BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c38643_g1_i1 len=134 path=[112:0-133]

Length=134
                                                                      Score     E

ref|XP_003598202.1|  60S ribosomal protein L23                        49.3    4e-05   
ref|XP_002300604.2|  hypothetical protein POPTR_0002s00270g           43.9    5e-04   Populus trichocarpa [western balsam poplar]



>ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatula]
Length=547

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    WEQLRNEVTPATSATGMRTSAWEPPPIGFLKCNVDAATF  120
            W+  RN  T     +   T AW+PP  GFLKCNVDAA F
Sbjct  36   WQAARNSATTQVQQSPQDTIAWQPPAAGFLKCNVDAAIF  74



>ref|XP_002300604.2| hypothetical protein POPTR_0002s00270g [Populus trichocarpa]
 gb|EEE79877.2| hypothetical protein POPTR_0002s00270g [Populus trichocarpa]
Length=166

 Score = 43.9 bits (102),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/43 (40%), Positives = 27/43 (63%), Gaps = 1/43 (2%)
 Frame = +1

Query  1    SWEQLRNEVTPATSATGMRTSAWEPPPIGFLKCNVDAATFDNG  129
            +W+ +R  V  + +  G ++  W+ PP+GFLKCN+DA   D G
Sbjct  30   AWKCVRQIVQHSVNVQG-QSQKWDKPPVGFLKCNIDADILDQG  71



Lambda      K        H        a         alpha
   0.313    0.127    0.412    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512165903184