BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c38767_g1_i1 len=448 path=[1:0-447]

Length=448
                                                                      Score     E

gb|AAD02550.1|  PGPS/D8                                               69.7    8e-13   Petunia x hybrida [garden petunia]
ref|XP_002320297.1|  hypothetical protein POPTR_0014s11560g           63.9    1e-10   Populus trichocarpa [western balsam poplar]
gb|KHG00470.1|  Cytochrome c oxidase subunit 5C                       60.1    3e-09   
gb|ACG39497.1|  cytochrome c oxidase polypeptide Vc                   60.1    4e-09   Zea mays [maize]
ref|XP_011070033.1|  PREDICTED: cytochrome c oxidase subunit 5C-2...  59.7    5e-09   
gb|EYU35673.1|  hypothetical protein MIMGU_mgv1a017603mg              59.3    5e-09   
ref|XP_004962769.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  59.3    6e-09   
ref|XP_002443358.1|  hypothetical protein SORBIDRAFT_08g018180        58.9    8e-09   Sorghum bicolor [broomcorn]
ref|XP_008660415.1|  PREDICTED: cytochrome c oxidase subunit 5C       59.3    1e-08   
sp|P19173.3|COX5C_IPOBA  RecName: Full=Cytochrome c oxidase subun...  58.5    1e-08   Ipomoea batatas [batate]
ref|XP_009133811.1|  PREDICTED: probable cytochrome c oxidase sub...  58.5    1e-08   
ref|XP_002515282.1|  Cytochrome c oxidase polypeptide Vc, putative    58.2    2e-08   Ricinus communis
ref|XP_011042251.1|  PREDICTED: cytochrome c oxidase subunit 5C       57.4    2e-08   
ref|XP_006574529.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     57.4    3e-08   
gb|ACU15919.1|  unknown                                               57.4    3e-08   Glycine max [soybeans]
ref|XP_002302765.2|  hypothetical protein POPTR_0002s19690g           57.8    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_003579253.1|  PREDICTED: cytochrome c oxidase subunit 5C       57.4    3e-08   
ref|XP_006397931.1|  hypothetical protein EUTSA_v10001714mg           57.4    3e-08   
ref|XP_003570359.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  57.0    3e-08   
ref|NP_001067021.1|  Os12g0561000                                     57.0    4e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20843.1|  hypothetical protein MIMGU_mgv1a017612mg              57.0    4e-08   
ref|XP_006387973.1|  hypothetical protein POPTR_0440s00200g           57.8    5e-08   
gb|KDP28259.1|  hypothetical protein JCGZ_14030                       56.2    6e-08   
sp|Q8VY40.1|CX5C1_HELAN  RecName: Full=Cytochrome c oxidase subun...  56.2    6e-08   Helianthus annuus
gb|AFK48388.1|  unknown                                               56.2    6e-08   
ref|XP_003535930.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     56.2    7e-08   
ref|XP_007051107.1|  Cytochrome c oxidase subunit 5C                  56.2    7e-08   
ref|XP_004495903.1|  PREDICTED: cytochrome c oxidase subunit 5C-2...  56.2    7e-08   
gb|ACG33529.1|  cytochrome c oxidase polypeptide Vc                   55.8    1e-07   Zea mays [maize]
sp|Q8VY39.1|CX5C2_HELAN  RecName: Full=Cytochrome c oxidase subun...  55.8    1e-07   Helianthus annuus
ref|XP_002862722.1|  cytochrome c oxidase subunit VC family protein   55.8    1e-07   
gb|ACG31149.1|  cytochrome c oxidase polypeptide Vc                   55.8    1e-07   Zea mays [maize]
ref|XP_006402379.1|  hypothetical protein EUTSA_v10006359mg           55.8    1e-07   
ref|XP_010521442.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     55.1    2e-07   
ref|XP_003591400.1|  Cytochrome c oxidase subunit 5C                  55.1    2e-07   
ref|XP_009383933.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  54.7    3e-07   
sp|Q9LZQ0.1|CX5C2_ARATH  RecName: Full=Cytochrome c oxidase subun...  54.7    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010261730.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  54.3    3e-07   
gb|KHN30639.1|  Cytochrome c oxidase subunit 5C-2                     54.3    3e-07   
ref|XP_011079230.1|  PREDICTED: probable cytochrome c oxidase sub...  54.3    3e-07   
ref|XP_008781111.1|  PREDICTED: cytochrome c oxidase subunit 5C       53.9    5e-07   
gb|ADB85086.1|  cytochrome c oxidase polypeptide Vc                   53.9    5e-07   
ref|XP_007145147.1|  hypothetical protein PHAVU_007G214100g           53.9    5e-07   
ref|XP_010674655.1|  PREDICTED: cytochrome c oxidase subunit 5C       53.9    5e-07   
ref|XP_008812525.1|  PREDICTED: probable cytochrome c oxidase sub...  53.5    7e-07   
ref|XP_003625971.1|  Cytochrome c oxidase subunit 5C                  53.5    7e-07   
ref|XP_010038288.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     53.1    8e-07   
ref|XP_004300448.1|  PREDICTED: cytochrome c oxidase subunit 5C-2...  53.1    8e-07   
gb|KFK33110.1|  hypothetical protein AALP_AA6G332300                  53.1    8e-07   
ref|XP_004229388.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     53.1    9e-07   
ref|XP_006338585.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  53.1    1e-06   
ref|XP_010273899.1|  PREDICTED: cytochrome c oxidase subunit 5C       52.8    1e-06   
ref|XP_011098444.1|  PREDICTED: cytochrome c oxidase subunit 5C i...  52.4    1e-06   
gb|AES82189.2|  cytochrome C oxidase subunit 5C                       53.5    1e-06   
ref|XP_009382494.1|  PREDICTED: probable cytochrome c oxidase sub...  52.4    2e-06   
ref|XP_011098443.1|  PREDICTED: cytochrome c oxidase subunit 5C i...  52.4    2e-06   
ref|XP_008237260.1|  PREDICTED: cytochrome c oxidase subunit 5C-2...  52.4    2e-06   
ref|XP_009604952.1|  PREDICTED: cytochrome c oxidase subunit 5C-2     52.4    2e-06   
gb|KCW50112.1|  hypothetical protein EUGRSUZ_K03546                   52.8    2e-06   
ref|XP_004232316.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  52.0    2e-06   
ref|XP_010921492.1|  PREDICTED: cytochrome c oxidase subunit 5C i...  52.0    2e-06   
ref|XP_006840451.1|  hypothetical protein AMTR_s00045p00172340        52.4    2e-06   
ref|XP_006577165.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  52.0    3e-06   
ref|XP_006577163.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  52.4    3e-06   
ref|XP_008785010.1|  PREDICTED: putative cytochrome c oxidase sub...  52.0    3e-06   
gb|AGE46018.1|  cytochrome c oxidase subunit 5C                       51.6    3e-06   
ref|XP_009136460.1|  PREDICTED: probable cytochrome c oxidase sub...  51.6    3e-06   
ref|NP_200939.1|  putative cytochrome c oxidase subunit 5C-3          51.6    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006577164.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  51.6    3e-06   
gb|EYU44775.1|  hypothetical protein MIMGU_mgv11b013929mg             52.4    3e-06   
ref|XP_010033301.1|  PREDICTED: putative cytochrome c oxidase sub...  51.6    3e-06   
ref|XP_010435906.1|  PREDICTED: putative cytochrome c oxidase sub...  51.2    4e-06   
ref|XP_008797451.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  51.2    4e-06   
ref|XP_003521595.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  51.6    5e-06   
ref|XP_002524666.1|  Cytochrome c oxidase polypeptide Vc-2, putative  51.2    5e-06   Ricinus communis
ref|XP_002457267.1|  hypothetical protein SORBIDRAFT_03g004470        51.2    5e-06   Sorghum bicolor [broomcorn]
ref|XP_007216586.1|  hypothetical protein PRUPE_ppb018456mg           50.8    5e-06   
ref|XP_010921491.1|  PREDICTED: cytochrome c oxidase subunit 5C i...  51.6    5e-06   
ref|XP_009384427.1|  PREDICTED: cytochrome c oxidase subunit 5C       50.8    6e-06   
ref|XP_010660885.1|  PREDICTED: putative cytochrome c oxidase sub...  50.8    6e-06   
gb|EPS64250.1|  hypothetical protein M569_10536                       50.8    7e-06   
ref|XP_010441174.1|  PREDICTED: putative cytochrome c oxidase sub...  50.8    7e-06   
emb|CDP17068.1|  unnamed protein product                              50.4    7e-06   
ref|XP_009139998.1|  PREDICTED: putative cytochrome c oxidase sub...  50.4    7e-06   
ref|XP_009596475.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  50.4    8e-06   
gb|KCW52911.1|  hypothetical protein EUGRSUZ_J02226                   50.8    9e-06   
ref|XP_010528240.1|  PREDICTED: putative cytochrome c oxidase sub...  50.4    9e-06   
ref|XP_004135996.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  50.1    1e-05   
ref|XP_009411629.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  49.3    2e-05   
ref|XP_010106282.1|  Cytochrome c oxidase subunit 5C-2                49.3    2e-05   
ref|XP_009596474.1|  PREDICTED: cytochrome c oxidase subunit 5C-l...  49.7    2e-05   
ref|XP_002868657.1|  hypothetical protein ARALYDRAFT_493950           48.9    3e-05   
ref|XP_010931748.1|  PREDICTED: cytochrome c oxidase subunit 5C-like  49.3    3e-05   
gb|KDP45317.1|  hypothetical protein JCGZ_09566                       48.5    3e-05   
ref|XP_008235147.1|  PREDICTED: probable cytochrome c oxidase sub...  48.1    5e-05   
ref|XP_009797280.1|  PREDICTED: cytochrome c oxidase subunit 5C       48.1    5e-05   
ref|XP_010088697.1|  Cytochrome c oxidase subunit 5C-2                48.1    5e-05   
emb|CDM81139.1|  unnamed protein product                              48.1    6e-05   
ref|XP_009631036.1|  PREDICTED: cytochrome c oxidase subunit 5C       48.1    6e-05   
ref|XP_006470279.1|  PREDICTED: putative cytochrome c oxidase sub...  48.1    6e-05   
ref|XP_010689705.1|  PREDICTED: putative cytochrome c oxidase sub...  47.8    6e-05   
emb|CDM81135.1|  unnamed protein product                              49.3    8e-05   
ref|XP_006446555.1|  hypothetical protein CICLE_v10017383mg           47.4    9e-05   
ref|XP_007201483.1|  hypothetical protein PRUPE_ppa014546mg           47.4    1e-04   
ref|XP_006492338.1|  PREDICTED: probable cytochrome c oxidase sub...  47.4    1e-04   
ref|XP_008386720.1|  PREDICTED: probable cytochrome c oxidase sub...  47.0    1e-04   
ref|XP_007163179.1|  hypothetical protein PHAVU_001G213100g           47.8    1e-04   
ref|NP_001119340.1|  putative cytochrome c oxidase subunit 5C-4       47.0    1e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDM81134.1|  unnamed protein product                              47.4    2e-04   
gb|EMT09818.1|  Putative cytochrome c oxidase subunit 5C-4            46.2    3e-04   
ref|XP_008369045.1|  PREDICTED: probable cytochrome c oxidase sub...  45.4    5e-04   
ref|XP_002282099.1|  PREDICTED: cytochrome c oxidase subunit 5C       45.1    7e-04   Vitis vinifera
ref|XP_010251362.1|  PREDICTED: putative cytochrome c oxidase sub...  44.7    9e-04   
gb|ABK20891.1|  unknown                                               44.7    0.001   Picea sitchensis



>gb|AAD02550.1| PGPS/D8 [Petunia x hybrida]
Length=63

 Score = 69.7 bits (169),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = -1

Query  364  GRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            GRV H++LG PM  +E+V GF L   A   +K  H D QK+T   YQQLD GE +VVA+D
Sbjct  3    GRVQHIQLGGPMLIKEIVIGFVLAYAAGGAFKMWHWDTQKRTNHFYQQLDRGEATVVAED  62

Query  184  Y  182
            Y
Sbjct  63   Y  63



>ref|XP_002320297.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
 ref|XP_006375433.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
 ref|XP_006375434.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
 gb|ABK92994.1| unknown [Populus trichocarpa]
 gb|ABK94001.1| unknown [Populus trichocarpa]
 gb|ABK94684.1| unknown [Populus trichocarpa]
 gb|ABK95683.1| unknown [Populus trichocarpa]
 gb|ABK96646.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE98612.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
 gb|ERP53230.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
 gb|ERP53231.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa]
Length=63

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H+ L  P   REL  GFALGL A   WK  H + Q+K +S Y  L+ GEISVV
Sbjct  1    MAGGRVAHVTLKGPSVVRELCIGFALGLVAGSLWKMHHWNEQRKVRSFYDLLEKGEISVV  60

Query  193  AQD  185
             ++
Sbjct  61   VEE  63



>gb|KHG00470.1| Cytochrome c oxidase subunit 5C [Gossypium arboreum]
Length=63

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A  RV H  L  P   +E+V G  LGLCA   WK  H + Q+K ++ Y  L+ GEISV+
Sbjct  1    MAGSRVAHATLKGPSVVKEIVIGITLGLCAGGLWKMHHWNEQRKVRAFYDMLEKGEISVI  60

Query  193  AQD  185
            A++
Sbjct  61   AEE  63



>gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays]
Length=77

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H  L  P   +E+  G  LGL A   WK  H + Q+KT+S Y  LD G+ISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVV  60

Query  193  AQD  185
             +D
Sbjct  61   VED  63



>ref|XP_011070033.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum]
 ref|XP_011070034.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum]
 ref|XP_011070035.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum]
Length=63

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -1

Query  364  GRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            GR+PH  L  P   +E++ G  LG+ A   WK  H + Q+K ++ Y  LD GEI+VVA +
Sbjct  3    GRIPHPTLKGPNVVKEIIIGITLGIAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAE  62



>gb|EYU35673.1| hypothetical protein MIMGU_mgv1a017603mg [Erythranthe guttata]
Length=64

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            RV H+ L  P   +EL+ G ALG+ A   WK  H + Q+K +S Y  LD GEI+VVA +
Sbjct  5    RVAHVTLKGPSVVKELLIGIALGVAAGSVWKMHHWNEQRKVRSFYDMLDKGEITVVAAE  63



>ref|XP_004962769.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Setaria italica]
 gb|ACF80884.1| unknown [Zea mays]
 gb|ACF86858.1| unknown [Zea mays]
 gb|ACG24439.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG26171.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG26852.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG30837.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG47360.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 tpg|DAA46995.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays]
 tpg|DAA55250.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays]
Length=63

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H  L  P   +E+  G  LGL A   WK  H + Q+KT+S Y  LD G+ISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVV  60

Query  193  AQD  185
             ++
Sbjct  61   VEE  63



>ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor]
 gb|EES17196.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor]
Length=63

 Score = 58.9 bits (141),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H  L  P   +E+  G  LGL A   WK  H + Q+KT+S Y  LD G+ISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGMTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVV  60

Query  193  AQD  185
             ++
Sbjct  61   VEE  63



>ref|XP_008660415.1| PREDICTED: cytochrome c oxidase subunit 5C [Zea mays]
Length=100

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H  L  P   +E+  G  LGL A   WK  H + Q+KT+S Y  LD G+ISVV
Sbjct  38   MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVV  97

Query  193  AQD  185
             ++
Sbjct  98   VEE  100



>sp|P19173.3|COX5C_IPOBA RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome 
c oxidase polypeptide Vc [Ipomoea batatas]
 emb|CAA37470.1| unnamed protein product [Ipomoea batatas]
 gb|AAB31231.1| cytochrome c oxidase subunit Vc [Ipomoea batatas]
Length=64

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A G V HL    P   +ELV GF+LGL A   WK  H + Q++TK  Y  L+ G+ISVV
Sbjct  1    MAGGHVAHLVYKGPSVVKELVIGFSLGLVAGGFWKMHHWNSQRRTKEFYDMLEKGQISVV  60

Query  193  AQD  185
            A +
Sbjct  61   ADE  63



>ref|XP_009133811.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Brassica 
rapa]
 emb|CDY37800.1| BnaC04g00250D [Brassica napus]
 emb|CDX95722.1| BnaC03g26030D [Brassica napus]
 emb|CDX83330.1| BnaA03g21760D [Brassica napus]
Length=64

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            RV H  L  P   +EL+ G ALGL A   WK  H + Q+KT++ Y  L+ GEISV+A +
Sbjct  5    RVAHATLKGPSVVKELIIGMALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVIAAE  63



>ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis]
 ref|XP_002520707.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis]
 gb|EEF41669.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis]
 gb|EEF47266.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis]
Length=63

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GR+ H  L  P   +E+  G ALGL A   WK  H + Q+K ++ Y  L+ GEISVV
Sbjct  1    MAGGRIAHATLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVV  60

Query  193  AQD  185
            A++
Sbjct  61   AEE  63



>ref|XP_011042251.1| PREDICTED: cytochrome c oxidase subunit 5C [Populus euphratica]
 ref|XP_011042252.1| PREDICTED: cytochrome c oxidase subunit 5C [Populus euphratica]
 ref|XP_011042253.1| PREDICTED: cytochrome c oxidase subunit 5C [Populus euphratica]
Length=63

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H+ L  P   +E+  G ALGL A   WK  H + Q+K +S Y  L+ GEI VV
Sbjct  1    MAGGRVAHVTLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRSFYDLLEKGEIGVV  60

Query  193  AQD  185
             ++
Sbjct  61   VEE  63



>ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max]
 gb|KHN08636.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja]
Length=64

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E++ G  LGL A   WK  H + Q+KT++ Y  L+ GEISVVA++
Sbjct  5    RIAHATLKGPSVVKEIIIGITLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVVAEE  63



>gb|ACU15919.1| unknown [Glycine max]
Length=64

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E++ G  LGL A   WK  H + Q+KT++ Y  L+ GEISVVA++
Sbjct  5    RIAHATLRGPSVVKEIIIGITLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVVAEE  63



>ref|XP_002302765.2| hypothetical protein POPTR_0002s19690g [Populus trichocarpa]
 gb|EEE82038.2| hypothetical protein POPTR_0002s19690g [Populus trichocarpa]
Length=73

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = -1

Query  376  SVAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISV  197
             +A GRV H+ L  P   +E+  G ALGL A   WK  H + Q+K +S Y  L+ GEI V
Sbjct  10   EMAGGRVAHVTLKGPSVVKEICIGIALGLAAGSLWKMHHWNEQRKVRSFYDLLEKGEIGV  69

Query  196  VAQD  185
            V ++
Sbjct  70   VVEE  73



>ref|XP_003579253.1| PREDICTED: cytochrome c oxidase subunit 5C [Brachypodium distachyon]
 sp|Q42841.3|COX5C_HORVU RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome 
c oxidase polypeptide Vc [Hordeum vulgare]
 emb|CAA92107.1| cytochrome c oxidase, Vc subunit [Hordeum vulgare subsp. vulgare]
 gb|EMS48910.1| Cytochrome c oxidase subunit 5C [Triticum urartu]
 gb|EMT13154.1| Cytochrome c oxidase subunit 5C [Aegilops tauschii]
Length=63

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H  L  P   +E+  G  LGL A   WK  H + Q+KT+S Y  L+ G+ISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLVAGGMWKMHHWNEQRKTRSFYDMLEKGQISVV  60

Query  193  AQD  185
             ++
Sbjct  61   VEE  63



>ref|XP_006397931.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
 ref|XP_006397932.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
 ref|XP_006397933.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
 gb|ESQ39384.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
 gb|ESQ39385.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
 gb|ESQ39386.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum]
Length=64

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            +V H  L  P   +EL+ G ALGL A   WK  H + Q+KT++ Y  L+ GEISVVA +
Sbjct  5    KVAHATLKGPSVVKELIIGMALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVVAAE  63



>ref|XP_003570359.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium 
distachyon]
 ref|XP_010235932.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium 
distachyon]
Length=63

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H  L  P   +E+  G  LGL A   WK  H + Q+KT+S Y  L+ G+ISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLVAGGMWKMHHWNEQRKTRSFYDMLEKGQISVV  60

Query  193  AQD  185
             ++
Sbjct  61   VKE  63



>ref|NP_001067021.1| Os12g0561000 [Oryza sativa Japonica Group]
 sp|Q9SXX7.3|COX5C_ORYSJ RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome 
c oxidase polypeptide Vc [Oryza sativa Japonica Group]
 dbj|BAA77682.1| cytochrome c oxidase subunit 5c [Oryza sativa Japonica Group]
 dbj|BAF30040.1| Os12g0561000 [Oryza sativa Japonica Group]
 gb|EAZ20870.1| hypothetical protein OsJ_36508 [Oryza sativa Japonica Group]
Length=63

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GR+ H  L  P   +E+  G  LGL A   WK  H + Q+KT+S Y  L+ G+ISVV
Sbjct  1    MAGGRIAHATLKGPSVVKEICIGLTLGLVAGGLWKMHHWNEQRKTRSFYDMLEKGQISVV  60

Query  193  AQD  185
             ++
Sbjct  61   VEE  63



>gb|EYU20843.1| hypothetical protein MIMGU_mgv1a017612mg [Erythranthe guttata]
Length=64

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A  RV H  L  P   +E++ G ALG  A   WK  H + Q+K +S Y  LD GEI+VV
Sbjct  1    MAGSRVAHATLKGPSVVKEILIGIALGFAAGSVWKMHHWNEQRKVRSFYDMLDKGEITVV  60

Query  193  AQD  185
            A +
Sbjct  61   AAE  63



>ref|XP_006387973.1| hypothetical protein POPTR_0440s00200g, partial [Populus trichocarpa]
 gb|ERP46887.1| hypothetical protein POPTR_0440s00200g, partial [Populus trichocarpa]
Length=111

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H+ L  P   +E+  G ALGL A   WK  H + Q+K +S Y  L+ GEI VV
Sbjct  49   MAGGRVAHVTLKGPSVVKEICIGIALGLAAGSLWKMHHWNEQRKVRSFYDLLEKGEIGVV  108

Query  193  AQD  185
             ++
Sbjct  109  VKE  111



>gb|KDP28259.1| hypothetical protein JCGZ_14030 [Jatropha curcas]
Length=63

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GR+ H  L  P   +E+  G ALGL A   WK  H + Q+K ++ Y  L+ GEISVV
Sbjct  1    MAGGRIAHATLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVV  60

Query  193  AQD  185
             ++
Sbjct  61   VEE  63



>sp|Q8VY40.1|CX5C1_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-1; AltName: Full=Cytochrome 
c oxidase polypeptide Vc-1 [Helianthus annuus]
 gb|AAL67938.1| cytochrome c oxidase subunit 5c [Helianthus annuus]
Length=63

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -1

Query  364  GRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            GRV H  L  P   +EL+ G  LGL A   WK  H + Q+KT++ Y  L+ GEISVV Q+
Sbjct  4    GRVAHPVLKGPSEVKELIIGSVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVVVQE  63



>gb|AFK48388.1| unknown [Lotus japonicus]
Length=64

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E+V G  LGL A   WK  H + Q+KT++ Y  L+ GEI VVA++
Sbjct  5    RIAHATLKGPSVVKEIVIGMVLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEIGVVAEE  63



>ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max]
Length=64

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E++ G  LGL A   WK  H + Q+KT++ Y  L+ GEI+VVA++
Sbjct  5    RIAHATLKGPSVVKEIIIGITLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVVAEE  63



>ref|XP_007051107.1| Cytochrome c oxidase subunit 5C [Theobroma cacao]
 gb|EOX95264.1| Cytochrome c oxidase subunit 5C [Theobroma cacao]
Length=63

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E++ G  LG CA   WK  H + Q+K ++ Y  L+ G+ISVVA++
Sbjct  5    RIAHATLKGPSVVKEIIIGITLGFCAGGLWKMHHWNEQRKVRAFYDMLEKGDISVVAEE  63



>ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Cicer arietinum]
Length=64

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E++ G  LG+ A   WK  H + Q+KT++ Y  L+ GEISV+A++
Sbjct  5    RIAHATLKGPSVVKEIIIGITLGIAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVIAEE  63



>gb|ACG33529.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG34917.1| cytochrome c oxidase polypeptide Vc [Zea mays]
 gb|ACG35185.1| cytochrome c oxidase polypeptide Vc [Zea mays]
Length=62

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H  L  P   +E+  G  LGL A   WK  H + Q+KT+S Y  LD G+I VV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQIVVV  60

Query  193  AQ  188
             +
Sbjct  61   EE  62



>sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome 
c oxidase polypeptide Vc-2 [Helianthus annuus]
 gb|AAL67939.1| cytochrome c oxidase subunit 5c [Helianthus annuus]
Length=64

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -1

Query  364  GRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            GRV H  L  P   +ELV G  LGL A   WK  H + Q+KT++ Y  L+ GEISVV  +
Sbjct  4    GRVAHPVLKGPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVVVDE  63



>ref|XP_002862722.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata 
subsp. lyrata]
 ref|XP_002876673.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH38980.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52932.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=64

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            +V H  L  P   +EL+ G  LGL A   WK  H + Q+KT++ Y  L+ GEISVVA +
Sbjct  5    KVAHATLKGPSVVKELIIGLTLGLAAGGLWKMHHWNEQRKTRTFYDLLERGEISVVAAE  63



>gb|ACG31149.1| cytochrome c oxidase polypeptide Vc [Zea mays]
Length=63

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H  L  P   +E+  G  LGL A   WK    + Q+KT+S Y  LD G+ISVV
Sbjct  1    MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHXWNEQRKTRSFYDMLDKGQISVV  60

Query  193  AQD  185
             ++
Sbjct  61   VEE  63



>ref|XP_006402379.1| hypothetical protein EUTSA_v10006359mg [Eutrema salsugineum]
 gb|ESQ43832.1| hypothetical protein EUTSA_v10006359mg [Eutrema salsugineum]
Length=64

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            +V H  L  P   +EL+ G  LGL A   WK  H + Q+KT++ Y  L+ GEISVVA +
Sbjct  5    KVAHATLKGPSVVKELIIGLTLGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVVAAE  63



>ref|XP_010521442.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Tarenaya hassleriana]
Length=66

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVA  191
            ++ H  L  P   +E+V G  LGL A   WK  H + Q+KTK+ Y  L+ GEISVVA
Sbjct  5    KIAHATLKGPSVVKEIVIGITLGLAAGGLWKMHHWNEQRKTKAFYDLLEKGEISVVA  61



>ref|XP_003591400.1| Cytochrome c oxidase subunit 5C [Medicago truncatula]
 gb|AES61651.1| cytochrome C oxidase subunit 5C [Medicago truncatula]
Length=64

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E++ G  LGL A   WK  H + Q+KT++ Y  L+ GEISVV  +
Sbjct  5    RIAHATLKGPSVVKEIIIGITLGLVAGGVWKMHHWNEQRKTRTFYDLLEKGEISVVVDE  63



>ref|XP_009383933.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383934.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Musa acuminata 
subsp. malaccensis]
Length=64

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+V G ALGL A   WK  H + Q++T++ Y  L+ GEISVV ++
Sbjct  5    KIAHTTLKGPSVIKEIVIGLALGLFAGGLWKMHHWNEQRRTRAFYDMLEKGEISVVVEE  63



>sp|Q9LZQ0.1|CX5C2_ARATH RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome 
c oxidase polypeptide Vc-2 [Arabidopsis thaliana]
 emb|CAB82954.1| cytochrome c oxidase subunit 5c-like protein [Arabidopsis thaliana]
Length=64

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            +V H  L  P   +EL+ G  LGL A   WK  H + Q+KT++ Y  L+ GEI VVA +
Sbjct  5    KVAHATLKGPSVVKELIIGLTLGLAAGGLWKMHHWNEQRKTRTFYDLLERGEIGVVASE  63



>ref|XP_010261730.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Nelumbo nucifera]
Length=63

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LGL A   WK  H + Q+K ++ Y  LD GEISVVA++
Sbjct  5    KIAHATLKGPSVVKEICIGITLGLLAGGMWKMHHWNEQRKVRAFYDMLDKGEISVVAEE  63



>gb|KHN30639.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja]
Length=64

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   ++++ G  LGL A   WK  H + Q+KT++ Y  L+ GEI+VVA++
Sbjct  5    RIVHATLKGPSVVKDIIIGITLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVVAEE  63



>ref|XP_011079230.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Sesamum 
indicum]
Length=64

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E+  G  LG+ A   WK  H + Q+K ++ Y  LD GEISVVA +
Sbjct  5    RIAHATLKGPSVVKEIAIGIVLGIAAGSVWKMHHWNEQRKVRAFYDLLDKGEISVVAAE  63



>ref|XP_008781111.1| PREDICTED: cytochrome c oxidase subunit 5C [Phoenix dactylifera]
Length=63

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G ALGL A   WK  H + Q+KT++ Y  L+ GEISVV ++
Sbjct  5    KIAHATLKGPNVVKEICIGLALGLFAGSLWKMHHWNEQRKTRTFYDMLEKGEISVVVEE  63



>gb|ADB85086.1| cytochrome c oxidase polypeptide Vc [Jatropha curcas]
 gb|KDP21540.1| hypothetical protein JCGZ_22011 [Jatropha curcas]
Length=63

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A G++ H  L  P   +E+  G ALGL A   WK  H + Q+K ++ Y  L+ GEISVV
Sbjct  1    MAGGKIAHATLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVV  60

Query  193  AQD  185
              +
Sbjct  61   VDE  63



>ref|XP_007145147.1| hypothetical protein PHAVU_007G214100g [Phaseolus vulgaris]
 gb|ESW17141.1| hypothetical protein PHAVU_007G214100g [Phaseolus vulgaris]
Length=64

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GR+ H  L  P   +E++ G  LGL A   WK  H + Q+K ++ Y  L+ GEI VV
Sbjct  1    MAGGRIAHATLKGPSVVKEIIIGTVLGLAAGSVWKMHHWNEQRKVRTFYDLLEKGEIGVV  60

Query  193  AQD  185
             ++
Sbjct  61   LEE  63



>ref|XP_010674655.1| PREDICTED: cytochrome c oxidase subunit 5C [Beta vulgaris subsp. 
vulgaris]
Length=63

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A  +V H  L  P   +E+  GF LGL A   WK  H + Q+K +S Y  L+ G+ISVV
Sbjct  1    MAGSKVAHAALKGPSVVKEIFIGFGLGLAAGTLWKMHHWNEQRKVRSFYDMLEKGQISVV  60

Query  193  AQD  185
             ++
Sbjct  61   VEE  63



>ref|XP_008812525.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Phoenix 
dactylifera]
Length=64

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LG+ A   WK  H + QKKT++ Y  L+ GEISV+A +
Sbjct  5    KIAHATLKGPNVVKEICIGITLGILAGSVWKMHHWNEQKKTRAFYDMLEKGEISVIAAE  63



>ref|XP_003625971.1| Cytochrome c oxidase subunit 5C [Medicago truncatula]
 gb|AFK47757.1| unknown [Medicago truncatula]
Length=64

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E+  G  LGL A   WK  H + Q+KT++ +  L+ GEISV+A++
Sbjct  5    RIAHATLKGPSVVKEICIGIVLGLAAGSVWKMHHWNEQRKTRTFHDLLEKGEISVIAEE  63



>ref|XP_010038288.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Eucalyptus grandis]
Length=63

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E++ G  LGL A   WK  H + Q+K ++ Y  L+ GEISVVA++
Sbjct  5    KIAHATLKGPSVVKEILIGITLGLAAGGVWKMHHWNEQRKVRAFYDLLEKGEISVVAEE  63



>ref|XP_004300448.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Fragaria vesca 
subsp. vesca]
Length=63

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            +V H  L  P   +E++ G  LGL A   WK  H + Q+K ++ Y  L+ GEISVVA++
Sbjct  5    KVAHATLKGPSVVKEIIIGAVLGLAAGGLWKMHHWNEQRKVRTFYDLLEKGEISVVAEE  63



>gb|KFK33110.1| hypothetical protein AALP_AA6G332300 [Arabis alpina]
Length=65

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P   +E++ G ALGL A   WK  H + Q++T+  Y  L+ GEISVVA+D
Sbjct  14   GPSIVKEIIYGIALGLAAGGLWKMHHWNNQRRTREFYDLLEKGEISVVAED  64



>ref|XP_004229388.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Solanum lycopersicum]
 ref|XP_006349185.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Solanum tuberosum]
Length=63

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E+V    LGL A   WK  H + Q+K +S Y  L+ GEIS+VA++
Sbjct  5    RIAHATLKGPSVVKEIVIASVLGLAAGSLWKMHHWNEQRKVRSFYDLLEKGEISIVAEE  63



>ref|XP_006338585.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006338586.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X2 [Solanum 
tuberosum]
Length=64

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = -1

Query  358  VPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            + H     P   +E+V G ALG+ A   WK  H + Q++TK  Y  LD  EISVV  D
Sbjct  6    IAHAAYKGPSVVKEIVIGIALGIVAGGLWKMHHWNNQRRTKEFYDLLDKNEISVVVND  63



>ref|XP_010273899.1| PREDICTED: cytochrome c oxidase subunit 5C [Nelumbo nucifera]
 ref|XP_010273900.1| PREDICTED: cytochrome c oxidase subunit 5C [Nelumbo nucifera]
Length=63

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LGL A   WK  H + Q+K ++ Y  L+ GEISVVA++
Sbjct  5    KIAHATLKGPSVVKEICIGITLGLLAGGMWKMHHWNEQRKVRAFYDMLEKGEISVVAEE  63



>ref|XP_011098444.1| PREDICTED: cytochrome c oxidase subunit 5C isoform X2 [Sesamum 
indicum]
Length=61

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = -1

Query  352  HLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            H+    P   +E++ G  LGL A   WK  H + QK+TK  Y  LD GEISVV +D
Sbjct  5    HVVYKGPSVLKEILIGIGLGLVAGGFWKMHHWNNQKRTKEFYDLLDKGEISVVRED  60



>gb|AES82189.2| cytochrome C oxidase subunit 5C [Medicago truncatula]
Length=117

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E+  G  LGL A   WK  H + Q+KT++ +  L+ GEISV+A++
Sbjct  58   RIAHATLKGPSVVKEICIGIVLGLAAGSVWKMHHWNEQRKTRTFHDLLEKGEISVIAEE  116



>ref|XP_009382494.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Musa acuminata 
subsp. malaccensis]
Length=64

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LGL A   WK  H + Q+KT++ Y  L+ GEISVVA +
Sbjct  5    KIAHATLKGPSVIKEICIGLTLGLFAGGLWKMHHWNEQRKTRAFYDMLEKGEISVVAAE  63



>ref|XP_011098443.1| PREDICTED: cytochrome c oxidase subunit 5C isoform X1 [Sesamum 
indicum]
Length=67

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = -1

Query  352  HLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            H+    P   +E++ G  LGL A   WK  H + QK+TK  Y  LD GEISVV +D
Sbjct  11   HVVYKGPSVLKEILIGIGLGLVAGGFWKMHHWNNQKRTKEFYDLLDKGEISVVRED  66



>ref|XP_008237260.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Prunus mume]
Length=62

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -1

Query  364  GRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            GRV H  L  P   RE+  G  +   A   WK  H D+QKKT+S Y+ L+  E+SVV  +
Sbjct  3    GRVAHPTLKGPSVIREMCFGLVIAFAAGSFWKMYHWDLQKKTRSFYELLEKDEVSVVPDE  62



>ref|XP_009604952.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Nicotiana tomentosiformis]
 ref|XP_009774668.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Nicotiana sylvestris]
Length=63

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E+V    LGL A   WK  H + Q+K +S Y  L+ GEIS+VA++
Sbjct  5    RIAHATLKGPSVVKEIVIATVLGLAAGSLWKMHHWNEQRKVRSFYDLLEKGEISLVAEE  63



>gb|KCW50112.1| hypothetical protein EUGRSUZ_K03546, partial [Eucalyptus grandis]
Length=93

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E++ G  LGL A   WK  H + Q+K ++ Y  L+ GEISVVA++
Sbjct  35   KIAHATLKGPSVVKEILIGITLGLAAGGVWKMHHWNEQRKVRAFYDLLEKGEISVVAEE  93



>ref|XP_004232316.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Solanum lycopersicum]
 ref|XP_010316294.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Solanum lycopersicum]
Length=64

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -1

Query  358  VPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            + H     P   +E++ G ALG+ A   WKK H + Q++TK  Y  L+  EISVV  D
Sbjct  6    IAHAAYKGPSVVKEIMIGIALGMVAGGLWKKHHWNNQRRTKEFYDLLEKNEISVVVND  63



>ref|XP_010921492.1| PREDICTED: cytochrome c oxidase subunit 5C isoform X2 [Elaeis 
guineensis]
Length=63

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LGL A   WK  H + Q+KT++ Y  L+ GEISVV ++
Sbjct  5    KIAHATLRGPSVVKEICIGITLGLFAGSLWKMHHWNEQRKTRAFYDMLEKGEISVVVEE  63



>ref|XP_006840451.1| hypothetical protein AMTR_s00045p00172340 [Amborella trichopoda]
 gb|ERN02126.1| hypothetical protein AMTR_s00045p00172340 [Amborella trichopoda]
Length=99

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 37/71 (52%), Gaps = 0/71 (0%)
 Frame = -1

Query  397  PHYHHSFSVAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQL  218
            P      ++A  R+ H+    P   +E+  G  LGL A   WK  H + Q+KTK+ Y  L
Sbjct  28   PDAKKEEAMAAHRIAHVAYTGPSIIKEIFYGMTLGLLAGGVWKTHHWNEQRKTKAFYDLL  87

Query  217  DTGEISVVAQD  185
            + GEISVV  +
Sbjct  88   EKGEISVVVAE  98



>ref|XP_006577165.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X4 [Glycine 
max]
 ref|XP_006577166.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X5 [Glycine 
max]
Length=64

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E+  G  LGL A   WK  H + Q+KT++ Y  L+  EISVVA +
Sbjct  5    RIAHATLKGPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISVVADE  63



>ref|XP_006577163.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X2 [Glycine 
max]
Length=95

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 45/93 (48%), Gaps = 5/93 (5%)
 Frame = -1

Query  448  IHTLSLTASSLSFHLPFPHYHHSFSVAMG-----RVPHLELGSPMFYRELVAGFALGLCA  284
            I  L LT +++ +         S S ++      R+ H  L  P   +E+  G  LGL A
Sbjct  2    ICCLLLTPNTIEYRPIVAKKRSSASTSVKQMAGPRIAHATLKGPSVVKEICIGMVLGLAA  61

Query  283  AFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
               WK  H + Q+KT++ Y  L+  EISVVA +
Sbjct  62   GSVWKMHHWNEQRKTRAFYDLLEKDEISVVADE  94



>ref|XP_008785010.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Phoenix 
dactylifera]
Length=67

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            SP   +E++ G +LGL A F WK  H   Q++T+  Y  LD GEISVV  +
Sbjct  17   SPSVIKEMIYGISLGLAAGFFWKMYHWSSQRRTREFYDLLDKGEISVVVDE  67



>gb|AGE46018.1| cytochrome c oxidase subunit 5C [Elaeis guineensis]
Length=63

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LGL A   WK  H + Q+KT++ Y  L+ GEISVV ++
Sbjct  5    KIAHATLRGPSVVKEIFIGITLGLFAGSLWKMHHWNEQRKTRAFYDMLEKGEISVVVEE  63



>ref|XP_009136460.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Brassica 
rapa]
Length=63

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +EL+ G ALG+ A   WK  H + Q+KT++ Y  L+  EISVV  +
Sbjct  5    KIAHATLKGPSVVKELIIGLALGIAAGGMWKMHHWNEQRKTRAFYDLLEKDEISVVVAE  63



>ref|NP_200939.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 ref|NP_851239.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 ref|NP_001032118.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 ref|NP_001119471.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 sp|Q9FLK2.1|CX5C3_ARATH RecName: Full=Probable cytochrome c oxidase subunit 5C-3; AltName: 
Full=Cytochrome c oxidase polypeptide Vc-3 [Arabidopsis 
thaliana]
 dbj|BAB08486.1| cytochrome c oxidase Vc subunit-like protein [Arabidopsis thaliana]
 gb|AAM65881.1| cytochrome c oxidase subunit-like [Arabidopsis thaliana]
 gb|ABD38860.1| At5g61310 [Arabidopsis thaliana]
 gb|AED97450.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 gb|AED97451.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 gb|AED97452.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
 gb|AED97453.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana]
Length=64

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +ELV G  LGL A   WK  H + Q+KT+  Y  L+ GEI VV  +
Sbjct  5    KIAHATLKGPSVVKELVIGLTLGLAAGGLWKMHHWNEQRKTRVFYDLLERGEIGVVVTE  63



>ref|XP_006577164.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X3 [Glycine 
max]
Length=68

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E+  G  LGL A   WK  H + Q+KT++ Y  L+  EISVVA +
Sbjct  9    RIAHATLKGPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISVVADE  67



>gb|EYU44775.1| hypothetical protein MIMGU_mgv11b013929mg [Erythranthe guttata]
Length=113

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = -1

Query  367  MGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQ  188
            MG V H+    P   +E++ G  LGL A   WK+ H + Q++TK  Y  LD GEI+VV +
Sbjct  53   MGGV-HVVYKGPSVVKEILIGIGLGLVAGGFWKRHHWNNQRRTKEFYDLLDKGEITVVRE  111

Query  187  D  185
            D
Sbjct  112  D  112



>ref|XP_010033301.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Eucalyptus 
grandis]
Length=65

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P   +E+V G  LG+ A   WK  H + Q++TK  Y  L+ GEISVV +D
Sbjct  14   GPSVVKEIVYGITLGISAGLLWKMHHWNYQRRTKEFYDLLERGEISVVVED  64



>ref|XP_010435906.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
 ref|XP_010435907.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
Length=65

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P   +E+V G ALG+     WK  H + Q++TK  Y  L+ GEISVVA+D
Sbjct  14   GPSIVKEIVYGIALGIAVGGLWKMHHWNNQRQTKEFYDLLEKGEISVVAED  64



>ref|XP_008797451.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Phoenix dactylifera]
Length=64

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LG+ A   WK  H + Q+KT++ Y  L+ G+ISVVA +
Sbjct  5    KIAHATLKGPNVVKEICIGITLGILAGSMWKMHHWNEQRKTRAFYDMLEKGQISVVAAE  63



>ref|XP_003521595.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X1 [Glycine 
max]
 gb|KHN19213.1| Cytochrome c oxidase subunit 5C [Glycine soja]
Length=103

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            R+ H  L  P   +E+  G  LGL A   WK  H + Q+KT++ Y  L+  EISVVA +
Sbjct  44   RIAHATLKGPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISVVADE  102



>ref|XP_002524666.1| Cytochrome c oxidase polypeptide Vc-2, putative [Ricinus communis]
 gb|EEF37685.1| Cytochrome c oxidase polypeptide Vc-2, putative [Ricinus communis]
Length=65

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P   +E++ G +LGL A   WK  H + QK+ K  Y  L+ GEISVV +D
Sbjct  14   GPSIIKEIIYGISLGLGAGLLWKMHHWNNQKRAKEFYDLLERGEISVVVED  64



>ref|XP_002457267.1| hypothetical protein SORBIDRAFT_03g004470 [Sorghum bicolor]
 gb|EES02387.1| hypothetical protein SORBIDRAFT_03g004470 [Sorghum bicolor]
Length=81

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  334  PMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            P   RE+V G +LGL A + WK  H   Q++T+  Y  LD G+I+VVA D
Sbjct  25   PSVLREIVYGMSLGLFAGYLWKLHHWSNQRRTREFYSLLDQGKITVVAGD  74



>ref|XP_007216586.1| hypothetical protein PRUPE_ppb018456mg, partial [Prunus persica]
 gb|EMJ17785.1| hypothetical protein PRUPE_ppb018456mg, partial [Prunus persica]
Length=68

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -1

Query  322  RELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            +E++ G  +GL   F WK  H ++Q++TK  Y+ LD GEIS V +D
Sbjct  22   KEIIYGATIGLSVGFLWKMYHWNLQRRTKEFYELLDRGEISTVVED  67



>ref|XP_010921491.1| PREDICTED: cytochrome c oxidase subunit 5C isoform X1 [Elaeis 
guineensis]
Length=106

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LGL A   WK  H + Q+KT++ Y  L+ GEISVV ++
Sbjct  48   KIAHATLRGPSVVKEICIGITLGLFAGSLWKMHHWNEQRKTRAFYDMLEKGEISVVVEE  106



>ref|XP_009384427.1| PREDICTED: cytochrome c oxidase subunit 5C [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384428.1| PREDICTED: cytochrome c oxidase subunit 5C [Musa acuminata subsp. 
malaccensis]
Length=64

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LGL A   WK  H + Q+KT++ Y  L+ GEISVV  +
Sbjct  5    KIAHATLKGPSVVKEICIGLTLGLFAGGLWKMHHWNEQRKTRAFYDMLEKGEISVVVAE  63



>ref|XP_010660885.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Vitis 
vinifera]
 emb|CBI34888.3| unnamed protein product [Vitis vinifera]
Length=65

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P  ++E++ G   GL A   WK+ H ++Q++ K  Y  L+ GEISVV +D
Sbjct  14   GPSIFKEIMYGLTAGLIAGGLWKRYHWNLQRRNKEFYDMLERGEISVVVED  64



>gb|EPS64250.1| hypothetical protein M569_10536, partial [Genlisea aurea]
Length=70

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            RV H  L  P   +E++ G +LGL A   WK  H + Q+KT+  Y   + GE+SVV ++
Sbjct  12   RVVHATLKGPSVVKEILIGASLGLAAGSVWKMFHWNQQRKTREFYDLYNKGEVSVVVEE  70



>ref|XP_010441174.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
 ref|XP_010441175.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
 ref|XP_010441176.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
 ref|XP_010450674.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Camelina 
sativa]
Length=65

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P   +E++ G ALG+     WK  H + Q++TK  Y  L+ GEISVVA+D
Sbjct  14   GPSIVKEILYGIALGIAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVAED  64



>emb|CDP17068.1| unnamed protein product [Coffea canephora]
Length=63

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            +V H  L  P   +EL+ G   GL A   WK  H + Q+K ++ Y  L+ G+ISVVA++
Sbjct  5    KVAHATLTGPSVVKELIFGAVFGLAAGTLWKMHHWNEQRKVRAFYDLLEKGDISVVAEE  63



>ref|XP_009139998.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Brassica 
rapa]
 ref|XP_009139999.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Brassica 
rapa]
 emb|CDY42588.1| BnaA04g10250D [Brassica napus]
 emb|CDY36854.1| BnaC04g32470D [Brassica napus]
Length=65

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P   +E++ G ALGL A   WK  H + Q++T+  Y  L+ GEISVV  D
Sbjct  14   GPSIVKEIIYGIALGLAAGGLWKMHHWNNQRRTREFYDLLEKGEISVVVAD  64



>ref|XP_009596475.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X2 [Nicotiana 
tomentosiformis]
Length=64

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -1

Query  358  VPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            + H     P   +E++ G ALG+ A   WK  H + Q++TK  Y  L+ GEISVV  +
Sbjct  6    IAHAAYKGPSVVKEILIGIALGIAAGGLWKMHHWNNQRRTKEFYDMLEKGEISVVVDE  63



>gb|KCW52911.1| hypothetical protein EUGRSUZ_J02226, partial [Eucalyptus grandis]
Length=97

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P   +E+V G  LG+ A   WK  H + Q++TK  Y  L+ GEISVV +D
Sbjct  46   GPSVVKEIVYGITLGISAGLLWKMHHWNYQRRTKEFYDLLERGEISVVVED  96



>ref|XP_010528240.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Tarenaya 
hassleriana]
 ref|XP_010528241.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Tarenaya 
hassleriana]
Length=66

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = -1

Query  367  MGRVPHLELGS---PMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISV  197
            M RVP +   +   P   +E++ G +LGL A   WK  H + Q++TK  Y+ L+ GEISV
Sbjct  1    MARVPKIAKAANKGPSVVKEIIYGISLGLIAGGLWKMYHWNSQRQTKEFYELLEKGEISV  60

Query  196  VAQD  185
            V  +
Sbjct  61   VVDE  64



>ref|XP_004135996.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform 1 [Cucumis 
sativus]
 ref|XP_004135997.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform 2 [Cucumis 
sativus]
 ref|XP_008451480.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Cucumis melo]
 gb|KGN45016.1| hypothetical protein Csa_7G407690 [Cucumis sativus]
Length=64

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = -1

Query  373  VAMGRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +A GRV H+ L  P   +E++ G  L L A   WK    + Q+K ++ Y  L+ GEISVV
Sbjct  1    MAAGRVAHVTLQGPSVVKEILTGMGLALFAGSFWKMHQWNEQRKVRAFYDLLEKGEISVV  60

Query  193  AQD  185
              +
Sbjct  61   VDE  63



>ref|XP_009411629.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Musa acuminata 
subsp. malaccensis]
Length=64

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LGL A   WK  H + Q++T++ Y  L+ GEISVV  +
Sbjct  5    KIAHATLKGPSVVKEICIGLTLGLFAGGLWKMYHWNEQRRTRAFYDMLEKGEISVVVAE  63



>ref|XP_010106282.1| Cytochrome c oxidase subunit 5C-2 [Morus notabilis]
 gb|EXC09699.1| Cytochrome c oxidase subunit 5C-2 [Morus notabilis]
Length=63

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            +V H  L  P   +EL+ G  L L A   WK  H + Q+K ++ Y  LD GEI VV ++
Sbjct  5    KVAHATLKGPSVVKELLIGSVLALAAGSLWKMHHWNEQRKVRTFYDLLDKGEIGVVVEE  63



>ref|XP_009596474.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X1 [Nicotiana 
tomentosiformis]
Length=92

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -1

Query  358  VPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            + H     P   +E++ G ALG+ A   WK  H + Q++TK  Y  L+ GEISVV  +
Sbjct  34   IAHAAYKGPSVVKEILIGIALGIAAGGLWKMHHWNNQRRTKEFYDMLEKGEISVVVDE  91



>ref|XP_002868657.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44916.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. 
lyrata]
Length=65

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P   +E++ G  LGL     WK  H + Q++TK  Y  L+ GEISVV +D
Sbjct  14   GPSVVKEIIYGITLGLAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVVED  64



>ref|XP_010931748.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Elaeis guineensis]
Length=106

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LG+ A   WK  H + Q+KT++ Y  L+ G ISVVA +
Sbjct  47   KIAHATLKGPNVVKEICIGITLGIFAGSMWKMHHWNEQRKTRAFYDMLEKGHISVVAAE  105



>gb|KDP45317.1| hypothetical protein JCGZ_09566 [Jatropha curcas]
Length=65

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P   +E+V G +LGL A   WK  H + Q++TK  Y  L+  EI+VV +D
Sbjct  14   GPSVLKEIVYGISLGLAAGLLWKMHHWNNQRRTKEFYDLLEKDEITVVVED  64



>ref|XP_008235147.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Prunus 
mume]
Length=63

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  L L A   WK  H + Q+K +  Y  L+ GEISVVA++
Sbjct  5    KIAHATLKGPSVVKEICYGMVLALAAGSLWKMHHWNEQRKVRVFYDLLEKGEISVVAEE  63



>ref|XP_009797280.1| PREDICTED: cytochrome c oxidase subunit 5C [Nicotiana sylvestris]
 ref|XP_009797281.1| PREDICTED: cytochrome c oxidase subunit 5C [Nicotiana sylvestris]
 ref|XP_009797282.1| PREDICTED: cytochrome c oxidase subunit 5C [Nicotiana sylvestris]
Length=64

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = -1

Query  358  VPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            V H     P   +E++ G  LG+ A   WK  H + Q++TK  Y  L+ GEISVV  +
Sbjct  6    VAHAVYKGPSVVKEILIGITLGMVAGGFWKIHHWNNQRRTKEFYDMLEKGEISVVVNE  63



>ref|XP_010088697.1| Cytochrome c oxidase subunit 5C-2 [Morus notabilis]
 gb|EXB36878.1| Cytochrome c oxidase subunit 5C-2 [Morus notabilis]
Length=71

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (54%), Gaps = 0/56 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV  194
            +V H  L  P   +EL+ G  L L A   WK  H + Q+K ++ Y  LD GEI VV
Sbjct  5    KVAHATLKGPSVVKELLIGSVLALAAGSLWKMHHWNEQRKVRTFYDLLDKGEIGVV  60



>emb|CDM81139.1| unnamed protein product [Triticum aestivum]
Length=81

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -1

Query  334  PMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            P   RE+V G +LGL A + WK  H   Q++T+  Y  LD G I+VV  +
Sbjct  26   PSVVREIVYGMSLGLFAGYLWKLHHWSNQRRTREFYSLLDEGRITVVVDE  75



>ref|XP_009631036.1| PREDICTED: cytochrome c oxidase subunit 5C [Nicotiana tomentosiformis]
 ref|XP_009631037.1| PREDICTED: cytochrome c oxidase subunit 5C [Nicotiana tomentosiformis]
Length=64

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = -1

Query  358  VPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            V H     P   +E++ G  LG+ A   WK  H + Q++TK  Y  L+ GEISVV  +
Sbjct  6    VAHAVYKGPSVVKEILIGITLGMVAGGFWKMHHWNNQRRTKEFYDMLEKGEISVVVDE  63



>ref|XP_006470279.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4-like [Citrus 
sinensis]
Length=64

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H     P   +E+V G ++GL A   WK    + Q++T+  Y  L+ GEISVV +D
Sbjct  5    KIAHATYQGPSVVKEIVYGISIGLFAGGLWKMHQWNNQRRTREFYDLLEKGEISVVVED  63



>ref|XP_010689705.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Beta vulgaris 
subsp. vulgaris]
Length=64

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H+   +P   +E++ G +LG      WK  H + Q++TK  +  L+ G+ISVV +D
Sbjct  5    KIAHVASKNPSVVKEIIYGISLGTACGLLWKMHHWNNQRRTKEFHDLLEKGQISVVVED  63



>emb|CDM81135.1| unnamed protein product [Triticum aestivum]
Length=166

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (57%), Gaps = 6/58 (10%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVV------AQDY  182
            SP   RE+V G +LGL   + WK  H   Q++T+ +Y  LD G ISVV      A+DY
Sbjct  91   SPSVVREIVYGMSLGLLVGYLWKLHHWSNQRRTRELYSLLDEGTISVVVDEAAGAKDY  148



>ref|XP_006446555.1| hypothetical protein CICLE_v10017383mg [Citrus clementina]
 gb|ESR59795.1| hypothetical protein CICLE_v10017383mg [Citrus clementina]
Length=72

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H     P   +E+V G ++GL A   WK    + Q++T+  Y  L+ GEISVV +D
Sbjct  13   KIAHATYQGPSVVKEIVYGISIGLFAGGLWKMHQWNNQRRTREFYDLLEKGEISVVVED  71



>ref|XP_007201483.1| hypothetical protein PRUPE_ppa014546mg [Prunus persica]
 gb|EMJ02682.1| hypothetical protein PRUPE_ppa014546mg [Prunus persica]
Length=63

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  + L A   WK  H + Q+K K  Y  L+ GEISVVA +
Sbjct  5    KIAHATLKGPSVVKEICYGMVIALAAGSLWKMHHWNEQRKVKVFYDLLEKGEISVVADE  63



>ref|XP_006492338.1| PREDICTED: probable cytochrome c oxidase subunit 5C-3-like [Citrus 
sinensis]
Length=63

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LGL A   WK    + Q+K++  Y  L+ GE+SVV ++
Sbjct  5    KIAHATLKGPSVVKEICLGITLGLAAGGLWKMNQWNNQRKSRVFYDLLEKGEVSVVVEE  63



>ref|XP_008386720.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Malus 
domestica]
Length=63

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E++ G  L L     WK  H + Q+K ++ Y  L+ GEISVVA++
Sbjct  5    KIAHATLKGPSVVKEILYGSVLALACGSLWKMHHWNEQRKVRAFYDLLEKGEISVVAEE  63



>ref|XP_007163179.1| hypothetical protein PHAVU_001G213100g, partial [Phaseolus vulgaris]
 gb|ESW35173.1| hypothetical protein PHAVU_001G213100g, partial [Phaseolus vulgaris]
Length=108

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -1

Query  358  VPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            + H  L  P   +E++ G  LGL AA  WK  H + +KK ++ Y  L+ GEISVV ++
Sbjct  50   IAHATLKGPSVVKEIIIGTVLGLGAASFWKMHHWNEKKKIRTFYDFLEKGEISVVKEE  107



>ref|NP_001119340.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana]
 sp|Q9FNE0.1|CX5C4_ARATH RecName: Full=Putative cytochrome c oxidase subunit 5C-4; AltName: 
Full=Cytochrome c oxidase polypeptide Vc-4 [Arabidopsis 
thaliana]
 dbj|BAB11594.1| cytochrome c oxidase Vc subunit [Arabidopsis thaliana]
 gb|AED94541.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana]
Length=65

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
             P   +E++ G  LG      WK  H + Q++TK  Y  L+ GEISVV +D
Sbjct  14   GPSVVKEIIYGITLGFAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVVED  64



>emb|CDM81134.1| unnamed protein product [Triticum aestivum]
Length=105

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -1

Query  334  PMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            P   RE+V G +LGL A + WK  H   Q++T+  +  LD G ISVV  +
Sbjct  26   PSVVREIVYGMSLGLFAGYLWKLHHWSNQRRTREFHSLLDQGRISVVVDE  75



>gb|EMT09818.1| Putative cytochrome c oxidase subunit 5C-4 [Aegilops tauschii]
Length=81

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 6/60 (10%)
 Frame = -1

Query  364  GRVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            GR P      P   +E+V G +LGL A + WK  H   Q++T+  Y  LD G I+VV  +
Sbjct  22   GRRP------PSVVKEIVYGMSLGLFAGYLWKLHHWSNQRRTREFYALLDEGRITVVVDE  75



>ref|XP_008369045.1| PREDICTED: probable cytochrome c oxidase subunit 5C-3 [Malus 
domestica]
 ref|XP_009378732.1| PREDICTED: probable cytochrome c oxidase subunit 5C-3 [Pyrus 
x bretschneideri]
Length=63

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E++ G  L L     WK  H + Q+K ++ Y  L+ GEISVV ++
Sbjct  5    KIAHATLKGPSVVKEILYGSVLALACGSLWKMHHWNEQRKVRAFYDLLEKGEISVVVEE  63



>ref|XP_002282099.1| PREDICTED: cytochrome c oxidase subunit 5C [Vitis vinifera]
 emb|CBI39596.3| unnamed protein product [Vitis vinifera]
Length=63

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = -1

Query  361  RVPHLELGSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQD  185
            ++ H  L  P   +E+  G  LGL A   WK  H + QKK ++ Y  L+  +ISVV  +
Sbjct  5    KIAHATLKGPSVVKEICIGATLGLLAGGLWKMHHWNEQKKLRTFYDMLEKDQISVVVDE  63



>ref|XP_010251362.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4 [Nelumbo 
nucifera]
Length=68

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -1

Query  337  SPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQ  188
             P   +E++ G ALGL A   WK  H   +K+TK  Y  L+ G+ISVV +
Sbjct  17   GPSVLKEIMHGMALGLIAGGFWKMHHWSYRKRTKEFYDLLEKGDISVVVE  66



>gb|ABK20891.1| unknown [Picea sitchensis]
 gb|ABK24962.1| unknown [Picea sitchensis]
 gb|ABK25688.1| unknown [Picea sitchensis]
Length=66

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = -1

Query  361  RVP-HLEL-GSPMFYRELVAGFALGLCAAFTWKKEHKDMQKKTKSIYQQLDTGEISVVAQ  188
            +VP H+ L G P   +E+  G ALGL A   WK      Q+KT+  Y+ L+ G ISVV +
Sbjct  5    KVPSHVALKGGPSVIKEICYGLALGLMAGGVWKMYQWREQRKTREFYEMLERGVISVVHE  64

Query  187  D  185
            +
Sbjct  65   E  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511302198024