BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c38293_g1_i1 len=168 path=[1:0-167]

Length=168
                                                                      Score     E

gb|AAB07724.1|  Pn47p                                                 99.0    4e-23   Ipomoea nil [qian niu]
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like            68.9    5e-12   
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like         68.6    6e-12   
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like            68.6    7e-12   
emb|CDP11819.1|  unnamed protein product                              68.2    9e-12   
emb|CDO96758.1|  unnamed protein product                              67.8    1e-11   
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                 67.4    2e-11   
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma              67.4    2e-11   
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                 67.0    2e-11   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like         67.0    2e-11   
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like            67.0    2e-11   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like            66.2    5e-11   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein        65.9    6e-11   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like         65.9    7e-11   
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma              65.5    1e-10   
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like         65.1    1e-10   
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg          65.1    1e-10   
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like            65.1    1e-10   
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like         64.7    1e-10   
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like         64.7    1e-10   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g           64.7    2e-10   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like         64.7    2e-10   
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like         64.7    2e-10   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                 64.7    2e-10   
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma              64.7    2e-10   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like         64.7    2e-10   
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg              64.7    2e-10   
gb|ABQ95989.1|  phospholipase A1                                      64.3    2e-10   Capsicum annuum
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                 64.3    2e-10   
ref|XP_002316835.2|  lipase class 3 family protein                    64.3    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg           64.3    2e-10   
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma              64.3    2e-10   
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like         64.3    2e-10   
gb|KDP21073.1|  hypothetical protein JCGZ_21544                       64.3    2e-10   
gb|EPS70940.1|  hypothetical protein M569_03817                       64.3    2e-10   
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1   64.3    2e-10   Vitis vinifera
gb|AFK35349.1|  unknown                                               62.4    2e-10   
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like         63.9    3e-10   
ref|XP_002522554.1|  triacylglycerol lipase, putative                 63.9    3e-10   Ricinus communis
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  63.9    3e-10   
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  63.9    3e-10   
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like         63.9    3e-10   
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like            63.5    3e-10   
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                   63.5    4e-10   
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like         63.5    4e-10   
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like         63.9    4e-10   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like         63.5    4e-10   
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like         63.5    4e-10   
emb|CBI21954.3|  unnamed protein product                              63.2    5e-10   
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like         63.2    5e-10   
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like         63.2    5e-10   
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                 63.2    5e-10   
ref|XP_010557126.1|  PREDICTED: phospholipase A1-IIbeta isoform X2    62.4    6e-10   
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg           63.2    6e-10   
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like         63.2    6e-10   
gb|KHN08451.1|  Phospholipase A1-IIgamma                              62.8    7e-10   
gb|KHN18919.1|  Phospholipase A1-IIgamma                              62.8    8e-10   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like         62.8    8e-10   
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like         62.8    8e-10   
ref|XP_002525127.1|  triacylglycerol lipase, putative                 62.8    8e-10   Ricinus communis
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like         62.8    8e-10   
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like         62.8    8e-10   
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like         62.4    8e-10   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like         62.4    9e-10   
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1    62.4    9e-10   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like         62.4    9e-10   
ref|NP_001141332.1|  uncharacterized protein LOC100273423             62.4    1e-09   Zea mays [maize]
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like         62.0    1e-09   
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...  62.0    1e-09   
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  62.0    1e-09   
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like         62.0    1e-09   
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  62.0    2e-09   
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  61.6    2e-09   
ref|XP_010108436.1|  Phospholipase A1-IIgamma                         62.0    2e-09   
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like            61.6    2e-09   
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like         61.6    2e-09   
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like         61.6    2e-09   
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like         61.6    2e-09   
gb|KDO63322.1|  hypothetical protein CISIN_1g0475241mg                58.5    3e-09   
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like         61.2    3e-09   
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470        61.2    3e-09   
ref|XP_002305750.2|  lipase class 3 family protein                    60.8    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma              61.2    3e-09   
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like          60.8    3e-09   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma              60.8    4e-09   
ref|XP_003593747.1|  Lipase                                           60.8    4e-09   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like         60.8    4e-09   
gb|KGN49294.1|  hypothetical protein Csa_6G519470                     60.8    4e-09   
gb|EPS68357.1|  hypothetical protein M569_06414                       58.5    5e-09   
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like            60.5    5e-09   
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like         60.5    5e-09   
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like            60.1    7e-09   
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like            59.7    8e-09   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                 59.7    9e-09   
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta               59.7    9e-09   
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like          59.7    9e-09   
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like         59.7    9e-09   
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta        59.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like         59.3    1e-08   
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like         59.3    1e-08   
emb|CDO96757.1|  unnamed protein product                              58.9    1e-08   
ref|XP_011100290.1|  PREDICTED: phospholipase A1-IIgamma-like         58.9    1e-08   
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like         58.9    2e-08   
emb|CDY23963.1|  BnaC03g17280D                                        58.5    2e-08   
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                  58.5    2e-08   
gb|AAM61647.1|  lipase-like protein                                   58.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232955.1|  PREDICTED: phospholipase A1-II 1-like isofor...  58.5    2e-08   
ref|XP_010316799.1|  PREDICTED: phospholipase A1-II 1-like isofor...  58.5    2e-08   
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg           58.5    2e-08   
gb|EMT04701.1|  Lipase                                                58.2    3e-08   
gb|KCW89613.1|  hypothetical protein EUGRSUZ_A01896                   57.8    3e-08   
ref|XP_009793565.1|  PREDICTED: uncharacterized protein LOC104240421  55.8    4e-08   
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  57.8    4e-08   
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like            57.8    4e-08   
ref|XP_009144598.1|  PREDICTED: phospholipase A1-IIbeta-like          57.8    4e-08   
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg              57.8    4e-08   
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like          57.8    5e-08   
emb|CDX84801.1|  BnaA03g14290D                                        57.8    5e-08   
emb|CDY24728.1|  BnaC04g13330D                                        57.4    5e-08   
ref|NP_172115.1|  phospholipase A1-IIalpha                            57.4    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                  57.4    6e-08   
ref|XP_002892328.1|  predicted protein                                56.6    8e-08   
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg           57.0    8e-08   
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg           57.0    9e-08   
gb|ABK24664.1|  unknown                                               57.0    9e-08   Picea sitchensis
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha              57.0    9e-08   
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like         56.6    1e-07   
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  57.4    1e-07   
emb|CDX86530.1|  BnaC08g01730D                                        56.6    1e-07   
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  56.6    1e-07   
ref|XP_003608120.1|  Lipase                                           56.6    1e-07   
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like            56.6    1e-07   
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like         56.6    1e-07   
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha              56.6    1e-07   
gb|ABK23399.1|  unknown                                               56.2    1e-07   Picea sitchensis
emb|CDY57813.1|  BnaA10g28020D                                        56.6    1e-07   
ref|XP_002525129.1|  triacylglycerol lipase, putative                 56.2    1e-07   Ricinus communis
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630        56.2    1e-07   Sorghum bicolor [broomcorn]
gb|ABR18391.1|  unknown                                               56.2    2e-07   Picea sitchensis
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g           56.2    2e-07   
ref|XP_004232958.1|  PREDICTED: phospholipase A1-II 1-like            56.2    2e-07   
gb|KDP31780.1|  hypothetical protein JCGZ_12241                       55.8    2e-07   
gb|EMT21704.1|  Putative lipase                                       56.2    2e-07   
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...  56.2    2e-07   
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...  55.8    2e-07   
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                 55.8    2e-07   
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like            55.8    2e-07   
gb|EMS48809.1|  Phospholipase A1-II 6                                 55.8    2e-07   
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g           55.5    2e-07   
gb|EYU17473.1|  hypothetical protein MIMGU_mgv1a008748mg              55.5    2e-07   
ref|XP_001779106.1|  predicted protein                                55.8    3e-07   
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  55.5    3e-07   
ref|XP_002440294.1|  hypothetical protein SORBIDRAFT_09g029220        55.5    3e-07   Sorghum bicolor [broomcorn]
ref|XP_010655496.1|  PREDICTED: phospholipase A1-IIgamma isoform X2   55.1    3e-07   
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like         55.5    3e-07   
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  55.5    3e-07   
gb|EEE64775.1|  hypothetical protein OsJ_19631                        55.1    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma              55.5    3e-07   
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1           55.1    4e-07   Oryza sativa Indica Group [Indian rice]
gb|EMS51987.1|  Phospholipase A1-II 3                                 55.1    4e-07   
ref|XP_003608142.1|  Lipase                                           54.7    4e-07   
emb|CDY10187.1|  BnaC05g04300D                                        55.1    4e-07   
gb|EAY99121.1|  hypothetical protein OsI_21080                        54.7    4e-07   Oryza sativa Indica Group [Indian rice]
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6           54.7    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like            54.7    5e-07   
ref|XP_006362439.1|  PREDICTED: phospholipase A1-IIgamma-like         54.7    5e-07   
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like         54.3    7e-07   
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like         54.3    7e-07   
dbj|BAJ96485.1|  predicted protein                                    53.9    9e-07   
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like         53.9    1e-06   
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like         53.9    1e-06   
emb|CBI30665.3|  unnamed protein product                              53.1    1e-06   
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                  53.5    1e-06   
ref|XP_009137120.1|  PREDICTED: phospholipase A1-IIgamma-like         53.1    1e-06   
ref|NP_001149813.1|  triacylglycerol lipase                           53.5    1e-06   Zea mays [maize]
gb|EMS63185.1|  Phospholipase A1-II 1                                 53.9    2e-06   
gb|AFK39140.1|  unknown                                               51.6    2e-06   
emb|CDM85400.1|  unnamed protein product                              53.1    2e-06   
emb|CDM83551.1|  unnamed protein product                              53.1    2e-06   
gb|EMT15519.1|  Lipase                                                53.1    2e-06   
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like         53.1    2e-06   
ref|XP_004505480.1|  PREDICTED: phospholipase A1-IIdelta-like         53.1    2e-06   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg           52.8    3e-06   
emb|CDY53993.1|  BnaA03g58180D                                        52.4    3e-06   
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...  52.4    3e-06   
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like         52.4    3e-06   
ref|XP_001779107.1|  predicted protein                                52.4    3e-06   
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg           52.4    3e-06   
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420        52.4    4e-06   Sorghum bicolor [broomcorn]
ref|NP_001056387.1|  Os05g0574100                                     52.4    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002867985.1|  lipase class 3 family protein                    52.4    4e-06   
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like            52.0    4e-06   
gb|EMS63790.1|  Phospholipase A1-II 7                                 52.4    4e-06   
ref|XP_007025431.1|  Alpha/beta-Hydrolases superfamily protein        52.0    4e-06   
gb|EMT11182.1|  hypothetical protein F775_27795                       52.0    5e-06   
ref|XP_010446304.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  51.6    5e-06   
emb|CDY49813.1|  BnaC06g04560D                                        52.0    5e-06   
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  52.0    5e-06   
emb|CDY22842.1|  BnaA06g02350D                                        52.0    5e-06   
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma              52.0    6e-06   
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like         52.0    6e-06   
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                 52.0    6e-06   
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  51.6    6e-06   
ref|XP_003608122.1|  Lipase                                           51.6    7e-06   
gb|AFK47098.1|  unknown                                               51.6    7e-06   
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like            51.2    8e-06   
ref|XP_002437113.1|  hypothetical protein SORBIDRAFT_10g021260        51.2    8e-06   Sorghum bicolor [broomcorn]
ref|XP_003528483.1|  PREDICTED: phospholipase A1-IIgamma-like         51.2    8e-06   
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202            51.2    8e-06   
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor   51.2    9e-06   Zea mays [maize]
gb|ACG40994.1|  triacylglycerol lipase                                49.7    1e-05   Zea mays [maize]
gb|EMT05578.1|  hypothetical protein F775_13080                       50.8    1e-05   
ref|XP_007048713.1|  Alpha/beta-Hydrolases superfamily protein        50.8    1e-05   
gb|AFW83434.1|  hypothetical protein ZEAMMB73_348788                  49.7    1e-05   
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810        50.8    1e-05   Sorghum bicolor [broomcorn]
gb|KDO40783.1|  hypothetical protein CISIN_1g046292mg                 49.3    1e-05   
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                  50.8    1e-05   
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like            50.8    1e-05   
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like            50.8    1e-05   
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1     50.8    1e-05   
emb|CBI21996.3|  unnamed protein product                              50.8    1e-05   
ref|NP_001151242.1|  triacylglycerol lipase                           50.8    1e-05   Zea mays [maize]
gb|EMT15520.1|  Feruloyl esterase A                                   51.2    1e-05   
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                  50.8    1e-05   
gb|KDO38625.1|  hypothetical protein CISIN_1g0208022mg                50.1    1e-05   
emb|CDY01554.1|  BnaC07g35440D                                        50.4    1e-05   
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg           50.8    2e-05   
emb|CDY34061.1|  BnaC03g62710D                                        50.4    2e-05   
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like            50.4    2e-05   
ref|XP_006655614.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  50.4    2e-05   
dbj|BAJ90094.1|  predicted protein                                    50.1    2e-05   
ref|XP_002281095.2|  PREDICTED: phospholipase A1-IIdelta              50.4    2e-05   Vitis vinifera
gb|ABK23028.1|  unknown                                               49.7    2e-05   Picea sitchensis
ref|NP_193590.1|  phospholipase A1-IIgamma                            50.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDX76515.1|  BnaA08g08850D                                        50.1    2e-05   
dbj|BAJ95995.1|  predicted protein                                    50.4    2e-05   
gb|EMS50696.1|  Phospholipase A1-II 7                                 49.7    2e-05   
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  50.4    2e-05   
gb|ACJ85535.1|  unknown                                               50.1    2e-05   Medicago truncatula
ref|XP_003607601.1|  Feruloyl esterase A                              50.1    2e-05   
ref|XP_006374296.1|  hypothetical protein POPTR_0015s05770g           50.1    2e-05   
ref|XP_003565876.1|  PREDICTED: phospholipase A1-II 6-like            50.1    2e-05   
ref|XP_011005460.1|  PREDICTED: phospholipase A1-II 4-like            50.1    2e-05   
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                  50.1    2e-05   
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  50.1    3e-05   
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  50.1    3e-05   
ref|XP_010102366.1|  Phospholipase A1-Igamma3                         50.1    3e-05   
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  50.1    3e-05   
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like            49.7    3e-05   
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  50.1    3e-05   
ref|NP_001152663.1|  triacylglycerol lipase precursor                 49.7    3e-05   Zea mays [maize]
ref|XP_006428645.1|  hypothetical protein CICLE_v10011864mg           49.7    3e-05   
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1     50.1    4e-05   
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  49.7    4e-05   
ref|XP_002891639.1|  lipase class 3 family protein                    49.7    4e-05   
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg           49.3    4e-05   
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                   49.3    4e-05   
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  49.7    4e-05   
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like         49.3    4e-05   
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  49.3    4e-05   
dbj|BAD68802.1|  lipase-like protein                                  49.3    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EMS52156.1|  Phospholipase A1-II 2                                 49.3    4e-05   
ref|NP_001043730.2|  Os01g0651200                                     49.3    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680        49.3    4e-05   Sorghum bicolor [broomcorn]
gb|EAY75192.1|  hypothetical protein OsI_03084                        49.3    4e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_008353849.1|  PREDICTED: phospholipase A1-IIdelta-like         49.3    5e-05   
ref|XP_008343100.1|  PREDICTED: phospholipase A1-IIdelta-like         49.3    5e-05   
ref|XP_007048712.1|  Alpha/beta-Hydrolases superfamily protein        48.9    5e-05   
ref|XP_006469038.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  48.9    5e-05   
ref|XP_010246745.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  49.3    5e-05   
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like            48.9    5e-05   
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2           48.9    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like            48.9    6e-05   
ref|XP_004300994.1|  PREDICTED: uncharacterized protein LOC101301206  48.9    6e-05   
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg           48.9    6e-05   
ref|XP_006446810.1|  hypothetical protein CICLE_v10015386mg           48.9    6e-05   
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  48.9    7e-05   
dbj|BAJ85084.1|  predicted protein                                    48.5    7e-05   
ref|XP_008371821.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  48.9    7e-05   
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640        48.5    7e-05   
ref|XP_008451277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  48.5    8e-05   
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  48.5    8e-05   
ref|XP_008451276.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  48.5    8e-05   
ref|XP_008371801.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  48.5    8e-05   
ref|XP_007024951.1|  Alpha/beta-Hydrolases superfamily protein        48.5    9e-05   
ref|NP_564590.1|  DAD1-like lipase 2                                  48.5    9e-05   
ref|XP_010058981.1|  PREDICTED: phospholipase A1-IIgamma-like         48.1    9e-05   
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  48.5    9e-05   
ref|XP_011079989.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  48.1    9e-05   
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  48.5    9e-05   
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1            48.1    1e-04   
gb|AAD01804.1|  lipase                                                48.1    1e-04   
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4           48.1    1e-04   
gb|EYU31376.1|  hypothetical protein MIMGU_mgv1a004679mg              48.1    1e-04   
ref|XP_008362525.1|  PREDICTED: phospholipase A1-IIdelta-like         48.1    1e-04   
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                 48.1    1e-04   
ref|XP_010108435.1|  Phospholipase A1-IIgamma                         47.8    1e-04   
ref|XP_006489506.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  47.8    1e-04   
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...  48.1    1e-04   
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                 47.8    1e-04   
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like         47.8    1e-04   
emb|CBI16352.3|  unnamed protein product                              47.8    1e-04   
emb|CDP03693.1|  unnamed protein product                              47.8    1e-04   
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  47.8    2e-04   
gb|KDP21364.1|  hypothetical protein JCGZ_21835                       47.8    2e-04   
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  47.8    2e-04   
ref|XP_011080360.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  47.8    2e-04   
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  47.8    2e-04   
ref|XP_008343102.1|  PREDICTED: phospholipase A1-IIdelta-like         47.8    2e-04   
gb|KCW74063.1|  hypothetical protein EUGRSUZ_E02691                   47.4    2e-04   
emb|CAN83233.1|  hypothetical protein VITISV_005768                   47.8    2e-04   
ref|XP_010655698.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  47.8    2e-04   
gb|KHN12425.1|  Phospholipase A1-Igamma1, chloroplastic               47.8    2e-04   
gb|EEC79153.1|  hypothetical protein OsI_19824                        47.8    2e-04   
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  47.4    2e-04   
ref|XP_010269807.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  47.4    2e-04   
ref|XP_007210039.1|  hypothetical protein PRUPE_ppa017270mg           47.4    2e-04   
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like         47.4    2e-04   
emb|CAN74039.1|  hypothetical protein VITISV_012945                   47.4    2e-04   
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                 47.4    2e-04   
gb|KDP22109.1|  hypothetical protein JCGZ_25940                       47.4    2e-04   
ref|XP_003532708.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  47.4    2e-04   
emb|CDP15943.1|  unnamed protein product                              47.0    2e-04   
ref|XP_007132834.1|  hypothetical protein PHAVU_011G128500g           47.0    2e-04   
ref|XP_011028727.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  47.0    2e-04   
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  47.4    2e-04   
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  47.4    2e-04   
gb|KDP46905.1|  hypothetical protein JCGZ_24114                       47.0    2e-04   
ref|XP_004301748.1|  PREDICTED: phospholipase A1-IIgamma-like         47.0    3e-04   
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  47.0    3e-04   
gb|KDP38020.1|  hypothetical protein JCGZ_04663                       47.0    3e-04   
emb|CDY09593.1|  BnaC05g23260D                                        47.0    3e-04   
gb|EMT30117.1|  Mono- and diacylglycerol lipase                       47.0    3e-04   
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  47.0    3e-04   
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein        47.0    3e-04   
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  47.0    3e-04   
ref|XP_002488949.1|  hypothetical protein SORBIDRAFT_1306s002010      46.6    3e-04   
ref|XP_002513514.1|  triacylglycerol lipase, putative                 47.0    3e-04   
ref|NP_001055438.1|  Os05g0390000                                     47.0    3e-04   
ref|XP_002438517.1|  hypothetical protein SORBIDRAFT_10g021250        46.6    3e-04   
emb|CDP09265.1|  unnamed protein product                              47.0    3e-04   
ref|XP_010655697.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  47.0    3e-04   
emb|CDY47985.1|  BnaA04g24630D                                        46.6    3e-04   
ref|XP_004244860.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  46.6    3e-04   
ref|XP_008371806.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  46.6    3e-04   
dbj|BAH56866.1|  AT2G42690                                            46.6    4e-04   
ref|XP_009362273.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  46.6    4e-04   
ref|XP_009362274.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  46.6    4e-04   
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like            46.6    4e-04   
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  46.6    4e-04   
ref|XP_006364888.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  46.6    4e-04   
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  46.6    4e-04   
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  46.6    4e-04   
ref|XP_010058983.1|  PREDICTED: phospholipase A1-IIgamma-like         46.2    4e-04   
ref|XP_011047800.1|  PREDICTED: phospholipase A1-II 4-like            46.2    4e-04   
ref|XP_002893614.1|  lipase class 3 family protein                    46.2    5e-04   
ref|XP_010058987.1|  PREDICTED: uncharacterized protein LOC104446890  46.6    5e-04   
ref|XP_010087133.1|  Phospholipase A1-Igamma1                         46.2    5e-04   
ref|XP_011005461.1|  PREDICTED: phospholipase A1-IIgamma-like         46.2    5e-04   
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  46.2    5e-04   
ref|XP_006374295.1|  hypothetical protein POPTR_0015s05760g           46.2    5e-04   
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  46.2    5e-04   
emb|CDP21091.1|  unnamed protein product                              46.2    5e-04   
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                   46.2    5e-04   
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  46.2    5e-04   
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  46.2    5e-04   
ref|XP_008228927.1|  PREDICTED: phospholipase A1-IIdelta              46.2    5e-04   
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  46.2    5e-04   
ref|XP_010274200.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  46.2    5e-04   
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like         46.2    5e-04   
ref|NP_174326.1|  DAD1-like acylhydrolase                             46.2    6e-04   
gb|KFK44851.1|  hypothetical protein AALP_AA1G310600                  46.2    6e-04   
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg           46.2    6e-04   
ref|XP_003551855.1|  PREDICTED: galactolipase DONGLE, chloroplast...  46.2    6e-04   
ref|NP_181797.1|  phospholipase A1-IIdelta                            45.8    6e-04   
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg           46.2    6e-04   
ref|XP_007217233.1|  hypothetical protein PRUPE_ppa005547mg           45.8    6e-04   
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  46.2    6e-04   
ref|XP_009142078.1|  PREDICTED: phospholipase A1-IIdelta              45.8    6e-04   
ref|XP_009801144.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  45.8    6e-04   
gb|KCW74056.1|  hypothetical protein EUGRSUZ_E02682                   45.8    6e-04   
emb|CDY14851.1|  BnaC04g48480D                                        45.8    7e-04   
ref|XP_010940258.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  45.8    7e-04   
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein        45.8    7e-04   
gb|KCW74061.1|  hypothetical protein EUGRSUZ_E02689                   45.4    7e-04   
ref|XP_002303465.1|  lipase family protein                            45.8    7e-04   
ref|XP_002881867.1|  hypothetical protein ARALYDRAFT_483364           45.8    7e-04   
ref|XP_002518706.1|  triacylglycerol lipase, putative                 45.8    7e-04   
ref|XP_004292180.1|  PREDICTED: phospholipase A1-IIdelta-like         44.3    7e-04   
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg           45.8    7e-04   
ref|XP_011047741.1|  PREDICTED: phospholipase A1-IIgamma-like         45.4    7e-04   
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  45.8    8e-04   
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  45.8    8e-04   
ref|XP_011028053.1|  PREDICTED: phospholipase A1-IIdelta              45.4    8e-04   
gb|KHG20660.1|  Phospholipase A1-IIgamma -like protein                45.4    8e-04   
ref|XP_011082995.1|  PREDICTED: phospholipase A1-IIdelta              45.4    8e-04   
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg           45.4    9e-04   
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  45.4    0.001   
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                   45.4    0.001   



>gb|AAB07724.1| Pn47p [Ipomoea nil]
Length=402

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYAPSTI  P+ GYNVRA R+DAVLKESNW GYVA ATDEGK+ALGRRDILIVW
Sbjct  84   YFYAPSTIPLPDEGYNVRATRADAVLKESNWNGYVAVATDEGKVALGRRDILIVW  138



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S+++ P+A + +++   +A  KESNW+G+VA ATD+GKIALGRRDI+IVW
Sbjct  127  YIYATSSVQVPDALF-IKSLSREAWSKESNWVGFVAVATDKGKIALGRRDIVIVW  180



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S+I+ PEA + +++   +A  KESNWIG+VA ATDEG++ALGRRDI+I W
Sbjct  88   YVYATSSIQVPEA-FIIKSLSGEAWSKESNWIGFVAVATDEGEVALGRRDIVIAW  141



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S+++ PEA + +++   +A  KESNW+G+VA ATDEGK+ALGRRDI+I W
Sbjct  110  YIYATSSVQVPEALF-IKSLSREAWSKESNWVGFVAVATDEGKMALGRRDIVIAW  163



>emb|CDP11819.1| unnamed protein product [Coffea canephora]
Length=396

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S I  P+A +  ++   D+V KESN++GYVA ATDEGKIALGRRDIL+ W
Sbjct  85   YLYATSKISVPDA-FIEKSLSKDSVCKESNFMGYVAVATDEGKIALGRRDILVAW  138



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S+I+ P+A + V++   +A  KESNW+GYVA ATDEGK+ALGRRDI+I W
Sbjct  84   YLYATSSIQLPDA-FIVKSFSREAWSKESNWMGYVAVATDEGKVALGRRDIVIAW  137



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S++K P   + +R+   +A  KESNWIGYVA ATD+GK ALGRRDILI W
Sbjct  85   YFYATSSVKLP-GCFLLRSLSREAWNKESNWIGYVAVATDKGKAALGRRDILIAW  138



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+ K P+A + +++   +A  +ESNWIGYVA ATDEGK ALGRRDILI W
Sbjct  108  YFYATSSTKVPDA-FILKSWSREAWSRESNWIGYVAVATDEGKSALGRRDILIAW  161



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S+I+ PEA + V++   ++  KESNWIG++A  TDEGKIALGRR+ILI W
Sbjct  102  YLYATSSIQVPEA-FIVKSLSRESWSKESNWIGFIAVCTDEGKIALGRREILISW  155



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S+I+ PEA + V++   ++  KESNWIG++A  TDEGKIALGRR+ILI W
Sbjct  93   YLYATSSIQVPEA-FIVKSLSRESWSKESNWIGFIAVCTDEGKIALGRREILISW  146



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S+++ PEA   +++   +A  KESNW+G+VA ATDEGK+ALGRRDI+I W
Sbjct  121  YIYATSSVQVPEA-LIIKSLSREAWSKESNWVGFVAVATDEGKVALGRRDIVISW  174



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S ++ PEA + +++   +A  KESNW G+VA ATD+GKIALGRRDI+IVW
Sbjct  125  YIYATSAVQVPEALF-IKSLSREAWSKESNWAGFVAVATDKGKIALGRRDIVIVW  178



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+ PEA + V+++  +A  KESNWIGYVA ATDEGK  LGRRDI+I W
Sbjct  102  FLYATSQIQLPEA-FIVKSSSREAWSKESNWIGYVAVATDEGKDVLGRRDIVIAW  155



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+ PEA + V++   +A  KESNWIGYVA ATDEGK  LGRRDI+I W
Sbjct  121  FLYATSQIQVPEA-FIVKSLSREAWSKESNWIGYVAVATDEGKALLGRRDIVIAW  174



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+ PEA + +++   ++  KESNW+GYVA ATDEGK ALGRRDI+I W
Sbjct  116  FVYATSQIQVPEA-FLIKSLSRESWCKESNWMGYVAVATDEGKAALGRRDIVIAW  169



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S+I  P+A + V++   +A  KESN++GYVA ATDEGK++LGRRDI+I W
Sbjct  81   FFYATSSIPLPDA-FVVKSLSREAWSKESNFMGYVAVATDEGKVSLGRRDIVINW  134



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+ PEA + +++   ++  KESNW+GYVA ATDEGK ALGRRDI+I W
Sbjct  87   FVYATSQIQVPEA-FLIKSLSRESWCKESNWMGYVAVATDEGKAALGRRDIVIAW  140



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+ + P+A + V +   +A  KESNW+GYVA ATDEGK ALGRRDILI W
Sbjct  101  YFYATSSAQVPDA-FIVPSWSREAWSKESNWMGYVAVATDEGKSALGRRDILIAW  154



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA ++I  P+  + V++   +A  KESN++GY+A ATDEGK++LGRRDI+I W
Sbjct  81   YFYATASIPLPDGVFFVKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVINW  135



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+I  P A + V++   +A  KESN++GY+A ATDEGK+ALGRRDI+I W
Sbjct  81   YFYATSSIPLPSA-FLVKSLSREAWSKESNFMGYIAVATDEGKVALGRRDIVIAW  134



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S+I  PEA + +++   +A  +ESNWIGYVA ATDEGK ALGRRDI+I W
Sbjct  113  FLYATSSIDLPEA-FIIKSFSREAWSRESNWIGYVAVATDEGKAALGRRDIVIAW  166



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S+I  P+A + V++   +A  KESN++GY+A ATDEGK++LGRRDI+I W
Sbjct  81   FFYATSSIPLPDA-FVVKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVINW  134



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+I  P A + V++   +A  KESN++GY+A ATDEGK+ALGRRDI+I W
Sbjct  81   YFYATSSIPLPSA-FLVKSLSREAWNKESNFMGYIAVATDEGKVALGRRDIVIAW  134



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S+I  PEA + +++   +A  KESNW+GYVA ATDEGK  LGRRD+++ W
Sbjct  85   FFYATSSIDVPEA-FLIKSLSREAWSKESNWMGYVAVATDEGKKVLGRRDVVVAW  138



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+  EA + +R+   +A  KESNWIGY+A ATDEGK ALGRRDI+I W
Sbjct  166  FLYATSGIEVSEA-FLLRSLSREAWNKESNWIGYIAVATDEGKAALGRRDIVIAW  219



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P+A + +++   +A  +ESNWIGYVA ATDEGK ALGRRDI+IVW
Sbjct  110  FLYATSEIDVPDA-FIIKSFSREAWSRESNWIGYVAVATDEGKAALGRRDIVIVW  163



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S++      + +R+   +A  KESNWIGYVA ATDEGK+ALGRRDILI W
Sbjct  106  YVYATSSLTEVPDAFILRSWSREAWTKESNWIGYVAVATDEGKLALGRRDILIAW  160



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FY  S+I  P+A +  R+   +A  KESN++GY+A ATDEGK+ALGRRDI+I W
Sbjct  81   FFYGTSSIPLPDA-FMTRSLSREAWSKESNFMGYIAVATDEGKVALGRRDIVINW  134



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S+I  P+A + +R+   +A  KESNW+GYVA ATDEGK  LGRRD+++ W
Sbjct  85   FFYATSSIDVPDA-FLIRSLSREAWSKESNWMGYVAVATDEGKKVLGRRDVVVAW  138



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S ++ PEA + V++   +A  KESNWIG+VA ATDEGK  LGRRDI+I W
Sbjct  102  FLYATSQVQLPEA-FIVKSLSREAWSKESNWIGFVAVATDEGKTTLGRRDIVIAW  155



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S I  PEA   V  +R +A  KESNW+GYVA ATDEGK  LGRRDI+I W
Sbjct  103  FFYATSQIHVPEAFIIVPLSR-EAWSKESNWMGYVAVATDEGKAVLGRRDIVIAW  156



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S ++ PEA + V++   +A  KESNWIG+VA ATDEGK  LGRRDI+I W
Sbjct  102  FLYATSQVQLPEA-FIVKSLSREAWSKESNWIGFVAVATDEGKTTLGRRDIVIAW  155



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S I  PEA   V  +R +A  KESNW+GYVA ATDEGK  LGRRDI+I W
Sbjct  103  FFYATSQIHVPEAFIIVPLSR-EAWSKESNWMGYVAVATDEGKAVLGRRDIVIAW  156



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S I+ PEA + V++   +A  KESNW+GY+A ATDEG   LGRRDI+I W
Sbjct  86   FFYATSQIQLPEA-FIVKSLSREAWSKESNWMGYIAVATDEGTAVLGRRDIVIAW  139



>gb|EPS70940.1| hypothetical protein M569_03817 [Genlisea aurea]
Length=397

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S+I  P + +  ++    A  KESNWIGYVA ATDEGK+ALGRRD+++ W
Sbjct  88   YIYATSSIALPLS-FLCKSLSEKAWSKESNWIGYVAVATDEGKVALGRRDVVVAW  141



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S I+ P+ G+ +++   +A  KESNW+GYVA ATDEGK  LGRRDI+I W
Sbjct  99   YLYATSEIQVPD-GFILKSLSREAWSKESNWMGYVAVATDEGKAVLGRRDIVIAW  152



>gb|AFK35349.1| unknown [Lotus japonicus]
Length=246

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  PEA + V++   +A  +ESNWIGYVA ATDEGK  LGRRDI++ W
Sbjct  118  FLYATSKIDLPEA-FIVKSLSREAWSRESNWIGYVAVATDEGKAVLGRRDIVVAW  171



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA ++I  P+ G+ V++   +A  KESN++GY+A ATDEGK++LGRRDI+I W
Sbjct  78   FFYATASIPLPD-GFIVKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVIAW  131



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+ PEA + +++   +A  KESNW+GYVA ATDEGK  LGRRDI+I W
Sbjct  108  FLYATSQIQLPEA-FIIKSLSREAWSKESNWMGYVAVATDEGKAVLGRRDIVIAW  161



>ref|XP_009757709.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S+I  P+ G+ VR+   +A  K+SN++GYVA ATDEGK+ LGRRDI+I W
Sbjct  81   FFYATSSIPLPD-GFFVRSLSLEAWSKDSNFMGYVAVATDEGKVELGRRDIVIAW  134



>ref|XP_009757707.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=394

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S+I  P+ G+ VR+   +A  K+SN++GYVA ATDEGK+ LGRRDI+I W
Sbjct  81   FFYATSSIPLPD-GFFVRSLSLEAWSKDSNFMGYVAVATDEGKVELGRRDIVIAW  134



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S+I  P A + V++   +A  KESN++GY+A ATDEGK+ALGRRDI+I W
Sbjct  81   FFYATSSIPLPSA-FLVKSLSREAWNKESNFMGYIAVATDEGKVALGRRDIVIAW  134



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+I  P+A +  ++   +A  KESN++GY+A ATDEGK++LGRRDI+I W
Sbjct  79   YFYATSSIPLPDA-FITKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVINW  132



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S ++ P+A + V++   +A  KESNWIGYVA ATDEGK  LGRRDI+I W
Sbjct  101  FLYATSQVQVPDA-FIVKSLSREAWSKESNWIGYVAVATDEGKAVLGRRDIVIAW  154



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S+I  P+ G  VR+   +A  KESN++GYVA ATDEGK+ LGRRDI+I W
Sbjct  81   FFYATSSIPLPD-GLFVRSLSLEAWSKESNFMGYVAVATDEGKVELGRRDIVIAW  134



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S ++ P+A + V++   +A  KESNWIGYVA ATDEGK  LGRRDI+I W
Sbjct  141  FLYATSQVQVPDA-FIVKSLSREAWSKESNWIGYVAVATDEGKAVLGRRDIVIAW  194



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P+A + ++    +A  KESNWIGYVA ATDEGK ALGRRDI++ W
Sbjct  97   FLYATSEIHVPDA-FLIKPLSREAWRKESNWIGYVAVATDEGKTALGRRDIVVAW  150



>ref|XP_010657149.1| PREDICTED: phospholipase A1-IIgamma-like [Vitis vinifera]
Length=407

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S IK P A + ++    DA  K+SNWIG+VA ATDEGK ALGRRDI++ W
Sbjct  85   YLYATSEIKVPTA-FILKPIPIDAWSKQSNWIGFVAVATDEGKTALGRRDIVVAW  138



>emb|CBI21954.3| unnamed protein product [Vitis vinifera]
Length=396

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S IK P A + ++    DA  K+SNWIG+VA ATDEGK ALGRRDI++ W
Sbjct  85   YLYATSEIKVPTA-FILKPIPIDAWSKQSNWIGFVAVATDEGKTALGRRDIVVAW  138



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+I  P+A +  ++   +A  KESN++GY+A ATDEGK++LGRRDI+I W
Sbjct  81   YFYATSSIPLPDA-FITKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVIAW  134



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S+I  P+A + V++   +A  KESN++GY+A ATDEGK+ALGRRDI++ W
Sbjct  81   FFYATSSIPLPDA-FIVKSLSREAWSKESNFMGYIAVATDEGKVALGRRDIVVNW  134



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+I  P+A +  ++   +A  KESN++GY+A ATDEGK++LGRRDI+I W
Sbjct  81   YFYATSSIPLPDA-FITKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVIAW  134



>ref|XP_010557126.1| PREDICTED: phospholipase A1-IIbeta isoform X2 [Tarenaya hassleriana]
Length=327

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S++K P   + V++   +A  KESNW+GY+A ATDEGK  LGRRDI++ W
Sbjct  85   FFYATSSVKLP-GSFIVKSLSREAWSKESNWMGYIAVATDEGKEKLGRRDIVVAW  138



>ref|XP_006295721.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
 gb|EOA28619.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
Length=411

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + Y  S+I+ PE  + +++   +A+ KESNW+GYVA ATDEGK  LGRRDI++ W
Sbjct  85   FIYGTSSIRLPEC-FIIKSLSREALYKESNWLGYVAVATDEGKRLLGRRDIVVAW  138



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+ PEA + +++   ++  KESNW+ YVA ATDEGK ALGRRDI+I W
Sbjct  125  FVYATSQIQVPEA-FLIKSLSRESWCKESNWMAYVAVATDEGKAALGRRDIVIAW  178



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P+A + +++   +A  +ESNWIGYVA ATDEGK ALGRRDI+I W
Sbjct  85   FLYATSEIDVPDA-FIIKSFSREAWSRESNWIGYVAVATDEGKAALGRRDIVIAW  138



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P+A + +++   +A  +ESNWIGYVA ATDEGK ALGRRDI+I W
Sbjct  85   FLYATSEIDVPDA-FIIKSFSREAWSRESNWIGYVAVATDEGKAALGRRDIVIAW  138



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+  EA + +R+   +A  KESNWIGY+A ATDEGK ALGRRDI+I W
Sbjct  85   FLYATSGIEVSEA-FLLRSLSREAWNKESNWIGYIAVATDEGKAALGRRDIVIAW  138



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P+A + +++   +A  +ESNWIGYVA ATDEGK ALGRRDI+I W
Sbjct  112  FLYATSEIDVPDA-FIIKSFSREAWSRESNWIGYVAVATDEGKAALGRRDIVIAW  165



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S I  PE+ + ++    DA  +ESNWIGY+A ATD+GK ALGRRDI I W
Sbjct  86   YLYATSKIDVPES-FILKPLSRDAWNRESNWIGYIAVATDQGKQALGRRDITIAW  139



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S++  P+A +  ++   +A  KESN++GYVA ATDEGK++LGRRDI+I W
Sbjct  78   YFYATSSMPLPDA-FITKSLSREAWSKESNFMGYVAVATDEGKVSLGRRDIVIAW  131



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+I  P+A +  ++   +A  KESN++GY+A ATDEGK +LGRRDILI W
Sbjct  81   YFYATSSIPLPDA-FITKSLSREAWSKESNFMGYIAVATDEGKASLGRRDILIAW  134



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA ++I  P+A +  R+   +A  KESN++GYVA ATDEGK++LGRRDI++ W
Sbjct  81   FFYATASIPLPDA-FITRSFSREAWSKESNFMGYVAVATDEGKVSLGRRDIVVAW  134



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P+A + ++    +A  KESNWIGYVA ATDEGK ALGRRD+++ W
Sbjct  97   FLYATSEIHVPDA-FLIKPLSREAWRKESNWIGYVAVATDEGKAALGRRDVVVAW  150



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S++K P   + V++   +A  KESNW+GY+A ATDEGK  LGRRDI++ W
Sbjct  85   FFYATSSVKLP-GSFIVKSLSREAWSKESNWMGYIAVATDEGKEKLGRRDIVVAW  138



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PEA + +++   +A  +ESNW+GYVA ATDEGK ALGRRDI+I W
Sbjct  84   FLYATSRMDVPEA-FIIKSLSREAWSRESNWMGYVAVATDEGKAALGRRDIVIAW  137



>ref|NP_001141332.1| uncharacterized protein LOC100273423 [Zea mays]
 gb|ACF86097.1| unknown [Zea mays]
Length=420

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S++  P A      A S    +ESNWIGYVAAATDEGK ALGRRDI++ W
Sbjct  153  FLYATSSVAVPAAFMLWSVAGSRRRCRESNWIGYVAAATDEGKAALGRRDIVVAW  207



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P+A + +++   +A  +ESNW+GYVA ATDEGK  LGRRDILI W
Sbjct  85   FLYATSRIDVPDA-FIIKSLSREAWSRESNWMGYVAVATDEGKAVLGRRDILIAW  138



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P+A + +++   +A  +ESNW+GYVA ATDEGK  LGRRDILI W
Sbjct  85   FLYATSRIDVPDA-FIIKSLSREAWSRESNWMGYVAVATDEGKAVLGRRDILIAW  138



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P+A + +++   +A  +ESNW+GYVA ATDEGK  LGRRDILI W
Sbjct  85   FLYATSRIDVPDA-FIIKSLSREAWSRESNWMGYVAVATDEGKAVLGRRDILIAW  138



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+ PEA + +++   +A  +ESNW+GYVA ATDEGK  LGRRDI++ W
Sbjct  85   FLYATSRIEVPEA-FIIKSLSREAWSRESNWMGYVAVATDEGKAVLGRRDIVVAW  138



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA ++I  P+A + V++   +A  KESN++GY+A ATDEGK+ALGRRDI++ W
Sbjct  81   FFYATASIPLPDA-FIVKSLSREAWSKESNFMGYIAVATDEGKVALGRRDIVVNW  134



>ref|XP_009777407.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA ++I  P+A + V++   +A  KESN++GY+A ATDEGK+ALGRRDI++ W
Sbjct  81   FFYATASIPLPDA-FIVKSLSREAWSKESNFMGYIAVATDEGKVALGRRDIVVNW  134



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  P+A + V++   +A  KESNW+GYVA ATDEGK  LGRRDI+I W
Sbjct  115  FLYATSQVDVPDA-FIVKSLSREAWSKESNWMGYVAVATDEGKAELGRRDIVIAW  168



>ref|XP_004961148.1| PREDICTED: phospholipase A1-II 6-like [Setaria italica]
Length=409

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S++  P A + +R+A      +ESNWIGYVA ATDEGK ALGRRD+++ W
Sbjct  89   FLYATSSLPVPGA-FILRSASGAGRCRESNWIGYVAVATDEGKAALGRRDVVVAW  142



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S++  P+A +  ++   +A  KESN++GY+A ATDEGK +LGRRDI+I W
Sbjct  82   YFYATSSMPLPDA-FITKSLSREAWSKESNFMGYIAVATDEGKASLGRRDIVINW  135



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S++  P+A +  ++   +A  KESN++GY+A ATDEGK +LGRRDI+I W
Sbjct  82   YFYATSSMPLPDA-FITKSFSREAWSKESNFMGYIAVATDEGKASLGRRDIVINW  135



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S+I  P+ G+ V++   +A  KESN++GY+A ATDEGK +LGRRDI++ W
Sbjct  81   FFYATSSIPLPD-GFIVKSFSREAWSKESNFMGYIAVATDEGKASLGRRDIVVNW  134



>gb|KDO63322.1| hypothetical protein CISIN_1g0475241mg, partial [Citrus sinensis]
Length=118

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S+   P A +  ++  S+   KESNWIGY+A A DEGK ALGRRDIL  W
Sbjct  31   FLYATSSSPLP-AAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRDILTAW  84



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA ++I  P+A + V++   +A  KESN++GY+A ATDEGK++LGRRDI+I W
Sbjct  78   FFYATASIPLPDA-FIVKSFSREAWSKESNFMGYIAVATDEGKVSLGRRDIVINW  131



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S+++ PEA + +R+   +A  KESNW+G+VA ATD GK  LGRRD++I W
Sbjct  86   FIYATSSVQVPEA-FLIRSLSREAWSKESNWMGFVAVATDNGKKQLGRRDVVIAW  139



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +   EA + +++   +A  KESNW+G+VA +TDEGK+ALGRRDI+I W
Sbjct  85   FLYATSQVHISEA-FIIKSLSREAWSKESNWMGFVAVSTDEGKVALGRRDIVIAW  138



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S ++ P+A + VR+   +A  KESNWIGYVA +TDEG   LGRRD++I W
Sbjct  128  FLYATSQVQVPDA-FIVRSLSREAWSKESNWIGYVAVSTDEGAAELGRRDVVIAW  181



>ref|XP_010469763.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=411

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + Y  S+I+ PE  + +++   +A  KESNW+GY+A ATDEGK  LGRRDI++ W
Sbjct  85   FIYGTSSIRLPEC-FIIKSLSREAWNKESNWLGYIAVATDEGKRLLGRRDIVVAW  138



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+ PEA + +++   ++  KESNW+ Y+A ATDEGK  LGRRDI+I W
Sbjct  116  FVYATSQIQVPEA-FLIKSLSRESWCKESNWMAYIAVATDEGKAVLGRRDIVIAW  169



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  PEA + +++   +A  KESNWIG+VA A DEGK  LGRRDI+I W
Sbjct  100  FIYATSEINVPEA-FIIKSLSREAWSKESNWIGFVAVANDEGKDVLGRRDIVIAW  153



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S ++ P+A + VR+   +A  KESNWIGYVA  TDEG   LGRRD++I W
Sbjct  122  FLYATSQVQVPDA-FIVRSLSREAWSKESNWIGYVAVGTDEGAAELGRRDVVIAW  175



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S ++ P+A + VR+   +A  KESNWIGYVA  TDEG   LGRRD++I W
Sbjct  128  FLYATSQVQVPDA-FIVRSLSREAWSKESNWIGYVAVGTDEGAAELGRRDVVIAW  181



>gb|EPS68357.1| hypothetical protein M569_06414, partial [Genlisea aurea]
Length=191

 Score = 58.5 bits (140),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S    P+A + VR+   +A  KESNW+GYVA ATDEG   LGRRDILI W
Sbjct  80   YLYATSNGAMPDA-FLVRSWSREAWSKESNWMGYVAVATDEGVGVLGRRDILIAW  133



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+   PEA + V++   +A  KESN++GYVA ATD+GK  LGRRDI+I W
Sbjct  81   YFYATSSFPLPEA-FMVKSWSREAWSKESNFMGYVAVATDKGKAVLGRRDIVIAW  134



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +   EA + +++   +A  KESNW+G+VA +TDEGK+ALGRRDI+I W
Sbjct  85   FVYATSQVHISEA-FIIKSLSREAWSKESNWMGFVAVSTDEGKVALGRRDIVIAW  138



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+   PEA + +R+   +A  KESN++G+VA ATD+GK  LGRRDI+I W
Sbjct  81   YFYATSSFPLPEA-FMIRSWSREAWSKESNFMGFVAVATDKGKAVLGRRDIVIAW  134



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S++  PE  + +R+       +ESNWIGYVA ATD+GK ALGRRDI++ W
Sbjct  87   FLYATSSVAVPEP-FILRSVSLGRRCRESNWIGYVAVATDDGKTALGRRDIVVAW  140



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S ++ P+A + +++    A  K+SNW+GYVA ATDEG   LGRRD+L+ W
Sbjct  85   FFYATSGVQVPDA-FIIKSLSRQAWSKDSNWMGYVAVATDEGAAQLGRRDVLVAW  138



>ref|XP_010510242.1| PREDICTED: phospholipase A1-IIbeta [Camelina sativa]
Length=415

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + Y  S+I+ PE  + +++   +A  KESNW+GY+A ATDEGK  LGRRDI++ W
Sbjct  85   FIYGTSSIRLPEC-FIIKSLSREAWNKESNWLGYIAVATDEGKRLLGRRDIVVAW  138



>ref|XP_010414181.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=423

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + Y  S+I+ PE  + +++   +A  KESNW+GY+A ATDEGK  LGRRDI++ W
Sbjct  94   FIYGTSSIRLPEC-FIIKSLSREAWNKESNWLGYIAVATDEGKRLLGRRDIVVAW  147



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA ++I  P+A + V++   +A  KESN++GY+A +TDEGK +LGRRDI+I W
Sbjct  81   FFYATASIPLPDA-FIVKSFSREAWSKESNFMGYIAVSTDEGKASLGRRDIVINW  134



>sp|O82274.2|PLA19_ARATH RecName: Full=Phospholipase A1-IIbeta [Arabidopsis thaliana]
Length=414

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y Y  S+I+ PE  + +++   +A  KESNW+GY+A ATDEGK  LGRR I++ W
Sbjct  85   YIYGTSSIRLPEC-FIIKSLSREAWNKESNWLGYIAVATDEGKKLLGRRGIVVAW  138



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S +  PEA + +++   +A  KESNWIGYV  ++DEGK  LGRRDI+I W
Sbjct  103  YIYATSEMDVPEA-FIIKSFSREAWSKESNWIGYVGVSSDEGKDVLGRRDIVIAW  156



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  PEA + +++   ++  KESNW+ Y+A ATDEGK  LGRRDI+I W
Sbjct  116  FVYATSQIPIPEA-FLIKSLSRESWCKESNWMAYIAVATDEGKAVLGRRDIVIAW  169



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  62   RSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            R    LKESNW+GYVA ATDEGK+ALGRRDI+I W
Sbjct  80   RVTKYLKESNWMGYVAVATDEGKVALGRRDIVIAW  114



>ref|XP_011100290.1| PREDICTED: phospholipase A1-IIgamma-like [Sesamum indicum]
Length=395

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = +2

Query  2    YFYAPST--IKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S   I  PE+ + ++        KESNW+GY+A ATDEGK ALGRRDILI W
Sbjct  85   YIYATSGPGISLPES-FILKPLSEKTWYKESNWMGYIAVATDEGKAALGRRDILIAW  140



>ref|XP_003528482.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31003.1| Phospholipase A1-IIgamma [Glycine soja]
Length=408

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA       E+ + +++   DA  +ESNWIGYVA ATDEGK ALGRRDI++ W
Sbjct  84   FLYATCKAGASES-FILKSFNKDAWSQESNWIGYVAVATDEGKAALGRRDIVVAW  137



>emb|CDY23963.1| BnaC03g17280D [Brassica napus]
Length=414

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y Y  S+I+ PE  + + +   +A  K+SNW+GY A ATDEGK  LGRRDI++ W
Sbjct  85   YIYGTSSIRLPEC-FLINSLSREAWNKDSNWLGYTAVATDEGKELLGRRDIVVAW  138



>gb|KFK42950.1| hypothetical protein AALP_AA1G060100 [Arabis alpina]
Length=412

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA ++IK P   + V++   DA   ++NW+GY+A ATDEGK  LGRRDI++ W
Sbjct  85   YIYATASIKLPIC-FIVKSLSKDATRVQTNWMGYIAVATDEGKAMLGRRDIVVAW  138



>gb|AAM61647.1| lipase-like protein [Arabidopsis thaliana]
Length=423

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA ++IK P   + V++   DA   ++NW+GY+A ATD+GK  LGRRDI++ W
Sbjct  85   YIYATASIKLP-ISFIVKSLSKDASHVQTNWMGYIAVATDQGKAMLGRRDIVVAW  138



>ref|XP_004232955.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Solanum lycopersicum]
Length=408

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  80   KESNWIGYVAAATDEGKIALGRRDILIVW  166
            KESNWIG+VA ATDEGK+ALGRRDILI W
Sbjct  121  KESNWIGFVAVATDEGKVALGRRDILIAW  149



>ref|XP_010316799.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Solanum lycopersicum]
Length=410

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  80   KESNWIGYVAAATDEGKIALGRRDILIVW  166
            KESNWIG+VA ATDEGK+ALGRRDILI W
Sbjct  121  KESNWIGFVAVATDEGKVALGRRDILIAW  149



>ref|XP_006410236.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
 gb|ESQ51689.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
Length=414

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y Y  S+I+ PE  + + +   +A  KESNW+GY+A ATD+GK  LGRRDI++ W
Sbjct  85   YIYGTSSIRLPEC-FIINSLSREAWNKESNWLGYIAVATDQGKELLGRRDIVVAW  138



>gb|EMT04701.1| Lipase [Aegilops tauschii]
Length=373

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  +     A   VR+    +  KESNWIGYVA ATD GK  LGRRD+++VW
Sbjct  95   FLYATCSAPAAPAATFVRSCHPQSRSKESNWIGYVAVATDAGKATLGRRDVVVVW  149



>gb|KCW89613.1| hypothetical protein EUGRSUZ_A01896, partial [Eucalyptus grandis]
Length=330

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  50   VRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +R+   +A  KESNWIGYVA ATD+GK ALGRRDILI W
Sbjct  8    LRSLSREAWNKESNWIGYVAVATDKGKAALGRRDILIAW  46



>ref|XP_009793565.1| PREDICTED: uncharacterized protein LOC104240421 [Nicotiana sylvestris]
Length=180

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRD  151
            Y YA S+++ PEA + +++   +A  KESNW G+V   TDEGK+ALGRRD
Sbjct  35   YIYATSSVQVPEA-FIIKSLSREAWSKESNWAGFVVVTTDEGKVALGRRD  83



>ref|XP_004505132.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Cicer arietinum]
Length=401

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S     E+         DA   ESNWIGYVA ATDEGK++LGRRDI++ W
Sbjct  84   FIYATSKASDSESFLLRSILSKDAWSMESNWIGYVAVATDEGKVSLGRRDIVVAW  138



>ref|XP_004232956.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=410

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  44   YNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y   A+     +K SNWIG+VA ATDEGK+ALGRRDILIVW
Sbjct  109  YFYGASSKTEKVKVSNWIGFVAVATDEGKVALGRRDILIVW  149



>ref|XP_009144598.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=408

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + Y  S+IK PE  + + +   +A  KESNW+GYVA ATDE K  LGRRDI++ W
Sbjct  85   FIYGTSSIKLPEC-FMINSWSREAWNKESNWLGYVAVATDECKELLGRRDIVVAW  138



>gb|EYU24809.1| hypothetical protein MIMGU_mgv1a007765mg [Erythranthe guttata]
Length=396

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA ++I     G+ V++   +  + ESNW+GYVA +T+EG  ALGRRDIL+ W
Sbjct  85   YIYATASIGGLPQGFMVKSMADNPWMDESNWMGYVAVSTNEGSKALGRRDILVAW  139



>ref|XP_009132769.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=414

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y Y  S+I+ PE  + + +   +A  K+SNW+GY A +TDEGK  LGRRDI++ W
Sbjct  85   YIYGTSSIRLPEC-FLINSLSREAWNKDSNWLGYTAVSTDEGKELLGRRDIVVAW  138



>emb|CDX84801.1| BnaA03g14290D [Brassica napus]
Length=414

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y Y  S+I+ PE  + + +   +A  K+SNW+GY A +TDEGK  LGRRDI++ W
Sbjct  85   YIYGTSSIRLPEC-FLINSLSREAWNKDSNWLGYTAVSTDEGKELLGRRDIVVAW  138



>emb|CDY24728.1| BnaC04g13330D [Brassica napus]
Length=408

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + Y  S+IK PE  + + +   +A  KESNW+GYVA ATDE K  LGRRDI++ W
Sbjct  85   FIYGTSSIKLPEC-FMINSWSREAWNKESNWLGYVAVATDECKELLGRRDIVVAW  138



>ref|NP_172115.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
 sp|Q9LNC2.1|PLA18_ARATH RecName: Full=Phospholipase A1-IIalpha [Arabidopsis thaliana]
 gb|AAF80222.1|AC025290_11 Contains similarity to petal abundant lipase-like protein Pn47p 
mRNA from Ipomoea nil gb|U55867 and contains a lipase PF|01764 
domain [Arabidopsis thaliana]
 gb|AEE27968.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
Length=423

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA ++IK P   + V++   DA   ++NW+GY+A ATD+GK  LGRRDI++ W
Sbjct  85   YIYATASIKLP-ISFIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVVAW  138



>gb|KFK31237.1| hypothetical protein AALP_AA6G086300 [Arabis alpina]
Length=414

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + Y  S+I+ PE  + V +   +A  +ESNW+GY+A ATDEGK  LGRRDI++ W
Sbjct  85   FIYGTSSIRLPEC-FIVNSWSREAWNRESNWLGYIAVATDEGKKLLGRRDIVVAW  138



>ref|XP_002892328.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68587.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA ++IK P   + V++   DA   ++NW+GY+A ATD+GK  LGRRDI++ W
Sbjct  85   YIYATASIKLPIC-FIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVVAW  138



>ref|XP_006417941.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
 gb|ESQ36294.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
Length=411

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA +++K P   + V++   DA   ++NW+GY+A ATDEGK  LGRRDI++ W
Sbjct  85   YIYATASLKLPIC-FIVKSLSKDASRVQTNWMGYIAVATDEGKAMLGRRDIVVAW  138



>ref|XP_006306316.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
 gb|EOA39214.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
Length=423

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA ++IK P   + V++   DA   ++NW+GY+A ATD+GK  LGRRDI++ W
Sbjct  85   YIYATASIKLPIC-FIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVVAW  138



>gb|ABK24664.1| unknown [Picea sitchensis]
Length=426

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S ++ P+A + +++   +A  +ESNWIGYVA ATD GK  LGRR+I++ W
Sbjct  88   FLYATSRLELPQA-FMLKSLSREAWSRESNWIGYVAVATDRGKQRLGRREIVVAW  141



>ref|XP_010457749.1| PREDICTED: phospholipase A1-IIalpha [Camelina sativa]
Length=423

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA ++IK P   + V++   DA   ++NW+GY+A ATD+GK  LGRRDI++ W
Sbjct  85   YIYATASIKLP-ICFIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVVAW  138



>ref|XP_009110999.1| PREDICTED: phospholipase A1-IIalpha-like [Brassica rapa]
 emb|CDY15570.1| BnaA08g28540D [Brassica napus]
Length=408

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA ++IK P   + V++    A   ++NW+GY+A ATDEGK  LGRRDI++ W
Sbjct  85   YIYATASIKMPLC-FIVKSLSKKASRVQTNWMGYIAVATDEGKAMLGRRDIVVAW  138



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+ G+ +++    A  K+SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  685  FIYAMCTVSLPD-GFMIKSLSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVAW  738



>emb|CDX86530.1| BnaC08g01730D [Brassica napus]
Length=408

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA ++IK P   + V++    A   ++NW+GY+A ATDEGK  LGRRDI++ W
Sbjct  85   YIYATASIKMPLC-FIVKSLSKKASRVQTNWMGYIAVATDEGKAMLGRRDIVVAW  138



>ref|XP_004505133.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Cicer arietinum]
Length=364

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S     E+         DA   ESNWIGYVA ATDEGK++LGRRDI++ W
Sbjct  84   FIYATSKASDSESFLLRSILSKDAWSMESNWIGYVAVATDEGKVSLGRRDIVVAW  138



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S      A         DA   ESNWIGYVA ATDE K ALGRRDI++VW
Sbjct  93   YLYATSKASDSAAFLLTSIFSKDAWSLESNWIGYVAVATDEAKEALGRRDIVVVW  147



>ref|XP_003574515.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=438

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVR-AARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S+I  PE+   +   +  DA  ++SNWIGYVA ATDEG  ALGRRDI++ W
Sbjct  121  FIYATSSIPLPESFLCLPLPSLPDAWSRDSNWIGYVAVATDEGAEALGRRDIVVAW  176



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + Y+ S I  P++ + V     +   KESNWIGYVA ATD+GK  LGRRDI++ W
Sbjct  108  FLYSTSQISVPDS-FLVFPVSREGWTKESNWIGYVAVATDQGKQVLGRRDIVVAW  161



>ref|XP_009119078.1| PREDICTED: phospholipase A1-IIalpha [Brassica rapa]
Length=440

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA +++  P   + V++   +A   ++NWIGYVA ATDEGK  LGRRDI++ W
Sbjct  123  YIYATASLNLPIC-FIVKSLSKEASRVQTNWIGYVAVATDEGKALLGRRDIVVAW  176



>gb|ABK23399.1| unknown [Picea sitchensis]
Length=412

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA STIK PEA      +R     +ESNW+GYVA  TD GK   GRRDI + W
Sbjct  87   FIYATSTIKVPEAFITTSLSREGGS-RESNWMGYVAHVTDTGKTQYGRRDITVAW  140



>emb|CDY57813.1| BnaA10g28020D [Brassica napus]
Length=545

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA +++  P   + V++   +A   ++NWIGYVA ATDEGK  LGRRDI++ W
Sbjct  228  YIYATASLNLPIC-FIVKSLSKEASRVQTNWIGYVAVATDEGKALLGRRDIVVAW  281



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLK-ESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S +  P++     A+ S AV   ESNWIGY+A ATD+ K  LGRRDI + W
Sbjct  87   YLYATSKVDVPQSFIMSPASTSRAVPNGESNWIGYIAVATDQAKEKLGRRDIAVAW  142



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+ G+ V++    A  ++SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  88   FIYAMCTVSLPD-GFMVKSLSKAAWSRQSNWMGFVAVATDEGKEVLGRRDVVVAW  141



>gb|ABR18391.1| unknown [Picea sitchensis]
Length=412

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA STIK PEA      +R     +ESNW+GYVA  TD GK   GRRDI + W
Sbjct  87   FIYATSTIKVPEAFIRTSLSREGGS-RESNWMGYVAHVTDTGKTQYGRRDITVAW  140



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S     E  + +R+   DA   +SNWIGYVA ATDEGK ALGRRDI++ W
Sbjct  84   FLYATSKASDSEK-FLLRSFSKDAWSLQSNWIGYVAVATDEGKEALGRRDIVVAW  137



>ref|XP_004232958.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=419

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  77   LKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +K SNWIG+VA ATDEGK+ALGRRDILI W
Sbjct  126  IKSSNWIGFVAVATDEGKVALGRRDILIAW  155



>gb|KDP31780.1| hypothetical protein JCGZ_12241 [Jatropha curcas]
Length=372

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S ++ P++ + V++        + NWIGYVA ATDEGK  LGRRDI+I W
Sbjct  59   YVYATSKVELPQS-FMVKSLAKQPWSSQCNWIGYVAVATDEGKAMLGRRDIVIAW  112



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEA-GYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S++  PE+       +  D   +ESNW+GYVA ATDEG  ALGRRDI++ W
Sbjct  119  FVYATSSLPLPESFLLLPLPSLPDVWSRESNWMGYVAVATDEGAAALGRRDIVVAW  174



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+ G+ +++    A  K+SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  91   FIYAMCTVNLPD-GFMIKSWSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVAW  144



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+ G+ +++    A  K+SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  91   FIYAMCTVNLPD-GFMIKSWSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVAW  144



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+ G+ V++    A  ++SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  88   FIYAMCTVSLPD-GFMVKSLSKAAWSRQSNWMGFVAVATDEGKELLGRRDVVVAW  141



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+ G+ V++    A  ++SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  88   FVYAMCTVSLPD-GFMVKSLSKAAWSRQSNWMGFVAVATDEGKEVLGRRDVVVAW  141



>gb|EMS48809.1| Phospholipase A1-II 6 [Triticum urartu]
Length=454

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S+    +A   V+     +  +ESNWIGYVA ATD GK ALGRRD+++ W
Sbjct  95   FLYATSSAHAAKAVAFVKGGHPRSRCRESNWIGYVAVATDAGKSALGRRDVVVAW  149



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S   T    + ++    D    ESNWIGYVA ATDEGK ALGRRDI++ W
Sbjct  86   FLYATSK-ATASKQFALKLFSKDEWGMESNWIGYVAVATDEGKAALGRRDIVVAW  139



>gb|EYU17473.1| hypothetical protein MIMGU_mgv1a008748mg [Erythranthe guttata]
Length=363

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA S+     +   V  +R +A  KESNW+G+VA ATDEG++ALGRRDILI W
Sbjct  48   YFYAASSSLVLGSLLVVSLSR-EAWSKESNWMGFVAVATDEGRLALGRRDILISW  101



>ref|XP_001779106.1| predicted protein [Physcomitrella patens]
 gb|EDQ56052.1| predicted protein [Physcomitrella patens]
Length=469

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKI-ALGRRDILIVW  166
            Y YA + ++     +  R+ R DA  K+SNWIGYVA  TDE +I  LGRRDIL+VW
Sbjct  118  YIYATANVRV--WSFLRRSEREDAWSKKSNWIGYVAVCTDEKEINRLGRRDILVVW  171



>ref|XP_010518796.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+ P++ + V     +   KESNW+GYVA  TDEG   LGRRDI++ W
Sbjct  86   FLYATSQIEVPDS-FLVFPVSREGRTKESNWMGYVAVTTDEGTELLGRRDIVVAW  139



>ref|XP_002440294.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
 gb|EES18724.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
Length=408

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S++  P+A + +R+       +ESNWIGYVA ATDEGK ALGRRD+++VW
Sbjct  94   FLYATSSVALPDA-FMLRSVSRSRRCRESNWIGYVAVATDEGKAALGRRDVVVVW  147



>ref|XP_010655496.1| PREDICTED: phospholipase A1-IIgamma isoform X2 [Vitis vinifera]
Length=321

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 35/60 (58%), Gaps = 6/60 (10%)
 Frame = +2

Query  5    FYAPSTIKTPEAGYNVRAARS------DAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
               PS ++ P     V A R       +A  KESNW+GYVA ATDEGK  LGRRDI+I W
Sbjct  8    LMTPSILRRPLDLLEVAAMRRRISSPREAWSKESNWMGYVAVATDEGKAVLGRRDIVIAW  67



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S     EA + +++   D+  K+SNWIGYVA ATD GK ALGRRDI++ W
Sbjct  85   FLYATSKASDAEA-FLLKSFSKDSWSKQSNWIGYVAVATDAGKEALGRRDIVVAW  138



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I+ P++ + V     +   KESNW+GYVA  TDEG   LGRRDI++ W
Sbjct  86   FLYATSQIEVPDS-FLVFPVSREGRTKESNWMGYVAVTTDEGTELLGRRDIVVAW  139



>gb|EEE64775.1| hypothetical protein OsJ_19631 [Oryza sativa Japonica Group]
Length=387

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 6/54 (11%)
 Frame = +2

Query  5    FYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            F+  + +    A Y V      A  +ESNWIGYVA ATDEGK ALGRRDI++ W
Sbjct  72   FFERAQLPGHSAAYRV------ARCRESNWIGYVAVATDEGKAALGRRDIVVAW  119



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + +A S I  PE+      +R +   KESNWIGYVA   D+G  ALGRRDI++ W
Sbjct  115  FLFATSQIHVPESFLLFPVSR-EGCTKESNWIGYVAVTDDQGTAALGRRDIVVAW  168



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+A + +++    A  K+SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  88   FIYAMCTVSLPDA-FMIKSWSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVAW  141



>gb|EMS51987.1| Phospholipase A1-II 3 [Triticum urartu]
Length=423

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S+ + PE G+  R     A   ESNW+GYVA ATD G  ALGRRDI++ W
Sbjct  77   FIYATSSARLPE-GFMARPLPVGAWSTESNWMGYVAVATDRGAAALGRRDIVVAW  130



>ref|XP_003608142.1| Lipase [Medicago truncatula]
Length=349

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S  +   A         DA   E+NW+GYVA ATDE K ALGRRDI++ W
Sbjct  34   YLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAVATDEAKEALGRRDIVVAW  88



>emb|CDY10187.1| BnaC05g04300D [Brassica napus]
Length=402

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA +++  P   + V++   +A   ++NWIGYVA ATDEGK  LGRRDI++ W
Sbjct  85   YIYATASLNLPIC-FIVKSLSKEASRVQTNWIGYVAVATDEGKALLGRRDIVVAW  138



>gb|EAY99121.1| hypothetical protein OsI_21080 [Oryza sativa Indica Group]
Length=399

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PE    +R+A      +ESNWIGYVA ATDEGK ALGRRDI++ W
Sbjct  90   FVYATSCVAVPEP-LILRSASRARRCRESNWIGYVAVATDEGKAALGRRDIVVAW  143



>sp|Q6F358.1|PLA6_ORYSJ RecName: Full=Phospholipase A1-II 6 [Oryza sativa Japonica Group]
 gb|AAT69580.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44110.1| putative lipase [Oryza sativa Japonica Group]
Length=411

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PE    +R+A      +ESNWIGYVA ATDEGK ALGRRDI++ W
Sbjct  90   FVYATSCVAVPEP-LILRSASRARRCRESNWIGYVAVATDEGKAALGRRDIVVAW  143



>ref|XP_004960509.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=420

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAAR-SDAV-LKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +FYA S +  PE+   +      DA   +ESNWIGYVA ATDEG   LGRRDI++ W
Sbjct  106  FFYATSAVPVPESVLLLPLPELGDAAWCRESNWIGYVAVATDEGVAELGRRDIVVAW  162



>ref|XP_006362439.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=419

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  77   LKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +K SNWIG+VA ATD+GK+ALGRRDILI W
Sbjct  126  IKSSNWIGFVAVATDDGKVALGRRDILIAW  155



>ref|XP_010501341.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=424

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA ++I  P   + V+    DA   ++NW+GY+A ATD+GK  LGRRDI++ W
Sbjct  85   YIYATASINLP-ICFIVKPLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVVAW  138



>ref|XP_010475356.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
 ref|XP_010475357.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=423

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA +++  P   + V++   DA   ++NW+GY+A ATD+GK  LGRRDI++ W
Sbjct  85   YIYATASLNLP-ICFIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVVAW  138



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+  + ++     A  K+SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  88   FIYAMCTVSLPD-DFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVMVAW  141



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S  + P A + V  A      K+SNWIGYVA AT++G   LGRRDI++ W
Sbjct  122  FLYATSEARMPGA-FMVFPASGQGWTKQSNWIGYVAVATNDGTAVLGRRDIVVAW  175



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  PEA      +R +   KESNW+GYVA   D+G   LGRRDI+I W
Sbjct  116  FLYATSEIHVPEAFLLFPVSR-EGWSKESNWMGYVAVTDDQGTAVLGRRDIVIAW  169



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  77   LKESNWIGYVAAATDEGKIALGRRDILIVW  166
             KESNW+GYVA ATDEGK  LGRRDI+I W
Sbjct  85   FKESNWMGYVAVATDEGKAVLGRRDIVIAW  114



>gb|AFW79273.1| hypothetical protein ZEAMMB73_515320 [Zea mays]
Length=400

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S++  P+A + +R+       +ESNWIGYVA ATDEGK ALGRRD+++ W
Sbjct  89   FLYATSSVAVPDA-FILRSVSRSRRCRESNWIGYVAVATDEGKAALGRRDVVVAW  142



>ref|XP_009137120.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=349

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  PE+      +R +   KESNW+GYVA   D+G   LGRRDI++ W
Sbjct  114  FLYATSQIHVPESFLLFPLSR-EGCTKESNWMGYVAVTDDQGTAVLGRRDIVVAW  167



>ref|NP_001149813.1| triacylglycerol lipase [Zea mays]
 gb|ACG36877.1| triacylglycerol lipase [Zea mays]
Length=400

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S++  P+A + +R+       +ESNWIGYVA ATDEGK ALGRRD+++ W
Sbjct  89   FLYATSSVAVPDA-FILRSVSRSRRCRESNWIGYVAVATDEGKAALGRRDVVVAW  142



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+  + ++     A  K+SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  491  FIYAMCTVSLPD-DFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVAW  544



>gb|AFK39140.1| unknown [Medicago truncatula]
Length=196

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S  +   A         DA   E+NW+GYVA ATDE K ALGRRDI++ W
Sbjct  84   YLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAVATDEAKEALGRRDIVVAW  138



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S+ + P+ G+  R   + A   +SNW+GYVA ATD G  ALGRRDI++ W
Sbjct  98   FIYATSSARLPD-GFMARPLPAGAWSTDSNWMGYVAVATDRGAAALGRRDIVVAW  151



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+  + ++     A  K+SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  88   FIYAMCTVSLPD-DFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVAW  141



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA  T+  P+  + ++     A  K+SNW+G+VA ATDEGK  LGRRD+++ W
Sbjct  88   FIYAMCTVSLPD-DFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVAW  141



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S I  P+A + ++++  +A  KESN+IGYVA A D    +LGRRDI+I W
Sbjct  107  YLYATSGIDVPDA-FILKSSSREAWSKESNFIGYVAVAEDTAVASLGRRDIVIAW  160



>ref|XP_004505480.1| PREDICTED: phospholipase A1-IIdelta-like [Cicer arietinum]
Length=480

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA + +  PEA + +R+   ++  +ESNWIGY+A ++DE    LGRR+I +VW
Sbjct  144  FLYATARVSVPEA-FILRSRSRESWDRESNWIGYIAVSSDERTKELGRREIYVVW  197



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PE+      +R +   KESNW+GYVA   D+G   LGRRDI++VW
Sbjct  121  FLYATSEVHVPESFLLFPISR-EGWTKESNWMGYVAVTDDQGTALLGRRDIVVVW  174



>emb|CDY53993.1| BnaA03g58180D [Brassica napus]
Length=351

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  PE+      +R +   KESNW+GYVA   D+G   LGRRDI++ W
Sbjct  32   FLYATSHIHVPESFLLFPLSR-EGWTKESNWMGYVAVTDDQGTAVLGRRDIVVAW  85



>ref|XP_007025432.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY28054.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=406

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  83   ESNWIGYVAAATDEGKIALGRRDILIVW  166
            ESNWIGYVA  TDEGK  LGRRDILI W
Sbjct  111  ESNWIGYVAVTTDEGKAVLGRRDILICW  138



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P A +  ++   +A  KESN+IGYVA A DE   ALGRRDI+I W
Sbjct  89   FLYATSGIDLPSA-FMFKSLSREAWSKESNFIGYVAVAEDESVAALGRRDIVISW  142



>ref|XP_001779107.1| predicted protein [Physcomitrella patens]
 gb|EDQ56053.1| predicted protein [Physcomitrella patens]
Length=480

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +2

Query  53   RAARSDAVLKESNWIGYVAAATDEGKIA-LGRRDILIVW  166
            R  R DA  K SNW+GYVA  TDE +I  LGRRDIL+VW
Sbjct  133  RTEREDAWSKRSNWMGYVAVCTDEKEIKRLGRRDILVVW  171



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  PE+      +R +   KESNW+GYVA   D+G   LGRRDI++ W
Sbjct  117  FLYATSQIHVPESFLLFPMSR-EGWTKESNWMGYVAVTDDQGTAILGRRDIVVAW  170



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVR--AARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S    P+A + VR  AA  D   +ESN++GYVA ATDEG  ALGRRDI++ W
Sbjct  91   FIYATSGQPLPDA-FLVRPLAALKDVWSRESNFMGYVAVATDEGAAALGRRDIVVAW  146



>ref|NP_001056387.1| Os05g0574100 [Oryza sativa Japonica Group]
 sp|Q6F357.1|PLA7_ORYSJ RecName: Full=Phospholipase A1-II 7 [Oryza sativa Japonica Group]
 sp|A2Y7R2.1|PLA7_ORYSI RecName: Full=Phospholipase A1-II 7 [Oryza sativa Indica Group]
 gb|AAT69581.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44111.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF18301.1| Os05g0574100 [Oryza sativa Japonica Group]
 gb|EAY99122.1| hypothetical protein OsI_21081 [Oryza sativa Indica Group]
Length=407

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    YFYAPSTIKTPEA--GYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PEA     + +    A  +ESNW+GYVA ATDEG  ALGRRDI++ W
Sbjct  88   FVYATSGLPVPEAFLLLPLPSLLPPAWSRESNWMGYVAVATDEGVAALGRRDIVVAW  144



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  PE+      +R +   KESNW+GYVA   D+G   LGRRDI++ W
Sbjct  99   FLYATSEIHVPESFLLFPVSR-EGWTKESNWMGYVAVTDDQGTALLGRRDIVVAW  152



>ref|XP_004961147.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=406

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    YFYAPSTIKTPEA--GYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PEA     +     ++  +ESNW+GYVA ATD G  ALGRRDIL+ W
Sbjct  90   FIYATSALPVPEAFLVLPLPDLLPESWSRESNWMGYVAVATDAGVAALGRRDILVAW  146



>gb|EMS63790.1| Phospholipase A1-II 7 [Triticum urartu]
Length=515

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  68   DAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            D   +ESNW+GYVA ATDEG  ALGRRDI++ W
Sbjct  143  DVWSRESNWMGYVAVATDEGAAALGRRDIVVAW  175



>ref|XP_007025431.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28053.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=383

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  80   KESNWIGYVAAATDEGKIALGRRDILIVW  166
             +SNW GYVA ATDEGK ALGRRDIL+ W
Sbjct  93   NDSNWFGYVAVATDEGKTALGRRDILVSW  121



>gb|EMT11182.1| hypothetical protein F775_27795 [Aegilops tauschii]
Length=474

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  68   DAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            D   +ESNW+GYVA ATDEG  ALGRRDI++ W
Sbjct  143  DVWSRESNWMGYVAVATDEGAAALGRRDIVVAW  175



>ref|XP_010446304.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010446311.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=309

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PE+      +R +   KESNW+GYVA   D+G   LGRRDI++ W
Sbjct  116  FLYATSQVHVPESFLLFPVSR-EGWTKESNWMGYVAVTDDQGTALLGRRDIVVAW  169



>emb|CDY49813.1| BnaC06g04560D [Brassica napus]
Length=517

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIA-LGRRDILIVW  166
            Y YA S I  P   +  R+  S    + +NW+GY+A ATDE ++A LGRRDI+I W
Sbjct  159  YLYATSNINLPN--FFQRSKLSSIWSQHANWMGYIAVATDEEEVARLGRRDIVIAW  212



>ref|XP_009147767.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Brassica 
rapa]
Length=518

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIA-LGRRDILIVW  166
            Y YA S I  P   +  R+  S    + +NW+GY+A ATDE ++A LGRRDI+I W
Sbjct  160  YLYATSNINLPN--FFQRSKLSSIWSQHANWMGYIAVATDEEEVARLGRRDIVIAW  213



>emb|CDY22842.1| BnaA06g02350D [Brassica napus]
Length=518

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIA-LGRRDILIVW  166
            Y YA S I  P   +  R+  S    + +NW+GY+A ATDE ++A LGRRDI+I W
Sbjct  160  YLYATSNINLPN--FFQRSKLSSIWSQHANWMGYIAVATDEEEVARLGRRDIVIAW  213



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PE+      +R +   KESNW+GYVA   D+G   LGRRDI++ W
Sbjct  116  FLYATSQVHVPESFLLFPVSR-EGWTKESNWMGYVAVTDDQGTALLGRRDIVVAW  169



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PE+      +R +   KESNW+GYVA   D+G   LGRRDI++ W
Sbjct  116  FLYATSQVHVPESFLLFPVSR-EGWTKESNWMGYVAVTDDQGTALLGRRDIVVAW  169



>ref|XP_009401938.1| PREDICTED: phospholipase A1-II 5 [Musa acuminata subsp. malaccensis]
Length=449

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            YFYA + +  P+  +    AR DA  KESNW+GYVA +TD    A GRR+I + W
Sbjct  86   YFYATAQVGLPDHFFLFSYAR-DAWSKESNWMGYVAVSTDAAARATGRREIYVAW  139



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PE+      +R +   KESNW+GYVA   D+G   LGRRDI++ W
Sbjct  116  FLYATSQVHVPESFLLFPVSR-EGWTKESNWMGYVAVTDDQGTALLGRRDIVVAW  169



>ref|XP_003608122.1| Lipase [Medicago truncatula]
Length=387

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S  +   A         DA   E+NW+GYVA ATDE K ALGRRDI++ W
Sbjct  84   YLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAVATDEAKEALGRRDIVVAW  138



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S  +   A         DA   E+NW+GYVA ATDE K ALGRRDI++ W
Sbjct  84   YLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAVATDEAKEALGRRDIVVAW  138



>ref|XP_003566945.1| PREDICTED: phospholipase A1-II 2-like [Brachypodium distachyon]
Length=410

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA +          +R    D   +E NW+GYVAAATDEG   LGRRDI++ W
Sbjct  85   YVYATACADVLHGETLLRPLCRDGRARECNWMGYVAAATDEGAARLGRRDIVVAW  139



>ref|XP_002437113.1| hypothetical protein SORBIDRAFT_10g021260 [Sorghum bicolor]
 ref|XP_002438518.1| hypothetical protein SORBIDRAFT_10g021270 [Sorghum bicolor]
 gb|EER88480.1| hypothetical protein SORBIDRAFT_10g021260 [Sorghum bicolor]
 gb|EER89885.1| hypothetical protein SORBIDRAFT_10g021270 [Sorghum bicolor]
Length=401

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  53   RAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
             AA  D    ESNWIGYVA ATD+G  ALGRRDIL+ W
Sbjct  110  NAALRDPWSTESNWIGYVAVATDDGVAALGRRDILVAW  147



>ref|XP_003528483.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31004.1| Phospholipase A1-IIgamma [Glycine soja]
Length=366

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S    P A      ++ +   + +NWIGYVA ATDEGK ALGRRDI++ W
Sbjct  79   FLYATSQTSAPRACILNLFSKKEWNTR-TNWIGYVAVATDEGKEALGRRDIVVTW  132



>tpg|DAA45463.1| TPA: hypothetical protein ZEAMMB73_472202 [Zea mays]
Length=448

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGY---NVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  P+A          + +   +ESNW+GYVA ATDEG  ALGRRD+++ W
Sbjct  89   FVYATSGLHVPDAFLLLPQPALGQQEPWCRESNWMGYVAVATDEGAAALGRRDVVVAW  146



>ref|NP_001132361.1| uncharacterized protein LOC100193806 precursor [Zea mays]
 gb|ACF81176.1| unknown [Zea mays]
 gb|AFW74937.1| hypothetical protein ZEAMMB73_515693 [Zea mays]
Length=427

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARS--DAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  P + + +       +A  +ESNWIGYVA ATDEG   LGRRD+++ W
Sbjct  107  FVYATSALPVPGSDFPLLPLPETREAWTRESNWIGYVAVATDEGAAELGRRDVVVAW  163



>gb|ACG40994.1| triacylglycerol lipase [Zea mays]
Length=223

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S+ + P   +  R A   A   ESNW+GYVA ATD G   LGRRDI++ W
Sbjct  107  FLYATSSARVP-GQFITRPAPPGAWSAESNWMGYVAVATDAGVARLGRRDIVVAW  160



>gb|EMT05578.1| hypothetical protein F775_13080 [Aegilops tauschii]
Length=414

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = +2

Query  2    YFYAPST-IKTPEAGY--NVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +F AP+T    P+A +   + +   +   +ES+W+GYVA ATDEG  ALGRRDI++ W
Sbjct  94   FFLAPTTGTSVPDAFFVLPLPSLLEEPWCRESHWMGYVAVATDEGVAALGRRDIVVAW  151



>ref|XP_007048713.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX92870.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=420

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA + +  PEA + + +   ++  +ESNWIGY+A  +DE   ALGRR+I +VW
Sbjct  85   FLYATARVSLPEA-FLLHSKSRESWDRESNWIGYIATTSDERTEALGRREIYVVW  138



>gb|AFW83434.1| hypothetical protein ZEAMMB73_348788 [Zea mays]
Length=226

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S+ + P   +  R A   A   ESNW+GYVA ATD G   LGRRDI++ W
Sbjct  111  FLYATSSARVP-GQFITRPAPPGAWSAESNWMGYVAVATDAGVARLGRRDIVVAW  164



>ref|XP_002465238.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
 gb|EER92236.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
Length=423

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 4/59 (7%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRA----ARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S ++ P+A   +       +  A  +ESNW+GYVA ATDEG   LGRRD+++ W
Sbjct  90   FVYATSGLQVPDAFLLLPQPGLQGQEPAWCRESNWMGYVAVATDEGAAELGRRDVVVAW  148



>gb|KDO40783.1| hypothetical protein CISIN_1g046292mg [Citrus sinensis]
Length=191

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 6/42 (14%)
 Frame = +2

Query  59   ARSDAVLKE------SNWIGYVAAATDEGKIALGRRDILIVW  166
            ARSD    E      S WIGYVA ATDEGK  LGRRDILI W
Sbjct  89   ARSDTDFLEWLLPDQSAWIGYVAVATDEGKAVLGRRDILISW  130



>gb|AFW74936.1| hypothetical protein ZEAMMB73_664132 [Zea mays]
Length=401

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARS--DAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  P + + +       +A  +ESNWIGYVA ATDEG   LGRRD+++ W
Sbjct  107  FVYATSALPVPGSDFPLLPLPETREAWSRESNWIGYVAVATDEGAAELGRRDVVVAW  163



>ref|XP_008655897.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=424

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGY---NVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  P+A          + +   +ESNW+GYVA ATDEG  ALGRRD+++ W
Sbjct  89   FVYATSGLHVPDAFLLLPQPALGQQEPWCRESNWMGYVAVATDEGAAALGRRDVVVAW  146



>ref|XP_008648636.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=446

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRA--ARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  P + + +       +A  +ESNWIGYVA ATDEG   LGRRD+++ W
Sbjct  118  FVYATSALPVPGSDFPLLPLPETREAWSRESNWIGYVAVATDEGAAELGRRDVVVAW  174



>ref|XP_008647947.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
 gb|ACN26514.1| unknown [Zea mays]
 gb|AFW79274.1| triacylglycerol lipase [Zea mays]
Length=402

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  80   KESNWIGYVAAATDEGKIALGRRDILIVW  166
            +ESNW+GYVA ATD+G  ALGRRDIL+ W
Sbjct  113  RESNWMGYVAVATDDGVAALGRRDILVAW  141



>emb|CBI21996.3| unnamed protein product [Vitis vinifera]
Length=483

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA + +  PEA + + +   ++  +ESNWIGY+A  TDE   A GRR+I + W
Sbjct  169  YLYATARVSVPEA-FILHSMSRESWDRESNWIGYIAVTTDEVSRARGRREIYVAW  222



>ref|NP_001151242.1| triacylglycerol lipase [Zea mays]
 gb|ACG42106.1| triacylglycerol lipase [Zea mays]
Length=402

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  80   KESNWIGYVAAATDEGKIALGRRDILIVW  166
            +ESNW+GYVA ATD+G  ALGRRDIL+ W
Sbjct  113  RESNWMGYVAVATDDGVAALGRRDILVAW  141



>gb|EMT15520.1| Feruloyl esterase A [Aegilops tauschii]
Length=663

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  80   KESNWIGYVAAATDEGKIALGRRDILIVW  166
            +E NW+GYVA ATDEG  ALGRRDI++ W
Sbjct  313  RECNWMGYVAVATDEGAAALGRRDIVVAW  341



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  P++      +R +   KESNW+GYVA   D+G   LGRRDI++ W
Sbjct  98   FLYATSQIHVPDSFLLFPVSR-EGWTKESNWMGYVAVTDDQGTAVLGRRDIVVSW  151



>gb|KDO38625.1| hypothetical protein CISIN_1g0208022mg, partial [Citrus sinensis]
Length=288

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +2

Query  65   SDAVL-KESNWIGYVAAATDEGKIALGRRDILIVW  166
            SD VL  +S WIGYVA ATDEGK  LGRRDILI W
Sbjct  96   SDWVLPDQSAWIGYVAVATDEGKTLLGRRDILISW  130



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  PE+      +R +   KESNW+GYVA   ++G   LGRRDI++ W
Sbjct  114  FLYATSQIHVPESFLLFPLSR-EGWTKESNWMGYVAVTDNQGTAVLGRRDIVVAW  167



>ref|XP_006393053.1| hypothetical protein EUTSA_v10011370mg [Eutrema salsugineum]
 gb|ESQ30339.1| hypothetical protein EUTSA_v10011370mg [Eutrema salsugineum]
Length=542

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIA-LGRRDILIVW  166
            Y YA S I  P   +  R+  S    + +NW+GYVA AT+E ++A LGRRDI+I W
Sbjct  173  YLYATSNINLPN--FFQRSKLSSIWSQHANWMGYVAVATNEEEVARLGRRDIVIAW  226



>emb|CDY34061.1| BnaC03g62710D [Brassica napus]
Length=402

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDIL  157
            + +A S I  PE+      +R +   KESNWIGYVA   D+G  ALGRRDI+
Sbjct  115  FLFATSQIHVPESFLLFPVSR-EGCTKESNWIGYVAVTDDQGTAALGRRDII  165



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S  + P+ G  +R A   A   ESNW+GYVA ATD G   LGRRD+++ W
Sbjct  105  FLYATSGARVPD-GIIMRPAPPGAWSLESNWMGYVAVATDAGAARLGRRDVVVAW  158



>ref|XP_006655614.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-II 7-like [Oryza 
brachyantha]
Length=416

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    YFYAPSTIKTPEA--GYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S +  PEA     + +    A  K SNW+GYVA ATDEG  ALGRRDI++ W
Sbjct  95   FVYATSGLPVPEAFLVLPLPSLLPPAWSKVSNWMGYVAVATDEGVAALGRRDIVVAW  151



>dbj|BAJ90094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +2

Query  68   DAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            D   +ESNW+GYVA ATDEG   LGRRDI++ W
Sbjct  68   DVWSRESNWMGYVAVATDEGAAKLGRRDIVVAW  100



>ref|XP_002281095.2| PREDICTED: phospholipase A1-IIdelta [Vitis vinifera]
Length=470

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA + +  PEA + + +   ++  +ESNWIGY+A  TDE   A GRR+I + W
Sbjct  135  YLYATARVSVPEA-FILHSMSRESWDRESNWIGYIAVTTDEVSRARGRREIYVAW  188



>gb|ABK23028.1| unknown [Picea sitchensis]
 gb|ABK23975.1| unknown [Picea sitchensis]
Length=254

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  50   VRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +++   +A  +ESNWIGYVA ATD GK  LGRR+I++ W
Sbjct  2    LKSLSREAWSRESNWIGYVAVATDRGKQRLGRREIVVAW  40



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA S I  PE+      +R +   KESNW+GYVA   D+G   LGRRDI++ W
Sbjct  100  FIYATSDIHVPESFLLFPISR-EGWSKESNWMGYVAVTDDQGTALLGRRDIVVSW  153



>emb|CDX76515.1| BnaA08g08850D [Brassica napus]
Length=398

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDIL  157
            + +A S I  PE+      +R +   KESNWIGYVA   D+G  ALGRRDI+
Sbjct  115  FLFATSQIHVPESFLLFPVSR-EGCTKESNWIGYVAVTDDQGTAALGRRDIV  165



>dbj|BAJ95995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +2

Query  68   DAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            D   +ESNW+GYVA ATDEG   LGRRDI++ W
Sbjct  143  DVWSRESNWMGYVAVATDEGAAKLGRRDIVVAW  175



>gb|EMS50696.1| Phospholipase A1-II 7 [Triticum urartu]
Length=311

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  86   SNWIGYVAAATDEGKIALGRRDILIVW  166
            SNW+GYVA ATDEG  ALGRRDI++VW
Sbjct  50   SNWMGYVAVATDEGVAALGRRDIVVVW  76



>ref|XP_009414857.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=508

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEA-GYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S +K P+    +V  +R+ +  + +NWIGYV+ + DE    LGRRDILI W
Sbjct  163  YLYATSNVKVPKFFAKSVMGSRTWS--ERANWIGYVSVSNDETTARLGRRDILIAW  216



>gb|ACJ85535.1| unknown [Medicago truncatula]
Length=435

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA + +  PEA + + +   ++  +ESNWIGY+A ++DE    LGRR+I +VW
Sbjct  106  FLYATARVSVPEA-FILHSLSRESWDRESNWIGYIAVSSDERSRELGRREIYVVW  159



>ref|XP_003607601.1| Feruloyl esterase A [Medicago truncatula]
 gb|AES89798.1| phospholipase A1 [Medicago truncatula]
Length=442

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            + YA + +  PEA + + +   ++  +ESNWIGY+A ++DE    LGRR+I +VW
Sbjct  106  FLYATARVSVPEA-FILHSLSRESWDRESNWIGYIAVSSDERSRELGRREIYVVW  159



>ref|XP_006374296.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
 gb|ERP52093.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
Length=412

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +2

Query  77   LKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +KES WIGYVA  TDEG   LGRRDIL+ W
Sbjct  101  IKESAWIGYVAVTTDEGNTVLGRRDILVCW  130



>ref|XP_003565876.1| PREDICTED: phospholipase A1-II 6-like [Brachypodium distachyon]
Length=446

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  65   SDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            S    +ESNWIGYVA AT+ GK ALGRRDI++ W
Sbjct  132  SGGGCRESNWIGYVAVATEAGKAALGRRDIVVAW  165



>ref|XP_011005460.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=412

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +2

Query  77   LKESNWIGYVAAATDEGKIALGRRDILIVW  166
            +KES WIGYVA  TDEG   LGRRDIL+ W
Sbjct  101  IKESAWIGYVAVTTDEGNTVLGRRDILVCW  130



>gb|KFK35847.1| hypothetical protein AALP_AA4G044700 [Arabis alpina]
Length=522

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIA-LGRRDILIVW  166
            Y YA S I  P   +  ++  S    + +NW+GY+A ATDE ++A LGRRDI+I W
Sbjct  165  YLYATSNINLPN--FFQKSKLSSIWSQHANWMGYIAVATDEEEVARLGRRDIVISW  218



>ref|XP_010461974.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Camelina 
sativa]
Length=524

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIA-LGRRDILIVW  166
            Y YA S I  P   +  ++  S    + +NW+GYVA ATDE +++ LGRRDI+I W
Sbjct  163  YLYATSNINLPN--FFQKSKLSSIWSQHANWMGYVAVATDEEEVSRLGRRDIVIAW  216



>ref|XP_010500719.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Camelina 
sativa]
Length=527

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIA-LGRRDILIVW  166
            Y YA S I  P   +  ++  S    + +NW+GYVA ATDE +++ LGRRDI+I W
Sbjct  166  YLYATSNINLPN--FFQKSKLSSIWSQHANWMGYVAVATDEEEVSRLGRRDIVIAW  219



>ref|XP_010102366.1| Phospholipase A1-Igamma3 [Morus notabilis]
 gb|EXB93327.1| Phospholipase A1-Igamma3 [Morus notabilis]
Length=547

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKI-ALGRRDILIVW  166
            Y YA S I  P   +  R+  S    + +NW+GYVA +TDE +I  LGRRDI+I W
Sbjct  185  YLYATSNINLPN--FFQRSKMSSVWSQHANWMGYVAVSTDEDEIRRLGRRDIVIAW  238



>ref|XP_010679169.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 31/55 (56%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIALGRRDILIVW  166
            Y YA S I  P    N R  +  +  K +NWIGYVA + DE    LGRRDI+I W
Sbjct  203  YLYATSNINLPNFFKNSRWPKVWS--KNANWIGYVAVSNDEMSKRLGRRDIIISW  255



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  80   KESNWIGYVAAATDEGKIALGRRDILIVW  166
            +E NW+GYVA ATDEG  ALGRRDI++ W
Sbjct  110  RECNWMGYVAVATDEGAAALGRRDIVVAW  138



>ref|XP_010479626.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Camelina 
sativa]
Length=523

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +2

Query  2    YFYAPSTIKTPEAGYNVRAARSDAVLKESNWIGYVAAATDEGKIA-LGRRDILIVW  166
            Y YA S I  P   +  ++  S    + +NW+GYVA ATDE +++ LGRRDI+I W
Sbjct  162  YLYATSNINLPN--FFQKSKLSSIWSQHANWMGYVAVATDEEEVSRLGRRDIVIAW  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527645914101