BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c386_g1_i1 len=924 path=[39:0-86 19:87-923]

Length=924
                                                                      Score     E

ref|XP_009767687.1|  PREDICTED: dehydration-responsive element-bi...    182   8e-52   
ref|XP_009598034.1|  PREDICTED: dehydration-responsive element-bi...    177   6e-50   
emb|CDP07457.1|  unnamed protein product                                163   1e-44   
ref|XP_009621512.1|  PREDICTED: dehydration-responsive element-bi...    162   2e-44   
ref|XP_004238613.1|  PREDICTED: dehydration-responsive element-bi...    160   1e-43   
ref|XP_006342227.1|  PREDICTED: dehydration-responsive element-bi...    153   2e-40   
ref|XP_009767453.1|  PREDICTED: dehydration-responsive element-bi...    146   1e-38   
ref|XP_003527879.1|  PREDICTED: dehydration-responsive element-bi...    147   2e-38   
ref|XP_002510462.1|  Dehydration-responsive element-binding prote...    143   5e-37   Ricinus communis
ref|XP_006473580.1|  PREDICTED: dehydration-responsive element-bi...    140   5e-36   
ref|XP_011083628.1|  PREDICTED: dehydration-responsive element-bi...    137   3e-35   
gb|KDO84711.1|  hypothetical protein CISIN_1g036655mg                   138   3e-35   
ref|XP_006435084.1|  hypothetical protein CICLE_v10002280mg             138   4e-35   
ref|XP_003523563.1|  PREDICTED: dehydration-responsive element-bi...    138   4e-35   
gb|EPS61812.1|  hypothetical protein M569_12986                         135   9e-35   
ref|XP_010271525.1|  PREDICTED: dehydration-responsive element-bi...    135   2e-34   
ref|XP_007017661.1|  Dehydration-responsive element-binding prote...    134   1e-33   
gb|KDP38573.1|  hypothetical protein JCGZ_04498                         133   2e-33   
dbj|BAJ53172.1|  JHL18I08.6                                             133   2e-33   
ref|XP_002280893.3|  PREDICTED: dehydration-responsive element-bi...    132   3e-33   Vitis vinifera
ref|XP_010105262.1|  GTPase obg                                         138   1e-32   
ref|XP_007226392.1|  hypothetical protein PRUPE_ppa023248mg             132   1e-32   
ref|XP_008388158.1|  PREDICTED: dehydration-responsive element-bi...    131   1e-32   
ref|XP_004499266.1|  PREDICTED: dehydration-responsive element-bi...    130   3e-32   
gb|KCW67902.1|  hypothetical protein EUGRSUZ_F01607                     127   3e-31   
ref|XP_008347385.1|  PREDICTED: dehydration-responsive element-bi...    128   3e-31   
ref|XP_002302006.1|  hypothetical protein POPTR_0002s03090g             127   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010064559.1|  PREDICTED: dehydration-responsive element-bi...    127   4e-31   
ref|XP_008377237.1|  PREDICTED: dehydration-responsive element-bi...    127   7e-31   
ref|XP_008444762.1|  PREDICTED: dehydration-responsive element-bi...    125   9e-31   
ref|XP_004152768.1|  PREDICTED: dehydration-responsive element-bi...    124   1e-30   
ref|XP_009104705.1|  PREDICTED: dehydration-responsive element-bi...    125   2e-30   
ref|XP_007160709.1|  hypothetical protein PHAVU_001G010400g             126   2e-30   
gb|KGN62640.1|  hypothetical protein Csa_2G363010                       125   2e-30   
ref|XP_011048848.1|  PREDICTED: dehydration-responsive element-bi...    125   3e-30   
ref|XP_003589344.1|  Ethylene-responsive transcription factor ERF071    125   3e-30   
ref|XP_002306897.2|  hypothetical protein POPTR_0005s25470g             124   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008221333.1|  PREDICTED: dehydration-responsive element-bi...    127   5e-30   
ref|XP_008388157.1|  PREDICTED: dehydration-responsive element-bi...    125   5e-30   
ref|XP_011029080.1|  PREDICTED: dehydration-responsive element-bi...    123   9e-30   
gb|EYU32882.1|  hypothetical protein MIMGU_mgv1a018624mg                123   1e-29   
ref|XP_010416439.1|  PREDICTED: dehydration-responsive element-bi...    122   2e-29   
ref|XP_009336823.1|  PREDICTED: dehydration-responsive element-bi...    122   2e-29   
ref|XP_009336842.1|  PREDICTED: dehydration-responsive element-bi...    124   2e-29   
ref|XP_007136043.1|  hypothetical protein PHAVU_009G013200g             123   2e-29   
emb|CAN60823.1|  hypothetical protein VITISV_037056                     120   3e-29   Vitis vinifera
ref|XP_010428577.1|  PREDICTED: dehydration-responsive element-bi...    121   4e-29   
ref|XP_010471662.1|  PREDICTED: dehydration-responsive element-bi...    120   5e-29   
gb|KFK41984.1|  hypothetical protein AALP_AA2G197300                    120   1e-28   
ref|XP_006390299.1|  hypothetical protein EUTSA_v10019142mg             120   1e-28   
emb|CDY64211.1|  BnaC06g43980D                                          119   2e-28   
ref|XP_009351419.1|  PREDICTED: dehydration-responsive element-bi...    117   2e-28   
ref|XP_010674522.1|  PREDICTED: dehydration-responsive element-bi...    120   2e-28   
ref|XP_008366770.1|  PREDICTED: dehydration-responsive element-bi...    120   2e-28   
emb|CBI19777.3|  unnamed protein product                                119   2e-28   
gb|KFK26084.1|  hypothetical protein AALP_AA8G200700                    121   2e-28   
ref|XP_010533259.1|  PREDICTED: dehydration-responsive element-bi...    119   3e-28   
ref|XP_003549447.2|  PREDICTED: ethylene-responsive transcription...    120   3e-28   
ref|XP_006302829.1|  hypothetical protein CARUB_v10020960mg             119   3e-28   
emb|CDY58117.1|  BnaA02g35180D                                          120   3e-28   
gb|KHN12670.1|  Dehydration-responsive element-binding protein 2D       120   3e-28   
emb|CDY02629.1|  BnaC02g08060D                                          120   4e-28   
ref|XP_002887600.1|  hypothetical protein ARALYDRAFT_476698             118   4e-28   
ref|XP_004292958.1|  PREDICTED: dehydration-responsive element-bi...    119   5e-28   
ref|XP_009128106.1|  PREDICTED: dehydration-responsive element-bi...    118   5e-28   
ref|NP_177681.2|  dehydration-responsive element-binding protein 2D     118   5e-28   Arabidopsis thaliana [mouse-ear cress]
gb|ABK59671.1|  At1g75490                                               117   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004147872.1|  PREDICTED: dehydration-responsive element-bi...    117   6e-28   
ref|XP_010243654.1|  PREDICTED: dehydration-responsive element-bi...    117   6e-28   
ref|XP_008466672.1|  PREDICTED: dehydration-responsive element-bi...    117   6e-28   
ref|XP_003545264.1|  PREDICTED: ethylene-responsive transcription...    119   7e-28   
ref|XP_002873895.1|  hypothetical protein ARALYDRAFT_909855             120   7e-28   
ref|NP_197346.1|  dehydration-responsive element-binding protein 2G     120   7e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106200.1|  PREDICTED: dehydration-responsive element-bi...    117   8e-28   
ref|XP_009126252.1|  PREDICTED: dehydration-responsive element-bi...    119   8e-28   
ref|XP_006289041.1|  hypothetical protein CARUB_v10002425mg             120   8e-28   
emb|CDY47519.1|  BnaAnng09170D                                          117   9e-28   
ref|XP_002522019.1|  hypothetical protein RCOM_0610630                  117   1e-27   Ricinus communis
ref|XP_009120973.1|  PREDICTED: dehydration-responsive element-bi...    119   1e-27   
ref|XP_010420608.1|  PREDICTED: dehydration-responsive element-bi...    119   2e-27   
ref|XP_010454086.1|  PREDICTED: dehydration-responsive element-bi...    119   2e-27   
emb|CDY25420.1|  BnaC09g39350D                                          119   2e-27   
gb|KEH36215.1|  dehydration-responsive element-binding protein          117   2e-27   
ref|XP_011084760.1|  PREDICTED: ethylene-responsive transcription...    115   4e-27   
ref|XP_010492849.1|  PREDICTED: dehydration-responsive element-bi...    117   9e-27   
ref|XP_006443285.1|  hypothetical protein CICLE_v10022244mg             114   1e-26   
emb|CDY70626.1|  BnaCnng69090D                                          114   1e-26   
emb|CDY20377.1|  BnaC02g24390D                                          113   2e-26   
ref|XP_007208518.1|  hypothetical protein PRUPE_ppa026176mg             110   3e-26   
emb|CAN66064.1|  hypothetical protein VITISV_032355                     112   3e-26   Vitis vinifera
ref|XP_002267549.1|  PREDICTED: dehydration-responsive element-bi...    113   4e-26   Vitis vinifera
ref|XP_010043317.1|  PREDICTED: dehydration-responsive element-bi...    114   4e-26   
ref|XP_009131668.1|  PREDICTED: dehydration-responsive element-bi...    114   6e-26   
gb|EYU39769.1|  hypothetical protein MIMGU_mgv1a018752mg                109   6e-26   
ref|XP_009406908.1|  PREDICTED: dehydration-responsive element-bi...    114   1e-25   
ref|XP_009406909.1|  PREDICTED: dehydration-responsive element-bi...    114   1e-25   
ref|XP_008389032.1|  PREDICTED: dehydration-responsive element-bi...    112   1e-25   
ref|XP_004302113.1|  PREDICTED: dehydration-responsive element-bi...    110   2e-25   
ref|XP_010922640.1|  PREDICTED: dehydration-responsive element-bi...    113   2e-25   
gb|KDP23749.1|  hypothetical protein JCGZ_23582                         111   2e-25   
ref|XP_007030307.1|  Integrase-type DNA-binding superfamily prote...    111   2e-25   
ref|XP_010505763.1|  PREDICTED: dehydration-responsive element-bi...    113   3e-25   
emb|CDP04254.1|  unnamed protein product                                111   3e-25   
ref|XP_006400393.1|  hypothetical protein EUTSA_v10015907mg             112   3e-25   
gb|AFK24441.1|  DREB2                                                   111   3e-25   
ref|XP_004237644.1|  PREDICTED: dehydration-responsive element-bi...    109   3e-25   
ref|XP_010936099.1|  PREDICTED: dehydration-responsive element-bi...    110   5e-25   
ref|XP_008218369.1|  PREDICTED: dehydration-responsive element-bi...    110   5e-25   
ref|XP_009630729.1|  PREDICTED: ethylene-responsive transcription...    112   6e-25   
ref|XP_009386363.1|  PREDICTED: dehydration-responsive element-bi...    109   6e-25   
ref|XP_009391184.1|  PREDICTED: dehydration-responsive element-bi...    108   9e-25   
gb|AIZ74387.1|  DREB1                                                   108   1e-24   
ref|XP_008799804.1|  PREDICTED: dehydration-responsive element-bi...    111   1e-24   
gb|AFP89590.1|  putative dehydration responsive element-binding p...    108   2e-24   
ref|XP_002520794.1|  Dehydration-responsive element-binding prote...    111   2e-24   Ricinus communis
ref|XP_009416308.1|  PREDICTED: dehydration-responsive element-bi...    110   2e-24   
ref|XP_010921034.1|  PREDICTED: dehydration-responsive element-bi...    110   2e-24   
ref|XP_008796422.1|  PREDICTED: dehydration-responsive element-bi...    108   2e-24   
ref|XP_010508876.1|  PREDICTED: dehydration-responsive element-bi...    110   2e-24   
ref|XP_004293490.1|  PREDICTED: dehydration-responsive element-bi...    108   2e-24   
ref|XP_010257031.1|  PREDICTED: dehydration-responsive element-bi...    110   2e-24   
ref|XP_010940672.1|  PREDICTED: dehydration-responsive element-bi...    108   2e-24   
ref|XP_010931300.1|  PREDICTED: dehydration-responsive element-bi...    109   3e-24   
gb|KDP44697.1|  hypothetical protein JCGZ_01197                         110   4e-24   
ref|XP_002881716.1|  hypothetical protein ARALYDRAFT_903325             110   5e-24   
ref|XP_010549641.1|  PREDICTED: dehydration-responsive element-bi...    110   5e-24   
ref|XP_010254126.1|  PREDICTED: dehydration-responsive element-bi...    108   7e-24   
ref|XP_008789576.1|  PREDICTED: dehydration-responsive element-bi...    106   7e-24   
ref|XP_006660398.1|  PREDICTED: dehydration-responsive element-bi...    107   7e-24   
ref|XP_009402398.1|  PREDICTED: dehydration-responsive element-bi...    109   7e-24   
ref|XP_009384928.1|  PREDICTED: dehydration-responsive element-bi...    108   7e-24   
gb|ABS11171.1|  putative DRE-binding protein DREB2                      108   8e-24   Avena sativa [cultivated oat]
ref|XP_010517453.1|  PREDICTED: dehydration-responsive element-bi...    109   8e-24   
ref|XP_010534621.1|  PREDICTED: dehydration-responsive element-bi...    109   8e-24   
ref|XP_007009970.1|  Dehydration-responsive element-binding prote...    107   1e-23   
ref|XP_002968658.1|  hypothetical protein SELMODRAFT_38494              102   1e-23   
ref|NP_181566.2|  putative dehydration-responsive element-binding...    104   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828126.1|  hypothetical protein AMTR_s00023p00044590          108   2e-23   
ref|XP_009384927.1|  PREDICTED: dehydration-responsive element-bi...    107   2e-23   
emb|CDP16214.1|  unnamed protein product                                105   2e-23   
ref|XP_006294524.1|  hypothetical protein CARUB_v10023556mg             108   2e-23   
ref|XP_008792179.1|  PREDICTED: dehydration-responsive element-bi...    107   2e-23   
ref|XP_006353419.1|  PREDICTED: dehydration-responsive element-bi...    107   2e-23   
gb|AAD25670.1|  AP2 domain transcription factor                         104   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294523.1|  hypothetical protein CARUB_v10023556mg             107   3e-23   
gb|AFO12477.1|  DRE-binding protein 2                                   106   3e-23   
ref|XP_003569085.1|  PREDICTED: dehydration-responsive element-bi...    106   4e-23   
ref|NP_565929.1|  dehydration-responsive element-binding protein 2C     107   5e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CAH10193.1|  dehydration-responsive element binding protein 2...    105   5e-23   Festuca arundinacea [tall fescue]
gb|ADM73511.1|  dehydration responsive element-binding protein 2        105   5e-23   
gb|AIY22663.1|  Dreb-like protein                                       105   5e-23   
gb|AIY22664.1|  Dreb-like protein                                       105   7e-23   
gb|AAT44958.1|  putative AP2/EREBP transcription factor                 102   8e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDX70820.1|  BnaC03g09040D                                          105   8e-23   
gb|AEI98833.1|  dehydration responsive element binding protein 1        105   8e-23   
ref|XP_007028832.1|  Integrase-type DNA-binding superfamily protein     105   8e-23   
gb|AFO12481.1|  DRE-binding protein 2                                   105   9e-23   
ref|XP_004968294.1|  PREDICTED: dehydration-responsive element-bi...    105   9e-23   
gb|AAS59530.1|  putative DRE-binding protein DREB2                      104   1e-22   Poa pratensis
ref|NP_001062535.1|  Os08g0565200                                       104   1e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAG30547.1|  putative DREB2A protein                                104   1e-22   Festuca arundinacea [tall fescue]
emb|CAG30548.1|  putative DREB2A protein                                104   1e-22   Festuca arundinacea [tall fescue]
gb|AFO12472.1|  DRE-binding protein 2                                   104   1e-22   
ref|XP_008678419.1|  PREDICTED: dehydration-responsive element-bi...    105   1e-22   
gb|ACA79910.1|  DRE-binding protein 2                                   104   1e-22   Sorghum bicolor [broomcorn]
ref|XP_008776283.1|  PREDICTED: dehydration-responsive element-bi...    105   1e-22   
ref|XP_002444543.1|  hypothetical protein SORBIDRAFT_07g023575          105   1e-22   Sorghum bicolor [broomcorn]
gb|AFV52020.1|  DREB2                                                   104   1e-22   
gb|EAZ08049.1|  hypothetical protein OsI_30314                          103   1e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_003571275.1|  PREDICTED: dehydration-responsive element-bi...    103   1e-22   
ref|NP_001234689.1|  dehydration responsive element binding protein     105   1e-22   
gb|AIU40168.1|  dehydration responsive element binding protein 2        104   1e-22   
ref|XP_001756620.1|  predicted protein                                99.8    1e-22   
ref|XP_002457289.1|  hypothetical protein SORBIDRAFT_03g004980          104   2e-22   Sorghum bicolor [broomcorn]
gb|ACA79916.1|  DRE-binding protein 2                                   104   2e-22   Sorghum bicolor [broomcorn]
gb|ACA79914.1|  DRE-binding protein 2                                   104   2e-22   Sorghum bicolor [broomcorn]
gb|ABX45045.1|  desiccation responisve element-binding protein          104   2e-22   Sorghum bicolor [broomcorn]
gb|AFO12471.1|  DRE-binding protein 2                                   104   2e-22   
gb|AFO12474.1|  DRE-binding protein 2                                   104   2e-22   
gb|AFO12479.1|  DRE-binding protein 2                                   104   2e-22   
gb|AFO12468.1|  DRE-binding protein 2                                   104   2e-22   
ref|XP_002973089.1|  hypothetical protein SELMODRAFT_38502            99.4    2e-22   
gb|AAR11157.1|  dehydration-responsive element binding protein 2        104   2e-22   Festuca arundinacea [tall fescue]
gb|AAU29412.1|  dehydration-responsive element-binding protein 2        104   2e-22   Hordeum brevisubulatum
ref|NP_001152469.1|  dehydration-responsive element-binding prote...    104   2e-22   Zea mays [maize]
gb|AFO12470.1|  DRE-binding protein 2                                   104   2e-22   
gb|AFO12467.1|  DRE-binding protein 2                                   104   2e-22   
gb|AEO78516.1|  dehydration-responsive element-binding protein          101   2e-22   
gb|AFH75401.1|  dehydration-responsive element-binding transcript...    103   2e-22   
gb|AIY22669.1|  Dreb-like protein                                       103   2e-22   
gb|AFO12483.1|  DRE-binding protein 2                                   103   2e-22   
gb|ACA79919.1|  DRE-binding protein 2                                   103   2e-22   Sorghum bicolor [broomcorn]
gb|AIY22668.1|  Dreb-like protein                                       103   2e-22   
gb|ACX94337.1|  dehydration responsive factor 1.3                       104   2e-22   Aegilops columnaris
gb|AFO12475.1|  DRE-binding protein 2                                   103   2e-22   
gb|AAY25517.1|  dehydration responsive element binding protein 1        103   2e-22   Hordeum vulgare subsp. vulgare [barley]
gb|ABA08426.1|  dehydration-responsive element-binding protein          103   3e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AEZ68001.1|  dehydration-responsive element-binding protein          101   3e-22   
gb|AEV46839.1|  dehydration-responsive element binding protein          103   3e-22   
gb|AEK48231.1|  dehydration-responsive element-binding protein          100   3e-22   
gb|AFO12473.1|  DRE-binding protein 2                                   103   3e-22   
gb|AEO78515.1|  dehydration-responsive element-binding protein          100   3e-22   
gb|AEK48229.1|  dehydration-responsive element-binding protein          100   3e-22   
gb|AEK48227.1|  dehydration-responsive element-binding protein          100   3e-22   
gb|AER42620.1|  dehydration responsive element binding protein 1        103   3e-22   
gb|AIY22665.1|  Dreb-like protein                                       103   3e-22   
ref|XP_006643786.1|  PREDICTED: dehydration-responsive element-bi...    103   3e-22   
gb|AEI98920.1|  AP2/EREBP transcription factor                          103   3e-22   
gb|AEZ68003.1|  dehydration-responsive element-binding protein          101   3e-22   
gb|AGL08026.1|  dehydration-responsive element-binding protein          100   3e-22   
gb|AGL08024.1|  dehydration-responsive element-binding protein          100   3e-22   
gb|AGG20202.1|  DREB2                                                   103   3e-22   
gb|ACX94335.1|  dehydration responsive factor 1.1                       104   3e-22   Aegilops columnaris
ref|XP_010102188.1|  Dehydration-responsive element-binding prote...    102   3e-22   
gb|AEO78514.1|  dehydration-responsive element-binding protein          100   3e-22   
gb|ABA08425.1|  dehydration-responsive element-binding protein          101   3e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AGL08027.1|  dehydration-responsive element-binding protein          100   4e-22   
gb|AIY22662.1|  Dreb-like protein                                       103   4e-22   
gb|AEZ68005.1|  dehydration-responsive element-binding protein          100   4e-22   
gb|AEZ68002.1|  dehydration-responsive element-binding protein          100   4e-22   
gb|AGL08025.1|  dehydration-responsive element-binding protein          100   4e-22   
gb|AFO12478.1|  DRE-binding protein 2                                   103   4e-22   
emb|CAG30549.1|  putative FaDREB2A                                      103   4e-22   Festuca arundinacea [tall fescue]
gb|AAL01124.1|AF303376_1  AP2-containing protein                        103   4e-22   Triticum aestivum [Canadian hard winter wheat]
gb|ABU68663.1|  AP2 transcriptional activator variant                 99.0    4e-22   Triticum turgidum subsp. durum
gb|AIY22667.1|  Dreb-like protein                                       102   4e-22   
gb|AFO12476.1|  DRE-binding protein 2                                   103   4e-22   
gb|AAY44604.1|  dehydration responsive element binding protein W73      103   5e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AAM61256.1|  AP2 domain transcription factor                         103   5e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CBX87024.1|  DREB2 protein                                          103   5e-22   
gb|AFO12480.1|  DRE-binding protein 2                                   102   5e-22   
gb|AFO11002.1|  AP2 transcriptional activator DRF 1.3                   103   5e-22   
gb|ACO35588.1|  dehydration responsive factor 1 variant 3               103   6e-22   Aegilops speltoides var. ligustica
gb|EMS45041.1|  Dehydration-responsive element-binding protein 2B       103   6e-22   
gb|ACJ01643.1|  dehydration responsive factor 1 variant 1.3             103   6e-22   Triticum turgidum subsp. durum
gb|AFQ00888.1|  AP2 transcriptional activator DRF1.3                    103   6e-22   
gb|AFO10996.1|  AP2 transcriptional activator DRF 1.3                   103   6e-22   
gb|AAX13283.1|  DREB transcription factor 4B                            103   6e-22   Triticum aestivum [Canadian hard winter wheat]
gb|ABY19375.1|  DRE-binding protein DREB2                               102   6e-22   Phyllostachys edulis [kikko-chiku]
gb|AAX13289.1|  DREB transcription factor 6                             102   6e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AHG26212.1|  dreb2                                                   103   6e-22   
gb|ABD66654.1|  DRE-binding protein 2                                   102   7e-22   Sorghum bicolor [broomcorn]
gb|ACO35585.1|  dehydration responsive factor 1 variant 3               103   7e-22   Aegilops speltoides var. ligustica
gb|AFO11000.1|  AP2 transcriptional activator DRF 1.1                   103   7e-22   
gb|ACJ01649.1|  dehydration responsive factor 1 variant 1.3             103   7e-22   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
gb|AAX13278.1|  DREB transcription factor 3B                            103   8e-22   Triticum aestivum [Canadian hard winter wheat]
emb|CBH19547.1|  AP2 domain containing protein                          100   8e-22   Oryza sativa Indica Group [Indian rice]
gb|ADM93284.1|  DRE-binding transcription factor 1.1                    103   8e-22   
gb|ACO35586.1|  dehydration responsive factor 1 variant 1               103   8e-22   Aegilops speltoides var. ligustica
gb|AIY22666.1|  Dreb-like protein                                       102   8e-22   
ref|XP_010057479.1|  PREDICTED: dehydration-responsive element-bi...    102   8e-22   
gb|AAX13282.1|  DREB transcription factor 4A                            103   8e-22   Triticum aestivum [Canadian hard winter wheat]
gb|ACT78962.1|  dehydration responsive factor 1 variant 1.1             103   9e-22   
emb|CAT00689.1|  AP2 transcription factor                               100   9e-22   Antirrhinum majus [garden snapdragon]
gb|ACJ01645.1|  dehydration responsive factor 1 variant 1.3 type a      103   9e-22   Triticum turgidum subsp. durum
gb|ACJ01646.1|  dehydration responsive factor 1 variant 1.3 type b      103   9e-22   Triticum turgidum subsp. durum
gb|AAY83361.2|  AP2 transcriptional activator                           103   1e-21   Triticum turgidum subsp. durum
gb|ADM89078.1|  DREB2 transcription factor alpha isoform                103   1e-21   
gb|AFO10994.1|  AP2 transcriptional activator DRF 1.1                   103   1e-21   
gb|ACO35583.1|  dehydration responsive factor 1 variant 1               103   1e-21   Aegilops speltoides var. ligustica
gb|ACO58508.1|  dehydration responsive factor 1                         101   1e-21   Aegilops speltoides subsp. speltoides [goat grass]
gb|AAX13277.1|  DREB transcription factor 3A                            103   1e-21   Triticum aestivum [Canadian hard winter wheat]
gb|ACX37095.1|  DREB-like protein 1                                     102   1e-21   Zoysia japonica [Japanese lawn grass]
gb|ACV42429.1|  DREB-like protein 1                                     102   1e-21   Zoysia japonica [Japanese lawn grass]
gb|ABU97502.1|  AP2 transcriptional activator variant 1                 103   1e-21   Secale cereale x Triticum aestivum [octaploid triticale]
gb|ABU68665.1|  AP2 transcriptional activator DRF1.1                    103   1e-21   Triticum turgidum subsp. durum
gb|ACA79912.1|  DRE-binding protein 2                                   102   1e-21   Sorghum bicolor [broomcorn]
gb|AIY24737.1|  dehydration responsive element binding protein 2a       102   1e-21   
gb|ACT78966.1|  dehydration responsive factor 1 variant 1.1 type a      103   1e-21   
gb|AFO10997.1|  AP2 transcriptional activator DRF 1.1                   103   1e-21   
gb|AFO12469.1|  DRE-binding protein 2                                   101   1e-21   
gb|ADM93286.1|  DRE-binding transcription factor 1.3                    103   1e-21   
sp|A2WL19.2|DRE2A_ORYSI  RecName: Full=Dehydration-responsive ele...    102   1e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001042107.1|  Os01g0165000                                       102   1e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CBH19549.1|  AP2 domain containing protein                        99.4    1e-21   Oryza sativa Indica Group [Indian rice]
gb|AAX13287.1|  DREB transcription factor 5B                            102   1e-21   Triticum aestivum [Canadian hard winter wheat]
gb|ADT91190.1|  DREB-like protein                                       102   1e-21   
gb|AAY83360.2|  AP2 transcriptional activator                           103   1e-21   Triticum turgidum subsp. durum
emb|CBH19548.1|  AP2 domain containing protein                          100   1e-21   Oryza sativa Indica Group [Indian rice]
gb|AAL40870.1|  DREB1                                                   102   1e-21   
ref|XP_010922641.1|  PREDICTED: dehydration-responsive element-bi...    101   2e-21   
gb|EMT19751.1|  Dehydration-responsive element-binding protein 2A       102   2e-21   
gb|AFI71292.1|  dehydration responsive element binding protein 2 ...    102   2e-21   
gb|ABY66038.1|  DRF1.3                                                  102   2e-21   
dbj|BAD97369.1|  EREBP/AP2 type transcription factor                    102   2e-21   
gb|AEC53579.1|  dehydration-responsive element binding protein 2A       102   2e-21   
gb|EAZ10669.1|  hypothetical protein OsJ_00499                          101   2e-21   
gb|EAY72665.1|  hypothetical protein OsI_00531                          101   2e-21   
gb|ACA79921.1|  DRE-binding protein 2                                   101   2e-21   
gb|AAX13286.1|  DREB transcription factor 5A                            102   2e-21   
emb|CBH19567.1|  AP2 domain containing protein                          100   2e-21   
gb|AFI71291.1|  dehydration responsive element binding protein 2 ...    102   2e-21   
gb|AAS46285.1|  DREB-like protein 2                                     100   2e-21   
gb|AEC53580.1|  dehydration-responsive element binding protein 2C       102   2e-21   
ref|XP_002308045.2|  Dehydration responsive element binding prote...    101   2e-21   
gb|ABY66036.1|  DRF1.1                                                  102   3e-21   
ref|XP_011020328.1|  PREDICTED: dehydration-responsive element-bi...    101   3e-21   
gb|ACF98541.1|  DRE-binding protein DREB1                               100   3e-21   
gb|ACO35591.1|  dehydration responsive factor 1 variant 3               101   3e-21   
gb|AAS46284.1|  DREB-like protein 1                                     100   3e-21   
gb|ACJ01648.1|  dehydration responsive factor 1 variant 1.3 type b      101   3e-21   
gb|ACH73204.1|  dehydration responsive element binding protein          101   4e-21   
ref|XP_009141887.1|  PREDICTED: dehydration-responsive element-bi...    100   4e-21   
gb|ACO35589.1|  dehydration responsive factor 1 variant 1               101   4e-21   
ref|XP_011075213.1|  PREDICTED: dehydration-responsive element-bi...    100   5e-21   
gb|AFI71304.1|  dehydration responsive element binding protein is...    101   5e-21   
ref|XP_007202407.1|  hypothetical protein PRUPE_ppa009616mg             100   5e-21   
ref|XP_010265763.1|  PREDICTED: dehydration-responsive element-bi...    100   5e-21   
gb|AEI69362.1|  dehydration responsive element binding protein 1001   99.8    5e-21   
gb|AAO27885.1|  dehydration-responsive AP2 domain transcriptional...    100   6e-21   
ref|XP_008387280.1|  PREDICTED: dehydration-responsive element-bi...    100   6e-21   
ref|XP_008799805.1|  PREDICTED: dehydration-responsive element-bi...  99.8    6e-21   
ref|XP_008350282.1|  PREDICTED: dehydration-responsive element-bi...    100   6e-21   
gb|ABP52086.1|  dehydration responsive element binding protein        99.8    6e-21   
ref|XP_009340780.1|  PREDICTED: dehydration-responsive element-bi...    100   6e-21   
ref|XP_008240865.1|  PREDICTED: dehydration-responsive element-bi...    100   6e-21   
ref|XP_010257316.1|  PREDICTED: dehydration-responsive element-bi...    100   6e-21   
emb|CDY52924.1|  BnaA04g29310D                                          100   6e-21   
ref|XP_010934576.1|  PREDICTED: dehydration-responsive element-bi...  97.4    6e-21   
gb|EMS61906.1|  Dehydration-responsive element-binding protein 2C     98.2    6e-21   
gb|EPS72578.1|  hypothetical protein M569_02179                       98.6    7e-21   
gb|EMS47871.1|  Dehydration-responsive element-binding protein 2A       103   7e-21   
ref|XP_010534622.1|  PREDICTED: dehydration-responsive element-bi...    100   7e-21   
ref|XP_009402399.1|  PREDICTED: dehydration-responsive element-bi...  99.8    7e-21   
ref|XP_004307569.1|  PREDICTED: dehydration-responsive element-bi...    100   7e-21   
gb|EMT23900.1|  Dehydration-responsive element-binding protein 2A       103   7e-21   
gb|AAO38209.1|  AP2 transcriptional activator DRF1.1                    101   7e-21   
ref|XP_008664551.1|  PREDICTED: dehydration-responsive element-bi...    100   7e-21   
gb|ACJ01647.1|  dehydration responsive factor 1 variant 1.3 type a      100   8e-21   
ref|XP_010672841.1|  PREDICTED: dehydration-responsive element-bi...  99.8    8e-21   
ref|XP_009803153.1|  PREDICTED: uncharacterized protein LOC104248568    100   9e-21   
ref|XP_007145629.1|  hypothetical protein PHAVU_007G255100g           99.8    1e-20   
ref|XP_006850202.1|  hypothetical protein AMTR_s00022p00250320        99.4    1e-20   
ref|XP_010524115.1|  PREDICTED: dehydration-responsive element-bi...  99.4    1e-20   
gb|ACJ01644.1|  dehydration responsive factor 1 variant 1.3             100   1e-20   
ref|XP_007162244.1|  hypothetical protein PHAVU_001G136100g           99.4    1e-20   
gb|KHN26337.1|  Dehydration-responsive element-binding protein 2F     99.4    1e-20   
ref|XP_004493523.1|  PREDICTED: dehydration-responsive element-bi...  99.4    1e-20   
gb|ACT78969.1|  dehydration responsive factor 1 variant 1.1 type a      100   1e-20   
ref|XP_002277662.2|  PREDICTED: dehydration-responsive element-bi...  99.0    1e-20   
ref|XP_003520524.1|  PREDICTED: dehydration-responsive element-bi...  99.0    1e-20   
gb|ACT78964.1|  dehydration responsive factor 1 variant 1.1           99.8    2e-20   
ref|XP_003625169.1|  Dehydration-responsive element-binding prote...  99.0    2e-20   
ref|XP_008809802.1|  PREDICTED: dehydration-responsive element-bi...  99.0    2e-20   
ref|XP_010940962.1|  PREDICTED: dehydration-responsive element-bi...  99.0    2e-20   
gb|KFK36913.1|  hypothetical protein AALP_AA4G189100                  99.0    2e-20   
ref|XP_003553420.1|  PREDICTED: dehydration-responsive element-bi...  98.6    2e-20   
ref|XP_008651496.1|  PREDICTED: dehydration-responsive element-bi...  99.0    2e-20   
ref|XP_004249756.1|  PREDICTED: dehydration-responsive element-bi...  99.0    2e-20   
emb|CDY33815.1|  BnaCnng07330D                                        94.7    2e-20   
ref|XP_008804145.1|  PREDICTED: dehydration-responsive element-bi...  98.6    2e-20   
gb|KHN29762.1|  Dehydration-responsive element-binding protein 2F     96.3    2e-20   
gb|EYU18760.1|  hypothetical protein MIMGU_mgv1a011288mg              98.6    2e-20   
ref|XP_008660493.1|  PREDICTED: dehydration-responsive element-bi...  99.0    2e-20   
gb|AIB05898.1|  AP2-EREBP transcription factor                        99.0    2e-20   
ref|XP_006351409.1|  PREDICTED: dehydration-responsive element-bi...  98.6    2e-20   
ref|XP_010921035.1|  PREDICTED: dehydration-responsive element-bi...  97.8    2e-20   
gb|EAY88744.1|  hypothetical protein OsI_10219                        98.6    3e-20   
gb|ADX32484.1|  Dreb2                                                 97.8    3e-20   
ref|XP_003568655.1|  PREDICTED: dehydration-responsive element-bi...  98.6    3e-20   
ref|XP_002323309.1|  Dehydration responsive element binding prote...  98.2    3e-20   
gb|EAZ25772.1|  hypothetical protein OsJ_09612                        98.6    3e-20   
sp|Q10R18.1|DRE2E_ORYSJ  RecName: Full=Dehydration-responsive ele...  98.6    3e-20   
ref|XP_011033305.1|  PREDICTED: dehydration-responsive element-bi...  98.2    3e-20   
ref|XP_004985522.1|  PREDICTED: dehydration-responsive element-bi...  98.6    3e-20   
ref|XP_009613454.1|  PREDICTED: dehydration-responsive element-bi...  98.2    3e-20   
gb|KDP26013.1|  hypothetical protein JCGZ_21046                       98.2    3e-20   
ref|XP_003568656.1|  PREDICTED: dehydration-responsive element-bi...  99.0    3e-20   
gb|AHG26213.1|  dreb2                                                 99.0    3e-20   
ref|XP_009804771.1|  PREDICTED: dehydration-responsive element-bi...  97.8    3e-20   
ref|XP_004136746.1|  PREDICTED: dehydration-responsive element-bi...  95.9    3e-20   
ref|XP_009394631.1|  PREDICTED: dehydration-responsive element-bi...  97.1    4e-20   
ref|XP_008792180.1|  PREDICTED: dehydration-responsive element-bi...  97.4    4e-20   
ref|XP_009411347.1|  PREDICTED: dehydration-responsive element-bi...  97.8    4e-20   
ref|XP_003518110.1|  PREDICTED: dehydration-responsive element-bi...  97.8    5e-20   
ref|XP_009597142.1|  PREDICTED: dehydration-responsive element-bi...  99.0    5e-20   
ref|XP_004161497.1|  PREDICTED: dehydration-responsive element-bi...  95.1    5e-20   
ref|XP_002526723.1|  hypothetical protein RCOM_0089590                97.4    6e-20   
ref|XP_006575245.1|  PREDICTED: dehydration-responsive element-bi...  95.5    7e-20   
gb|AAO27884.1|  AP2 domain protein                                    97.4    7e-20   
gb|AEI54698.1|  AP2/EREBP protein                                     97.1    7e-20   
ref|XP_009768300.1|  PREDICTED: uncharacterized protein LOC104219331  99.0    7e-20   
gb|AEO78517.1|  dehydration-responsive element-binding protein        92.4    8e-20   
ref|XP_010091861.1|  Dehydration-responsive element-binding prote...  96.7    9e-20   
emb|CDY52095.1|  BnaC04g55440D                                        96.3    1e-19   
gb|KFK35005.1|  hypothetical protein AALP_AA5G221900                  95.9    1e-19   
gb|AEI54699.1|  AP2/EREBP protein                                     96.3    1e-19   
ref|XP_006493905.1|  PREDICTED: dehydration-responsive element-bi...  96.3    1e-19   
dbj|BAJ94771.1|  predicted protein                                    96.3    2e-19   
ref|XP_006421446.1|  hypothetical protein CICLE_v10005549mg           96.3    2e-19   
ref|XP_010504692.1|  PREDICTED: dehydration-responsive element-bi...  95.9    2e-19   
emb|CDP10066.1|  unnamed protein product                              95.9    2e-19   
ref|XP_010516379.1|  PREDICTED: dehydration-responsive element-bi...  95.9    2e-19   
ref|XP_009139025.1|  PREDICTED: dehydration-responsive element-bi...  95.5    2e-19   
gb|AGL07769.1|  AP2/EREBP protein                                     95.5    2e-19   
ref|XP_008676276.1|  PREDICTED: dehydration-responsive element-bi...  92.0    2e-19   
gb|KGN59345.1|  hypothetical protein Csa_3G812170                     95.9    2e-19   
ref|XP_002876426.1|  hypothetical protein ARALYDRAFT_486209           95.1    2e-19   
ref|XP_006291644.1|  hypothetical protein CARUB_v10017800mg           95.1    3e-19   
ref|NP_191319.1|  dehydration-responsive element-binding protein 2F   95.1    3e-19   
ref|XP_006402862.1|  hypothetical protein EUTSA_v10006489mg           95.1    3e-19   
ref|XP_010427643.1|  PREDICTED: dehydration-responsive element-bi...  95.1    3e-19   
emb|CDX88955.1|  BnaA04g02310D                                        94.7    3e-19   
ref|XP_008370188.1|  PREDICTED: uncharacterized protein LOC103433697  97.4    3e-19   
ref|XP_008776284.1|  PREDICTED: dehydration-responsive element-bi...  94.7    3e-19   
gb|AFJ14635.1|  dehydration-responsive element-binding protein (D...  97.1    3e-19   
ref|XP_008660491.1|  PREDICTED: dehydration-responsive element-bi...  95.1    4e-19   
ref|XP_008443124.1|  PREDICTED: dehydration-responsive element-bi...  95.1    4e-19   
emb|CDX72012.1|  BnaC08g28620D                                        94.4    4e-19   
gb|ACR22838.1|  dehydration responsive factor 1                       93.2    4e-19   
gb|ACR22839.1|  dehydration responsive factor 1                       93.2    5e-19   
ref|XP_004963449.1|  PREDICTED: dehydration-responsive element-bi...  94.7    5e-19   
gb|ACR22841.1|  dehydration responsive factor 1                       93.2    5e-19   
ref|XP_009116465.1|  PREDICTED: dehydration-responsive element-bi...  94.4    5e-19   
emb|CDP06427.1|  unnamed protein product                              97.1    5e-19   
emb|CDY06088.1|  BnaA09g36920D                                        94.0    6e-19   
gb|AAD25951.1|AF085279_24  hypothetical protein                       94.4    6e-19   
ref|XP_009373085.1|  PREDICTED: uncharacterized protein LOC103962141  96.7    6e-19   
ref|XP_010676824.1|  PREDICTED: dehydration-responsive element-bi...  94.0    7e-19   
gb|KHN48370.1|  Dehydration-responsive element-binding protein 2F     94.4    7e-19   
gb|ACR22840.1|  dehydration responsive factor 1                       92.8    7e-19   
gb|ACO58507.1|  dehydration responsive factor 1                       92.8    9e-19   
ref|XP_009345024.1|  PREDICTED: dehydration-responsive element-bi...  93.6    9e-19   
ref|XP_003535164.2|  PREDICTED: dehydration-responsive element-bi...  94.4    1e-18   
gb|EMT22445.1|  Dehydration-responsive element-binding protein 2A     91.7    1e-18   
ref|XP_010327719.1|  PREDICTED: dehydration-responsive element-bi...  94.7    1e-18   
gb|KDP22828.1|  hypothetical protein JCGZ_00415                       94.0    1e-18   
ref|XP_009599185.1|  PREDICTED: uncharacterized protein LOC104094874  95.1    1e-18   
ref|XP_001770012.1|  predicted protein                                88.6    2e-18   
ref|XP_010553212.1|  PREDICTED: dehydration-responsive element-bi...  93.2    2e-18   
gb|ACR22835.1|  dehydration responsive factor 1                       90.5    3e-18   
gb|AGE97365.1|  ethylene response factor 10                           92.4    3e-18   
ref|XP_004148625.1|  PREDICTED: uncharacterized protein LOC101215862  92.8    3e-18   
ref|XP_006411048.1|  hypothetical protein EUTSA_v10017658mg           91.3    4e-18   
ref|XP_008464230.1|  PREDICTED: ethylene-responsive transcription...  92.8    4e-18   
gb|EMT21934.1|  Dehydration-responsive element-binding protein 2G     90.9    5e-18   
gb|ACR22837.1|  dehydration responsive factor 1                       90.5    5e-18   
ref|NP_001280947.1|  dehydration-responsive element-binding prote...  93.2    5e-18   
ref|XP_006295384.1|  hypothetical protein CARUB_v10024477mg           91.3    6e-18   
ref|XP_009369224.1|  PREDICTED: dehydration-responsive element-bi...  92.8    6e-18   
ref|XP_002960299.1|  hypothetical protein SELMODRAFT_27203            88.6    6e-18   
ref|XP_010505457.1|  PREDICTED: dehydration-responsive element-bi...  90.9    6e-18   
ref|XP_004513549.1|  PREDICTED: dehydration-responsive element-bi...  90.1    6e-18   
gb|AFI71293.1|  dehydration responsive element binding protein 2 ...  90.9    6e-18   
gb|AES67310.2|  dehydration-responsive element-binding protein        89.7    6e-18   
gb|AFK38091.1|  unknown                                               89.7    7e-18   
gb|KEH15489.1|  dehydration-responsive element-binding protein        89.4    8e-18   
emb|CBH19568.1|  AP2 domain containing protein                        89.7    9e-18   
gb|ABC49682.1|  dehydration responsive element binding protein        89.4    9e-18   
gb|AFI71303.1|  dehydration responsive element binding protein 3      90.9    9e-18   
gb|ACR22834.1|  dehydration responsive factor 1                       89.7    9e-18   
gb|AEI54688.1|  AP2/EREBP protein                                     90.9    9e-18   
gb|AHI45171.1|  DREB group protein                                    92.0    1e-17   
ref|XP_004492501.1|  PREDICTED: uncharacterized protein LOC101505842  92.8    1e-17   
ref|XP_002967414.1|  hypothetical protein SELMODRAFT_38483            85.9    1e-17   
gb|ADV57357.1|  putative dehydration responsive element binding p...  89.4    1e-17   
gb|ACN27284.1|  unknown                                               89.7    1e-17   
gb|AFU07643.1|  ethylene-responsive element binding factor 6          91.7    1e-17   
ref|XP_010091874.1|  Dehydration-responsive element-binding prote...  93.2    1e-17   
emb|CDX93190.1|  BnaC04g47060D                                        89.0    2e-17   
ref|XP_009345422.1|  PREDICTED: dehydration-responsive element-bi...  91.3    2e-17   
emb|CAB93939.1|  AP2-domain DNA-binding protein                       90.9    2e-17   
ref|XP_001766084.1|  predicted protein                                85.5    2e-17   
gb|AFK47592.1|  unknown                                               88.2    2e-17   
ref|XP_006854296.1|  hypothetical protein AMTR_s00039p00088760        89.0    2e-17   
ref|XP_010327720.1|  PREDICTED: dehydration-responsive element-bi...  87.4    2e-17   
gb|KCW49415.1|  hypothetical protein EUGRSUZ_K02952                   87.8    2e-17   
emb|CDY71905.1|  BnaCnng75020D                                        88.6    3e-17   
ref|XP_009143395.1|  PREDICTED: dehydration-responsive element-bi...  88.6    3e-17   
ref|XP_007140202.1|  hypothetical protein PHAVU_008G092800g           91.7    3e-17   
ref|XP_001781003.1|  predicted protein                                84.7    3e-17   
gb|AFJ14634.1|  dehydration-responsive element-binding protein (D...  90.9    3e-17   
gb|AFJ14633.1|  dehydration-responsive element-binding protein (D...  91.7    3e-17   
ref|XP_010517125.1|  PREDICTED: dehydration-responsive element-bi...  88.6    3e-17   
ref|XP_003597059.1|  Dehydration responsive factor                    88.6    4e-17   
gb|KFK36732.1|  hypothetical protein AALP_AA4G162500                  88.2    4e-17   
ref|XP_008354169.1|  PREDICTED: dehydration-responsive element-bi...  90.1    5e-17   
gb|AFJ14632.1|  dehydration-responsive element-binding protein (D...  90.1    5e-17   
ref|XP_007216412.1|  hypothetical protein PRUPE_ppa022733mg           86.3    5e-17   
gb|AFS60111.1|  DREB2                                                 90.1    5e-17   
ref|XP_002980956.1|  hypothetical protein SELMODRAFT_420500           87.4    6e-17   
ref|XP_007026573.1|  Uncharacterized protein TCM_021596               91.3    6e-17   
ref|NP_001240238.1|  uncharacterized protein LOC100783729             87.4    6e-17   
ref|XP_009788693.1|  PREDICTED: dehydration-responsive element-bi...  89.0    6e-17   
gb|AGI78251.1|  dehydration responsive element binding protein 2      89.7    7e-17   
ref|XP_008230119.1|  PREDICTED: putative dehydration-responsive e...  86.7    7e-17   
ref|XP_010676822.1|  PREDICTED: dehydration-responsive element-bi...  88.6    8e-17   
ref|XP_010509186.1|  PREDICTED: dehydration-responsive element-bi...  87.8    8e-17   
ref|XP_002989303.1|  hypothetical protein SELMODRAFT_427925           86.7    8e-17   
emb|CDP13966.1|  unnamed protein product                              88.6    9e-17   
ref|XP_002273838.1|  PREDICTED: dehydration-responsive element-bi...  88.6    9e-17   
ref|XP_009612863.1|  PREDICTED: dehydration-responsive element-bi...  88.6    1e-16   
gb|AFU35564.1|  DRE-binding protein 2D;1                              89.7    1e-16   
ref|XP_004491005.1|  PREDICTED: dehydration-responsive element-bi...  89.0    1e-16   
ref|XP_010087025.1|  Dehydration-responsive element-binding prote...  88.2    1e-16   
ref|XP_006411292.1|  hypothetical protein EUTSA_v10016913mg           87.8    1e-16   
ref|XP_004487356.1|  PREDICTED: dehydration-responsive element-bi...  85.5    2e-16   
ref|XP_007132590.1|  hypothetical protein PHAVU_011G107800g           85.5    2e-16   
emb|CDY54455.1|  BnaAnng13220D                                        86.3    2e-16   
ref|XP_011084866.1|  PREDICTED: dehydration-responsive element-bi...  87.8    2e-16   



>ref|XP_009767687.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
Length=249

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 153/244 (63%), Gaps = 26/244 (11%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT+ENSYDAAVA
Sbjct  16   QATSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFENSYDAAVA  75

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++GA AKLNLPHL+  +    S    S      L+N    + +P TC      
Sbjct  76   YDAAARKLYGADAKLNLPHLYNKQAQAQSQAQNSRPNTMGLDNAGGPVSAPPTCN-----  130

Query  462  STVPAAYGNCASSSTSSAHHQNASI-FNGD-NSSVISPAAPPPLQNIKLPKLDMNEKAPE  289
               PAA  N AS ST S  + + S  FN D  ++  S A     Q      LD+N+ A E
Sbjct  131  ---PAAVYNVASPSTWSMGNDHTSFYFNNDFGNNSFSTADQTSFQ-----FLDINQTAEE  182

Query  288  ------NEVEG----MWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKMWTA  139
                  N+ EG    MW   N+N LPEIDDSS+W EA A++  Q AV+DPGI+   +   
Sbjct  183  FDENNINQNEGIGGEMWRDLNMN-LPEIDDSSIWEEAKASTSFQEAVSDPGIYACNLDDG  241

Query  138  VDYP  127
            ++YP
Sbjct  242  INYP  245



>ref|XP_009598034.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana tomentosiformis]
Length=251

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 151/242 (62%), Gaps = 20/242 (8%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT+ENSYDAAVA
Sbjct  16   QATSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFENSYDAAVA  75

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++GA AKLNLPHL+  +    +    S      L+N    + +P TC      
Sbjct  76   YDAAARKLYGADAKLNLPHLYNKQAQAQAQAHNSRPNTMGLDNAGGPVSAPPTCN-----  130

Query  462  STVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPE--  289
               PAA  N AS ST S  + + S +  ++    + +       +    LD+N+ A E  
Sbjct  131  ---PAAVYNVASPSTWSMGNDHTSFYFNNDFGNNNFSTGDQ-DLVSFQFLDINQTAEEFG  186

Query  288  ----NEVEG----MWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKMWTAVD  133
                N+ EG    MW   N+N LPEIDDSS+W EA AT+  Q AV+DPGI+   +   ++
Sbjct  187  ENNINQNEGIGGEMWRDLNMN-LPEIDDSSIWEEAKATTSFQEAVSDPGIYACNLDDGIN  245

Query  132  YP  127
            YP
Sbjct  246  YP  247



>emb|CDP07457.1| unnamed protein product [Coffea canephora]
Length=257

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 117/251 (47%), Positives = 150/251 (60%), Gaps = 31/251 (12%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENASC YKGVRQRTWGKWV EIREPNRGSR+WLGT++ S++AA+A
Sbjct  19   QASSRKGCMRGKGGPENASCAYKGVRQRTWGKWVAEIREPNRGSRLWLGTFDTSHEAAIA  78

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G  AKLNLPHL+     P  + V S+     LN  + +    E   + +G 
Sbjct  79   YDAAARKLYGTAAKLNLPHLYRR---PQHIPVYST-----LNTTTPIDTGGE---NQTGL  127

Query  462  STVP---AAYGNCASSSTSSAHHQ---NASIF-----NGDNSSVISPAAPPPLQNIKLPK  316
              VP   + + N ASSS SS   Q   N  +F     N   +  ++      + ++    
Sbjct  128  RPVPFQQSPFRNFASSSNSSYPPQCQPNERLFFQTETNATTTGYLAGTTTAGVTSVPNDN  187

Query  315  LDMNE-------KAPENEVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFD  157
             +  +       ++ E  + GMW   N N LP IDDSS+WAEA A S  QAAVTDPGIF 
Sbjct  188  NNFVDDNGNEAVESEEGTMRGMWNKLNAN-LPAIDDSSIWAEAQAASPFQAAVTDPGIFG  246

Query  156  GKMWTAVDYPW  124
            G    + +YPW
Sbjct  247  GNFEDS-NYPW  256



>ref|XP_009621512.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana tomentosiformis]
Length=216

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 138/235 (59%), Gaps = 35/235 (15%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG R+WLGT+E S+DAAVA
Sbjct  15   QAASRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGPRLWLGTFETSHDAAVA  74

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDA AR ++G  AKLN PHL      P S G  SS         +     PET       
Sbjct  75   YDAVARKLYGDNAKLNFPHLNTKNQAPNSTGSSSS---------TYCNGVPETV------  119

Query  462  STVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENE  283
                    N  + S   ++   +S ++   +S        PL + K  + D N++     
Sbjct  120  --------NMVNESLFFSNDSRSSCYSAGQASF-------PLPDNKKVEDDNNDEGVG--  162

Query  282  VEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKMWTAVDY-PWY  121
              GMW   N+N LPEIDDSS+WAEA AT+  Q AV +PG+F G +   ++Y PWY
Sbjct  163  FGGMWEDLNVN-LPEIDDSSIWAEAKATTLFQ-AVNEPGMFAGNLGDGIEYPPWY  215



>ref|XP_004238613.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Solanum lycopersicum]
Length=248

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 141/228 (62%), Gaps = 15/228 (7%)
 Frame = -1

Query  819  AVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavay  640
            A SRKGCMRGKGGPENA+CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++NSYDAAV Y
Sbjct  11   ATSRKGCMRGKGGPENANCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDNSYDAAVVY  70

Query  639  daaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGGS  460
            DAAA  ++GA+AKLNLPHL+ N+    +    S  P   + +PS L P   T A  S  S
Sbjct  71   DAAALKLYGAEAKLNLPHLYNNQAQAQAQIQNSK-PITIM-SPS-LSPVSTTTAQASSPS  127

Query  459  TVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKL-------DMNE  301
             V + Y N AS ST S    ++S +   +   I    P     I + K        +   
Sbjct  128  -VTSVY-NVASPSTWSVGSDDSSFYFNSHDFGIHNDIPSAFNLIDINKTADDYSVDNATN  185

Query  300  KAPENEVEG--MWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGI  163
                +EV G  M+   N+N LPEIDDSS+W EA AT+  Q AV DPGI
Sbjct  186  NNQSSEVLGGEMFRDLNMN-LPEIDDSSIWEEAKATTSFQEAVNDPGI  232



>ref|XP_006342227.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Solanum tuberosum]
Length=262

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 147/252 (58%), Gaps = 25/252 (10%)
 Frame = -1

Query  819  AVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavay  640
            A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++NSYDAAV Y
Sbjct  11   ATSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDNSYDAAVVY  70

Query  639  daaARYIFGAKAKLNLPHLWE---NEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGS  469
            DAAA  ++GA+AKLNLPHL+     +       + +S P   + +PS L P   T     
Sbjct  71   DAAALKLYGAEAKLNLPHLYSIPAQDQSQAQSQIQNSRPITIM-SPS-LAPVSATAPASV  128

Query  468  GGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAA---PPPLQNIKLPK------  316
                VP+ Y N AS ST S    ++  FN  +  + + +A   P     I + K      
Sbjct  129  PAPPVPSVY-NVASPSTWSVGTDSSLYFNDHDFGISNFSANDIPSAFNLIDINKTADDHP  187

Query  315  ---LDMNEKAPENEVEG------MWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGI  163
               +  N+ A  N          M+   N+N LPEIDDSS+W EA AT+  Q AV DPGI
Sbjct  188  DEFVVKNDNATNNNQSSQGLGGEMFRDLNMN-LPEIDDSSIWEEAKATTSFQEAVNDPGI  246

Query  162  FDGKMWTAVDYP  127
                +   +++P
Sbjct  247  GGYNLDDGLNFP  258



>ref|XP_009767453.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
 ref|XP_009767454.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
 ref|XP_009767455.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
 ref|XP_009767456.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
 ref|XP_009767457.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
 ref|XP_009767458.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nicotiana sylvestris]
Length=208

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 132/239 (55%), Gaps = 51/239 (21%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG R+WLGT+E S+DAA+A
Sbjct  15   QATSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGPRLWLGTFETSHDAAMA  74

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDA A  ++G  AKLN                G +      +  S  +P           
Sbjct  75   YDAVAHKLYGDNAKLNF---------------GQNSTGSSSSTYSTGVP-----------  108

Query  462  STVPAAYGNCASSSTSSAHHQNASIF--NGDNSSVIS--PAAPPPLQNIKLPKLDMNEKA  295
                            +   +N S+F  N   SS  S   A+ P L N K+ + + +E  
Sbjct  109  ---------------ETVKMENESLFFNNDFESSCYSGGQASFPLLDNKKVEEDNSDEGV  153

Query  294  PENEVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKMWTAVDY-PWY  121
                  GMW   N+N LPEIDDSS+WAEA AT+  Q AV +PG+F G +   ++Y PWY
Sbjct  154  G---FGGMWEDLNVN-LPEIDDSSIWAEAKATTLFQ-AVNEPGMFPGNLGDGIEYPPWY  207



>ref|XP_003527879.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Glycine max]
 gb|KHN22218.1| Dehydration-responsive element-binding protein 2D [Glycine soja]
Length=249

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 140/245 (57%), Gaps = 28/245 (11%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT+E S++AA+A
Sbjct  19   QASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSHEAALA  78

Query  642  ydaaARYIFGAKAKLNLPHL---WENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADG  472
            YDAAAR ++G+ AKLNLP L    +++ PPP   V ++   P++ N  Q + +     D 
Sbjct  79   YDAAARKLYGSDAKLNLPELSIKSQSQCPPPPSSVSNNTQIPQMENLQQQIQN--NYMDM  136

Query  471  SGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAP  292
            +  S       N  S  + ++      +    + S++S           LP LD N K  
Sbjct  137  ATCSNNFNNNTNNPSEVSMASQQVGVGVPIYTSDSIVS-----------LP-LDTNPKPV  184

Query  291  EN--EVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF-------DGKMWTA  139
            EN  +    WGT N  GLP  DD S+WAEA  + D      +  I+       D  +W +
Sbjct  185  ENDGDFRPSWGTMN-EGLPVFDD-SIWAEAAMSLDFPQIAAETAIYSSGNNLADVGVWDS  242

Query  138  VDYPW  124
            +  PW
Sbjct  243  LQTPW  247



>ref|XP_002510462.1| Dehydration-responsive element-binding protein 2G, putative [Ricinus 
communis]
 gb|EEF52649.1| Dehydration-responsive element-binding protein 2G, putative [Ricinus 
communis]
Length=247

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 139/238 (58%), Gaps = 19/238 (8%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AA+A
Sbjct  22   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAAMA  81

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G +AKLNLP L  ++   P+    S          SQL    ++    + G
Sbjct  82   YDAAARKLYGPEAKLNLPELHSSKNKVPASSANSQ--------ASQLGNRSQSQILHNSG  133

Query  462  STVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENE  283
            +T P++     +++  +  +   SI +  N++V    A     N         E A  NE
Sbjct  134  ATCPSSGPIIRANNLVTPAYSYDSIVSFPNANVDCCNANVAESNEASIYGQNQEGAGINE  193

Query  282  VEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF-----DGKMWTAVDYPW  124
               +W   N+N LP  DD S+WAEA  + D   A+ DPGIF     DG  W A+  PW
Sbjct  194  ---LWENLNVN-LPLFDD-SIWAEAAMSIDF-PAMEDPGIFASNLMDGTNWDALQTPW  245



>ref|XP_006473580.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Citrus sinensis]
Length=248

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 101/242 (42%), Positives = 136/242 (56%), Gaps = 24/242 (10%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AAVA
Sbjct  20   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAAVA  79

Query  642  ydaaARYIFGAKAKLNLPHL--WENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGS  469
            YDAAAR ++G  AKLNLP L   ++   P S    + +   R N P  +  S  TC   S
Sbjct  80   YDAAARKLYGPDAKLNLPELPSAQSHHLPASSANCTQHVAQRRNQPQMIHNSGITC---S  136

Query  468  GGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPE  289
              S +P +  N A+   +         FN +NS++  P       + KL + ++     E
Sbjct  137  SNSPLPRSSNNDATQVYN---------FNYNNSAMSFPDNGSFGSHGKLAENEVKFSLNE  187

Query  288  NEVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKM-------WTAVDY  130
             E +G W   N+N    + D S+WAEA  + D    + + G+ +G         W  +  
Sbjct  188  QETDGFWENLNVNS--PVFDESIWAEAAMSVDY-PVMGEQGLLNGNFVDASGCGWDMLPT  244

Query  129  PW  124
            PW
Sbjct  245  PW  246



>ref|XP_011083628.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Sesamum indicum]
Length=212

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 123/245 (50%), Gaps = 55/245 (22%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R   +A SRKGCMRGKGGPENA+CTYKGVRQRTWGKWV EIREPNRGSR+WLGT++ SYD
Sbjct  15   RKPAQASSRKGCMRGKGGPENAACTYKGVRQRTWGKWVAEIREPNRGSRVWLGTFDTSYD  74

Query  654  aavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCAD  475
            AAVAYD AAR ++G  AK+NLPHL+E +P                               
Sbjct  75   AAVAYDTAARKLYGPDAKVNLPHLYEEKP-------------------------------  103

Query  474  GSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKA  295
              G     A+   C   +       N  IF+   +  ISP               +N   
Sbjct  104  -QGQVQAQASVEACKMENQEYCPSSNLPIFDSFLADEISP---------------VNGYQ  147

Query  294  PENEVEGMWGTF-NLN-GLPEIDDSSMWAEATATSDIQAAVTDPGIFD-----GKMWTAV  136
               E     G   NLN  LPE+DDS +WAEA   +  Q  V +P +F      GK    V
Sbjct  148  GGGEYVSSSGILKNLNVSLPEVDDSYLWAEAAKDTSFQ-IVHEPAVFASNLDCGKDSNGV  206

Query  135  DYPWY  121
             + W+
Sbjct  207  PFTWF  211



>gb|KDO84711.1| hypothetical protein CISIN_1g036655mg [Citrus sinensis]
Length=243

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/241 (42%), Positives = 135/241 (56%), Gaps = 22/241 (9%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AA+A
Sbjct  15   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAAMA  74

Query  642  ydaaARYIFGAKAKLNLPHL--WENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGS  469
            YDAAAR ++G  AKLNLP L   ++   P S    + +   R N P  +  S  TC   S
Sbjct  75   YDAAARKLYGPDAKLNLPELPSAQSHHLPASSVNCTQHVAQRRNQPQMIHNSGITC---S  131

Query  468  GGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPE  289
              S +P +  N A+   +  ++ +A  F  DN SV S          KL + ++     E
Sbjct  132  SNSPLPRSSNNDATQVYNFNYNNSAMSF-LDNGSVGSHG--------KLAENEVKFSLNE  182

Query  288  NEVEGMWGTFNLNGLPEIDDSSMWAEATATSDI----QAAVTDPGIFDGKM--WTAVDYP  127
             E +G W   N+N    + D S+WAEA  + D     +  + +    D     W  +  P
Sbjct  183  QETDGFWENLNVNS--PVFDESIWAEAAMSVDYPVMGEQGLLNANFVDASCCGWDMLPTP  240

Query  126  W  124
            W
Sbjct  241  W  241



>ref|XP_006435084.1| hypothetical protein CICLE_v10002280mg [Citrus clementina]
 gb|ESR48324.1| hypothetical protein CICLE_v10002280mg [Citrus clementina]
Length=248

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/241 (42%), Positives = 135/241 (56%), Gaps = 22/241 (9%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AA+A
Sbjct  20   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAAMA  79

Query  642  ydaaARYIFGAKAKLNLPHL--WENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGS  469
            YDAAAR ++G  AKLNLP L   ++   P S    + +   R N P  +  S  TC   S
Sbjct  80   YDAAARKLYGPDAKLNLPELPSAQSHHLPASSVNCTQHVAQRRNQPQMIHNSGITC---S  136

Query  468  GGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPE  289
              S +P +  N A+   +  ++ +A  F  DN SV S          KL + ++     E
Sbjct  137  SNSPLPRSSNNDATQVYNFNYNNSAMSF-LDNGSVGSHG--------KLAENEVKFSLNE  187

Query  288  NEVEGMWGTFNLNGLPEIDDSSMWAEATATSDI----QAAVTDPGIFDGKM--WTAVDYP  127
             E +G W   N+N    + D S+WAEA  + D     +  + +    D     W  +  P
Sbjct  188  QETDGFWENLNVNS--PVFDESIWAEAAMSVDYPVMGEQGLLNANFVDASCCGWDMLPTP  245

Query  126  W  124
            W
Sbjct  246  W  246



>ref|XP_003523563.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Glycine max]
 gb|KHN45888.1| Dehydration-responsive element-binding protein 2D [Glycine soja]
Length=245

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 136/244 (56%), Gaps = 30/244 (12%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT+E S++AA+A
Sbjct  19   QASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSHEAALA  78

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G+ AKLNLP L  +          S  P   + N +Q + + +   +    
Sbjct  79   YDAAARKLYGSDAKLNLPEL--SIKSQSQCPPPSPPPPSSVTNNTQ-MENLQQIQNNYID  135

Query  462  STVPAAYGNCASSSTSSAHHQNAS--IFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPE  289
                + + N  +   S A  Q     I+  D  S++S           LP LD N K  E
Sbjct  136  MATCSNFNNINNPEVSMASQQVGVGPIYTSD--SIVS-----------LP-LDTNPKPVE  181

Query  288  NEVEGM--WGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF-------DGKMWTAV  136
            NEVE    W T N  GLP  DD S+WAEA  + D      +  I+       D  +W ++
Sbjct  182  NEVEFRPSWATMN-EGLPVFDD-SIWAEAAMSLDFPHIAAETAIYASGNNLADVGVWDSL  239

Query  135  DYPW  124
              PW
Sbjct  240  QTPW  243



>gb|EPS61812.1| hypothetical protein M569_12986, partial [Genlisea aurea]
Length=186

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 128/249 (51%), Gaps = 71/249 (29%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            ++  ++ R   +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRGSR+WLG
Sbjct  2    EERKTAGRKPAQASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGSRVWLG  61

Query  675  TYENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLP  496
            T++ SY+AA+AYDAAAR ++G +AK+NLPHL+E+           S     + N      
Sbjct  62   TFDTSYEAAIAYDAAARKLYGPEAKVNLPHLYEDRAAEEEEEEDGS----SIAN----FD  113

Query  495  SPETCADGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPK  316
            SPE    G GG      + +C+                              LQN     
Sbjct  114  SPENGFAGDGGE-----FASCSG----------------------------ILQN-----  135

Query  315  LDMNEKAPENEVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFD-----GK  151
            L+MN                   LPE+DDS +WAEA   +  Q  V DPG F      GK
Sbjct  136  LNMN-------------------LPEVDDSYLWAEAAKDTSFQ-IVHDPGAFASSLDYGK  175

Query  150  MWTAVDYPW  124
                V +PW
Sbjct  176  DNNGVPFPW  184



>ref|XP_010271525.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Nelumbo nucifera]
Length=200

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 121/236 (51%), Gaps = 53/236 (22%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCMRGKGGPENA CTY+GVRQRTWGKWV EIREPNRG+R+WLGT++ S DAA+AYD+
Sbjct  12   SRKGCMRGKGGPENALCTYRGVRQRTWGKWVAEIREPNRGARLWLGTFDTSRDAAIAYDS  71

Query  633  aARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGGSTV  454
            AAR ++G  AKLNLP LW  E    +  +  S P P        +PS  T          
Sbjct  72   AARKLYGKFAKLNLPELW-TEAESQAGSISESVPVP--------VPSSTTTT--------  114

Query  453  PAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENEVEG  274
                   A+ S      +  S  +G+N                           E+ +EG
Sbjct  115  -----QQAAESLLKVEPEMGSSSDGNN-------------------------LVEDGMEG  144

Query  273  MWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKM------WTAVDYPW  124
            +W   NL+ LPEI +       T T +    + DPGI+  ++      W A++ PW
Sbjct  145  IWRDMNLSLLPEIQEFPWMELPTTTMEFPVVMKDPGIWSQELLDDTTGWNALELPW  200



>ref|XP_007017661.1| Dehydration-responsive element-binding protein 2G, putative [Theobroma 
cacao]
 gb|EOY14886.1| Dehydration-responsive element-binding protein 2G, putative [Theobroma 
cacao]
Length=235

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 137/240 (57%), Gaps = 33/240 (14%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AA A
Sbjct  20   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAATA  79

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G  AKLNLP L  N   PPS    ++ P   + N +Q + +          
Sbjct  80   YDAAARKLYGLDAKLNLPELCVNPQYPPS---SANTPIAPIGNQTQNVNN----------  126

Query  462  STVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENE  283
            S   ++      ++     + N S+ +  N ++ S        N+     + N K  +NE
Sbjct  127  SGTSSSNSQIIMANDVKPVYNNDSVMSFPNENIGSQG------NLA----ENNAKFGQNE  176

Query  282  --VEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKM-----WTAVDYPW  124
              ++G W   ++N LP +DD S+WAEA  + D    + +PG F G       W A+  PW
Sbjct  177  DGIDGFWENMSVN-LPVLDD-SIWAEAAMSLDF-PVMDNPGSFTGTFVDATGWDALQSPW  233



>gb|KDP38573.1| hypothetical protein JCGZ_04498 [Jatropha curcas]
Length=233

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 134/238 (56%), Gaps = 28/238 (12%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AA+A
Sbjct  17   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAAMA  76

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G +AKLNLP L               +P    NN S+  P     A    G
Sbjct  77   YDAAARKLYGPEAKLNLPEL---------------HP----NNNSR-FPVETHSAQIQMG  116

Query  462  STVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENE  283
            +     + +   SS+ S+   +  I   D +   +  +     N  + + + N    +  
Sbjct  117  NQSQGQHNSSTMSSSPSSSSGSPIIRTNDVTPAYTHESSNTESNGTVVEEEANLWQNQQG  176

Query  282  VEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF-----DGKMWTAVDYPW  124
            ++ +WG  N+N LP  DD S+WAEA  + D   A+ D GIF     D   W A+  PW
Sbjct  177  IDDLWGNLNVN-LPLFDD-SIWAEAAMSIDF-PAMEDTGIFASNLMDVTGWDALHTPW  231



>dbj|BAJ53172.1| JHL18I08.6 [Jatropha curcas]
Length=238

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 134/238 (56%), Gaps = 28/238 (12%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AA+A
Sbjct  22   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAAMA  81

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G +AKLNLP L               +P    NN S+  P     A    G
Sbjct  82   YDAAARKLYGPEAKLNLPEL---------------HP----NNNSR-FPVETHSAQIQMG  121

Query  462  STVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENE  283
            +     + +   SS+ S+   +  I   D +   +  +     N  + + + N    +  
Sbjct  122  NQSQGQHNSSTMSSSPSSSSGSPIIRTNDVTPAYTHESSNTESNGTVVEEEANLWQNQQG  181

Query  282  VEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF-----DGKMWTAVDYPW  124
            ++ +WG  N+N LP  DD S+WAEA  + D   A+ D GIF     D   W A+  PW
Sbjct  182  IDDLWGNLNVN-LPLFDD-SIWAEAAMSIDF-PAMEDTGIFASNLMDVTGWDALHTPW  236



>ref|XP_002280893.3| PREDICTED: dehydration-responsive element-binding protein 2D 
[Vitis vinifera]
Length=228

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/244 (41%), Positives = 130/244 (53%), Gaps = 40/244 (16%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            +   +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ SY+
Sbjct  16   KKTAQASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSYE  75

Query  654  aavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCAD  475
            AA+AYDAAAR ++G +AKLNLP L   +PP  +    +  P      P  L P P     
Sbjct  76   AAIAYDAAARKLYGPEAKLNLPELCA-QPPANTQFTHNQIPPNPNITPPSLTPLPR----  130

Query  474  GSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKA  295
                             +  +  +   S+     +  + P A P           +NEK 
Sbjct  131  ----------------PNIQTPPYHKYSVVPSPATQEVPPHAKP---------TAINEKN  165

Query  294  PENE--VEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF-----DGKMWTAV  136
             EN+  +EG+W   N+  LP++DD S+W E   + D   A  D  IF     DG  W  +
Sbjct  166  GENDDGMEGVWANMNVT-LPKVDD-SLWTETLMSMDF-PAFDDTEIFGSNLVDGNSWEML  222

Query  135  DYPW  124
              PW
Sbjct  223  QSPW  226



>ref|XP_010105262.1| GTPase obg [Morus notabilis]
 gb|AHJ25990.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXC04197.1| GTPase obg [Morus notabilis]
Length=782

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 138/253 (55%), Gaps = 32/253 (13%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA+CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AA+A
Sbjct  540  QASSRKGCMRGKGGPENATCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAAMA  599

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G+ AKLNLP L  +          S+     +N+      SP   A  S  
Sbjct  600  YDAAARKLYGSDAKLNLPDLSSSSQSQSQ----SNNNNKDINSTD----SPHYHASNSAA  651

Query  462  ST----------VPAAYGNCASSSTSSAHHQNASI-----FNGDNSSVISPAAPPPLQNI  328
            ST          +P A  N  +++T+     N        F G    +   ++       
Sbjct  652  STTTILPENQTKIPQALHNSGTTTTAIVVSDNHVCYPDGGFEGRVKIIDQGSSSGGGGGG  711

Query  327  KLPKLDMNEKAPENEVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF----  160
             + K    +   E  ++G+WG+ N + LP  DD S+WAEA  + D    + + GIF    
Sbjct  712  DVHK-QARDAVEEGIIDGLWGSVNAS-LPMFDD-SIWAEAALSLDF-PIMENHGIFPGNI  767

Query  159  -DGKMWTAVDYPW  124
             DG  W A+  PW
Sbjct  768  VDGSGWEALQSPW  780



>ref|XP_007226392.1| hypothetical protein PRUPE_ppa023248mg [Prunus persica]
 gb|EMJ27591.1| hypothetical protein PRUPE_ppa023248mg [Prunus persica]
Length=255

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 133/243 (55%), Gaps = 21/243 (9%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AA A
Sbjct  22   QASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAASA  81

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G++AKLNLP  + ++ P       +++   +  NPS  L        G+  
Sbjct  82   YDAAARKLYGSQAKLNLPDQYHHQVP----SSANTHMLSQTPNPSAQLTLLHQNPSGTSS  137

Query  462  STVPAAYG---NCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAP  292
            + +   Y    N  +      H  N        +    P   P  ++ K+ K++ N    
Sbjct  138  ACLSNDYAAPLNDVAVPVLRDHFPNVKAHQPHGT---YPEPKPEAEHSKM-KVEENMSGN  193

Query  291  ENEVEGM-WGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF-----DGKMWTAVD-  133
            E    G+ WG  + N  P  DD S+W EA  + D    + D GIF     DG +W  +  
Sbjct  194  EGMESGIFWGNVSGN-FPMFDD-SIWVEAAMSLDF-PVIEDHGIFSSNFVDGSVWEPLQP  250

Query  132  YPW  124
             PW
Sbjct  251  SPW  253



>ref|XP_008388158.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=251

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 132/241 (55%), Gaps = 39/241 (16%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT+  S++AA+AYDA
Sbjct  24   SRKGCMKGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFATSFEAALAYDA  83

Query  633  aARYIFGAKAKLNLP--------------HLWENEPPPPSLGVGSSYPFPRLNNPSQLLP  496
            AAR ++G+KAKLNLP              HL +++  P S   G     P++ N + +L 
Sbjct  84   AARKLYGSKAKLNLPDQQAPNYHHHQLNQHL-QHQVFPSSANAGVP---PQIPNQTLVLN  139

Query  495  SPETCADGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPK  316
            +P   A       VP  + N  +      H      +N   +  +     P    +K+ K
Sbjct  140  NPSDIA-------VPVIHNNFPNVKVDQPHGN----YNSGGAETL-----PEQDGMKVEK  183

Query  315  LDMNEKAPENEVEGM-WGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKMWTA  139
             +M+       ++G+ WG  +    P  DD SMW EA  + D+   V D GIF G  W  
Sbjct  184  -NMSSGVNNEGMDGIFWGNMS-ESFPVFDD-SMWTEAAMSLDL-PVVADQGIFGGGSWMG  239

Query  138  V  136
            +
Sbjct  240  I  240



>ref|XP_004499266.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cicer arietinum]
Length=249

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 132/230 (57%), Gaps = 32/230 (14%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT+E S++AA+A
Sbjct  19   QASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSHEAALA  78

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADG---  472
            YDAAAR ++G+ AKLNLP L        S+   S+         +Q +P      +    
Sbjct  79   YDAAARKLYGSDAKLNLPEL--------SVTTNST--------TTQQIPQINIPHNNNNI  122

Query  471  ---SGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVIS-PAAPPPLQNIKLPKLDMN  304
               S  STV        +++ ++ +    +I++  ++S++S P     +++     +D +
Sbjct  123  KNFSVSSTVHNNNSCFNNNNNNTNNSVFGAIYSSSDNSIVSIPLEQQVVESSYTKHMDHS  182

Query  303  EKAPENEVEGMWGTFNLNG-LPEIDDSSMWAEATATSDIQAAVTDPGIFD  157
                    +  +GT N    +P +DD S+W EA  + D   ++  P I D
Sbjct  183  --------DSFFGTVNYESTMPVVDDDSIWTEAAMSLDAAISMDFPMISD  224



>gb|KCW67902.1| hypothetical protein EUGRSUZ_F01607, partial [Eucalyptus grandis]
Length=232

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 130/235 (55%), Gaps = 34/235 (14%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R   +A SRKGCMRGKGGPENASC+YKGVRQRTWGKWV EIREPNRG+R+WLGT++ S+D
Sbjct  13   RKPAQASSRKGCMRGKGGPENASCSYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHD  72

Query  654  aavaydaaARYIFGAKAKLNLPHLWEN------EPPPPSLGVGSSYPFPRLNNPSQLLPS  493
            AAVAYDAAAR ++G +AKLNLP L+        +PP P+  + +    P L N +Q+  +
Sbjct  73   AAVAYDAAARKLYGLEAKLNLPELYAAAPTTNLQPPAPAPTIANQAVHP-LGNQAQIFHN  131

Query  492  PETCADGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKL  313
                 +      VP       S+    A   +             P  P P  N+K    
Sbjct  132  --LVLNPPSAPPVPVTQAMPISNDGLQAQGND-------------PVDPVP-DNLKF---  172

Query  312  DMNEKAPENEVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKM  148
               +   EN+   +WG  N+N LP +D+ S+W EA  + D    + DP  F G  
Sbjct  173  --GQNIEEND---LWGNLNVN-LPFLDE-SIWEEAAMSVDF-PVLEDPVNFAGNF  219



>ref|XP_008347385.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=258

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 126/235 (54%), Gaps = 41/235 (17%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S +AA+A
Sbjct  22   QASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSDEAALA  81

Query  642  ydaaARYIFGAKAKLNLP--------------HLWENEPPPPSLGVGSSYPFPRLNNPSQ  505
            YD AAR ++G+ AKLNLP              HL     P P+       P P++ N + 
Sbjct  82   YDVAARKLYGSVAKLNLPEQRVPHCHQHHLNQHLQNQVVPSPA---NPCVP-PQIPNQTL  137

Query  504  LLPSPETCADGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIK  325
            +  +P      SG  T PA YG   +          A  F GDN   +    P     + 
Sbjct  138  VQNNP------SGTGTNPAGYGAXVNDI--------AVPFIGDNFLXVKADQPHGNWAVA  183

Query  324  LPKLDMNE------KAPENEVEG-MWGTFNLNGLPEIDDSSMWAEATATSDIQAA  181
            LP+    E          NE+EG +WG  + N  P  DD S+W EA  + D+ A 
Sbjct  184  LPEQGGTEVGENMSSGGNNEMEGILWGNTSGN-FPVFDD-SIWTEAAMSLDLPAV  236



>ref|XP_002302006.1| hypothetical protein POPTR_0002s03090g [Populus trichocarpa]
 gb|EEE81279.1| hypothetical protein POPTR_0002s03090g [Populus trichocarpa]
Length=240

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 125/221 (57%), Gaps = 19/221 (9%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGTY+ S++AA+A
Sbjct  20   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTYDTSHEAAMA  79

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G +AKLNLP L  N    P+    +S      N PS L+       + S  
Sbjct  80   YDAAARKLYGPEAKLNLPELQVNSSQFPA-SPANSQVIQMTNQPSHLI------QNSSPT  132

Query  462  STVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENE  283
            ST  +   N  S+      + +  I +  N SV S      ++N      D N     + 
Sbjct  133  STYSSNIPNMESNEAKPILYNHNPIMSFSNESVDSNGM--EVEN------DANFGRSGDV  184

Query  282  VEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF  160
            ++      N+N      + S+WAEA  + +    + DPGIF
Sbjct  185  IKEFSANLNVN---MTFNDSIWAEAALSINF-PVMDDPGIF  221



>ref|XP_010064559.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Eucalyptus grandis]
Length=235

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 136/249 (55%), Gaps = 40/249 (16%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R   +A SRKGCMRGKGGPENASC+YKGVRQRTWGKWV EIREPNRG+R+WLGT++ S+D
Sbjct  13   RKPAQASSRKGCMRGKGGPENASCSYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHD  72

Query  654  aavaydaaARYIFGAKAKLNLPHLWEN------EPPPPSLGVGSSYPFPRLNNPSQLLPS  493
            AAVAYDAAAR ++G +AKLNLP L+        +PP P+  + +    P L N +Q+  +
Sbjct  73   AAVAYDAAARKLYGLEAKLNLPELYAAAPTTNLQPPAPAPTIANQAVHP-LGNQAQIFHN  131

Query  492  PETCADGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKL  313
                 +      VP       S+    A   +             P  P P  N+K    
Sbjct  132  --LVLNPPSAPPVPVTQAMPISNDGLQAQGND-------------PVDPVP-DNLKF---  172

Query  312  DMNEKAPENEVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDP-----GIFDGKM  148
               +   EN+   +WG  N+N LP +D+ S+W EA  + D    + DP        DG  
Sbjct  173  --GQNIEEND---LWGNLNVN-LPFLDE-SIWEEAAMSVDF-PVLEDPVNFAGNFLDGNP  224

Query  147  W-TAVDYPW  124
            W +++  PW
Sbjct  225  WESSLPSPW  233



>ref|XP_008377237.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=258

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 126/235 (54%), Gaps = 41/235 (17%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S +AA+A
Sbjct  22   QASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSDEAALA  81

Query  642  ydaaARYIFGAKAKLNLP--------------HLWENEPPPPSLGVGSSYPFPRLNNPSQ  505
            YD AAR ++G+ AKLNLP              HL     P P+    +    P++ N + 
Sbjct  82   YDVAARKLYGSVAKLNLPEQRVPHCHQHHLNQHLQNQVVPSPA----NPXVXPQIPNQTL  137

Query  504  LLPSPETCADGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIK  325
            +  +P      SG  T PA Y         +  +  A  F GDN   +    P     + 
Sbjct  138  VQNNP------SGTGTNPAGY--------XAXVNDIAVPFIGDNFLXVKADQPHGNWAVA  183

Query  324  LPKLDMNE------KAPENEVEG-MWGTFNLNGLPEIDDSSMWAEATATSDIQAA  181
            LP+    E          NE+EG +WG  + N  P  DD S+W EA  + D+ A 
Sbjct  184  LPEQGGTEVGENMSSGGNNEMEGILWGNTSGN-FPVFDD-SIWTEAXMSLDLPAV  236



>ref|XP_008444762.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Cucumis melo]
Length=211

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  843  SSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYEN  664
            S+ ++N +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ 
Sbjct  7    SNNKNNKKASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDT  66

Query  663  SydaavaydaaARYIFGAKAKLNLPHL  583
            SYDAA+AYD AAR ++G+ AKLNLP +
Sbjct  67   SYDAALAYDNAARRLYGSDAKLNLPLI  93



>ref|XP_004152768.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis sativus]
 ref|XP_004172094.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis sativus]
Length=164

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  843  SSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYEN  664
            S+ ++N +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ 
Sbjct  7    SNNKNNKKASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDT  66

Query  663  SydaavaydaaARYIFGAKAKLNLPHL  583
            S+DAA+AYD AAR ++G+ AKLNLP +
Sbjct  67   SHDAALAYDNAARRLYGSDAKLNLPLI  93



>ref|XP_009104705.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Brassica rapa]
 emb|CDX68128.1| BnaA07g21680D [Brassica napus]
Length=204

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 110/207 (53%), Gaps = 58/207 (28%)
 Frame = -1

Query  819  AVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavay  640
            A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT+E S +AA+AY
Sbjct  22   ASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSREAALAY  81

Query  639  daaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGGS  460
            D+AAR ++G +A LNLP                            L   PET + G+  S
Sbjct  82   DSAARKLYGPEAHLNLPE--------------------------SLRSYPETASPGTQVS  115

Query  459  TVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENEV  280
              P++                       N+S  S    P L N      +M+     +E+
Sbjct  116  QTPSS-----------------------NTSAKSSEESPRLSN------EMSSWGTRSEI  146

Query  279  EGMWGTFNLNGLPEIDDSSMWAEATAT  199
               W   N++ LP  DDSS+W EAT +
Sbjct  147  S--WEHMNVD-LPVTDDSSIWEEATMS  170



>ref|XP_007160709.1| hypothetical protein PHAVU_001G010400g [Phaseolus vulgaris]
 gb|ESW32703.1| hypothetical protein PHAVU_001G010400g [Phaseolus vulgaris]
Length=265

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 5/95 (5%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA+CT+KGVRQRTWGKWV EIREPNRG+R+WLGT+E S +AA+A
Sbjct  19   KASSRKGCMRGKGGPENATCTFKGVRQRTWGKWVAEIREPNRGARLWLGTFETSLEAAMA  78

Query  642  ydaaARYIFGAKAKLNLPHL-----WENEPPPPSL  553
            YD AAR ++G+ AKLNLP L     ++  PP PSL
Sbjct  79   YDGAARKLYGSDAKLNLPELPLLFNFQFPPPNPSL  113



>gb|KGN62640.1| hypothetical protein Csa_2G363010 [Cucumis sativus]
Length=212

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  843  SSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYEN  664
            S+ ++N +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ 
Sbjct  7    SNNKNNKKASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDT  66

Query  663  SydaavaydaaARYIFGAKAKLNLPHL  583
            S+DAA+AYD AAR ++G+ AKLNLP +
Sbjct  67   SHDAALAYDNAARRLYGSDAKLNLPLI  93



>ref|XP_011048848.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Populus euphratica]
Length=244

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 129/222 (58%), Gaps = 20/222 (9%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+RIWLGT++ S++AA A
Sbjct  23   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARIWLGTFDTSHEAATA  82

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLN-NPSQLLPSPETCADGSG  466
            YDAAAR ++G +AKLNLP L  N    P+    +++   ++   P Q++ +  +      
Sbjct  83   YDAAARKLYGPEAKLNLPELQVNNCQFPA--SPANFQATQMTCQPCQIIHNCSSTTSACS  140

Query  465  GSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPEN  286
             +T      +  S   +   + +  I    N SV S      ++ +     ++N    E 
Sbjct  141  SNT-----PSIESIEMAPMLYNHDPIMYFSNESVDSGG----MEAVN----EVNFGRSEV  187

Query  285  EVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF  160
            E++  W  FN+N +P   D S+W EA  + +    V DPGIF
Sbjct  188  EIKEFWSNFNVN-IP--FDDSIWVEAAMSINF-PVVEDPGIF  225



>ref|XP_003589344.1| Ethylene-responsive transcription factor ERF071 [Medicago truncatula]
 gb|AES59595.1| AP2 domain class transcription factor [Medicago truncatula]
Length=271

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT+E S++AA+A
Sbjct  19   QASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSHEAALA  78

Query  642  ydaaARYIFGAKAKLNLPHL  583
            YDAAAR ++G+ AKLNLP L
Sbjct  79   YDAAARKLYGSDAKLNLPEL  98



>ref|XP_002306897.2| hypothetical protein POPTR_0005s25470g [Populus trichocarpa]
 gb|ABP64694.1| putative DRE-binding protein 5 [Populus trichocarpa]
 gb|EEE93893.2| hypothetical protein POPTR_0005s25470g [Populus trichocarpa]
Length=244

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 124/221 (56%), Gaps = 18/221 (8%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AA A
Sbjct  23   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAATA  82

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G +AKLNLP L  N    P+    S         P Q++ +  +       
Sbjct  83   YDAAARKLYGPEAKLNLPELQVNNCQFPASPANSQVT-QMTYQPCQIIHNCSSTT-----  136

Query  462  STVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENE  283
            ST  +   +  S   +   + +  I    N SV S          K    ++N    E E
Sbjct  137  STCSSNTPSIESIEMTPMLYNHDPIMYFSNESVDSDG--------KGAVNEVNFGRSEVE  188

Query  282  VEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF  160
            ++  W  FN+N +P   D S+W EA  + +    V DPGIF
Sbjct  189  IKEFWSNFNVN-IP--FDDSIWVEAAMSINF-PVVEDPGIF  225



>ref|XP_008221333.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Prunus mume]
Length=352

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 134/239 (56%), Gaps = 20/239 (8%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S++AA+A
Sbjct  111  QASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSHEAALA  170

Query  642  ydaaARYIFGAKAKLNLP-HLWENEPPPPSLGVGSS---YPFPRLNNPS---QLLPSPET  484
            YDAAAR ++G++AKLNLP  L  +        V SS   +  P+  NPS    LL    +
Sbjct  171  YDAAARKLYGSEAKLNLPDQLVPHCHHHHHHQVPSSANTHMLPQTPNPSAQLTLLHQNPS  230

Query  483  CADGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMN  304
                +G S   AA  N  +      H+ N        +    P   P  ++ K+ K++ N
Sbjct  231  GTSSAGLSNDYAAPLNNVAVPVLRDHYPNVKAHQPHGT---YPEPKPEAEHSKM-KVEEN  286

Query  303  EKAPENEVEGM-WGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF-----DGKMW  145
                E    G+ WG  + N  P  DD S+WAEA  + D    + D GIF     DG  W
Sbjct  287  MSGNEGMDSGIFWGNVSGN-FPMFDD-SIWAEAAMSLDF-PVIEDHGIFSSNSVDGSGW  342



>ref|XP_008388157.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=279

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 130/246 (53%), Gaps = 36/246 (15%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ SY+AA+AYDA
Sbjct  38   SRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSYEAALAYDA  97

Query  633  aARYIFGAKAKLNLP--------HLWENE-------PPPPSLGVGSSYPFPRL--NNPSQ  505
            AAR ++G++AKLNLP        H   N+       P   + GV    P   L  NNPS 
Sbjct  98   AARKLYGSEAKLNLPDQQAPNYHHYQLNQHLQHQVFPSSANAGVPPQIPNQTLVQNNPSG  157

Query  504  LLPSPETCADGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIK  325
               +P   A       VP  + N  +        Q    +N   + ++       ++N  
Sbjct  158  TGTNPACYAPPVKDIAVPVVHNNFPNVKVD----QPLGNYNSGGAEILPEQGGMKVEN--  211

Query  324  LPKLDMNEKAPENEVEGM-WGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF----  160
                +M+       ++G+ WG  +    P  DD S+W EA  + D+   V D GIF    
Sbjct  212  ----NMSSGVTNEGMDGIFWGNMS-ESFPVFDD-SIWTEAAMSLDL-PGVADQGIFGCGF  264

Query  159  -DGKMW  145
             DG  W
Sbjct  265  MDGNFW  270



>ref|XP_011029080.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Populus euphratica]
Length=212

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPN G+R+WLGTY+ S++AA+A
Sbjct  23   QASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNCGARLWLGTYDTSHEAAMA  82

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLP-SPETCADGSG  466
            YDAAAR ++G +AKLNLP L  N    P+    +S      N PS L+  S  TC D +G
Sbjct  83   YDAAARKLYGPEAKLNLPELQVNRSQFPA-SPANSQVIQMTNQPSLLIQNSIPTCVDSNG  141



>gb|EYU32882.1| hypothetical protein MIMGU_mgv1a018624mg [Erythranthe guttata]
Length=215

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R   +A SRKGCMRGKGGPENA+CTYKGVRQRTWGKWV EIREPNRGSR+WLGT++ S++
Sbjct  15   RKLAQASSRKGCMRGKGGPENAACTYKGVRQRTWGKWVAEIREPNRGSRVWLGTFDTSHE  74

Query  654  aavaydaaARYIFGAKAKLNLPHL  583
            AAVAYDAAAR ++G  AK+NLPHL
Sbjct  75   AAVAYDAAARKLYGPDAKVNLPHL  98



>ref|XP_010416439.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Camelina sativa]
Length=206

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  16   KQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  75

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYP  532
            +AA+AYD+AAR ++G +A LNLP  + + P  PS     + P
Sbjct  76   EAALAYDSAARKLYGPEAHLNLPESFRSYPETPSSQASQTTP  117



>ref|XP_009336823.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Pyrus x bretschneideri]
Length=225

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 119/239 (50%), Gaps = 65/239 (27%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT+  SY+AA+AYDA
Sbjct  28   SRKGCMKGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFATSYEAALAYDA  87

Query  633  aARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGGSTV  454
            AAR ++G+KAKLNLP   + + P        +Y   +LN                     
Sbjct  88   AARKLYGSKAKLNLP---DQQAP--------NYRHRQLN---------------------  115

Query  453  PAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKL---------PKLDMNE  301
                            H    +F     S  +P  PP + N  L         P  + N 
Sbjct  116  ---------------QHLQHQVF----PSSANPGVPPQIPNQTLVQNNPSVDRPHGNYNS  156

Query  300  KAPEN--EVEGMWGTF--NLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKMWTAV  136
               E   E +GM G F  N++    + D SMW EA  + D+   V D GIF    W  +
Sbjct  157  GGAETPPEQDGMDGIFWGNMSESFPVFDDSMWTEAAMSLDL-PVVADQGIFGSGSWMGI  214



>ref|XP_009336842.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Pyrus x bretschneideri]
Length=279

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 129/246 (52%), Gaps = 36/246 (15%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ SY+AA+AYDA
Sbjct  38   SRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSYEAALAYDA  97

Query  633  aARYIFGAKAKLNLP--------HLWENE-------PPPPSLGVGSSYPFPRL--NNPSQ  505
            AAR ++G++AKLNLP        H   N+       P P + GV    P   L  NNPS 
Sbjct  98   AARKLYGSEAKLNLPDQQAPNYHHYQLNQHLQHQVFPSPANPGVPPQIPNQTLVQNNPSG  157

Query  504  LLPSPETCADGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIK  325
               +P   A       VP  + N  +        Q    +N   +  +       ++N  
Sbjct  158  TGTNPACYAAPVKDIAVPVIHNNFPNVKVD----QPLGNYNSGGAETLPEQGGMKVEN--  211

Query  324  LPKLDMNEKAPENEVEGM-WGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF----  160
                +M+       ++ + WG  +    P  DD S+W EA  + D+   V D GIF    
Sbjct  212  ----NMSSGVTNEGIDRIFWGNIS-ESFPVFDD-SIWTEAAMSLDL-PGVADQGIFGCGF  264

Query  159  -DGKMW  145
             DG  W
Sbjct  265  VDGNFW  270



>ref|XP_007136043.1| hypothetical protein PHAVU_009G013200g [Phaseolus vulgaris]
 gb|ESW08037.1| hypothetical protein PHAVU_009G013200g [Phaseolus vulgaris]
Length=249

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            +   +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT+E S+D
Sbjct  15   KKTAQASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSHD  74

Query  654  aavaydaaARYIFGAKAKLNLPHL  583
            AA+AYDAAAR ++G  AKLNLP L
Sbjct  75   AALAYDAAARKLYGPDAKLNLPDL  98



>emb|CAN60823.1| hypothetical protein VITISV_037056 [Vitis vinifera]
Length=178

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ SY+AA+A
Sbjct  14   QASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSYEAAIA  73

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPS  508
            YDAAAR ++G +AKLNLP L    P           P P + +PS
Sbjct  74   YDAAARKLYGPEAKLNLPELCAQPPANTQFTHNQIPPNPNITSPS  118



>ref|XP_010428577.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Camelina sativa]
Length=205

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  16   KQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  75

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYP  532
            +AA+AYD+AAR ++G +A LNLP    + P  PS     + P
Sbjct  76   EAALAYDSAARKLYGPEAHLNLPESLRSYPDTPSSQTSQTTP  117



>ref|XP_010471662.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Camelina sativa]
Length=205

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  16   KQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  75

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYP  532
            +AA+AYD+AAR ++G +A LNLP    + P  PS     + P
Sbjct  76   EAALAYDSAARKLYGPEAHLNLPESLRSYPETPSSQTSQTTP  117



>gb|KFK41984.1| hypothetical protein AALP_AA2G197300 [Arabis alpina]
Length=211

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  15   KQRTVQASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  74

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLN  517
            +AA+AYD+AAR ++G +A LNLP      P   S G   S   P  N
Sbjct  75   EAALAYDSAARKLYGPEAHLNLPESLRCYPERASSGRVLSQTTPSSN  121



>ref|XP_006390299.1| hypothetical protein EUTSA_v10019142mg [Eutrema salsugineum]
 gb|ESQ27585.1| hypothetical protein EUTSA_v10019142mg [Eutrema salsugineum]
Length=205

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  16   KQRTVQASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  75

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPSLG  550
            +AA+AYD+AAR ++G +A LNLP    + P   S G
Sbjct  76   EAALAYDSAARKLYGPEAHLNLPESKRSYPDTASSG  111



>emb|CDY64211.1| BnaC06g43980D [Brassica napus]
Length=206

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  16   KQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  75

Query  657  daavaydaaARYIFGAKAKLNLPH  586
            +AA+AYD+AAR ++G +A LN+PH
Sbjct  76   EAALAYDSAARKLYGPEAHLNIPH  99



>ref|XP_009351419.1| PREDICTED: dehydration-responsive element-binding protein 2D-like, 
partial [Pyrus x bretschneideri]
Length=123

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT+++S++AA+A
Sbjct  27   QASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDSSHEAALA  86

Query  642  ydaaARYIFGAKAKLNLP  589
            YDAAAR ++G+ AKLNLP
Sbjct  87   YDAAARKLYGSGAKLNLP  104



>ref|XP_010674522.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Beta vulgaris subsp. vulgaris]
Length=242

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 119/221 (54%), Gaps = 30/221 (14%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
             A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT+  S++AA+A
Sbjct  21   HASSRKGCMRGKGGPENALCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFNTSHEAALA  80

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGG  463
            YDAAAR ++G+ AKLNLP L+   P  PS+         +         +       S  
Sbjct  81   YDAAARKLYGSDAKLNLPELY--PPQLPSMTQVQVQAQAQAKAAQAQAQNGYNAGCSSDN  138

Query  462  STVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENE  283
            S++  A      S  S    +  SI    +S+  S                 +E   ENE
Sbjct  139  SSLSGA------SDISFPTEETNSISTNTDSATTS-----------------SESFGENE  175

Query  282  V---EGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDP  169
            V    G+W   N + LPE+DD ++WAE   T     +V +P
Sbjct  176  VGINHGLWENPNPS-LPELDD-TLWAETAMTLGFPPSVIEP  214



>ref|XP_008366770.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=270

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 96/241 (40%), Positives = 124/241 (51%), Gaps = 14/241 (6%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCMRGKGGPENA CTYKGVRQR WGKWV EIREPNRG R+WLGTY+ SY+AA+AYDA
Sbjct  29   SRKGCMRGKGGPENAMCTYKGVRQRMWGKWVAEIREPNRGPRLWLGTYDTSYEAALAYDA  88

Query  633  aARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYP-FPRLNNPS---QLLPSPETCADGSG  466
            AAR ++G++A+LNLP     +  P  L     +  FP   NP    Q+        + SG
Sbjct  89   AARKLYGSEAQLNLPDQQAPKYHPHQLNQHPQHQVFPSSANPRVPPQIPNQTLVQNNPSG  148

Query  465  GSTVPAAYGNCASSSTSSAHHQ---NASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKA  295
              T PA Y            H    NA +     +     A   P Q  +  + +M+   
Sbjct  149  TGTNPACYAPPVKDIAVPVIHNNFPNAKVDQPHGNYNSGGAETLPEQGGRKVEKNMSSGV  208

Query  294  PENEVEGM-WGTFNLNGLPEIDDSSMWAEATATSDI----QAAVTDPGIFDGKMWTAVDY  130
                ++G+ WG  + N  P  DD  +W E   + D+       + D G  DG  W  +  
Sbjct  209  NNEGMDGIFWGNMSDN-FPVFDD-WIWTEEAISLDLPVVAYQGIFDHGFVDGNCWETLHR  266

Query  129  P  127
            P
Sbjct  267  P  267



>emb|CBI19777.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 122/232 (53%), Gaps = 40/232 (17%)
 Frame = -1

Query  798  MRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavaydaaARYI  619
            MRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ SY+AA+AYDAAAR +
Sbjct  1    MRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSYEAAIAYDAAARKL  60

Query  618  FGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGGSTVPAAYG  439
            +G +AKLNLP L   +PP  +    +  P      P  L P P                 
Sbjct  61   YGPEAKLNLPELCA-QPPANTQFTHNQIPPNPNITPPSLTPLPR----------------  103

Query  438  NCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENE--VEGMWG  265
                 +  +  +   S+     +  + P A P           +NEK  EN+  +EG+W 
Sbjct  104  ----PNIQTPPYHKYSVVPSPATQEVPPHAKP---------TAINEKNGENDDGMEGVWA  150

Query  264  TFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIF-----DGKMWTAVDYPW  124
              N+  LP++DD S+W E   + D   A  D  IF     DG  W  +  PW
Sbjct  151  NMNVT-LPKVDD-SLWTETLMSMDF-PAFDDTEIFGSNLVDGNSWEMLQSPW  199



>gb|KFK26084.1| hypothetical protein AALP_AA8G200700 [Arabis alpina]
Length=295

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 78/91 (86%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+CTY+GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  3    EEQPPAKKRNMGR--SRKGCMKGKGGPENATCTYRGVRQRTWGKWVAEIREPNRGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLLH  91



>ref|XP_010533259.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Tarenaya hassleriana]
Length=216

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 120/236 (51%), Gaps = 32/236 (14%)
 Frame = -1

Query  846  PSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYE  667
            P + +   +  SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++
Sbjct  6    PKAIKRAVQTSSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFD  65

Query  666  NSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPE  487
             S++AA+AYD+AAR ++G  A++NLP     E P  S             N ++   S  
Sbjct  66   TSHEAALAYDSAARKLYGPSAQVNLP-----ESPTRSDNNNEDASKNTNRNKNRKKISNS  120

Query  486  TCADGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDM  307
                  G +    + G     S  S    ++S  +GD S   S                 
Sbjct  121  VSNSDRGKTRTEDSDGLVGEYSVGSLSLSSSSSEDGDRSMWRSK----------------  164

Query  306  NEKAPENEVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKMWTA  139
                     EG+W   +++ LP IDD S+W EAT +        D  +FD   W +
Sbjct  165  ---------EGIWEHMSVD-LPVIDD-SIWEEATISLGFPWVRDDISMFDDSGWNS  209



>ref|XP_003549447.2| PREDICTED: ethylene-responsive transcription factor CRF4-like 
[Glycine max]
Length=282

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA+CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ + +AA+A
Sbjct  14   QASSRKGCMRGKGGPENATCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAREAALA  73

Query  642  ydaaARYIFGAKAKLNLPHL  583
            YDAAAR ++G  AKLNLP L
Sbjct  74   YDAAARKLYGPDAKLNLPEL  93



>ref|XP_006302829.1| hypothetical protein CARUB_v10020960mg [Capsella rubella]
 gb|EOA35727.1| hypothetical protein CARUB_v10020960mg [Capsella rubella]
Length=205

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 84/118 (71%), Gaps = 12/118 (10%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  16   KQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  75

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPET  484
            +AA+AYD+AAR ++G +A LNLP          SL    SYP    +  SQ  PS  T
Sbjct  76   EAALAYDSAARKLYGPEAHLNLPE---------SL---RSYPETASSQASQTAPSSNT  121



>emb|CDY58117.1| BnaA02g35180D [Brassica napus]
Length=289

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 77/91 (85%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            +QQPP+ +R+  R  SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPN G+R+WL
Sbjct  4    EQQPPAKKRNMGR--SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNHGTRLWL  61

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  62   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLLH  92



>gb|KHN12670.1| Dehydration-responsive element-binding protein 2D [Glycine soja]
Length=289

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA+CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ + +AA+A
Sbjct  19   QASSRKGCMRGKGGPENATCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAREAALA  78

Query  642  ydaaARYIFGAKAKLNLPHL  583
            YDAAAR ++G  AKLNLP L
Sbjct  79   YDAAARKLYGPDAKLNLPEL  98



>emb|CDY02629.1| BnaC02g08060D [Brassica napus]
Length=288

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 77/91 (85%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPN G+RIWL
Sbjct  3    EEQPPTKKRNMGR--SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNHGTRIWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLLH  91



>ref|XP_002887600.1| hypothetical protein ARALYDRAFT_476698 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63859.1| hypothetical protein ARALYDRAFT_476698 [Arabidopsis lyrata subsp. 
lyrata]
Length=196

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  7    KQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  66

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPS  556
            +AA+AYD+AAR ++G +A LNLP    + P   S
Sbjct  67   EAALAYDSAARKLYGPEAHLNLPESLRSYPETAS  100



>ref|XP_004292958.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Fragaria vesca subsp. vesca]
Length=259

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S +AA+A
Sbjct  26   QASSRKGCMRGKGGPENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSSEAAMA  85

Query  642  ydaaARYIFGAKAKLNLP  589
            YDAAAR ++G++AKLNLP
Sbjct  86   YDAAARKLYGSEAKLNLP  103



>ref|XP_009128106.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Brassica rapa]
 emb|CDY39036.1| BnaA02g17250D [Brassica napus]
Length=198

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++    A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ + 
Sbjct  7    KQRTVHASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAR  66

Query  657  daavaydaaARYIFGAKAKLNLP  589
            +AA+AYD+AAR ++G++A LNLP
Sbjct  67   EAALAYDSAARKLYGSEAHLNLP  89



>ref|NP_177681.2| dehydration-responsive element-binding protein 2D [Arabidopsis 
thaliana]
 sp|Q9LQZ2.1|DRE2D_ARATH RecName: Full=Dehydration-responsive element-binding protein 
2D; Short=Protein DREB2D [Arabidopsis thaliana]
 gb|AAF87124.1|AC006434_20 F10A5.29 [Arabidopsis thaliana]
 dbj|BAD43665.1| transcription factor DREB2A like protein [Arabidopsis thaliana]
 gb|AEE35725.1| dehydration-responsive element-binding protein 2D [Arabidopsis 
thaliana]
Length=206

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  16   KQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  75

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPS  556
            +AA+AYD+AAR ++G +A LNLP    + P   S
Sbjct  76   EAALAYDSAARKLYGPEAHLNLPESLRSYPKTAS  109



>gb|ABK59671.1| At1g75490 [Arabidopsis thaliana]
Length=197

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  7    KQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  66

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPS  556
            +AA+AYD+AAR ++G +A LNLP    + P   S
Sbjct  67   EAALAYDSAARKLYGPEAHLNLPESLRSYPKTAS  100



>ref|XP_004147872.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis sativus]
 ref|XP_004167757.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis sativus]
 gb|KGN60003.1| hypothetical protein Csa_3G865380 [Cucumis sativus]
Length=184

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGP+NA+CT+KGVRQRTWGKWV EIREPNRG+R+WLGT++ +++AA+A
Sbjct  13   QASSRKGCMRGKGGPDNAACTFKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAHEAALA  72

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYP  532
            YDAAAR ++G++AKLNLP         P L  G   P
Sbjct  73   YDAAARKLYGSEAKLNLPQTTTTSHELPQLEHGGQSP  109



>ref|XP_010243654.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Nelumbo nucifera]
Length=204

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            + +P+  SRKGCMRGKGGPENA C Y+GVRQRTWGKWV EIREPNRG+RIWLGT+  S +
Sbjct  6    KRSPKRNSRKGCMRGKGGPENALCPYRGVRQRTWGKWVAEIREPNRGARIWLGTFNTSLE  65

Query  654  aavaydaaARYIFGAKAKLNLPHL  583
            AAVAYD AAR ++G+ A+LNLP L
Sbjct  66   AAVAYDDAARKLYGSSARLNLPEL  89



>ref|XP_008466672.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis melo]
Length=184

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGP+NASCT+KGVRQRTWGKWV EIREPNRG+R+WLGT++ +++AA+A
Sbjct  13   QASSRKGCMRGKGGPDNASCTFKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAHEAALA  72

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYP  532
            YDAAAR ++G++AKLNLP         P L  G   P
Sbjct  73   YDAAARKLYGSEAKLNLPQTTTTPHELPQLEHGGQSP  109



>ref|XP_003545264.1| PREDICTED: ethylene-responsive transcription factor CRF4-like 
[Glycine max]
 gb|KHN20940.1| Dehydration-responsive element-binding protein 2D [Glycine soja]
Length=283

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 129/253 (51%), Gaps = 46/253 (18%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A SRKGCMRGKGGPENA CTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ + +AA+A
Sbjct  14   QASSRKGCMRGKGGPENAKCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAREAALA  73

Query  642  ydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETC------  481
            YDAAAR ++G  AKLNL  L     P P+L            NPS +   P+        
Sbjct  74   YDAAARKLYGPDAKLNLAEL---SVPAPALAAV---------NPSHMQQQPQVVPEMLIQ  121

Query  480  ---------ADGSGGSTVPAAYGN------CASSSTSSAHHQNAS--IFNGDNSSVISPA  352
                      D    ++ P+ + N         SS +S+   +A+  ++   +S +  P+
Sbjct  122  QQQPLVHPTFDLVNVTSHPSGFNNILNNNPVVVSSMASSFLADAAVPVYTSCDSILSLPS  181

Query  351  APPPLQNIKLPKLDMN---------EKAPENEVEGMWGTFNLNGLPEIDDSSMWAEATAT  199
            A     N     ++M          E   +N     WG    + +P + D S+W EA  +
Sbjct  182  ATTNYTNTNTVPMEMENYSSSIPTVESNGDNMFRSFWGPTMDDTMP-VFDQSIWTEAAMS  240

Query  198  SDIQAAVTDPGIF  160
             D+   + D G +
Sbjct  241  LDL-PIIADNGFY  252



>ref|XP_002873895.1| hypothetical protein ARALYDRAFT_909855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50154.1| hypothetical protein ARALYDRAFT_909855 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 78/91 (86%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  3    EEQPPAKKRNMGR--SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLVH  91



>ref|NP_197346.1| dehydration-responsive element-binding protein 2G [Arabidopsis 
thaliana]
 sp|P61827.1|DRE2G_ARATH RecName: Full=Dehydration-responsive element-binding protein 
2G; Short=Protein DREB2G [Arabidopsis thaliana]
 gb|AAT44920.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABG48430.1| At5g18450 [Arabidopsis thaliana]
 gb|AED92565.1| dehydration-responsive element-binding protein 2G [Arabidopsis 
thaliana]
Length=307

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 78/91 (86%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  3    EEQPPAKKRNMGR--SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLVH  91



>ref|XP_009106200.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Brassica rapa]
Length=206

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  16   KQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  75

Query  657  daavaydaaARYIFGAKAKLNLPH  586
            +AA+AYD+AAR ++G +A LNLP 
Sbjct  76   EAALAYDSAARKLYGPEAHLNLPQ  99



>ref|XP_009126252.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Brassica rapa]
Length=288

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 77/91 (85%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPN G+R+WL
Sbjct  3    EEQPPAKKRNMGR--SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNHGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLLH  91



>ref|XP_006289041.1| hypothetical protein CARUB_v10002425mg [Capsella rubella]
 gb|EOA21939.1| hypothetical protein CARUB_v10002425mg [Capsella rubella]
Length=303

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 77/91 (85%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  3    EEQPPAKKRNMGR--SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAKAYDEAAKKLYGHEAKLNLLH  91



>emb|CDY47519.1| BnaAnng09170D [Brassica napus]
Length=206

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SRKGCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ S 
Sbjct  16   KQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSR  75

Query  657  daavaydaaARYIFGAKAKLNLPH  586
            +AA+AYD+AAR ++G +A LNLP 
Sbjct  76   EAALAYDSAARKLYGPEAHLNLPQ  99



>ref|XP_002522019.1| hypothetical protein RCOM_0610630 [Ricinus communis]
 gb|EEF40423.1| hypothetical protein RCOM_0610630 [Ricinus communis]
Length=215

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 85/138 (62%), Gaps = 9/138 (7%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA CTY+GVRQRTWGKWV EIREPNRG+RIWLGT+  S++AA AYD 
Sbjct  15   SRKGCMKGKGGPENALCTYRGVRQRTWGKWVAEIREPNRGNRIWLGTFNTSHEAAKAYDQ  74

Query  633  aARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGGSTV  454
            AA  ++G+ A LNLPH ++ +            PF   N  +  L S       S  S  
Sbjct  75   AAIKLYGSSATLNLPHSYDQQRQRQEEEEEEEVPFS--NRSTTPLSS-------SFASAC  125

Query  453  PAAYGNCASSSTSSAHHQ  400
            P   G C  S+ SS   Q
Sbjct  126  PDYVGTCGGSTNSSCRDQ  143



>ref|XP_009120973.1| PREDICTED: dehydration-responsive element-binding protein 2G 
[Brassica rapa]
 emb|CDX92610.1| BnaA10g16490D [Brassica napus]
Length=306

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 78/91 (86%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGP+NA+CT++GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  3    EEQPPAKKRNMGR--SRKGCMKGKGGPQNATCTFRGVRQRTWGKWVAEIREPNRGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLLH  91



>ref|XP_010420608.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Camelina sativa]
Length=300

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 78/91 (86%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  3    EEQPPAKKRNMGR--SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLLH  91



>ref|XP_010454086.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Camelina sativa]
Length=305

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 78/91 (86%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  3    EEQPPAKKRNMGR--SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLLH  91



>emb|CDY25420.1| BnaC09g39350D [Brassica napus]
Length=328

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 78/91 (86%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGP+NA+CT++GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  3    EEQPPAKKRNMGR--SRKGCMKGKGGPQNATCTFRGVRQRTWGKWVAEIREPNRGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLLH  91



>gb|KEH36215.1| dehydration-responsive element-binding protein [Medicago truncatula]
Length=227

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            +A+SRKGCM+GKGGPEN SC YKGVRQRTWGKWV EIREPNRGSR+WLGT+E S +AA+A
Sbjct  18   QAISRKGCMKGKGGPENPSCPYKGVRQRTWGKWVAEIREPNRGSRLWLGTFETSLEAALA  77

Query  642  ydaaARYIFGAKAKLNLPHL  583
            YDAAA  ++G++AKLNLP +
Sbjct  78   YDAAALKLYGSRAKLNLPEI  97



>ref|XP_011084760.1| PREDICTED: ethylene-responsive transcription factor RAP2-2-like 
[Sesamum indicum]
Length=199

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  849  PPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTY  670
            PP+S +      SRKGCMRGKGGPENA CTY+GVRQRTWGKWV EIREPNRG+R+WLGT+
Sbjct  29   PPASGKKPAVGRSRKGCMRGKGGPENALCTYRGVRQRTWGKWVAEIREPNRGARVWLGTF  88

Query  669  ENSydaavaydaaARYIFGAKAKLNL  592
              S +AA AYD AAR ++G+ AKLNL
Sbjct  89   NTSLEAAQAYDDAARRLYGSSAKLNL  114



>ref|XP_010492849.1| PREDICTED: dehydration-responsive element-binding protein 2G 
[Camelina sativa]
Length=305

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 77/91 (85%), Gaps = 2/91 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+C ++GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  3    EEQPPAKKRNMGR--SRKGCMKGKGGPENATCNFRGVRQRTWGKWVAEIREPNRGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPH  586
            GT+  S +AA+AYD AA+ ++G +AKLNL H
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAKLNLLH  91



>ref|XP_006443285.1| hypothetical protein CICLE_v10022244mg [Citrus clementina]
 ref|XP_006478977.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Citrus sinensis]
 gb|ESR56525.1| hypothetical protein CICLE_v10022244mg [Citrus clementina]
Length=210

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPEN  CTYKGVRQRTWGKWV EIREPNRG+R+WLG++  S DAA+AYD 
Sbjct  23   SRKGCMKGKGGPENVLCTYKGVRQRTWGKWVAEIREPNRGARLWLGSFNTSLDAALAYDE  82

Query  633  aARYIFGAKAKLNLPHLWENEPP  565
            AAR ++G  AKLNLP + ++  P
Sbjct  83   AARKLYGDYAKLNLPQVQQHNRP  105



>emb|CDY70626.1| BnaCnng69090D [Brassica napus]
Length=204

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 108/213 (51%), Gaps = 58/213 (27%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++    A SRKGCMRGKGGPENASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT+E S 
Sbjct  16   KQRTVNASSRKGCMRGKGGPENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSR  75

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCA  478
            +AA+AYD+AAR ++G  A LNL                          P  L   PET +
Sbjct  76   EAALAYDSAARKLYGPDAHLNL--------------------------PESLRSYPETAS  109

Query  477  DGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEK  298
             G+  S  P++  N    S+  +   +  + +    S IS                    
Sbjct  110  PGTQVSQTPSS--NTGEKSSEESPSSSNEMSSWGTRSEIS--------------------  147

Query  297  APENEVEGMWGTFNLNGLPEIDDSSMWAEATAT  199
                     W   N++ LP  DDSS+W EAT +
Sbjct  148  ---------WEHMNVD-LPVTDDSSIWQEATMS  170



>emb|CDY20377.1| BnaC02g24390D [Brassica napus]
Length=198

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 110/211 (52%), Gaps = 54/211 (26%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++   +A SR+GCMRGKGGP+NASCTYKGVRQRTWGKWV EIREPNRG+R+WLGT++ + 
Sbjct  7    KQRTVQASSRRGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAR  66

Query  657  daavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCA  478
            +AA+AYD+AAR ++G++A LNL                          P  L   PET  
Sbjct  67   EAALAYDSAARKLYGSEAHLNL--------------------------PESLRSYPETVL  100

Query  477  DGSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEK  298
             G+  S  P         S+++    + SI     SS    ++    + I          
Sbjct  101  PGTQVSHTP---------SSNTGGKSSDSINEESPSSSNEMSSWGTTEEIS---------  142

Query  297  APENEVEGMWGTFNLNGLPEIDDSSMWAEAT  205
                     WG  N + LP  DDSS+W EAT
Sbjct  143  ---------WGHMNAD-LPVTDDSSIWEEAT  163



>ref|XP_007208518.1| hypothetical protein PRUPE_ppa026176mg, partial [Prunus persica]
 gb|EMJ09717.1| hypothetical protein PRUPE_ppa026176mg, partial [Prunus persica]
Length=110

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA C+++GVRQRTWGKWV EIREPNRG+R+WLGT+  S +AA+AYD 
Sbjct  19   SRKGCMKGKGGPENALCSFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSTEAALAYDE  78

Query  633  aARYIFGAKAKLNLP  589
            AAR ++G+ AKLNLP
Sbjct  79   AARKLYGSSAKLNLP  93



>emb|CAN66064.1| hypothetical protein VITISV_032355 [Vitis vinifera]
Length=173

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA C+Y+GVRQRTWGKWV EIREPNRG+R+WLGT+  SY+AA+AYD 
Sbjct  4    SRKGCMKGKGGPENALCSYRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSYEAAMAYDM  63

Query  633  aARYIFGAKAKLNLPH  586
            AA+ ++G  AKLNLPH
Sbjct  64   AAQKLYGPSAKLNLPH  79



>ref|XP_002267549.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Vitis vinifera]
Length=198

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA C+Y+GVRQRTWGKWV EIREPNRG+R+WLGT+  SY+AA+AYD 
Sbjct  17   SRKGCMKGKGGPENALCSYRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSYEAAMAYDM  76

Query  633  aARYIFGAKAKLNLPH  586
            AA+ ++G  AKLNLPH
Sbjct  77   AAQKLYGPSAKLNLPH  92



>ref|XP_010043317.1| PREDICTED: dehydration-responsive element-binding protein 2E 
[Eucalyptus grandis]
Length=240

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCMRGKGGPENA CTY+GVRQRTWGKWV EIREPNRG+R+WLGT+  S +AA+AYD 
Sbjct  31   SRKGCMRGKGGPENALCTYRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSLEAALAYDK  90

Query  633  aARYIFGAKAKLNLP  589
            AAR ++G  A+LNLP
Sbjct  91   AARKLYGPSARLNLP  105



>ref|XP_009131668.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Brassica rapa]
Length=291

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  2    EEQPPAKKRNMGR--SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWL  59

Query  678  GTYENSydaavaydaaARYIFGAKAKLNL  592
            GT+  S  AA+AYD AA  ++G +A+LNL
Sbjct  60   GTFNTSVQAAMAYDEAAMKLYGPEARLNL  88



>gb|EYU39769.1| hypothetical protein MIMGU_mgv1a018752mg, partial [Erythranthe 
guttata]
Length=113

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCMRGKGGPENA CTY+GVRQRTWG+WV EIREPNRG+R+WLGT+  S +AA AYD 
Sbjct  40   SRKGCMRGKGGPENALCTYRGVRQRTWGRWVAEIREPNRGARVWLGTFSTSLEAAQAYDD  99

Query  633  aARYIFGAKAKLNL  592
            AAR ++G  AKLNL
Sbjct  100  AARRLYGPFAKLNL  113



>ref|XP_009406908.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=326

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 11/131 (8%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCMRGKGGPEN +C Y+GVRQRTWGKWV EIREPNRGSR+WLGT+  ++ 
Sbjct  50   RRPPAKGSKKGCMRGKGGPENPNCRYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAFQ  109

Query  654  aavaydaaARYIFGAKAKLNLPHL-----------WENEPPPPSLGVGSSYPFPRLNNPS  508
            AA+AYD AAR ++G  A+LNLP +           + +E    S+        PR++  S
Sbjct  110  AALAYDDAARAMYGTMARLNLPAMTRGLCGSTSTSYNSEDVDASVSCDFGIKTPRVDAGS  169

Query  507  QLLPSPETCAD  475
            + + +P T AD
Sbjct  170  ETVDAPRTWAD  180



>ref|XP_009406909.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009406910.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=318

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 11/131 (8%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCMRGKGGPEN +C Y+GVRQRTWGKWV EIREPNRGSR+WLGT+  ++ 
Sbjct  42   RRPPAKGSKKGCMRGKGGPENPNCRYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAFQ  101

Query  654  aavaydaaARYIFGAKAKLNLPHL-----------WENEPPPPSLGVGSSYPFPRLNNPS  508
            AA+AYD AAR ++G  A+LNLP +           + +E    S+        PR++  S
Sbjct  102  AALAYDDAARAMYGTMARLNLPAMTRGLCGSTSTSYNSEDVDASVSCDFGIKTPRVDAGS  161

Query  507  QLLPSPETCAD  475
            + + +P T AD
Sbjct  162  ETVDAPRTWAD  172



>ref|XP_008389032.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Malus domestica]
Length=228

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA C+++GVRQRTWGKWV EIREPNRG+R+WLGT+  S +AA+AYD 
Sbjct  26   SRKGCMKGKGGPENALCSFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSTEAALAYDE  85

Query  633  aARYIFGAKAKLNLP  589
            AAR ++G+ AKLNLP
Sbjct  86   AARKLYGSSAKLNLP  100



>ref|XP_004302113.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREP RG+R+WLGT+  S +AA+AYD 
Sbjct  4    SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPKRGARLWLGTFNTSTEAALAYDD  63

Query  633  aARYIFGAKAKLNLP  589
            AAR ++G+ AKLNLP
Sbjct  64   AARKLYGSSAKLNLP  78



>ref|XP_010922640.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Elaeis guineensis]
Length=328

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCMRGKGGPEN+ C Y+GVRQRTWGKWV EIREPNRGSR+WLGT+  + D
Sbjct  45   RRVPAKGSRKGCMRGKGGPENSHCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFNTALD  104

Query  654  aavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSY  535
            AA+AYD AAR ++G  A+LNLP   +      +LG   SY
Sbjct  105  AAMAYDEAARAMYGPCARLNLPQC-DIAAKDTTLGDAESY  143



>gb|KDP23749.1| hypothetical protein JCGZ_23582 [Jatropha curcas]
Length=224

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 72/97 (74%), Gaps = 6/97 (6%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            +++ P  RR      SRKGCM+GKGGPENA CTY+GVRQRTWGKWV EIREPNRG+RIWL
Sbjct  6    NEKKPCMRR------SRKGCMKGKGGPENALCTYRGVRQRTWGKWVAEIREPNRGNRIWL  59

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPHLWENEP  568
            GT+  S +AA AYD AA  ++G+ A LNLP    N P
Sbjct  60   GTFNTSDEAARAYDQAALKLYGSSATLNLPQYCFNLP  96



>ref|XP_007030307.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY10809.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=213

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -1

Query  840  SRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENS  661
            S+R +    SRKGC RGKGGPENA CTY+GVRQRTWGKWV EIREPNRG+R+W+GT+  S
Sbjct  16   SKRPSSLGKSRKGCKRGKGGPENAMCTYRGVRQRTWGKWVAEIREPNRGNRLWIGTFSTS  75

Query  660  ydaavaydaaARYIFGAKAKLNLPH  586
             DA +AYD  AR ++G  AKLNLP 
Sbjct  76   LDAVLAYDEVARKLYGPSAKLNLPQ  100



>ref|XP_010505763.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Camelina sativa]
Length=340

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCMRGKGGPEN +C Y+GVRQRTWGKWV EIREP +G R+WLGT+  S +
Sbjct  50   RKAPTKGSRKGCMRGKGGPENGNCEYRGVRQRTWGKWVAEIREPGKGGRLWLGTFSTSLE  109

Query  654  aavaydaaARYIFGAKAKLNLPHLWEN  574
            AA+AYD AA+ ++G  A+LNLPH   N
Sbjct  110  AALAYDEAAKAMYGYSARLNLPHFTTN  136



>emb|CDP04254.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCMRGKGGPENA CTY+GVRQRTWGKWV EIREPN G+R+WLGT+  SY+AA AYD 
Sbjct  38   SRKGCMRGKGGPENAFCTYRGVRQRTWGKWVAEIREPNHGARVWLGTFNTSYEAARAYDD  97

Query  633  aARYIFGAKAKLNLPH  586
            AA+ ++G  AKLNLP 
Sbjct  98   AAKRLYGKCAKLNLPE  113



>ref|XP_006400393.1| hypothetical protein EUTSA_v10015907mg [Eutrema salsugineum]
 gb|ESQ41846.1| hypothetical protein EUTSA_v10015907mg [Eutrema salsugineum]
Length=290

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            ++QPP+ +R+  R  SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPNRG+R+WL
Sbjct  3    EEQPPTKKRNMGR--SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWL  60

Query  678  GTYENSydaavaydaaARYIFGAKAK  601
            GT+  S +AA+AYD AA+ ++G +AK
Sbjct  61   GTFNTSVEAAMAYDEAAKKLYGHEAK  86



>gb|AFK24441.1| DREB2 [Coffea arabica]
Length=229

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCMRGKGGPENA CTY+GVRQRTWGKWV EIREPN G+R+WLGT+  SY+AA AYD 
Sbjct  37   SRKGCMRGKGGPENAFCTYRGVRQRTWGKWVAEIREPNHGARVWLGTFNTSYEAARAYDD  96

Query  633  aARYIFGAKAKLNLPH  586
            AA+ ++G  AKLNLP 
Sbjct  97   AAKRLYGKCAKLNLPE  112



>ref|XP_004237644.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Solanum lycopersicum]
Length=161

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -1

Query  822  RAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaava  643
            ++ SRKGCMRGKGGPENASCTY+GVRQRTWGKWV EIREPN G+RIWLGT+  S +AA A
Sbjct  17   KSRSRKGCMRGKGGPENASCTYRGVRQRTWGKWVAEIREPNGGARIWLGTFNTSVEAARA  76

Query  642  ydaaARYIFGAKAKLNLPH  586
            YD AAR ++G+ AKLNL  
Sbjct  77   YDDAARRLYGSDAKLNLSE  95



>ref|XP_010936099.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Elaeis guineensis]
Length=207

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = -1

Query  846  PSSRRHN---PRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            P  ++H    P   SRKGCM+GKGGPEN +CT++GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  9    PEEKKHKKCCPLRRSRKGCMKGKGGPENQACTFRGVRQRTWGKWVAEIREPNRGARLWLG  68

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            T+  S +AA AYDAAAR ++G  A+LNLP
Sbjct  69   TFNTSLEAAQAYDAAARSLYGECARLNLP  97



>ref|XP_008218369.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Prunus mume]
Length=223

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA C ++GVRQRTWGKWV EIREPNRG+R+WLGT+  S +AA+AYD 
Sbjct  19   SRKGCMKGKGGPENALCNFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSTEAALAYDE  78

Query  633  aARYIFGAKAKLNLP  589
            AAR ++G  AKLNLP
Sbjct  79   AARKLYGTSAKLNLP  93



>ref|XP_009630729.1| PREDICTED: ethylene-responsive transcription factor CRF3-like 
[Nicotiana tomentosiformis]
Length=326

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 90/158 (57%), Gaps = 29/158 (18%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCMRGKGGPENA CT++GVRQRTWGKWV EIREPNRG+RIWLGT+  S +AA AYD 
Sbjct  21   SRKGCMRGKGGPENALCTFRGVRQRTWGKWVAEIREPNRGARIWLGTFNTSLEAARAYDD  80

Query  633  aARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCADGSGGSTV  454
            AAR ++G+ AKLNL    E+E P                  ++   S E C  GS     
Sbjct  81   AARRLYGSGAKLNLS---ESEQP-----------------SNENFNSGENCIIGS-----  115

Query  453  PAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPP  340
                GN   SS   +  + ASIF   N   +    P P
Sbjct  116  ----GNGNESSGECSVLEEASIFKDGNGKYLVWENPAP  149



>ref|XP_009386363.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Musa acuminata subsp. malaccensis]
Length=202

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            R+  P   SRKGCM+GKGGPEN +CTY+GVRQRTWGKWV EIREPNRG+R+WLGT+  + 
Sbjct  9    RKCCPLRRSRKGCMKGKGGPENQACTYRGVRQRTWGKWVAEIREPNRGARLWLGTFSTAL  68

Query  657  daavaydaaARYIFGAKAKLNL  592
            +AA AYD AAR ++G  A+LNL
Sbjct  69   EAAQAYDNAARSLYGDCARLNL  90



>ref|XP_009391184.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Musa acuminata subsp. malaccensis]
Length=195

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            ++  P   SRKGCM+GKGGPEN +CTY+GVRQRTWGKWV EIREPNRG+R+WLGT+ +S 
Sbjct  9    KKCCPLRRSRKGCMKGKGGPENQACTYRGVRQRTWGKWVAEIREPNRGARLWLGTFSSSL  68

Query  657  daavaydaaARYIFGAKAKLNL  592
            +AA AYD AAR ++G  A+LNL
Sbjct  69   EAAQAYDNAARSLYGDCARLNL  90



>gb|AIZ74387.1| DREB1 [Sophora moorcroftiana]
Length=199

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCM+GKGGPEN+ C Y+GVRQRTWGKWV EIREPNRGSR+WLGT+  +  
Sbjct  40   RKVPAKGSRKGCMKGKGGPENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAIG  99

Query  654  aavaydaaARYIFGAKAKLNLPH  586
            AA+AYD AAR ++G  A+LN P+
Sbjct  100  AALAYDEAARAMYGTCARLNFPN  122



>ref|XP_008799804.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X1 [Phoenix dactylifera]
Length=319

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCM+GKGGPEN+ C Y+GVRQRTWGKWV EIREPNRGSR+WLGT+  + D
Sbjct  45   RRVPAKGSRKGCMQGKGGPENSHCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFNTALD  104

Query  654  aavaydaaARYIFGAKAKLNLP  589
            AA+AYD AAR ++G  A+LNLP
Sbjct  105  AAMAYDEAARAMYGPCARLNLP  126



>gb|AFP89590.1| putative dehydration responsive element-binding protein [Sophora 
davidii]
Length=199

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCM+GKGGPEN+ C Y+GVRQRTWGKWV EIREPNRG+R+WLGT+  +  
Sbjct  40   RKVPAKGSRKGCMKGKGGPENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTAIG  99

Query  654  aavaydaaARYIFGAKAKLNLPHL  583
            AA+AYD AAR ++G  A+LN P++
Sbjct  100  AALAYDEAARAMYGTCARLNFPNI  123



>ref|XP_002520794.1| Dehydration-responsive element-binding protein 2C, putative [Ricinus 
communis]
 gb|EEF41503.1| Dehydration-responsive element-binding protein 2C, putative [Ricinus 
communis]
Length=386

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCM+GKGGPEN+ C Y+GVRQRTWGKWV EIREPNRG R+WLGT+  +Y+
Sbjct  57   RKTPAKGSRKGCMKGKGGPENSECNYRGVRQRTWGKWVAEIREPNRGPRLWLGTFPTAYE  116

Query  654  aavaydaaARYIFGAKAKLNLPHL  583
            AAVAYD AA+ ++G+ A+LN P L
Sbjct  117  AAVAYDEAAKAMYGSSARLNFPEL  140



>ref|XP_009416308.1| PREDICTED: dehydration-responsive element-binding protein 2B 
[Musa acuminata subsp. malaccensis]
Length=297

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCMRGKGGPEN  C Y+GVRQRTWGKWV EIREPNRGSR+WLGT+  + +
Sbjct  8    RRAPAKGSRKGCMRGKGGPENPKCRYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAVE  67

Query  654  aavaydaaARYIFGAKAKLNLP  589
            AA+AYD AAR ++G  A++NLP
Sbjct  68   AALAYDDAARAMYGTMARVNLP  89



>ref|XP_010921034.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Elaeis guineensis]
Length=313

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            +R  P   SRKGCM+GKGGP+N  C Y+GVRQRTWGKWV EIREPNRGSR+WLGT+  + 
Sbjct  42   KRRAPAKGSRKGCMKGKGGPDNPQCKYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAL  101

Query  657  daavaydaaARYIFGAKAKLNLPHL  583
            +AA+AYD AAR ++G  A+LNLP  
Sbjct  102  EAALAYDEAARAMYGPYARLNLPQF  126



>ref|XP_008796422.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Phoenix dactylifera]
Length=204

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 3/89 (3%)
 Frame = -1

Query  846  PSSRRHN---PRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            P  ++H    P   SRKGCM+GKGGPEN +C ++GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  9    PEEKKHKKCCPLRRSRKGCMKGKGGPENQACAFRGVRQRTWGKWVAEIREPNRGARLWLG  68

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            T+  S +AA AYDAAAR ++G  A+LNLP
Sbjct  69   TFNTSLEAAQAYDAAARSLYGECARLNLP  97



>ref|XP_010508876.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X1 [Camelina sativa]
 ref|XP_010508877.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X2 [Camelina sativa]
Length=343

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = -1

Query  846  PSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYE  667
            P   R  P   SRKGCMRGKGGPEN  C Y+GVRQRTWGKWV EIREP +G R+WLGT+ 
Sbjct  45   PKRIRKAPTQGSRKGCMRGKGGPENRYCEYRGVRQRTWGKWVAEIREPGKGGRLWLGTFS  104

Query  666  NSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPE  487
             S++AA+AYD AA+ ++G  A+LNLP+   N     +  V  S      +N S++    +
Sbjct  105  TSHEAALAYDEAAKAMYGHSARLNLPYFTTNGSSSTAATVSGS--VTAFSNESEVCAHED  162

Query  486  T  484
            T
Sbjct  163  T  163



>ref|XP_004293490.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Fragaria vesca subsp. vesca]
Length=198

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCM+GKGGPEN+ C Y+GVRQRTWGKWV EIR PNRGSR+WLGT+  + +
Sbjct  42   RKVPAKGSRKGCMKGKGGPENSRCNYRGVRQRTWGKWVAEIRSPNRGSRLWLGTFPTAIE  101

Query  654  aavaydaaARYIFGAKAKLNLPHL  583
            AA+AYD AAR ++G+ A+LN P +
Sbjct  102  AALAYDKAARAMYGSAARLNFPKV  125



>ref|XP_010257031.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Nelumbo nucifera]
Length=362

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCMRGKGGPEN+ C Y+GVRQRTWGKWV EIREPNRGSR+WLGT+  + +
Sbjct  47   RKVPAKGSKKGCMRGKGGPENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFATALE  106

Query  654  aavaydaaARYIFGAKAKLNLPH  586
            AA AYD AAR ++G  A+LNLP 
Sbjct  107  AARAYDEAARAMYGPCARLNLPE  129



>ref|XP_010940672.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Elaeis guineensis]
Length=226

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  837  RRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSy  658
            +++ P   SRKGCM+GKGGPEN +C ++GVRQRTWGKWV EIREPNRG+R+WLGT+  S 
Sbjct  35   KKYCPLRRSRKGCMKGKGGPENQACAFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSL  94

Query  657  daavaydaaARYIFGAKAKLNLPH  586
            +AA AYDAAAR ++G  A+LNLP+
Sbjct  95   EAAQAYDAAARGLYGDCARLNLPN  118



>ref|XP_010931300.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Elaeis guineensis]
Length=281

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -1

Query  825  PRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaav  646
            P   SRKGCMRGKGGPEN+ C Y+GVRQRTWGKWV EIR+PNRGSR+WLGT+  + +AA+
Sbjct  48   PAKGSRKGCMRGKGGPENSHCNYRGVRQRTWGKWVAEIRKPNRGSRLWLGTFNTALEAAL  107

Query  645  aydaaARYIFGAKAKLNLP  589
            AYD AAR ++G  A+LNLP
Sbjct  108  AYDKAARAMYGPHARLNLP  126



>gb|KDP44697.1| hypothetical protein JCGZ_01197 [Jatropha curcas]
Length=374

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 116/247 (47%), Gaps = 41/247 (17%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCMRGKGGP+N+ C Y+GVRQRTWGKWV EIREPNRG R+WLGT+  +YD
Sbjct  52   RKIPAKGSRKGCMRGKGGPDNSRCNYRGVRQRTWGKWVAEIREPNRGPRLWLGTFPTAYD  111

Query  654  aavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPSPETCAD  475
            AA+AYD AA+ ++G  A+LN P L        S    SS  +     PS    S      
Sbjct  112  AALAYDEAAKAMYGNLARLNFPEL--------SNSTSSSKDYMSSTTPSGY--SSVATPA  161

Query  474  GSGGSTVPAAYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPP----------PLQNIK  325
            GS  +T       CA   T         I NG+  S I P  P           P Q +K
Sbjct  162  GSDSTTTSNHSEVCAFDDTK---EHVVKIENGEGESKIKPEYPAVTDLVSPRCTPKQEVK  218

Query  324  LPKLDMNEKAPENEVEGMWGTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPGIFDGKMW  145
              + D   K PE +V       + + +PEI       E     D+Q    D G  +    
Sbjct  219  NEEDDA--KIPETKVP----MKDDHKIPEI-------EVAVKDDLQHESKDDGTLN----  261

Query  144  TAVDYPW  124
               DY W
Sbjct  262  -IEDYGW  267



>ref|XP_002881716.1| hypothetical protein ARALYDRAFT_903325 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57975.1| hypothetical protein ARALYDRAFT_903325 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  846  PSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYE  667
            P   R+ P   SRKGCM+GKGGPEN  C Y+GVRQRTWGKWV EIREP RG+R+WLGT+ 
Sbjct  54   PKPVRNPPPKGSRKGCMKGKGGPENGICDYRGVRQRTWGKWVAEIREPGRGARLWLGTFS  113

Query  666  NSydaavaydaaARYIFGAKAKLNLPHL  583
            +SY+AA+AYD AA+ I+G  A+LNLP +
Sbjct  114  SSYEAALAYDEAAKAIYGQSARLNLPEI  141



>ref|XP_010549641.1| PREDICTED: dehydration-responsive element-binding protein 2G 
[Tarenaya hassleriana]
Length=370

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCMRGKGGP+NA+C Y+GVRQRTWGKWV EIREPNRGSR+WLGT++ S++AA+AYD 
Sbjct  47   SRKGCMRGKGGPDNATCRYRGVRQRTWGKWVAEIREPNRGSRLWLGTFDTSFEAAMAYDK  106

Query  633  aARYIFGAKAKLNL  592
            AA+ ++G  AKLNL
Sbjct  107  AAKKLYGQAAKLNL  120



>ref|XP_010254126.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Nelumbo nucifera]
Length=306

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCMRGKGGPEN  C Y+GVRQRTWGKWV EIREPNRGSR+WLGT+  + +
Sbjct  47   RKAPAKGSRKGCMRGKGGPENLRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFSTALE  106

Query  654  aavaydaaARYIFGAKAKLNLP  589
            AA+AYD AA+ ++G  A+LN P
Sbjct  107  AALAYDKAAKAMYGRYARLNFP  128



>ref|XP_008789576.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Phoenix dactylifera]
Length=199

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 3/89 (3%)
 Frame = -1

Query  846  PSSRRHN---PRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            P  ++H    P   SRKGCM+GKGGPEN  C ++GVRQR+WGKWV EIREPNRG+RIWLG
Sbjct  3    PEEKKHKKCCPLRRSRKGCMKGKGGPENQGCAFRGVRQRSWGKWVAEIREPNRGTRIWLG  62

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            T+  S +AA AYDAAAR ++G  A+LNLP
Sbjct  63   TFNTSLEAAQAYDAAARGLYGDCARLNLP  91



>ref|XP_006660398.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Oryza brachyantha]
Length=235

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   +R+  P   SRKGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  13   QQEAKTRKCCPLRRSRKGCMKGKGGPENQRCPFRGVRQRTWGKWVAEIREPNRGARLWLG  72

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            T+  + DAA AYD+AAR ++G  A+LNL
Sbjct  73   TFNTALDAARAYDSAARALYGDCARLNL  100



>ref|XP_009402398.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=326

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCMRGKGGPEN SC Y+GVRQRTWGKWV EIREPNRG+R+WLGT+  +  
Sbjct  49   RKPPAKGSKKGCMRGKGGPENRSCRYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTAVQ  108

Query  654  aavaydaaARYIFGAKAKLNLP  589
            AA+AYD AAR ++G  A++NLP
Sbjct  109  AALAYDDAARAMYGTSARINLP  130



>ref|XP_009384928.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009384929.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=279

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCMRGKGGPEN SC Y+GVRQRTWGKWV EIREPNRG R+WLGT+  + +
Sbjct  8    RKPPARGSKKGCMRGKGGPENPSCRYRGVRQRTWGKWVAEIREPNRGGRLWLGTFPTATE  67

Query  654  aavaydaaARYIFGAKAKLNLP  589
            AA+AYD AAR ++G+ A++NLP
Sbjct  68   AALAYDDAARAMYGSLARVNLP  89



>gb|ABS11171.1| putative DRE-binding protein DREB2 [Avena sativa]
Length=272

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  40   QEENGSRKAPAKGSKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIREPNRGNRLWLGS  99

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            + N+ +AA AYD AAR ++GAKA++N 
Sbjct  100  FPNAVEAAHAYDEAARAMYGAKARVNF  126



>ref|XP_010517453.1| PREDICTED: dehydration-responsive element-binding protein 2C 
[Camelina sativa]
Length=342

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCMRGKGGPEN +C Y+GVRQRTWGKWV EIREP +G R+WLGT+  S++
Sbjct  49   RKAPVKGSRKGCMRGKGGPENGNCEYRGVRQRTWGKWVAEIREPGKGGRLWLGTFSTSHE  108

Query  654  aavaydaaARYIFGAKAKLNLPHLWEN  574
            AA+AYD AA+ ++G  A+LNLP    N
Sbjct  109  AALAYDEAAKAMYGHSARLNLPDFTTN  135



>ref|XP_010534621.1| PREDICTED: dehydration-responsive element-binding protein 2C 
isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            S+KGCM GKGGPEN  C Y+GVRQRTWGKWV EIREPN+G+R+WLGT+ N+Y+AA+AYD 
Sbjct  55   SKKGCMTGKGGPENFDCDYRGVRQRTWGKWVAEIREPNKGTRLWLGTFPNAYEAALAYDN  114

Query  633  aARYIFGAKAKLNLPHL  583
            AAR ++G  A+LNLPH+
Sbjct  115  AARAMYGQSARLNLPHI  131



>ref|XP_007009970.1| Dehydration-responsive element-binding protein 2C [Theobroma 
cacao]
 gb|EOY18780.1| Dehydration-responsive element-binding protein 2C [Theobroma 
cacao]
Length=248

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCMRGKGGP+N SC Y+GVRQRTWGKWV EIR PNRG R+WLGT+  +Y+
Sbjct  48   RKAPAKGSKKGCMRGKGGPQNQSCNYRGVRQRTWGKWVAEIRAPNRGKRLWLGTFPTAYE  107

Query  654  aavaydaaARYIFGAKAKLNLPHL  583
            AA+AYD AAR ++G  A LN+P++
Sbjct  108  AALAYDEAARMMYGENAILNMPYV  131



>ref|XP_002968658.1| hypothetical protein SELMODRAFT_38494, partial [Selaginella moellendorffii]
 ref|XP_002989907.1| hypothetical protein SELMODRAFT_38495, partial [Selaginella moellendorffii]
 gb|EFJ08920.1| hypothetical protein SELMODRAFT_38495, partial [Selaginella moellendorffii]
 gb|EFJ29774.1| hypothetical protein SELMODRAFT_38494, partial [Selaginella moellendorffii]
Length=81

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA+C Y+GVRQR WGKWV EIREPN G+RIWLGT++ + +AA AYD 
Sbjct  7    SRKGCMKGKGGPENAACQYRGVRQRVWGKWVAEIREPNCGARIWLGTFDTAVEAARAYDQ  66

Query  633  aARYIFGAKAKLNLP  589
            AA   FG  A+LNLP
Sbjct  67   AALKYFGENARLNLP  81



>ref|NP_181566.2| putative dehydration-responsive element-binding protein 2H [Arabidopsis 
thaliana]
 sp|Q9SIZ0.3|DRE2H_ARATH RecName: Full=Putative dehydration-responsive element-binding 
protein 2H; Short=Protein DREB2H [Arabidopsis thaliana]
 gb|AEC09817.1| putative dehydration-responsive element-binding protein 2H [Arabidopsis 
thaliana]
Length=157

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCM+GKGGPEN  C Y GVRQRTWGKWV EIREP RG+++WLGT+ +SY+
Sbjct  42   RKAPPKRSRKGCMKGKGGPENGICDYTGVRQRTWGKWVAEIREPGRGAKLWLGTFSSSYE  101

Query  654  aavaydaaARYIFGAKAKLNLPHL  583
            AA+AYD A++ I+G  A+LNLP L
Sbjct  102  AALAYDEASKAIYGQSARLNLPLL  125



>ref|XP_006828126.1| hypothetical protein AMTR_s00023p00044590 [Amborella trichopoda]
 gb|ERM95542.1| hypothetical protein AMTR_s00023p00044590 [Amborella trichopoda]
Length=382

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCMRGKGGPEN+ C Y+GVRQRTWGKWV EIREPNRG+R+WLGT+  +  
Sbjct  43   RKVPAKGSKKGCMRGKGGPENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTALA  102

Query  654  aavaydaaARYIFGAKAKLNLP  589
            AA+AYD AAR ++G+ A+LNLP
Sbjct  103  AALAYDEAARAMYGSCARLNLP  124



>ref|XP_009384927.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=317

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCMRGKGGPEN SC Y+GVRQRTWGKWV EIREPNRG R+WLGT+  + +
Sbjct  46   RKPPARGSKKGCMRGKGGPENPSCRYRGVRQRTWGKWVAEIREPNRGGRLWLGTFPTATE  105

Query  654  aavaydaaARYIFGAKAKLNLP  589
            AA+AYD AAR ++G+ A++NLP
Sbjct  106  AALAYDDAARAMYGSLARVNLP  127



>emb|CDP16214.1| unnamed protein product [Coffea canephora]
Length=193

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 100/214 (47%), Gaps = 53/214 (25%)
 Frame = -1

Query  798  MRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavaydaaARYI  619
            MRGKGG ENASCTYKGV Q+TWGKW+ EI EPNR +                     R +
Sbjct  1    MRGKGGQENASCTYKGVWQQTWGKWLAEIGEPNRAA---------------------RKL  39

Query  618  FGAKAKLNLPHLWEN-EPPPPSLGVGSSYPFPRLNNPSQLL--PSPETCADGSGGSTVPA  448
            +G  AKLNLPHL++  +  P    + +  P         L+    PE  A G    T   
Sbjct  40   YGTAAKLNLPHLYQRPQHVPVYFTLNTLTPINTSGGNQGLVFKTKPEVTATGYPMGT---  96

Query  447  AYGNCASSSTSSAHHQNASIFNGDNSSVISPAAPPPLQNIKLPKLDMNEKAPENEVEGMW  268
                  +S  +S    N ++ + + + V+                    K+ E  +EG+W
Sbjct  97   -----TTSGVTSVMSNNNNVVDYNGNKVV--------------------KSEERNMEGVW  131

Query  267  GTFNLNGLPEIDDSSMWAEATATSDIQAAVTDPG  166
               N+N LPE DDSS+WA+  A S   AA++DPG
Sbjct  132  NILNIN-LPETDDSSIWADTPAVSPFLAAMSDPG  164



>ref|XP_006294524.1| hypothetical protein CARUB_v10023556mg [Capsella rubella]
 gb|EOA27422.1| hypothetical protein CARUB_v10023556mg [Capsella rubella]
Length=345

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  846  PSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYE  667
            P   R  P   S+KGCMRGKGGPEN  C Y+GVRQR WGKWV EIREP RG+R+WLGT+ 
Sbjct  54   PKPIRKAPAKGSKKGCMRGKGGPENGICGYRGVRQRIWGKWVAEIREPGRGNRLWLGTFS  113

Query  666  NSydaavaydaaARYIFGAKAKLNLP  589
            +S++AA+AYD AAR ++G  A+LNLP
Sbjct  114  SSHEAALAYDEAARAMYGQSARLNLP  139



>ref|XP_008792179.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Phoenix dactylifera]
Length=328

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -1

Query  825  PRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaav  646
            P   SRKGCMRGKGGPEN+ C Y+GVRQRTWGKWV EIR+PN GSR+WLGT+  + +AA+
Sbjct  48   PAKGSRKGCMRGKGGPENSHCNYRGVRQRTWGKWVAEIRKPNGGSRLWLGTFNTALEAAL  107

Query  645  aydaaARYIFGAKAKLNLP  589
            AYD AAR ++G +A+LNLP
Sbjct  108  AYDEAARAMYGPRARLNLP  126



>ref|XP_006353419.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Solanum tuberosum]
Length=320

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCMRGKGGPEN+ C Y+GVRQR WGKWV EIREP RGSR+WLGT+  + +
Sbjct  58   RKVPAKGSKKGCMRGKGGPENSRCKYRGVRQRIWGKWVAEIREPKRGSRLWLGTFGTAIE  117

Query  654  aavaydaaARYIFGAKAKLNLPH  586
            AA+AYD AAR ++G  A+LNLP+
Sbjct  118  AALAYDEAARAMYGPCARLNLPN  140



>gb|AAD25670.1| AP2 domain transcription factor [Arabidopsis thaliana]
Length=177

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCM+GKGGPEN  C Y GVRQRTWGKWV EIREP RG+++WLGT+ +SY+
Sbjct  42   RKAPPKRSRKGCMKGKGGPENGICDYTGVRQRTWGKWVAEIREPGRGAKLWLGTFSSSYE  101

Query  654  aavaydaaARYIFGAKAKLNLPHL  583
            AA+AYD A++ I+G  A+LNLP L
Sbjct  102  AALAYDEASKAIYGQSARLNLPLL  125



>ref|XP_006294523.1| hypothetical protein CARUB_v10023556mg [Capsella rubella]
 gb|EOA27421.1| hypothetical protein CARUB_v10023556mg [Capsella rubella]
Length=334

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  846  PSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYE  667
            P   R  P   S+KGCMRGKGGPEN  C Y+GVRQR WGKWV EIREP RG+R+WLGT+ 
Sbjct  43   PKPIRKAPAKGSKKGCMRGKGGPENGICGYRGVRQRIWGKWVAEIREPGRGNRLWLGTFS  102

Query  666  NSydaavaydaaARYIFGAKAKLNLP  589
            +S++AA+AYD AAR ++G  A+LNLP
Sbjct  103  SSHEAALAYDEAARAMYGQSARLNLP  128



>gb|AFO12477.1| DRE-binding protein 2 [Leymus qinghaicus]
Length=264

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM G+GGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGEGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA  YD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARTYDDAARAMYGATARVNFP  119



>ref|XP_003569085.1| PREDICTED: dehydration-responsive element-binding protein 2A 
[Brachypodium distachyon]
Length=279

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG R+WLG++  + +
Sbjct  53   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGKRLWLGSFPTAVE  112

Query  654  aavaydaaARYIFGAKAKLNL  592
            AA AYD AAR ++GAKA++N 
Sbjct  113  AAHAYDEAARAMYGAKARVNF  133



>ref|NP_565929.1| dehydration-responsive element-binding protein 2C [Arabidopsis 
thaliana]
 sp|Q8LFR2.2|DRE2C_ARATH RecName: Full=Dehydration-responsive element-binding protein 
2C; Short=Protein DREB2C [Arabidopsis thaliana]
 gb|AAD25669.2| AP2 domain transcription factor [Arabidopsis thaliana]
 gb|ABH04612.1| At2g40340 [Arabidopsis thaliana]
 gb|AEC09816.1| dehydration-responsive element-binding protein 2C [Arabidopsis 
thaliana]
Length=341

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  846  PSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYE  667
            P S R  P   SRKGCM+GKGGPEN  C Y+GVRQR WGKWV EIREP+ G+R+WLGT+ 
Sbjct  43   PKSIRKPPPKGSRKGCMKGKGGPENGICDYRGVRQRRWGKWVAEIREPDGGARLWLGTFS  102

Query  666  NSydaavaydaaARYIFGAKAKLNLPHL  583
            +SY+AA+AYD AA+ I+G  A+LNLP +
Sbjct  103  SSYEAALAYDEAAKAIYGQSARLNLPEI  130



>emb|CAH10193.1| dehydration-responsive element binding protein 2 isoform 2 [Festuca 
arundinacea]
Length=264

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 88/145 (61%), Gaps = 8/145 (6%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  32   QEENGARKAPAKGSKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIREPNRGNRLWLGS  91

Query  672  YENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPS  493
            +  + +AA AYD AAR ++GA A++N         P  + G  S+ P    N P+ +   
Sbjct  92   FPTAVEAAHAYDEAARAMYGATARVNFSE----RSPDANSGCTSAPPVLMSNGPTAV---  144

Query  492  PETCADGSGGSTVPAAYGNCASSST  418
                ADG   S  P +  + A ++T
Sbjct  145  -SHLADGKDESESPPSLTSDAPTAT  168



>gb|ADM73511.1| dehydration responsive element-binding protein 2 [Setaria italica]
Length=234

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  26   QDESGSRKAPAKGSKKGCMAGKGGPENGNCPYRGVRQRTWGKWVAEIREPNRGKRLWLGS  85

Query  672  YENSydaavaydaaARYIFGAKAKLNLP  589
            +  + +AA AYD AA+ ++G KA++N P
Sbjct  86   FPTAVEAAHAYDEAAKAMYGPKARVNFP  113



>gb|AIY22663.1| Dreb-like protein, partial [Thinopyrum bessarabicum]
Length=261

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 87/130 (67%), Gaps = 6/130 (5%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  29   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  87

Query  675  TYENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLP  496
            ++  + +AA AYD AAR ++GAKA++N    +  + P  + G   + P P ++N +  + 
Sbjct  88   SFPTAVEAARAYDDAARAMYGAKARVN----FSEQSPDANSGCTLAPPLP-MSNGATAVS  142

Query  495  SPETCADGSG  466
             P    D SG
Sbjct  143  HPSDGKDESG  152



>gb|AIY22664.1| Dreb-like protein, partial [Thinopyrum bessarabicum]
Length=261

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 86/130 (66%), Gaps = 6/130 (5%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  29   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  87

Query  675  TYENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLP  496
            ++  +  AA AYD AAR ++GAKA++N    +  + P  + G   + P P ++N +  + 
Sbjct  88   SFPTAVGAARAYDDAARAMYGAKARVN----FSEQSPDANSGCTLAPPLP-MSNGATAVS  142

Query  495  SPETCADGSG  466
             P    D SG
Sbjct  143  HPSDGKDESG  152



>gb|AAT44958.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
Length=157

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   SRKGCM+GKGGPEN  C Y GVRQRTWGKWV EIREP RG+++WLGT  +SY+
Sbjct  42   RKAPPKRSRKGCMKGKGGPENGICDYTGVRQRTWGKWVAEIREPGRGAKLWLGTISSSYE  101

Query  654  aavaydaaARYIFGAKAKLNLPHL  583
            AA+AYD A++ I+G  A+LNLP L
Sbjct  102  AALAYDEASKAIYGQSARLNLPLL  125



>emb|CDX70820.1| BnaC03g09040D [Brassica napus]
Length=280

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRKGCM+GKGGPENA+CT++GVRQRTWGKWV EIREPNRG+R+WLGT+  S  AA+AYD 
Sbjct  4    SRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNTSVQAAMAYDE  63

Query  633  aARYIFGAKAKLN  595
            AA  ++G +A+LN
Sbjct  64   AAMKLYGPEARLN  76



>gb|AEI98833.1| dehydration responsive element binding protein 1 [Solanum tuberosum]
Length=319

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -1

Query  825  PRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaav  646
            P   S+KGCMRGKGGPEN+ C Y+GVRQR WGKWV EIREP RGSR+WLGT+  + +AA+
Sbjct  61   PAKGSKKGCMRGKGGPENSRCKYRGVRQRIWGKWVAEIREPKRGSRLWLGTFGTAIEAAL  120

Query  645  aydaaARYIFGAKAKLNLPH  586
            AYD AAR ++G  A+LNLP+
Sbjct  121  AYDEAARAMYGPCARLNLPN  140



>ref|XP_007028832.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
 gb|EOY09334.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
Length=283

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -1

Query  840  SRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENS  661
            S R +P    +KG  RGKGGP+NASC Y+GVRQRTWGKWV EIREP + +R+WLG++  +
Sbjct  3    SYRRSPLKPWKKGPTRGKGGPQNASCQYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATA  62

Query  660  ydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSL  553
             +AA+AYD AAR ++G +A LNLPHL  N  PP  L
Sbjct  63   EEAAMAYDEAARRLYGPEAYLNLPHLQPNSNPPNKL  98



>gb|AFO12481.1| DRE-binding protein 2 [Leymus qinghaicus]
Length=264

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N+P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNIP  119



>ref|XP_004968294.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Setaria italica]
Length=259

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  51   QDESGSRKAPAKGSKKGCMAGKGGPENGNCPYRGVRQRTWGKWVAEIREPNRGKRLWLGS  110

Query  672  YENSydaavaydaaARYIFGAKAKLNLP  589
            +  + +AA AYD AA+ ++G KA++N P
Sbjct  111  FPTAVEAAHAYDEAAKAMYGPKARVNFP  138



>gb|AAS59530.1| putative DRE-binding protein DREB2 [Poa pratensis]
Length=264

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 5/123 (4%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  32   QEENGSRKAPAKGSKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIREPNRGNRLWLGS  91

Query  672  YENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQL-LP  496
            +  + +AA AYD AAR ++GA A++N         P  + G  S+ P    N P+ +  P
Sbjct  92   FPTAVEAAHAYDEAARAMYGATARVNFSE----RSPDANSGCTSAPPVLMSNGPTAVSYP  147

Query  495  SPE  487
            S E
Sbjct  148  SDE  150



>ref|NP_001062535.1| Os08g0565200 [Oryza sativa Japonica Group]
 sp|Q84ZA1.1|DRE2C_ORYSJ RecName: Full=Dehydration-responsive element-binding protein 
2C; Short=OsDREB2C [Oryza sativa Japonica Group]
 dbj|BAC56005.1| AP2-domain DNA-binding protein-like [Oryza sativa Japonica Group]
 gb|AAQ19033.1| Ap22 [Oryza sativa]
 dbj|BAD10326.1| AP2-domain DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF24449.1| Os08g0565200 [Oryza sativa Japonica Group]
 gb|EAZ08054.1| hypothetical protein OsI_30319 [Oryza sativa Indica Group]
Length=230

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -1

Query  840  SRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENS  661
            SR+  P   SRKGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNRG+R+WLGT+  +
Sbjct  28   SRKCCPLRRSRKGCMKGKGGPENQRCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTA  87

Query  660  ydaavaydaaARYIFGAKAKLN  595
             DAA AYD+AAR ++G  A+LN
Sbjct  88   LDAARAYDSAARALYGDCARLN  109



>emb|CAG30547.1| putative DREB2A protein [Festuca arundinacea]
Length=264

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 5/123 (4%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  32   QEENGSRKAPAKGSKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIREPNRGNRLWLGS  91

Query  672  YENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQL-LP  496
            +  + +AA AYD AAR ++GA A++N         P  + G  S+ P    N P+ +  P
Sbjct  92   FPTAVEAAHAYDEAARAMYGATARVNFSE----RSPDANSGCTSAPPVLMSNGPTAVSYP  147

Query  495  SPE  487
            S E
Sbjct  148  SDE  150



>emb|CAG30548.1| putative DREB2A protein [Festuca arundinacea]
Length=254

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  32   QEENGSRKAPAKGSKKGCMAGKGGPENSNCEYRGVRQRTWGKWVAEIREPNRGNRLWLGS  91

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GA A++N 
Sbjct  92   FPTAVEAAHAYDEAARAMYGATARVNF  118



>gb|AFO12472.1| DRE-binding protein 2 [Leymus crassiusculus]
 gb|AFO12482.1| DRE-binding protein 2 [Leymus tianschanicus]
Length=264

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNFP  119



>ref|XP_008678419.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Zea mays]
 gb|AFW61647.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05166.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=352

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 74/101 (73%), Gaps = 6/101 (6%)
 Frame = -1

Query  846  PSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYE  667
            P  R+  P   SRKGCM+GKGGP+N  C ++GVRQRTWGKWV EIREPNRG+R+WLGT+ 
Sbjct  49   PGGRKCCPLRRSRKGCMKGKGGPDNQQCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFG  108

Query  666  NSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVG  544
            ++ +AA AYDAAAR ++G  A+LNL      + PPPS   G
Sbjct  109  SALEAARAYDAAARALYGDCARLNL------QLPPPSAAAG  143



>gb|ACA79910.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79920.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  52   QDESGSRKAPAKGSKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGS  111

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AA+ ++G KA++N 
Sbjct  112  FPTAVEAAHAYDEAAKAMYGPKARVNF  138



>ref|XP_008776283.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Phoenix dactylifera]
Length=326

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -1

Query  825  PRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaav  646
            P   SRKGCM GKGGP+N  C Y+GVRQRTWGKWV EIREP+RGSR+WLGT+  + +AA+
Sbjct  48   PGKGSRKGCMEGKGGPDNPHCKYRGVRQRTWGKWVAEIREPSRGSRLWLGTFPTAVEAAL  107

Query  645  aydaaARYIFGAKAKLNLPHL  583
            AYD AAR ++G+ A+LNLP  
Sbjct  108  AYDEAARAMYGSYARLNLPEF  128



>ref|XP_002444543.1| hypothetical protein SORBIDRAFT_07g023575 [Sorghum bicolor]
 gb|EES14038.1| hypothetical protein SORBIDRAFT_07g023575 [Sorghum bicolor]
Length=388

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -1

Query  825  PRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaav  646
            P   SRKGCM+GKGGP+N  C Y+GVRQRTWGKWV EIREPNRG+R+WLGT+ ++ +AA 
Sbjct  67   PLRRSRKGCMKGKGGPDNQQCPYRGVRQRTWGKWVAEIREPNRGARLWLGTFGSALEAAR  126

Query  645  aydaaARYIFGAKAKLNLPHL  583
            AYD AAR ++G  A+LNL  +
Sbjct  127  AYDNAARQLYGDCARLNLQQM  147



>gb|AFV52020.1| DREB2 [Saccharum officinarum]
Length=262

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  52   QDESGSRKAPAKGSKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGS  111

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AA+ ++G KA++N 
Sbjct  112  FPTAVEAAHAYDEAAKAMYGPKARVNF  138



>gb|EAZ08049.1| hypothetical protein OsI_30314 [Oryza sativa Indica Group]
Length=231

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -1

Query  840  SRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENS  661
            SR+  P   SRKGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNRG+R+WLGT+  +
Sbjct  28   SRKCCPLRRSRKGCMKGKGGPENQRCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTA  87

Query  660  ydaavaydaaARYIFGAKAKLN  595
             DAA AYD+AAR ++G  A+LN
Sbjct  88   LDAARAYDSAARALYGDCARLN  109



>ref|XP_003571275.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Brachypodium distachyon]
Length=213

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -1

Query  840  SRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENS  661
            SR+  P   SRKGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNRG+R+WLGT+  +
Sbjct  14   SRKCCPLRRSRKGCMKGKGGPENQRCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFSTA  73

Query  660  ydaavaydaaARYIFGAKAKLNL  592
             DAA AYD+AA+ ++G  A+LNL
Sbjct  74   LDAARAYDSAAKALYGDCARLNL  96



>ref|NP_001234689.1| dehydration responsive element binding protein [Solanum lycopersicum]
 gb|AAN77051.1| dehydration responsive element binding protein [Solanum lycopersicum]
Length=300

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCMRGKGGPEN  C Y+GVRQR WGKWV EIREP RGSR+WLGT+  + +
Sbjct  57   RKVPAKGSKKGCMRGKGGPENWRCKYRGVRQRIWGKWVAEIREPKRGSRLWLGTFGTAIE  116

Query  654  aavaydaaARYIFGAKAKLNLPH  586
            AA+AYD AAR ++G  A+LNLP+
Sbjct  117  AALAYDDAARAMYGPCARLNLPN  139



>gb|AIU40168.1| dehydration responsive element binding protein 2 [Saccharum arundinaceum]
Length=262

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  52   QDESGSRKAPAKGSKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGS  111

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AA+ ++G KA++N 
Sbjct  112  FPTAVEAAHAYDEAAKAMYGPKARVNF  138



>ref|XP_001756620.1| predicted protein [Physcomitrella patens]
 gb|EDQ78574.1| predicted protein [Physcomitrella patens]
Length=85

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S++GCM+GKGGPENA CTY+GVRQ+TWG WV EIR+PNRG R+WLGTY  +  
Sbjct  4    RQAPAKGSKRGCMKGKGGPENALCTYRGVRQQTWGMWVAEIRKPNRGLRLWLGTYSTAEI  63

Query  654  aavaydaaARYIFGAKAKLNLP  589
            AA+AY++AAR ++G  A LN P
Sbjct  64   AALAYNSAARILYGPNALLNQP  85



>ref|XP_002457289.1| hypothetical protein SORBIDRAFT_03g004980 [Sorghum bicolor]
 gb|EES02409.1| hypothetical protein SORBIDRAFT_03g004980 [Sorghum bicolor]
Length=262

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  52   QDESGSRKAPAKGSKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGS  111

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AA+ ++G KA++N 
Sbjct  112  FPTAVEAAHAYDEAAKAMYGPKARVNF  138



>gb|ACA79916.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  52   QDESGSRKAPAKGSKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGS  111

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AA+ ++G KA++N 
Sbjct  112  FPTAVEAAHAYDEAAKAMYGPKARVNF  138



>gb|ACA79914.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  52   QDESGSRKAPAKGSKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGS  111

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AA+ ++G KA++N 
Sbjct  112  FPTAVEAAHAYDEAAKAMYGPKARVNF  138



>gb|ABX45045.1| desiccation responisve element-binding protein [Sorghum bicolor]
 gb|ACA79911.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79913.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79915.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79917.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79918.1| DRE-binding protein 2 [Sorghum bicolor]
 gb|ACA79922.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  52   QDESGSRKAPAKGSKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGS  111

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AA+ ++G KA++N 
Sbjct  112  FPTAVEAAHAYDEAAKAMYGPKARVNF  138



>gb|AFO12471.1| DRE-binding protein 2 [Leymus chinensis]
Length=264

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNFP  119



>gb|AFO12474.1| DRE-binding protein 2 [Leymus mollis]
Length=264

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNFP  119



>gb|AFO12479.1| DRE-binding protein 2 [Leymus secalinus]
Length=264

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNFP  119



>gb|AFO12468.1| DRE-binding protein 2 [Leymus alaicus subsp. karataviensis]
Length=264

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNFP  119



>ref|XP_002973089.1| hypothetical protein SELMODRAFT_38502, partial [Selaginella moellendorffii]
 ref|XP_002976779.1| hypothetical protein SELMODRAFT_105485, partial [Selaginella 
moellendorffii]
 gb|EFJ22448.1| hypothetical protein SELMODRAFT_105485, partial [Selaginella 
moellendorffii]
 gb|EFJ25463.1| hypothetical protein SELMODRAFT_38502, partial [Selaginella moellendorffii]
Length=75

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            S+KG MRGKGGPENASCTY+GVRQRTWGKWV EIREP + SR+WLG++  + +AA AYD 
Sbjct  1    SKKGSMRGKGGPENASCTYRGVRQRTWGKWVAEIREPKKRSRLWLGSFATADEAARAYDE  60

Query  633  aARYIFGAKAKLNLP  589
            AA+ ++G +A LNLP
Sbjct  61   AAKRLYGPEAHLNLP  75



>gb|AAR11157.1| dehydration-responsive element binding protein 2 [Festuca arundinacea]
Length=263

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  32   QEENGARKAPAKGSKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIREPNRGNRLWLGS  91

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GA A++N 
Sbjct  92   FPTAVEAAHAYDEAARAMYGATARVNF  118



>gb|AAU29412.1| dehydration-responsive element-binding protein 2 [Hordeum brevisubulatum]
Length=264

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNFP  119



>ref|NP_001152469.1| dehydration-responsive element-binding protein 2A [Zea mays]
 gb|ACG47772.1| dehydration-responsive element-binding protein 2A [Zea mays]
Length=260

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  50   QDESGSRKAPAKGSKKGCMMGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGS  109

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AA+ ++G KA++N 
Sbjct  110  FPTAVEAAHAYDEAAKAMYGPKARVNF  136



>gb|AFO12470.1| DRE-binding protein 2 [Leymus arenarius]
Length=264

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNFP  119



>gb|AFO12467.1| DRE-binding protein 2 [Leymus akmolinensis]
Length=264

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNFP  119



>gb|AEO78516.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=144

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 75/106 (71%), Gaps = 4/106 (4%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG++  + +
Sbjct  35   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  94

Query  654  aavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLN  517
            AA AYD AAR ++GAKA++N       + P  + G   + P P+ N
Sbjct  95   AARAYDDAARAMYGAKARVNFSE----QSPDANSGCTLAPPLPKSN  136



>gb|AFH75401.1| dehydration-responsive element-binding transcription factor 2 
[Hordeum brevisubulatum subsp. violaceum]
Length=264

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNFP  119



>gb|AIY22669.1| Dreb-like protein, partial [Dasypyrum villosum]
Length=261

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  29   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  87

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  88   SFPTAVEAARAYDDAARAMYGAKARVNF  115



>gb|AFO12483.1| DRE-binding protein 2 [Leymus triticoides]
Length=264

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGATARVNFP  119



>gb|ACA79919.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  52   QDESGSRKAPAKGSKKGCMTGKGGPENINCVYRGVRQRTWGKWVAEIREPNRGRRLWLGS  111

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AA+ ++G KA++N 
Sbjct  112  FPTAVEAAHAYDEAAKAMYGPKARVNF  138



>gb|AIY22668.1| Dreb-like protein, partial [Elymus spicatus]
Length=261

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  29   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  87

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  88   SFPTAVEAARAYDDAARAMYGAKARVNF  115



>gb|ACX94337.1| dehydration responsive factor 1.3 [Aegilops columnaris]
Length=324

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  36   DPQGAKRARKAPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  95

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  96   GTFPTAEDAARAYDEAARAMYGALARTNFP  125



>gb|AFO12475.1| DRE-binding protein 2 [Leymus multicaulis]
Length=264

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENRSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  91   SFPTAVEAARAYDDAARAMYGAKARVNF  118



>gb|AAY25517.1| dehydration responsive element binding protein 1 [Hordeum vulgare 
subsp. vulgare]
 dbj|BAK07539.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEI54696.1| AP2/EREBP-like protein [Hordeum vulgare subsp. vulgare]
 gb|AEI54697.1| AP2/EREBP-like protein [Hordeum vulgare subsp. vulgare]
 gb|AHY82615.1| dehydration responsive element binding protein 1 [Hordeum vulgare 
subsp. vulgare]
Length=278

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  46   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  104

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  105  SFPTAVEAARAYDDAARAMYGATARVNFP  133



>gb|ABA08426.1| dehydration-responsive element-binding protein [Triticum aestivum]
Length=261

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  29   QQENGSRKA-PAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  87

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  88   SFPTAVEAARAYDDAARAMYGAKARVNF  115



>gb|AEZ68001.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=157

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  33   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  92

Query  672  YENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLN  517
            +  + +AA AYD AAR ++GAKA++N       + P  + G   + P P  N
Sbjct  93   FPTAVEAARAYDDAARAMYGAKARVNFSE----QSPDANSGCTLAPPLPTYN  140



>gb|AEV46839.1| dehydration-responsive element binding protein [Leymus chinensis]
Length=278

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  46   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  104

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  105  SFPTAVEAARAYDDAARAMYGATARVNFP  133



>gb|AEK48231.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=150

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  26   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  85

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GAKA++N 
Sbjct  86   FPTAVEAARAYDDAARAMYGAKARVNF  112



>gb|AFO12473.1| DRE-binding protein 2 [Leymus karelinii]
Length=264

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  91   SFPTAVEAARAYDDAARAMYGAKARVNF  118



>gb|AEO78515.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=152

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  28   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  87

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GAKA++N 
Sbjct  88   FPTAVEAARAYDDAARAMYGAKARVNF  114



>gb|AEK48229.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
 gb|AEK48230.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=152

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  28   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  87

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GAKA++N 
Sbjct  88   FPTAVEAARAYDDAARAMYGAKARVNF  114



>gb|AEK48227.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
 gb|AEK48228.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=153

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+   +  S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  29   QQENGSRKAQAKG-SKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  87

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  88   SFPTAVEAARAYDDAARAMYGAKARVNF  115



>gb|AER42620.1| dehydration responsive element binding protein 1 [Hordeum brevisubulatum]
Length=278

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  46   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  104

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++GA A++N P
Sbjct  105  SFPTAVEAARAYDDAARAMYGATARVNFP  133



>gb|AIY22665.1| Dreb-like protein, partial [Thinopyrum ponticum]
Length=260

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  29   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  87

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  88   SFPTAVEAARAYDDAARAMYGAKARVNF  115



>ref|XP_006643786.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Oryza brachyantha]
Length=274

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  SS R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  45   QEESSSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGS  104

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++G  A++N 
Sbjct  105  FPTALEAAHAYDEAARAMYGPTARVNF  131



>gb|AEI98920.1| AP2/EREBP transcription factor [Lophopyrum elongatum]
Length=278

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  46   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  104

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  105  SFPTAVEAARAYDDAARAMYGAKARVNF  132



>gb|AEZ68003.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
 gb|AEZ68004.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=160

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  36   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  95

Query  672  YENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLN  517
            +  + +AA AYD AAR ++GAKA++N       + P  + G   + P P  N
Sbjct  96   FPTAVEAARAYDDAARAMYGAKARVNFSE----QSPDANSGCTLAPPLPTCN  143



>gb|AGL08026.1| dehydration-responsive element-binding protein, partial [Aegilops 
tauschii]
Length=153

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  29   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  88

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GAKA++N 
Sbjct  89   FPTAVEAARAYDDAARAMYGAKARVNF  115



>gb|AGL08024.1| dehydration-responsive element-binding protein, partial [Triticum 
dicoccoides]
Length=154

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  30   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  89

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GAKA++N 
Sbjct  90   FPTAVEAARAYDDAARAMYGAKARVNF  116



>gb|AGG20202.1| DREB2 [Hemarthria compressa]
Length=264

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  54   QDESGSRKAPAKGSKKGCMTGKGGPENVNCVYRGVRQRTWGKWVAEIREPNRGRRLWLGS  113

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AA+ ++G +A++N 
Sbjct  114  FPTAVEAAHAYDEAAKAMYGPRARVNF  140



>gb|ACX94335.1| dehydration responsive factor 1.1 [Aegilops columnaris]
Length=372

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  84   DPQGAKRARKAPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  143

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  144  GTFPTAEDAARAYDEAARAMYGALARTNFP  173



>ref|XP_010102188.1| Dehydration-responsive element-binding protein 2G [Morus notabilis]
 gb|AHJ25979.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB93131.1| Dehydration-responsive element-binding protein 2G [Morus notabilis]
Length=199

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  813  SRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSydaavayda  634
            SRK  M+GKGGPENA CT+ GVRQRTWGKWV EIREPNRG+R+WLGT+  S +AA+AYD 
Sbjct  24   SRKRRMKGKGGPENAECTFIGVRQRTWGKWVAEIREPNRGARLWLGTFNTSTEAALAYDD  83

Query  633  aARYIFGAKAKLNLP  589
            AA  ++G  AKLNLP
Sbjct  84   AATKLYGTSAKLNLP  98



>gb|AEO78514.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=149

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  28   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  87

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GAKA++N 
Sbjct  88   FPTAVEAARAYDDAARAMYGAKARVNF  114



>gb|ABA08425.1| dehydration-responsive element-binding protein [Triticum aestivum]
Length=176

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG++  + +
Sbjct  35   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  94

Query  654  aavaydaaARYIFGAKAKLNL  592
            AA AYD AAR ++GAKA++N 
Sbjct  95   AARAYDDAARAMYGAKARVNF  115



>gb|AGL08027.1| dehydration-responsive element-binding protein, partial [Aegilops 
peregrina]
Length=150

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  29   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  88

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GAKA++N 
Sbjct  89   FPTAVEAARAYDDAARAMYGAKARVNF  115



>gb|AIY22662.1| Dreb-like protein [Thinopyrum bessarabicum]
Length=279

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 6/130 (5%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVR RTWGKWV EIREPNRG+R+WLG
Sbjct  47   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRHRTWGKWVAEIREPNRGNRLWLG  105

Query  675  TYENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLP  496
            ++  + +AA AYD AAR ++GAKA++N    +  + P  + G   + P P ++N +  + 
Sbjct  106  SFPTAVEAARAYDDAARAMYGAKARVN----FSEQSPDANSGCTLAPPLP-MSNGATAVS  160

Query  495  SPETCADGSG  466
             P    D SG
Sbjct  161  HPSDGKDESG  170



>gb|AEZ68005.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=157

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  34   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  93

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GAKA++N 
Sbjct  94   FPTAVEAARAYDDAARAMYGAKARVNF  120



>gb|AEZ68002.1| dehydration-responsive element-binding protein, partial [Triticum 
aestivum]
Length=158

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  36   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  95

Query  672  YENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLN  517
            +  + +AA AYD AAR ++GAKA++N       + P  + G   + P P  N
Sbjct  96   FPTAVEAARAYDDAARAMYGAKARVNFSE----QSPDANSGCTLAPPLPTCN  143



>gb|AGL08025.1| dehydration-responsive element-binding protein, partial [Aegilops 
speltoides]
Length=144

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG++  + +
Sbjct  31   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  90

Query  654  aavaydaaARYIFGAKAKLNL  592
            AA AYD AAR ++GAKA++N 
Sbjct  91   AARAYDDAARAMYGAKARVNF  111



>gb|AFO12478.1| DRE-binding protein 2 [Leymus racemosus]
Length=264

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++G  A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGTTARVNFP  119



>emb|CAG30549.1| putative FaDREB2A [Festuca arundinacea]
 emb|CAH10192.1| dehydration-responsive element binding protein 2 isoform 1 [Festuca 
arundinacea]
Length=254

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 98/166 (59%), Gaps = 11/166 (7%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIR+PNRG+R+WLG+
Sbjct  32   QEENGSRKAPAKGSKKGCMAGKGGPENSNCKYRGVRQRTWGKWVAEIRKPNRGNRLWLGS  91

Query  672  YENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLLPS  493
            +  + +AA AYD AAR ++GA A++N      +E  P +    +S P   ++N    +  
Sbjct  92   FPTAVEAAHAYDEAARAMYGATARVNF-----SERSPDANSGCTSAPRVLMSNGPTAVSH  146

Query  492  PETCADGSGGSTVPAAYGNCASSSTSSAH---HQNASIFNGDNSSV  364
            P   ADG   S  P +  + A     SA    H+  +  + D++SV
Sbjct  147  P---ADGKDESESPPSLTSDAKDEPESAGTVVHEVKTEASNDSTSV  189



>gb|AAL01124.1|AF303376_1 AP2-containing protein [Triticum aestivum]
 gb|AAY44605.1| dehydration responsive element binding protein W50 [Triticum 
aestivum]
 gb|ABA08424.1| dehydration-responsive element-binding protein [Triticum aestivum]
Length=278

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  46   QQENGSRKA-PAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  104

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  105  SFPTAVEAARAYDDAARAMYGAKARVNF  132



>gb|ABU68663.1| AP2 transcriptional activator variant, partial [Triticum turgidum 
subsp. durum]
Length=104

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  13   DPQGSKRSRKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  72

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  73   GTFPTAEDAARAYDEAARAMYGALARTNFP  102



>gb|AIY22667.1| Dreb-like protein, partial [Thinopyrum intermedium]
Length=259

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  29   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  87

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  88   SFPTAAEAARAYDDAARAMYGAKARVNF  115



>gb|AFO12476.1| DRE-binding protein 2 [Leymus paboanus]
Length=264

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++G  A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGTTARVNFP  119



>gb|AAY44604.1| dehydration responsive element binding protein W73 [Triticum 
aestivum]
Length=278

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  46   QQENGSRKA-PAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  104

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  105  SFPTAVEAARAYDDAARAMYGAKARVNF  132



>gb|AAM61256.1| AP2 domain transcription factor [Arabidopsis thaliana]
Length=341

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -1

Query  846  PSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYE  667
            P S R  P   SRKGCM+GKGGPEN  C Y+ VRQR WGKWV EIREP+ G+R+WLGT+ 
Sbjct  43   PKSIRKPPPKGSRKGCMKGKGGPENGICDYREVRQRRWGKWVAEIREPDGGARLWLGTFS  102

Query  666  NSydaavaydaaARYIFGAKAKLNLPHL  583
            +SY+AA+AYD AA+ I+G  A+LNLP +
Sbjct  103  SSYEAALAYDEAAKAIYGQSARLNLPEI  130



>emb|CBX87024.1| DREB2 protein [Aegilops biuncialis]
Length=278

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +  R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG+
Sbjct  46   QQENGSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGS  105

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++GAKA++N 
Sbjct  106  FPTAVEAARAYDDAARAMYGAKARVNF  132



>gb|AFO12480.1| DRE-binding protein 2 [Leymus secalinus subsp. secalinus]
Length=264

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  32   QQENGSRK-APAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  90

Query  675  TYENSydaavaydaaARYIFGAKAKLNLP  589
            ++  + +AA AYD AAR ++G  A++N P
Sbjct  91   SFPTAVEAARAYDDAARAMYGTTARVNFP  119



>gb|AFO11002.1| AP2 transcriptional activator DRF 1.3 [Triticum turgidum subsp. 
durum]
Length=345

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  57   DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  116

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  117  GTFPTAEDAARAYDEAARAMYGALARTNFP  146



>gb|ACO35588.1| dehydration responsive factor 1 variant 3 [Aegilops speltoides 
var. ligustica]
Length=343

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  55   DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  114

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  115  GTFPTAEDAARAYDEAARAMYGALARTNFP  144



>gb|EMS45041.1| Dehydration-responsive element-binding protein 2B [Triticum urartu]
Length=361

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  73   DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  132

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  133  GTFPTAEDAARAYDEAARAMYGALARTNFP  162



>gb|ACJ01643.1| dehydration responsive factor 1 variant 1.3 [Triticum turgidum 
subsp. durum]
Length=346

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 85/156 (54%), Gaps = 26/156 (17%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  58   DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  117

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLPHLWENEPPPPSLGVGSSYPFPRLNNPSQLL  499
            GT+  + DAA AYD AAR ++GA A+ N P                        +P+Q  
Sbjct  118  GTFPTAEDAARAYDEAARAMYGALARTNFP-----------------------AHPAQ--  152

Query  498  PSPETCADGSGGSTVPAAYGNCASSSTSSAHHQNAS  391
             +P      +    V  A  +C S++TS+ H   AS
Sbjct  153  -APAVALPAAIEGVVRGASASCESTTTSTNHSDVAS  187



>gb|AFQ00888.1| AP2 transcriptional activator DRF1.3 [Triticum turgidum subsp. 
durum]
Length=345

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  57   DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  116

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  117  GTFPTAEDAARAYDEAARAMYGALARTNFP  146



>gb|AFO10996.1| AP2 transcriptional activator DRF 1.3 [Triticum turgidum subsp. 
durum]
 gb|AFO10999.1| AP2 transcriptional activator DRF 1.3 [Triticum turgidum subsp. 
durum]
Length=345

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  57   DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  116

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  117  GTFPTAEDAARAYDEAARAMYGALARTNFP  146



>gb|AAX13283.1| DREB transcription factor 4B [Triticum aestivum]
Length=346

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  58   DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  117

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  118  GTFPTAEDAARAYDEAARAMYGALARTNFP  147



>gb|ABY19375.1| DRE-binding protein DREB2 [Phyllostachys edulis]
 gb|ABY19376.1| DRE-binding protein DREB2 [Phyllostachys edulis]
Length=277

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG R+WLG++  + +
Sbjct  51   RKAPAKGSKKGCMAGKGGPENSNCDYRGVRQRTWGKWVAEIREPNRGKRLWLGSFPTALE  110

Query  654  aavaydaaARYIFGAKAKLNL  592
            AA AYD AAR ++G+ A++N 
Sbjct  111  AAHAYDEAARAMYGSAARVNF  131



>gb|AAX13289.1| DREB transcription factor 6 [Triticum aestivum]
 emb|CDM81490.1| unnamed protein product [Triticum aestivum]
Length=254

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -1

Query  834  RHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGTYENSyd  655
            R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG+R+WLG++  + +
Sbjct  52   RKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPTAVE  111

Query  654  aavaydaaARYIFGAKAKLNL  592
            AA AYD AAR ++GAKA++N 
Sbjct  112  AARAYDDAARAMYGAKARVNF  132



>gb|AHG26212.1| dreb2 [Triticum urartu]
Length=390

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  102  DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  161

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  162  GTFPTAEDAARAYDEAARAMYGALARTNFP  191



>gb|ABD66654.1| DRE-binding protein 2 [Sorghum bicolor]
Length=262

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  S  R  P   S+KGCM GKGGPEN +  Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  52   QDESGSRKAPAKGSKKGCMTGKGGPENVNSMYRGVRQRTWGKWVAEIREPNRGRRLWLGS  111

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            + N+ +AA AYD AA+ ++G KA++N 
Sbjct  112  FPNAVEAAHAYDEAAKAMYGPKARVNF  138



>gb|ACO35585.1| dehydration responsive factor 1 variant 3 [Aegilops speltoides 
var. ligustica]
Length=344

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  56   DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  115

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  116  GTFPTAEDAARAYDEAARAMYGALARTNFP  145



>gb|AFO11000.1| AP2 transcriptional activator DRF 1.1 [Triticum turgidum subsp. 
durum]
Length=392

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  104  DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  163

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  164  GTFPTAEDAARAYDEAARAMYGALARTNFP  193



>gb|ACJ01649.1| dehydration responsive factor 1 variant 1.3 [Secale cereale x 
Triticum turgidum subsp. durum]
Length=335

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  57   DPQGSKRSRKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  116

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  117  GTFPTAEDAARAYDEAARAMYGALARANFP  146



>gb|AAX13278.1| DREB transcription factor 3B [Triticum aestivum]
Length=341

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  58   DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  117

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  118  GTFPTAEDAARAYDEAARAMYGALARTNFP  147



>emb|CBH19547.1| AP2 domain containing protein [Oryza sativa Indica Group]
Length=168

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -1

Query  852  QPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLGT  673
            Q  +S R  P   S+KGCM GKGGPEN++C Y+GVRQRTWGKWV EIREPNRG R+WLG+
Sbjct  52   QEENSSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGS  111

Query  672  YENSydaavaydaaARYIFGAKAKLNL  592
            +  + +AA AYD AAR ++G  A++N 
Sbjct  112  FPTALEAAHAYDEAARAMYGPTARVNF  138



>gb|ADM93284.1| DRE-binding transcription factor 1.1 [Triticum dicoccoides]
Length=341

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  58   DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  117

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  118  GTFPTAEDAARAYDEAARAMYGALARANFP  147



>gb|ACO35586.1| dehydration responsive factor 1 variant 1 [Aegilops speltoides 
var. ligustica]
Length=391

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  DQQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWL  679
            D Q     R  P   S+KGCM+GKGGPEN  C ++GVRQRTWGKWV EIREPNR SR+WL
Sbjct  103  DPQGAKRARKPPAKGSKKGCMQGKGGPENTQCGFRGVRQRTWGKWVAEIREPNRVSRLWL  162

Query  678  GTYENSydaavaydaaARYIFGAKAKLNLP  589
            GT+  + DAA AYD AAR ++GA A+ N P
Sbjct  163  GTFPTAEDAARAYDEAARAMYGALARTNFP  192



>gb|AIY22666.1| Dreb-like protein, partial [Thinopyrum ponticum]
Length=260

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = -1

Query  855  QQPPSSRRHNPRAVSRKGCMRGKGGPENASCTYKGVRQRTWGKWVCEIREPNRGSRIWLG  676
            QQ   SR+  P   S+KGCM GKGGPE+++C Y+GVRQRTWGKWV EIREPNRG+R+WLG
Sbjct  29   QQENGSRK-APAKGSKKGCMAGKGGPEDSNCAYRGVRQRTWGKWVAEIREPNRGNRLWLG  87

Query  675  TYENSydaavaydaaARYIFGAKAKLNL  592
            ++  + +AA AYD AAR ++GAKA++N 
Sbjct  88   SFPTAVEAARAYDDAARAMYGAKARVNF  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1948488333440