLLEDKL--  765

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQC-HSS  195
               GGE +                               ++    AL +W+      HSS
Sbjct  766  ---GGEVI-------------------------------FDSAEKALNLWLDMEAFDHSS  791

Query  194  GQ--CNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLETLLSLL  30
                    S  ++ ++  ++DLLS+KG  +L  ++ ++MI ++K + + +E LLSLL
Sbjct  792  SDMVLQQPSKTIVPLICFLVDLLSMKGCFELQFKLCKVMIMIWKQEKLPIEKLLSLL  848



>ref|XP_001759110.1| predicted protein [Physcomitrella patens]
 gb|EDQ76179.1| predicted protein [Physcomitrella patens]
Length=2426

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 51/188 (27%), Positives = 84/188 (45%), Gaps = 16/188 (9%)
 Frame = -2

Query  527  LLEKVYTTEDDYLPKSRILIAKCEELRAKGLCYECIPCLSEAISTLEKYFAAKERGGEKL  348
            LL+ VY  +D  + + RIL+ K    R KG         SE I+ L K      + G   
Sbjct  778  LLDNVYIVDDFPVERCRILLEKGRLARLKG--NHDFESFSEVIAVLNKTLKDVTKKGIDS  835

Query  347  SCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVW------------MRPH-Q  207
            + +    + +A AYC  A C+ E EP+ +   E I +AL VW            +  H +
Sbjct  836  TQIANVENQLAMAYCAHAFCSYESEPSGQDYLESIFSALSVWEDSARGGRTWIGLDAHGE  895

Query  206  CHSSGQCNMLSGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFKWKDITLET-LLSLL  30
                GQ      ++L +L  + DL+++KG   +   I ++++ L     +  ++ L S L
Sbjct  896  ARILGQTASCGVSLLRLLLSVNDLMALKGYSLIQNRIQQLVVSLLSPVRMDSDSKLFSSL  955

Query  29   WKHRRLGH  6
            W + RL H
Sbjct  956  WANARLSH  963



>ref|XP_002454624.1| hypothetical protein SORBIDRAFT_04g034460 [Sorghum bicolor]
 gb|EES07600.1| hypothetical protein SORBIDRAFT_04g034460 [Sorghum bicolor]
Length=1945

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 79/164 (48%), Gaps = 41/164 (25%)
 Frame = -2

Query  545  VKIISILLEKVYTTEDDYLPKSRILIAKCEELRAKGL--CYECIPCLSEAISTLEKYFAA  372
            ++II +LL K+Y +++ +L +SR+L+ K   LRA G+     C+ CL +AIS LE     
Sbjct  695  IRIIDVLLHKIYCSKEHFLERSRVLVRKAGALRASGVENIKSCLECLHDAISLLE-----  749

Query  371  KERGGEKLSCMDPACHVVAYAYCIRALCTIEIEPNSKLPYEDIRAALRVWMRPHQCHSSG  192
               GGE +                               +++   AL++W++    +   
Sbjct  750  DSAGGEVI-------------------------------FDNAEKALKLWLKMGTFNHYS  778

Query  191  QCNML---SGAMLNMLYQIIDLLSIKGNLDLHAEIFEMMIRLFK  69
               +L   S  ++ ++  ++DLLS+KG  +L  ++ ++MI ++K
Sbjct  779  PDMVLQHPSQTIVPLICFLVDLLSMKGCFELQFKLCKVMIMMWK  822



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 546044595962