BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c38386_g1_i1 len=707 path=[685:0-706]

Length=707
                                                                      Score     E

ref|XP_010444399.1|  PREDICTED: cell wall / vacuolar inhibitor of...  55.8    2e-06   
ref|XP_009592268.1|  PREDICTED: putative invertase inhibitor          53.9    8e-06   
ref|NP_201267.1|  cell wall / vacuolar inhibitor of fructosidase 2    53.9    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009788876.1|  PREDICTED: pectinesterase inhibitor-like         53.5    1e-05   
ref|XP_006492567.1|  PREDICTED: pectinesterase inhibitor-like         53.1    2e-05   
ref|XP_006431609.1|  hypothetical protein CICLE_v10002621mg           52.8    3e-05   
ref|XP_006281177.1|  hypothetical protein CARUB_v10027212mg           52.8    3e-05   
ref|XP_010462937.1|  PREDICTED: cell wall / vacuolar inhibitor of...  52.4    3e-05   
ref|XP_007206622.1|  hypothetical protein PRUPE_ppa021753mg           52.0    5e-05   
ref|XP_006431604.1|  hypothetical protein CICLE_v10004017mg           52.0    5e-05   
ref|XP_008235482.1|  PREDICTED: cell wall / vacuolar inhibitor of...  51.6    7e-05   
ref|XP_002864910.1|  C/VIF2                                           51.2    8e-05   
ref|XP_010484247.1|  PREDICTED: cell wall / vacuolar inhibitor of...  51.2    8e-05   
ref|XP_006349541.1|  PREDICTED: pectinesterase inhibitor-like         50.1    3e-04   
gb|KDO41794.1|  hypothetical protein CISIN_1g037300mg                 48.9    4e-04   
ref|XP_009619356.1|  PREDICTED: putative invertase inhibitor          48.9    4e-04   
ref|XP_006431605.1|  hypothetical protein CICLE_v10003542mg           49.3    4e-04   
ref|XP_004304912.1|  PREDICTED: uncharacterized protein LOC101292328  49.3    5e-04   
ref|XP_008350729.1|  PREDICTED: putative invertase inhibitor          49.3    5e-04   
ref|XP_009112145.1|  PREDICTED: cell wall / vacuolar inhibitor of...  48.5    7e-04   



>ref|XP_010444399.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Camelina sativa]
Length=181

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 69/143 (48%), Gaps = 4/143 (3%)
 Frame = -3

Query  561  SGQAAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVI  382
            S ++   +I + CK T+   FC S L+    SP AD K LA +M+  G +  ATST   I
Sbjct  24   SAKSNATIIESTCKTTNNYKFCVSALKSDPRSPTADTKGLAAIMIGVG-MTNATSTATYI  82

Query  381  IKLLEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREVgsgadagsac  202
               L       + K++L  C   + LAV+S    ++D DS +Y  A+  V +  D  + C
Sbjct  83   AGNLTSAANDVVLKKVLQDCSEKYALAVDSLRQTIQDLDSEAYDYASMHVLAAEDYPNVC  142

Query  201  dALFKNAGLDGSPVPDGGLRHRQ  133
              +F+ A     PV    +R R+
Sbjct  143  RNIFRRAKGLSYPVE---IRRRE  162



>ref|XP_009592268.1| PREDICTED: putative invertase inhibitor [Nicotiana tomentosiformis]
Length=178

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 4/101 (4%)
 Frame = -3

Query  558  GQAAGDLISTVC-KNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVI  382
              ++GDLI  VC K+TDY   C S+LR    S  ADKK L ++ML   +L +A    N  
Sbjct  19   AHSSGDLIEDVCKKSTDY-KLCVSSLRADPRSSSADKKGLVRIML-QLSLGKAKDIYNQT  76

Query  381  IKLLEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSG  259
            + +L+ P +  + K+ L  CR  + LAV+   N++KD D  
Sbjct  77   LIMLKQP-MEPILKQCLQICRDNYDLAVSQITNSIKDLDEN  116



>ref|NP_201267.1| cell wall / vacuolar inhibitor of fructosidase 2 [Arabidopsis 
thaliana]
 sp|O49603.1|CVIF2_ARATH RecName: Full=Cell wall / vacuolar inhibitor of fructosidase 
2; Short=AtC/VIF2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA73335.1| invertase inhibitor homologue [Arabidopsis thaliana]
 dbj|BAB11429.1| invertase inhibitor homolog [Arabidopsis thaliana]
 gb|AAM63637.1| invertase inhibitor homolog [Arabidopsis thaliana]
 gb|AAO41931.1| putative invertase inhibitor homolog [Arabidopsis thaliana]
 gb|AAO50452.1| putative invertase inhibitor homolog [Arabidopsis thaliana]
 gb|AED97927.1| cell wall / vacuolar inhibitor of fructosidase 2 [Arabidopsis 
thaliana]
Length=180

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 4/136 (3%)
 Frame = -3

Query  540  LISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIKLLEDP  361
            +I + CK T+Y  FC S L+    SP AD K LA +M+  G +  ATST N I   L   
Sbjct  30   IIESTCKTTNYYKFCVSALKSDPRSPTADTKGLASIMVGVG-MTNATSTANYIAGNLSAT  88

Query  360  NIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREVgsgadagsacdALFKNA  181
                + K++L  C   + LA +S    ++D D  +Y  A+  V +  D  + C  +F+  
Sbjct  89   VKDTVLKKVLQDCSEKYALAADSLRLTIQDLDDEAYDYASMHVLAAQDYPNVCRNIFRRV  148

Query  180  GLDGSPVPDGGLRHRQ  133
                 PV    +R R+
Sbjct  149  KGLAYPVE---IRRRE  161



>ref|XP_009788876.1| PREDICTED: pectinesterase inhibitor-like [Nicotiana sylvestris]
Length=167

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 56/106 (53%), Gaps = 2/106 (2%)
 Frame = -3

Query  561  SGQAAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVI  382
            +  + GDLI  VCKN+     C +TLR    S +AD K L ++ML   +L +A +  + +
Sbjct  15   ANHSFGDLIEDVCKNSSDYKLCVNTLRANPKSAFADHKGLTRIML-QLSLAKAKNIQSQV  73

Query  381  IKLLEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEA  244
            I LL       LK+  L  CR  +G AV    N++K FD+ ++  A
Sbjct  74   IILLNQATKPILKQS-LQICRDNYGNAVFMLTNSIKYFDTSAFFSA  118



>ref|XP_006492567.1| PREDICTED: pectinesterase inhibitor-like [Citrus sinensis]
Length=183

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 68/151 (45%), Gaps = 3/151 (2%)
 Frame = -3

Query  546  GDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIKLLE  367
             DLI  +CK T YP  C  TLR   GS  AD K LA +++ S +   +  T   I KLL+
Sbjct  34   NDLIEAICKKTSYPDVCIKTLRSSPGSSGADVKGLAHIIVESAST-YSNDTYEQIKKLLK  92

Query  366  DPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREVgsgadagsacdALFK  187
            +    +  +  L  C   + L ++    A+K  +SG Y  A      G      C++ FK
Sbjct  93   ETK-DKAMRNCLDVCFQVYDLTIHDIPKAIKYLESGDYDSATEYANDGIIDSDTCESSFK  151

Query  186  N-AGLDGSPVPDGGLRHRQLAVVAQQLIKQL  97
                +  SP+ D      +L V+A  +I  L
Sbjct  152  EFPEIPKSPLTDRNNGLTELCVIALDMINLL  182



>ref|XP_006431609.1| hypothetical protein CICLE_v10002621mg [Citrus clementina]
 gb|ESR44849.1| hypothetical protein CICLE_v10002621mg [Citrus clementina]
Length=183

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 68/151 (45%), Gaps = 3/151 (2%)
 Frame = -3

Query  546  GDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIKLLE  367
             DLI  +CK T YP  C  TLR   GS  AD K LA +++ S +   +  T   I KLL+
Sbjct  34   NDLIEAICKKTSYPDVCIKTLRSSPGSSGADVKGLAHIIVESAST-YSNDTYEQIKKLLK  92

Query  366  DPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREVgsgadagsacdALFK  187
            +    +  +  L  C   + L ++    A+K  +SG Y  A      G      C++ FK
Sbjct  93   ETK-DKAMRNCLDVCFQVYDLTIHDIPKAIKYLESGDYDSATEYANDGIIDSDTCESSFK  151

Query  186  N-AGLDGSPVPDGGLRHRQLAVVAQQLIKQL  97
                +  SP+ D      +L V+A  +I  L
Sbjct  152  EFPEIPKSPLTDRNNGLTELCVIALDMIDLL  182



>ref|XP_006281177.1| hypothetical protein CARUB_v10027212mg [Capsella rubella]
 gb|EOA14075.1| hypothetical protein CARUB_v10027212mg [Capsella rubella]
Length=182

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 67/143 (47%), Gaps = 4/143 (3%)
 Frame = -3

Query  561  SGQAAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVI  382
            S +    +I + CKNT+   FC S L+    SP AD K LA +M+  G +  ATST   +
Sbjct  25   SAKPNTTIIESTCKNTNNYKFCVSALKSDPRSPTADTKGLAAIMVGVG-MTNATSTATYL  83

Query  381  IKLLEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREVgsgadagsac  202
               L       + K++L  C   + LA +S    ++D DS +Y  A+  V +  D  + C
Sbjct  84   AGNLTSAANDVVLKKVLQDCSEKYALAADSLRQTIQDLDSEAYDYASMHVLAAEDYPNVC  143

Query  201  dALFKNAGLDGSPVPDGGLRHRQ  133
              +F+       PV    LR R+
Sbjct  144  RNIFRRVRGLAYPVE---LRRRE  163



>ref|XP_010462937.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2 [Camelina 
sativa]
Length=180

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (47%), Gaps = 4/143 (3%)
 Frame = -3

Query  561  SGQAAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVI  382
            S ++   +I + CK T+   FC S L+    SP AD K LA +M+  G +  ATST   I
Sbjct  23   SAKSNATIIESTCKTTNNYKFCVSALKSDPRSPTADTKGLAAIMIGVG-MTNATSTATYI  81

Query  381  IKLLEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREVgsgadagsac  202
               L       + K++L  C   + LA +S    ++D D  +Y  A+  V +  D  + C
Sbjct  82   AGNLTSAANDVVLKKVLQDCSEKYALAADSLRQTIQDLDDEAYDYASMHVLAAEDYPNVC  141

Query  201  dALFKNAGLDGSPVPDGGLRHRQ  133
              +F+ A     PV    +R R+
Sbjct  142  RNIFRRAKGLSYPVE---IRRRE  161



>ref|XP_007206622.1| hypothetical protein PRUPE_ppa021753mg [Prunus persica]
 gb|EMJ07821.1| hypothetical protein PRUPE_ppa021753mg [Prunus persica]
Length=181

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 53/107 (50%), Gaps = 0/107 (0%)
 Frame = -3

Query  552  AAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIKL  373
            A  +LI   CKNT Y G C STL+    S  AD K LA +M+  G  +   ++  +  +L
Sbjct  26   ADSNLIQKTCKNTKYYGLCVSTLKSDPTSKTADTKGLAVIMVGIGMANATATSSYLSSQL  85

Query  372  LEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREV  232
            +   N     K++L  C   +G A ++   +VKD  S SY  A+  +
Sbjct  86   VSSRNNDTNMKKVLKECADKYGFAGDALQASVKDLASESYDYASMHI  132



>ref|XP_006431604.1| hypothetical protein CICLE_v10004017mg [Citrus clementina]
 gb|ESR44844.1| hypothetical protein CICLE_v10004017mg [Citrus clementina]
Length=178

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 49/103 (48%), Gaps = 2/103 (2%)
 Frame = -3

Query  546  GDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIKLLE  367
             DLI  +CK T YP  C  TLR   GS  AD K LA ++L S +   +  T   I KLL+
Sbjct  26   NDLIEAICKKTSYPDVCIKTLRSSPGSSGADVKGLAHIILESAST-YSNDTYEQIKKLLK  84

Query  366  DPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAR  238
            +    +  +  L  C   + L ++    A+K  +SG Y  A  
Sbjct  85   ETK-DKAMRNCLDVCFQVYDLTIHDIPKAIKYLESGHYDSATE  126



>ref|XP_008235482.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Prunus mume]
Length=181

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 54/107 (50%), Gaps = 0/107 (0%)
 Frame = -3

Query  552  AAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIKL  373
            A  +LI   CKNT Y G C STL+    S  AD K LA +M+  G  + + ++  +  +L
Sbjct  26   ADSNLIQKTCKNTKYYGLCVSTLKSDPTSKTADTKGLAVIMVGIGMANASATSSYLSSQL  85

Query  372  LEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREV  232
            +   N     K++L  C   +G A ++   +V+D  S SY  A+  +
Sbjct  86   VSSKNNDTNMKKVLKECADKYGFAGDALQASVQDLASESYDYASMHI  132



>ref|XP_002864910.1| C/VIF2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41169.1| C/VIF2 [Arabidopsis lyrata subsp. lyrata]
Length=179

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (48%), Gaps = 4/143 (3%)
 Frame = -3

Query  561  SGQAAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVI  382
            S ++   +I + CK T+Y  FC S L+    SP AD K LA +M+  G +  ATST   +
Sbjct  22   SAKSNTTIIESTCKTTNYYKFCVSALKSDPRSPTADTKGLAAIMVGVG-MTNATSTATYL  80

Query  381  IKLLEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREVgsgadagsac  202
               L       + K++L  C   + LA +S    ++D D+ +Y  A+  V +  D  + C
Sbjct  81   AGNLSTTVNDTVLKKVLQDCSEKYTLAADSLRLTIQDLDNEAYDYASMHVLAAQDYPNVC  140

Query  201  dALFKNAGLDGSPVPDGGLRHRQ  133
              +F+       PV    +R R+
Sbjct  141  RNIFRRVKGLAYPVE---IRRRE  160



>ref|XP_010484247.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Camelina sativa]
Length=181

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 63/134 (47%), Gaps = 1/134 (1%)
 Frame = -3

Query  561  SGQAAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVI  382
            S ++   +I + CK T+   FC S L+    SP AD K LA +M+  G +  ATST   I
Sbjct  24   SAKSNATIIESTCKTTNNYKFCVSALKSDPRSPTADTKGLAAIMIGVG-MTNATSTATYI  82

Query  381  IKLLEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREVgsgadagsac  202
               L       + K++L  C   + LA +S    ++D D  +Y  A+  V +  D  + C
Sbjct  83   AGNLTSAANDVVLKKVLKDCSEKYALAADSLRQTIQDLDDEAYDYASMHVLAAEDYPNVC  142

Query  201  dALFKNAGLDGSPV  160
              +F+ A     PV
Sbjct  143  RNIFRRAKGLSYPV  156



>ref|XP_006349541.1| PREDICTED: pectinesterase inhibitor-like [Solanum tuberosum]
Length=198

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (50%), Gaps = 2/103 (2%)
 Frame = -3

Query  552  AAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIKL  373
            ++GDLI  VC+ ++    C   LR    S  ADKK L  ++L    L +A    N ++ L
Sbjct  21   SSGDLIEDVCRTSNNFKVCTIALRTDPKSSSADKKGLVHILLQQ-CLSKAKRIYNEVVSL  79

Query  372  LEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEA  244
            LE      +  + L  C+  +  AV+    ++KDFD+ +Y  A
Sbjct  80   LEQAK-EHVLIQCLHICKENYDGAVDDATTSIKDFDANNYFRA  121



>gb|KDO41794.1| hypothetical protein CISIN_1g037300mg [Citrus sinensis]
Length=159

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 47/103 (46%), Gaps = 2/103 (2%)
 Frame = -3

Query  546  GDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIKLLE  367
             DLI   C+ T YP  C  TLR   GS  AD K LA ++L S +      T   + KLL 
Sbjct  17   NDLIEATCRKTSYPDLCIKTLRSSPGSSGADVKGLAHIILESASA-YCNDTYEQVKKLLN  75

Query  366  DPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAR  238
            +    +  +  L  C   + LA+     A+K  +SG Y  A +
Sbjct  76   ETK-DKTMRNCLDVCFQVYDLAIYEIPTAIKYLESGDYDSAVQ  117



>ref|XP_009619356.1| PREDICTED: putative invertase inhibitor [Nicotiana tomentosiformis]
Length=160

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 54/104 (52%), Gaps = 2/104 (2%)
 Frame = -3

Query  555  QAAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIK  376
             ++GDLI  VCKN+     C +TLR    S + D+  L ++ML   +L +A +  + +I 
Sbjct  9    HSSGDLIEDVCKNSSDYKLCVNTLRADPKSAFGDRIGLTRIML-QLSLTKAKNIQSQVII  67

Query  375  LLEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEA  244
            LL       LK+  L  CR  +G AV    N++K FD+  +  A
Sbjct  68   LLNHTTEPILKQS-LQICRDNYGNAVFMLTNSIKYFDTSDFFSA  110



>ref|XP_006431605.1| hypothetical protein CICLE_v10003542mg [Citrus clementina]
 gb|ESR44845.1| hypothetical protein CICLE_v10003542mg [Citrus clementina]
 gb|KDO40790.1| hypothetical protein CISIN_1g042545mg [Citrus sinensis]
Length=183

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 47/103 (46%), Gaps = 2/103 (2%)
 Frame = -3

Query  546  GDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIKLLE  367
             DLI   C+ T YP  C  TLR   GS  AD K LA ++L S +      T   + KLL 
Sbjct  34   NDLIEATCRKTSYPDLCIKTLRSSPGSSGADVKALAHIILESASA-YCNDTYEQVKKLLN  92

Query  366  DPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAR  238
            +    +  +  L  C   + LA+     A+K  +SG Y  A +
Sbjct  93   ETK-DKAMRNCLDVCFQVYDLAIYEIPTAIKYLESGDYDSAVQ  134



>ref|XP_004304912.1| PREDICTED: uncharacterized protein LOC101292328 [Fragaria vesca 
subsp. vesca]
Length=195

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 53/111 (48%), Gaps = 8/111 (7%)
 Frame = -3

Query  558  GQAAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVI-  382
             Q+   LI  +C++T+  GFC +T +    SP AD   L Q+ +   A+D +T T N I 
Sbjct  27   SQSTQQLIEKICRSTEDYGFCRTTFQAHLKSPNADIVALTQITV-EVAVDHSTKTHNFIR  85

Query  381  --IKLLEDPNIGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAARE  235
              I   +DP +    K+ L  C   +GL + +   A   F S  Y+   +E
Sbjct  86   QTIATTKDPVL----KKALSECENAYGLIMQAFDLAAVSFFSRDYSSVEKE  132



>ref|XP_008350729.1| PREDICTED: putative invertase inhibitor [Malus domestica]
Length=186

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 7/109 (6%)
 Frame = -3

Query  555  QAAGDLISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIK  376
            Q    LI  +C+ T+  GFC  T ++   SP AD   L Q+ +   ++D AT T N I +
Sbjct  29   QDTQQLIERICRXTEQYGFCTQTFKENLKSPDADIVALTQITI-ERSVDNATQTHNFIRQ  87

Query  375  LLEDPNIGQLKKEILGSCRLGFGLAVNS-DANAV----KDFDSGSYAEA  244
             ++  N   +K   L +C   +GL + + D+ AV    KD+D+   +E+
Sbjct  88   TIDSTNDPAVKSA-LETCEYSYGLVMEAFDSAAVAFFQKDYDTVEKSES  135



>ref|XP_009112145.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Brassica rapa]
Length=176

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = -3

Query  537  ISTVCKNTDYPGFCESTLRKFTGSPYADKKRLAQMMLMSGALDEATSTLNVIIKLLEDPN  358
            I + CK T+Y   C S L+    SP AD K LA +M   G +  AT+T + I K L    
Sbjct  27   IESTCKTTNYYDLCVSALKSDPRSPTADTKGLAAIMASVG-MTNATATASYIAKNLTATA  85

Query  357  IGQLKKEILGSCRLGFGLAVNSDANAVKDFDSGSYAEAAREVgsgadagsacdALFKNA  181
               + K++L  C   + LA +S    ++D D  +Y  A   V +  D  + C  +F+ A
Sbjct  86   NNTVLKKVLKDCSDKYTLAADSLRLTIQDLDDEAYDYAYMHVLAAQDYPNVCRNIFRRA  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1129260521844