BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c38165_g1_i1 len=550 path=[1:0-549]

Length=550
                                                                      Score     E

ref|XP_011091067.1|  PREDICTED: calmodulin-like protein 11              250   2e-81   
ref|XP_011073471.1|  PREDICTED: calmodulin-like protein 8               249   5e-81   
ref|XP_009611663.1|  PREDICTED: calmodulin-like protein 8               248   1e-80   
ref|XP_006350654.1|  PREDICTED: calmodulin-like protein 11-like         247   3e-80   
ref|XP_004241038.1|  PREDICTED: calmodulin-like protein 8               245   1e-79   
ref|XP_009786057.1|  PREDICTED: calmodulin-like protein 8               245   2e-79   
gb|KDP40249.1|  hypothetical protein JCGZ_02247                         245   2e-79   
ref|XP_011030612.1|  PREDICTED: calmodulin-like protein 8               244   4e-79   
ref|XP_002314661.1|  calmodulin 8 family protein                        244   4e-79   Populus trichocarpa [western balsam poplar]
ref|XP_004296596.1|  PREDICTED: calmodulin-like protein 11-like i...    243   1e-78   
ref|XP_002283755.1|  PREDICTED: calmodulin-like protein 11              241   5e-78   Vitis vinifera
ref|XP_011027358.1|  PREDICTED: calmodulin-like protein 11              241   7e-78   
gb|EYU23698.1|  hypothetical protein MIMGU_mgv1a023732mg                241   8e-78   
ref|XP_010274270.1|  PREDICTED: calmodulin-like protein 11 isofor...    240   1e-77   
emb|CDO99124.1|  unnamed protein product                                240   1e-77   
ref|XP_010069415.1|  PREDICTED: calmodulin-like protein 11              240   2e-77   
ref|XP_007223678.1|  hypothetical protein PRUPE_ppa012907mg             239   3e-77   
ref|XP_002312558.1|  calmodulin family protein                          239   3e-77   Populus trichocarpa [western balsam poplar]
ref|XP_002517054.1|  calmodulin, putative                               239   3e-77   Ricinus communis
gb|AFK40401.1|  unknown                                                 239   4e-77   
ref|XP_006420057.1|  hypothetical protein CICLE_v10006151mg             239   5e-77   
gb|KHN05043.1|  Calmodulin-like protein 11                              238   6e-77   
ref|XP_007034907.1|  Calmodulin 8 isoform 1                             238   8e-77   
ref|XP_004497995.1|  PREDICTED: calmodulin-like protein 11-like         238   1e-76   
ref|XP_008341030.1|  PREDICTED: calmodulin-like protein 11 isofor...    238   1e-76   
ref|XP_008224219.1|  PREDICTED: calmodulin-like protein 11 isofor...    238   1e-76   
ref|XP_010279286.1|  PREDICTED: calmodulin-like protein 11              238   1e-76   
ref|XP_009337272.1|  PREDICTED: calmodulin-like protein 11              238   1e-76   
ref|NP_001236170.1|  uncharacterized protein LOC100500308               238   1e-76   
gb|KHN15388.1|  Calmodulin-like protein 8                               238   1e-76   
ref|NP_001236910.1|  uncharacterized protein LOC100526987               238   1e-76   
ref|XP_004495421.1|  PREDICTED: calmodulin-like protein 11-like         237   2e-76   
gb|AFK42854.1|  unknown                                                 237   3e-76   
ref|NP_001237902.1|  calmodulin                                         236   3e-76   
ref|XP_009376002.1|  PREDICTED: calmodulin-like protein 11              236   4e-76   
ref|XP_003622346.1|  Calmodulin-like protein                            236   5e-76   
gb|ABD98034.1|  calmodulin                                              236   7e-76   Striga asiatica [witchweed]
ref|XP_010274269.1|  PREDICTED: calmodulin-like protein 11 isofor...    235   1e-75   
gb|EYU41429.1|  hypothetical protein MIMGU_mgv1a021942mg                235   1e-75   
ref|XP_004134112.1|  PREDICTED: calmodulin-like protein 11-like         235   1e-75   
gb|EYU26972.1|  hypothetical protein MIMGU_mgv1a019086mg                235   1e-75   
pdb|2L1W|A  Chain A, The Solution Structure Of Soybean Calmodulin...    234   2e-75   
ref|XP_004296595.1|  PREDICTED: calmodulin-like protein 11-like i...    235   2e-75   
ref|XP_010107731.1|  Calmodulin-like protein 11                         235   2e-75   
ref|XP_002870301.1|  hypothetical protein ARALYDRAFT_330049             234   4e-75   
gb|KHN10087.1|  Calmodulin-like protein 11                              233   8e-75   
ref|XP_008391015.1|  PREDICTED: calmodulin-like protein 11 isofor...    233   1e-74   
ref|XP_006285099.1|  hypothetical protein CARUB_v10006432mg             232   2e-74   
gb|AFK43190.1|  unknown                                                 232   2e-74   
gb|KFK23666.1|  hypothetical protein AALP_AAs70636U001500               232   3e-74   
gb|AAA92677.1|  calmodulin-like protein                                 231   4e-74   Pisum sativum [garden pea]
ref|XP_007145921.1|  hypothetical protein PHAVU_007G278900g             231   4e-74   
ref|XP_010917630.1|  PREDICTED: calmodulin-like protein 11              231   4e-74   
ref|XP_008808019.1|  PREDICTED: calmodulin-like                         230   8e-74   
ref|NP_193200.1|  calmodulin-like protein 8                             230   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001238254.1|  calmodulin                                         229   2e-73   
ref|XP_010421985.1|  PREDICTED: calmodulin-like protein 8               229   2e-73   
ref|XP_008224218.1|  PREDICTED: calmodulin-like protein 8 isoform X1    229   2e-73   
ref|XP_008341029.1|  PREDICTED: calmodulin-like protein 8 isoform X1    229   2e-73   
ref|XP_006414669.1|  hypothetical protein EUTSA_v10026490mg             228   6e-73   
ref|XP_010450019.1|  PREDICTED: calmodulin-like protein 8               228   6e-73   
ref|XP_006406114.1|  hypothetical protein EUTSA_v10021692mg             228   8e-73   
ref|XP_010435099.1|  PREDICTED: calmodulin-like protein 8               228   9e-73   
ref|XP_010440420.1|  PREDICTED: calmodulin-like protein 8               228   1e-72   
emb|CDY40824.1|  BnaC01g31320D                                          228   1e-72   
ref|XP_009145249.1|  PREDICTED: calmodulin-like protein 11              225   1e-71   
ref|XP_009596618.1|  PREDICTED: calmodulin-like protein 8               224   3e-71   
ref|XP_008391014.1|  PREDICTED: calmodulin-2/4-like isoform X1          224   3e-71   
gb|ABG74924.1|  calmodulin                                              223   6e-71   Aegiceras corniculatum
emb|CDY10686.1|  BnaA05g16760D                                          223   1e-70   
ref|XP_009108537.1|  PREDICTED: calmodulin-like protein 8               223   1e-70   
ref|XP_009766879.1|  PREDICTED: calmodulin-like protein 8               222   1e-70   
emb|CDY34215.1|  BnaA01g24320D                                          223   1e-70   
ref|XP_009380569.1|  PREDICTED: calmodulin-like                         224   1e-70   
ref|NP_188933.1|  calmodulin-like protein 11                            223   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004302046.1|  PREDICTED: calmodulin-like protein 11-like i...    221   4e-70   
gb|AAX31386.1|  calmodulin                                              221   5e-70   Aegiceras corniculatum
ref|XP_009408507.1|  PREDICTED: calmodulin-like protein 11              221   6e-70   
ref|XP_011080472.1|  PREDICTED: calmodulin                              221   6e-70   
ref|XP_003624801.1|  Calmodulin                                         221   6e-70   
ref|NP_001042747.1|  Os01g0279300                                       221   6e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006298722.1|  hypothetical protein CARUB_v10014817mg             221   7e-70   
ref|XP_004251248.1|  PREDICTED: calmodulin                              221   7e-70   
sp|O82018.3|CALM_MOUSC  RecName: Full=Calmodulin; Short=CaM             220   7e-70   Mougeotia scalaris
ref|NP_001275359.1|  calmodulin-5/6/7/8                                 220   8e-70   
ref|XP_004142655.1|  PREDICTED: calmodulin-like isoform 1               220   8e-70   
ref|XP_001765847.1|  predicted protein                                  220   9e-70   
gb|ABK21927.1|  unknown                                                 220   9e-70   Picea sitchensis
gb|AFA89861.2|  calmodulin 1                                            220   1e-69   
gb|AEG75427.1|  calmodulin                                              220   1e-69   
ref|XP_008798212.1|  PREDICTED: calmodulin                              219   2e-69   
ref|XP_010511906.1|  PREDICTED: calmodulin-like protein 11              219   2e-69   
emb|CDY06478.1|  BnaC06g11660D                                          219   2e-69   
sp|A2WNH1.2|CALM3_ORYSI  RecName: Full=Calmodulin-3; Short=CaM-3        219   2e-69   Oryza sativa Indica Group [Indian rice]
dbj|BAF31994.1|  putative calmodulin                                    219   2e-69   Cryptomeria japonica
ref|XP_004249098.1|  PREDICTED: calmodulin                              219   2e-69   
ref|XP_001763057.1|  predicted protein                                  219   2e-69   
ref|XP_007202636.1|  hypothetical protein PRUPE_ppa012070mg             220   2e-69   
ref|XP_009398373.1|  PREDICTED: calmodulin-like isoform X2              219   3e-69   
ref|XP_010243681.1|  PREDICTED: calmodulin-like                         219   3e-69   
ref|XP_009120715.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin         219   3e-69   
ref|XP_003567308.1|  PREDICTED: calmodulin-3                            219   3e-69   
dbj|BAA94696.1|  calmodulin                                             219   3e-69   Chara corallina
ref|XP_006854084.1|  hypothetical protein AMTR_s00048p00127800          219   3e-69   
ref|XP_010553894.1|  PREDICTED: calmodulin-7-like                       219   4e-69   
ref|XP_006369409.1|  calmodulin-like protein 6a                         219   4e-69   
ref|XP_010936850.1|  PREDICTED: calmodulin                              219   4e-69   
ref|XP_009150282.1|  PREDICTED: calmodulin-like                         219   4e-69   
ref|XP_002507130.1|  calmodulin                                         219   4e-69   Micromonas commoda
gb|AFK45794.1|  unknown                                                 218   4e-69   
ref|XP_009417893.1|  PREDICTED: calmodulin-3                            218   4e-69   
emb|CDY30947.1|  BnaA06g19660D                                          221   5e-69   
ref|XP_009419686.1|  PREDICTED: calmodulin-like                         218   5e-69   
ref|XP_003056131.1|  calmodulin                                         218   5e-69   
ref|XP_003632230.1|  PREDICTED: calmodulin-7 isoform X1                 219   5e-69   
ref|XP_009402452.1|  PREDICTED: calmodulin                              218   5e-69   
gb|ABG82015.1|  calmodulin                                              218   5e-69   Vigna radiata var. radiata [golden gram]
tpg|DAA45101.1|  TPA: calmodulin3                                       218   5e-69   
gb|AAQ63461.1|  calmodulin 4                                            218   6e-69   Daucus carota [carrots]
gb|ABR21756.1|  calmodulin                                              218   7e-69   Actinidia polygama
ref|XP_001760060.1|  predicted protein                                  218   7e-69   
gb|ADK23955.1|  calmodulin                                              218   7e-69   
gb|ABR21759.1|  calmodulin                                              218   7e-69   Actinidia deliciosa var. chlorocarpa
ref|NP_176814.1|  calmodulin 4                                          218   7e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KDP45998.1|  hypothetical protein JCGZ_14905                         219   8e-69   
emb|CAA62150.1|  Calmodulin                                             218   8e-69   Physcomitrella patens
ref|XP_004252866.2|  PREDICTED: LOW QUALITY PROTEIN: calmodulin         219   8e-69   
emb|CDX77060.1|  BnaC04g38550D                                          219   8e-69   
gb|ABK23242.1|  unknown                                                 218   8e-69   Picea sitchensis
ref|XP_009782644.1|  PREDICTED: calmodulin-7-like isoform X1            219   8e-69   
ref|XP_002963446.1|  hypothetical protein SELMODRAFT_141966             218   8e-69   
ref|XP_008811949.1|  PREDICTED: calmodulin-7 isoform X1                 219   8e-69   
gb|ABR21718.1|  calmodulin                                              218   8e-69   Actinidia melliana
gb|AAL79908.1|AF474074_1  calmodulin                                    218   8e-69   Stevia rebaudiana
ref|XP_009140755.1|  PREDICTED: calmodulin-7-like                       219   9e-69   
gb|KFK26360.1|  hypothetical protein AALP_AA8G238300                    218   9e-69   
ref|XP_009782645.1|  PREDICTED: calmodulin-7-like isoform X2            219   9e-69   
gb|ACL13151.1|  calmodulin 1                                            218   9e-69   Capsicum annuum
gb|ADT89773.1|  calmodulin                                              218   9e-69   
emb|CDX92965.1|  BnaA03g36870D                                          218   9e-69   
ref|XP_008364032.1|  PREDICTED: calmodulin-like                         218   1e-68   
ref|XP_010645766.1|  PREDICTED: calmodulin                              218   1e-68   
gb|ABR21725.1|  calmodulin                                              218   1e-68   Clematoclethra scandens subsp. tomentella
ref|XP_009410443.1|  PREDICTED: calmodulin-3-like                       218   1e-68   
gb|AAM34757.1|AF510075_1  calmodulin 1                                  218   1e-68   Ceratopteris richardii
ref|XP_010069460.1|  PREDICTED: calmodulin                              218   1e-68   
emb|CAA61980.1|  Calmodulin                                             218   1e-68   Bidens pilosa [beggar-ticks]
ref|XP_006374229.1|  calmodulin-like protein 6a                         217   1e-68   
gb|KHN34595.1|  Calmodulin                                              217   1e-68   
ref|XP_004299498.1|  PREDICTED: calmodulin-like                         217   1e-68   
ref|NP_001236109.1|  uncharacterized protein LOC100527439               217   1e-68   
sp|P27164.2|CALM3_PETHY  RecName: Full=Calmodulin-related protein       218   1e-68   Petunia x hybrida [garden petunia]
ref|NP_001049948.1|  Os03g0319300                                       217   1e-68   Oryza sativa Japonica Group [Japonica rice]
gb|ACB32228.1|  calmodulin                                              217   1e-68   Beta vulgaris [beet]
ref|NP_001105547.1|  calmodulin2                                        217   1e-68   Zea mays [maize]
ref|XP_010271350.1|  PREDICTED: calmodulin                              217   1e-68   
gb|ACU22802.1|  unknown                                                 217   1e-68   Glycine max [soybeans]
gb|ACG63497.1|  TCH                                                     217   1e-68   Ipomoea batatas [batate]
ref|XP_006378996.1|  hypothetical protein POPTR_0009s02660g             218   1e-68   
emb|CBI24333.3|  unnamed protein product                                217   1e-68   
ref|XP_009105204.1|  PREDICTED: calmodulin-1                            217   1e-68   
ref|XP_010551920.1|  PREDICTED: calmodulin-7-like                       217   1e-68   
emb|CAC84562.1|  putative calmodulin                                    217   1e-68   Solanum commersonii
ref|NP_189967.1|  calmodulin 7                                          217   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AFA89864.1|  calmodulin 4                                            217   1e-68   
gb|ABR21750.1|  calmodulin                                              217   2e-68   Actinidia melliana
ref|XP_007015563.1|  Calmodulin 5                                       218   2e-68   
gb|KDO66347.1|  hypothetical protein CISIN_1g0446441mg                  217   2e-68   
gb|ADY38663.1|  calmodulin-related protein CAM53                        217   2e-68   
ref|XP_002154349.2|  PREDICTED: calmodulin-like isoform 1               217   2e-68   
gb|KDP23657.1|  hypothetical protein JCGZ_23490                         217   2e-68   
ref|XP_010271115.1|  PREDICTED: calmodulin-like                         217   2e-68   
emb|CAH57706.1|  calmodulin                                             217   2e-68   Quercus petraea [durmast oak]
tpg|DAA41801.1|  TPA: calmodulin                                        218   2e-68   
ref|XP_003632229.1|  PREDICTED: calmodulin-7 isoform X2                 217   2e-68   
ref|XP_009391621.1|  PREDICTED: calmodulin                              217   2e-68   
gb|ABH12274.1|  calmodulin                                              217   2e-68   Betula halophila
gb|AAW02790.1|  calmodulin 2                                            217   2e-68   Codonopsis lanceolata
ref|XP_006446396.1|  hypothetical protein CICLE_v10016866mg             218   2e-68   
ref|XP_009135834.1|  PREDICTED: calmodulin-like protein 11              217   2e-68   
ref|XP_006292807.1|  hypothetical protein CARUB_v10019058mg             219   2e-68   
gb|EYU24499.1|  hypothetical protein MIMGU_mgv1a015687mg                216   2e-68   
gb|AFK42827.1|  unknown                                                 216   2e-68   
ref|XP_004144099.1|  PREDICTED: calmodulin-related protein-like         216   2e-68   
gb|ACG31089.1|  calmodulin                                              216   2e-68   Zea mays [maize]
gb|ABK94169.1|  unknown                                                 216   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_009404694.1|  PREDICTED: calmodulin-like                         216   2e-68   
ref|NP_001055907.1|  Os05g0491100                                       216   3e-68   Oryza sativa Japonica Group [Japonica rice]
gb|ABD60149.1|  calmodulin                                              216   3e-68   Vigna unguiculata
ref|XP_010417845.1|  PREDICTED: calmodulin-5 isoform X1                 218   3e-68   
gb|AAF73157.1|AF150059_1  calmodulin                                    216   3e-68   Brassica napus [oilseed rape]
ref|XP_010510825.1|  PREDICTED: calmodulin-5-like                       218   3e-68   
ref|XP_002317717.1|  calmodulin-like protein 6a                         216   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_004287204.1|  PREDICTED: calmodulin-related protein-like         216   3e-68   
gb|AAT73623.1|  calmodulin cam-210                                      216   3e-68   Daucus carota [carrots]
gb|AFW78488.1|  calmodulin1                                             218   3e-68   
gb|ABR21729.1|  calmodulin                                              216   3e-68   Actinidia melliana
ref|XP_001758487.1|  predicted protein                                  216   3e-68   
ref|NP_001275042.1|  calmodulin-1                                       216   3e-68   
ref|XP_006408585.1|  hypothetical protein EUTSA_v10002103mg             217   3e-68   
ref|NP_001167666.1|  calmodulin                                         216   3e-68   Zea mays [maize]
ref|NP_001234786.1|  calmodulin                                         216   3e-68   
gb|ABN79277.1|  calmodulin                                              216   3e-68   Noccaea caerulescens
ref|NP_850097.1|  calmodulin 5                                          217   3e-68   Arabidopsis thaliana [mouse-ear cress]
gb|ABR21762.1|  calmodulin                                              216   3e-68   Actinidia eriantha f. alba
gb|ABR21711.1|  calmodulin                                              216   3e-68   Actinidia deliciosa var. chlorocarpa
ref|XP_002885531.1|  hypothetical protein ARALYDRAFT_479802             216   3e-68   
gb|AAA16320.1|  calmodulin                                              216   4e-68   Bryonia dioica
emb|CAA78057.1|  calmodulin                                             216   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008810798.1|  PREDICTED: calmodulin-7-like                       216   4e-68   
emb|CAH57708.1|  calmodulin                                             216   4e-68   Quercus petraea [durmast oak]
emb|CAA67054.1|  calmodulin-2                                           216   4e-68   Capsicum annuum
gb|ABR21708.1|  calmodulin                                              216   4e-68   Actinidia chinensis
ref|XP_002879035.1|  calmodulin-2                                       217   4e-68   
gb|ABR21767.1|  calmodulin                                              216   4e-68   Actinidia kolomikta [miyama-mata-tabi]
gb|ACT53872.1|  calmodulin                                              216   4e-68   Saccharum officinarum [noble cane]
gb|AAT73614.1|  calmodulin cam-201                                      216   4e-68   Daucus carota [carrots]
gb|AGZ84228.1|  calmodulin                                              216   5e-68   
emb|CDY55678.1|  BnaC06g43530D                                          216   5e-68   
gb|ACF84469.1|  unknown                                                 216   5e-68   Zea mays [maize]
gb|KFK39574.1|  hypothetical protein AALP_AA3G262000                    216   5e-68   
gb|ABR21746.1|  calmodulin                                              216   5e-68   Actinidia valvata
ref|XP_010488327.1|  PREDICTED: calmodulin-like protein 11              216   5e-68   
ref|XP_011073165.1|  PREDICTED: calmodulin                              216   5e-68   
ref|NP_850860.1|  calmodulin 6                                          216   5e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466587.1|  PREDICTED: calmodulin-like protein 11              216   5e-68   
ref|NP_001105490.1|  calmodulin                                         216   5e-68   Zea mays [maize]
gb|AAT73616.1|  calmodulin cam-203                                      216   6e-68   Daucus carota [carrots]
ref|XP_009123275.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin         216   6e-68   
gb|EMS51119.1|  Calmodulin                                              216   6e-68   
gb|ABR21744.1|  calmodulin                                              216   6e-68   Actinidia deliciosa var. deliciosa
gb|ABR21761.1|  calmodulin                                              216   6e-68   Actinidia eriantha f. alba
ref|NP_180271.1|  calmodulin 5                                          216   6e-68   Arabidopsis thaliana [mouse-ear cress]
gb|ABR21741.1|  calmodulin                                              215   6e-68   Actinidia deliciosa var. chlorocarpa
sp|P27163.2|CALM2_PETHY  RecName: Full=Calmodulin-2; Short=CaM-2        215   7e-68   Petunia x hybrida [garden petunia]
ref|NP_001238237.1|  calmodulin                                         215   7e-68   
ref|XP_001755625.1|  predicted protein                                  215   7e-68   
gb|ABR21719.1|  calmodulin                                              215   7e-68   Actinidia kolomikta [miyama-mata-tabi]
ref|XP_007323358.1|  hypothetical protein SERLADRAFT_401260             215   7e-68   
ref|XP_006294957.1|  hypothetical protein CARUB_v10024013mg             218   7e-68   
gb|ACR15761.1|  calmodulin isoform 1                                    215   7e-68   Solanum tuberosum [potatoes]
gb|ABK21279.1|  unknown                                                 215   8e-68   Picea sitchensis
ref|XP_006295105.1|  hypothetical protein CARUB_v10024180mg             216   8e-68   
pdb|3WFN|B  Chain B, Crystal Structure Of Nav1.6 Iq Motif In Comp...    216   8e-68   
pir||S58314  calmodulin - moss (Physcomitrella patens)                  215   8e-68
ref|XP_007209738.1|  hypothetical protein PRUPE_ppa012922mg             215   8e-68   
gb|AAT73618.1|  calmodulin cam-205                                      215   8e-68   Daucus carota [carrots]
gb|ABR21709.1|  calmodulin                                              215   8e-68   Actinidia chinensis
gb|AAT73609.1|  calmodulin                                              215   9e-68   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006849452.1|  hypothetical protein AMTR_s00024p00073390          218   9e-68   
ref|XP_004493280.1|  PREDICTED: family of serine hydrolases 3-like      223   1e-67   
gb|AAD34242.1|AF084394_1  calmodulin mutant SYNCAM10                    215   1e-67   
gb|ABR21731.1|  calmodulin                                              215   1e-67   Actinidia sabiifolia
ref|XP_010673215.1|  PREDICTED: calmodulin                              215   1e-67   
sp|P04353.2|CALM_SPIOL  RecName: Full=Calmodulin; Short=CaM             215   1e-67   Spinacia oleracea
gb|AAC16663.1|  calmodulin                                              215   1e-67   Apium graveolens
ref|XP_009393093.1|  PREDICTED: calmodulin-like                         215   1e-67   
ref|XP_008791135.1|  PREDICTED: calmodulin-like protein 8               215   1e-67   
ref|XP_009405855.1|  PREDICTED: calmodulin                              214   1e-67   
emb|CDX99690.1|  BnaC04g34470D                                          214   1e-67   
ref|XP_009388516.1|  PREDICTED: calmodulin-like protein 8               214   1e-67   
gb|AAD10245.1|  calmodulin                                              214   1e-67   Phaseolus vulgaris [French bean]
gb|AAT73619.1|  calmodulin cam-206                                      214   1e-67   Daucus carota [carrots]
sp|P13868.2|CALM1_SOLTU  RecName: Full=Calmodulin-1; Short=CaM-1        214   1e-67   Solanum tuberosum [potatoes]
sp|Q8X187.3|CALM_PAXIN  RecName: Full=Calmodulin; Short=CaM             214   1e-67   Paxillus involutus
gb|ABR21730.1|  calmodulin                                              214   2e-67   Actinidia kolomikta [miyama-mata-tabi]
ref|XP_009107793.1|  PREDICTED: calmodulin-like protein 8 isoform X2    214   2e-67   
ref|XP_010521595.1|  PREDICTED: calmodulin                              215   2e-67   
gb|ABR21728.1|  calmodulin                                              214   2e-67   Actinidia deliciosa var. chlorocarpa
tpg|DAA64211.1|  TPA: calmodulin                                        220   2e-67   
emb|CCA71197.1|  probable Calmodulin                                    214   2e-67   
gb|ABA27137.1|  calmodulin 1                                            214   2e-67   Catharanthus roseus [chatas]
gb|AFK42378.1|  unknown                                                 214   2e-67   
ref|XP_003799587.1|  PREDICTED: calmodulin-like                         214   2e-67   
ref|XP_008375032.1|  PREDICTED: calmodulin-like                         214   2e-67   
ref|XP_009398372.1|  PREDICTED: calmodulin-like isoform X1              214   2e-67   
gb|AAR99409.1|  calmodulin                                              214   2e-67   Arachis hypogaea [goober]
pdb|1XFU|O  Chain O, Crystal Structure Of Anthrax Edema Factor (e...    214   3e-67   
ref|XP_008393461.1|  PREDICTED: calmodulin                              214   3e-67   
gb|AFY26192.1|  calmodulin-1                                            214   3e-67   
emb|CDM84638.1|  unnamed protein product                                214   3e-67   
gb|AAQ20043.1|  calmodulin                                              214   3e-67   
gb|ABK22713.1|  unknown                                                 214   3e-67   
gb|AAS78755.1|  calmodulin                                              214   3e-67   
sp|P48976.2|CALM_MALDO  RecName: Full=Calmodulin; Short=CaM             214   3e-67   
sp|P04464.3|CALM_WHEAT  RecName: Full=Calmodulin; Short=CaM             214   3e-67   
gb|KDQ52197.1|  hypothetical protein JAAARDRAFT_40314                   214   3e-67   
ref|XP_007306904.1|  calmodulin                                         214   3e-67   
ref|XP_006838912.1|  hypothetical protein AMTR_s00002p00269730          214   3e-67   
gb|AAT73620.1|  caomodulin cam-207                                      214   3e-67   
ref|XP_010966045.1|  PREDICTED: calmodulin                              217   3e-67   
emb|CAA66159.1|  calmodulin-1                                           214   4e-67   
gb|ACH46218.1|  putative calmodulin variant 1                           213   4e-67   
ref|NP_001104289.1|  calmodulin                                         213   4e-67   
gb|AAR99412.1|  calmodulin                                              213   4e-67   
ref|NP_001105455.1|  calmodulin                                         213   4e-67   
ref|NP_001159980.1|  calmodulin                                         213   4e-67   
ref|XP_760057.1|  calmodulin                                            213   4e-67   
ref|XP_008491074.1|  PREDICTED: calmodulin                              216   4e-67   
ref|XP_009116373.1|  PREDICTED: calmodulin-5                            213   4e-67   
sp|P02594.2|CALM_ELEEL  RecName: Full=Calmodulin; Short=CaM             213   4e-67   
gb|ETE70432.1|  Calmodulin                                              214   5e-67   
gb|AIL24126.1|  calmodulin 2                                            214   5e-67   
ref|XP_010710170.1|  PREDICTED: calmodulin                              213   5e-67   
sp|P11120.2|CALM_PLECO  RecName: Full=Calmodulin; Short=CaM             213   5e-67   
ref|NP_001104884.1|  calmodulin                                         213   5e-67   
ref|XP_005933937.1|  PREDICTED: calmodulin-like                         216   5e-67   
ref|XP_006799422.1|  PREDICTED: calmodulin-like                         215   5e-67   
ref|XP_004559359.1|  PREDICTED: calmodulin-like                         216   5e-67   
ref|NP_001103834.1|  neo-calmodulin                                     213   5e-67   
ref|NP_001105459.1|  calmodulin                                         213   5e-67   
sp|O94739.3|CALM_PLEOS  RecName: Full=Calmodulin; Short=CaM             213   6e-67   
ref|XP_005383080.1|  PREDICTED: calmodulin-like                         213   6e-67   
ref|XP_005738790.1|  PREDICTED: calmodulin-like                         215   6e-67   
gb|ELU15623.1|  hypothetical protein CAPTEDRAFT_154562                  213   6e-67   
ref|XP_006678916.1|  calmodulin                                         214   6e-67   
gb|AAD34415.1|AF084431_1  calmodulin mutant SYNCAM9                     213   6e-67   
ref|XP_003802733.1|  PREDICTED: calmodulin-like                         213   6e-67   
ref|XP_009647645.1|  PREDICTED: calmodulin                              214   6e-67   
emb|CDY27651.1|  BnaUnng00010D                                          213   6e-67   
gb|ADO29032.1|  calmodulin                                              213   7e-67   
ref|XP_009056065.1|  hypothetical protein LOTGIDRAFT_216228             213   7e-67   
gb|ABK22644.1|  unknown                                                 213   7e-67   
ref|XP_010935758.1|  PREDICTED: neo-calmodulin-like                     213   7e-67   
gb|AAT09075.1|  calmodulin                                              213   8e-67   
ref|XP_009056061.1|  hypothetical protein LOTGIDRAFT_216207             213   8e-67   
ref|XP_007363432.1|  calmodulin                                         213   9e-67   
ref|XP_009419782.1|  PREDICTED: calmodulin-like protein 11              213   9e-67   
tpg|DAA64212.1|  TPA: calmodulin                                        221   9e-67   
ref|XP_009702107.1|  PREDICTED: calmodulin-like                         214   1e-66   
gb|AAA72492.1|  VU1 calmodulin                                          212   1e-66   
pdb|2YGG|B  Chain B, Complex Of Cambr And Cam                           212   1e-66   
pdb|2WEL|D  Chain D, Crystal Structure Of Su6656-Bound CalciumCAL...    212   1e-66   
ref|NP_001734.1|  calmodulin                                            212   1e-66   
ref|XP_002461247.1|  hypothetical protein SORBIDRAFT_02g043510          221   1e-66   
gb|EMP25763.1|  Calmodulin                                              213   1e-66   
ref|XP_010126793.1|  PREDICTED: calmodulin                              213   1e-66   
ref|XP_006122412.1|  PREDICTED: calmodulin                              212   1e-66   
ref|XP_003976021.1|  PREDICTED: calmodulin-like                         212   1e-66   
gb|AAD34409.1|AF084425_1  calmodulin mutant SYNCAM5                     212   1e-66   
ref|XP_004958754.1|  PREDICTED: UPF0483 protein AGAP003155-like         220   1e-66   
pdb|4DJC|A  Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-...    212   1e-66   
emb|CAH91909.1|  hypothetical protein                                   212   1e-66   
gb|EPQ02469.1|  Calmodulin                                              213   1e-66   
ref|NP_001148310.1|  calmodulin                                         212   1e-66   
gb|ABN71532.1|  calmodulin                                              212   1e-66   
ref|XP_004797282.1|  PREDICTED: calmodulin                              213   1e-66   
gb|ACY00391.1|  calmodulin                                              212   1e-66   
ref|XP_005483194.1|  PREDICTED: calmodulin                              213   1e-66   
pdb|2BE6|A  Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Dom...    212   1e-66   
gb|ADV17372.1|  calmodulin                                              212   1e-66   
ref|NP_001044583.1|  Os01g0810300                                       213   1e-66   
dbj|GAA95920.1|  hypothetical protein E5Q_02578                         212   1e-66   
ref|XP_003770562.1|  PREDICTED: calmodulin-like                         213   1e-66   
gb|AAL87099.1|AF466266_1  calmodulin                                    212   1e-66   
gb|EPQ10746.1|  Calmodulin                                              213   1e-66   
gb|AAX37095.1|  calmodulin 2                                            212   1e-66   
ref|XP_007397964.1|  hypothetical protein PHACADRAFT_259505             212   1e-66   
dbj|BAE26689.1|  unnamed protein product                                214   1e-66   
gb|ETK82424.1|  calmodulin                                              214   1e-66   
pdb|4HEX|A  Chain A, A Novel Conformation Of Calmodulin                 212   2e-66   
ref|XP_005068466.1|  PREDICTED: calmodulin isoform X1                   213   2e-66   
emb|CBY09922.1|  unnamed protein product                                212   2e-66   
ref|XP_002984822.1|  hypothetical protein SELMODRAFT_181303             212   2e-66   
sp|Q9GRJ1.3|CALM_LUMRU  RecName: Full=Calmodulin; Short=CaM             212   2e-66   
ref|XP_001638581.1|  predicted protein                                  212   2e-66   
ref|XP_005836584.1|  hypothetical protein GUITHDRAFT_151413             212   2e-66   
sp|P21251.2|CALM_STIJA  RecName: Full=Calmodulin; Short=CaM             212   2e-66   
ref|XP_009559595.1|  PREDICTED: calmodulin                              212   2e-66   
ref|XP_002998616.1|  calmodulin                                         212   2e-66   
gb|AAD34436.1|AF084452_1  calmodulin mutant SYNCAM33                    212   2e-66   
gb|AAW27335.1|  unknown                                                 212   2e-66   
gb|EMD36290.1|  hypothetical protein CERSUDRAFT_95628                   212   2e-66   
gb|AAW24912.1|  unknown                                                 212   2e-66   
ref|XP_005549624.1|  PREDICTED: calmodulin-like                         212   2e-66   
gb|ADP20511.1|  calmodulin isoform 3                                    212   2e-66   
ref|XP_010986526.1|  PREDICTED: calmodulin                              215   2e-66   
ref|XP_004993230.1|  calmodulin                                         212   2e-66   
gb|AAD34426.1|AF084442_1  calmodulin mutant SYNCAM14                    212   2e-66   
ref|XP_007388040.1|  calmodulin                                         212   2e-66   
ref|NP_001271970.1|  uncharacterized protein LOC101865168               211   2e-66   
sp|Q9HFY6.3|CALM_BLAEM  RecName: Full=Calmodulin; Short=CaM             211   2e-66   
gb|EPT04782.1|  hypothetical protein FOMPIDRAFT_1021634                 211   2e-66   
gb|ACF79629.1|  unknown                                                 220   2e-66   
gb|KFO18269.1|  Calmodulin                                              213   2e-66   
sp|A8I1Q0.1|CALM_HETTR  RecName: Full=Calmodulin; Short=CaM             211   2e-66   
gb|ADP36946.1|  hypothetical protein                                    211   2e-66   
gb|AAD34265.1|AF084417_1  calmodulin mutant SYNCAM62                    211   2e-66   
gb|AAD34266.1|AF084418_1  calmodulin mutant SYNCAM63A                   211   2e-66   
sp|Q40302.3|CALM_MACPY  RecName: Full=Calmodulin; Short=CaM             211   2e-66   
gb|AAD34408.1|AF084424_1  calmodulin mutant SYNCAM3                     211   2e-66   
ref|XP_008921934.1|  PREDICTED: calmodulin                              219   3e-66   
sp|P11118.2|CALM_EUGGR  RecName: Full=Calmodulin; Short=CaM             211   3e-66   
dbj|BAE89379.1|  unnamed protein product                                211   3e-66   
gb|ABS12106.1|  calmodulin 1                                            211   3e-66   
ref|XP_005416368.1|  PREDICTED: calmodulin                              212   3e-66   
ref|XP_007876394.1|  hypothetical protein PFL1_00701                    211   3e-66   
ref|XP_003766688.1|  PREDICTED: calmodulin-like                         212   3e-66   
pdb|2F2O|A  Chain A, Structure Of Calmodulin Bound To A Calcineur...    212   3e-66   
gb|ACH46245.1|  putative calmodulin variant 3                           211   3e-66   
ref|XP_006432945.1|  hypothetical protein CICLE_v10003695mg             211   3e-66   
ref|XP_002473838.1|  calmodulin                                         211   3e-66   
ref|XP_004302047.1|  PREDICTED: calmodulin-like protein 11-like i...    211   3e-66   
ref|XP_003758346.1|  PREDICTED: calmodulin-like                         212   3e-66   
emb|CDQ92434.1|  unnamed protein product                                212   3e-66   
ref|XP_009284610.1|  PREDICTED: calmodulin                              213   3e-66   
ref|XP_010392081.1|  PREDICTED: calmodulin                              212   3e-66   
ref|XP_005242003.1|  PREDICTED: calmodulin                              216   3e-66   
sp|Q40642.1|CML1_ORYSI  RecName: Full=Calmodulin-like protein 1; ...    213   3e-66   
gb|AAD34430.1|AF084446_1  calmodulin mutant SYNCAM36                    211   3e-66   
ref|XP_004710659.1|  PREDICTED: calmodulin                              212   3e-66   
gb|EHB18285.1|  Calmodulin                                              213   3e-66   
ref|XP_006941193.1|  PREDICTED: probable calcium-binding protein ...    218   3e-66   
gb|AAD34243.1|AF084395_1  calmodulin mutant SYNCAM11                    211   3e-66   
ref|XP_641695.1|  hypothetical protein DDB_G0279407                     211   3e-66   
ref|XP_006909678.1|  PREDICTED: calmodulin isoform X1                   211   3e-66   
gb|AAD34435.1|AF084451_1  calmodulin mutant SYNCAM32                    211   3e-66   
pdb|4E50|A  Chain A, Calmodulin And Ng Peptide Complex                  212   3e-66   
gb|AAD34259.1|AF084411_1  calmodulin mutant SYNCAM57A                   211   3e-66   
ref|XP_009494169.1|  calmodulin                                         211   3e-66   
ref|XP_005605456.1|  PREDICTED: calmodulin                              211   3e-66   
gb|AAC61858.1|  calmodulin mutant SYNCAM28                              211   3e-66   
gb|AAC61859.1|  calmodulin mutant SYNCAM29                              211   3e-66   
gb|AAD34433.1|AF084449_1  calmodulin mutant SYNCAM26                    211   3e-66   
gb|AAD34257.1|AF084409_1  calmodulin mutant SYNCAM55                    211   3e-66   
gb|AAD34421.1|AF084437_1  calmodulin mutant SYNCAM44                    211   3e-66   
gb|AAD34419.1|AF084435_1  calmodulin mutant SYNCAM39                    211   3e-66   
gb|AAD34422.1|AF084438_1  calmodulin mutant SYNCAM45                    211   3e-66   
gb|AHA51309.1|  EF-hand_1 domain-containing protein                     211   4e-66   
gb|ACI15835.1|  calmodulin                                              211   4e-66   
ref|XP_005888468.1|  PREDICTED: calmodulin-like                         211   4e-66   
gb|ABR21716.1|  calmodulin                                              211   4e-66   
pdb|4E53|A  Chain A, Calmodulin And Nm Peptide Complex                  212   4e-66   
sp|A4UHC0.1|CALM_ALEFU  RecName: Full=Calmodulin; Short=CaM             211   4e-66   
ref|XP_006627766.1|  PREDICTED: calcium-binding protein 1-like          221   4e-66   
dbj|BAE41271.1|  unnamed protein product                                211   4e-66   
gb|AAD34260.1|AF084412_1  calmodulin mutant SYNCAM57B                   211   4e-66   
ref|XP_010996006.1|  PREDICTED: calmodulin                              213   4e-66   
gb|AAA32765.1|  calmodulin-3                                            211   4e-66   
ref|XP_006839639.1|  PREDICTED: calmodulin                              211   4e-66   
ref|XP_005889388.1|  PREDICTED: calmodulin-like                         211   4e-66   
dbj|BAB28959.1|  unnamed protein product                                211   4e-66   
sp|Q7T3T2.3|CALM_EPIAK  RecName: Full=Calmodulin; Short=CaM             211   4e-66   
ref|XP_004633140.1|  PREDICTED: calmodulin-like                         211   5e-66   
ref|XP_009581738.1|  PREDICTED: calmodulin                              212   5e-66   
gb|ELW48699.1|  Calmodulin                                              213   5e-66   
ref|XP_004881286.1|  PREDICTED: calmodulin                              212   5e-66   
ref|XP_006125555.1|  PREDICTED: calmodulin-like isoform X2              211   5e-66   
gb|EHB02604.1|  Calmodulin                                              215   5e-66   
ref|NP_001290903.1|  calmodulin 2 (phosphorylase kinase, delta)         211   5e-66   
ref|XP_004607860.1|  PREDICTED: calmodulin                              212   5e-66   
gb|AAR99410.1|  calmodulin                                              211   5e-66   
ref|XP_005438974.1|  PREDICTED: calmodulin                              212   5e-66   
gb|EHB00855.1|  Calmodulin                                              212   5e-66   
ref|XP_001113485.1|  PREDICTED: calmodulin-like isoform 4               211   5e-66   
ref|XP_002367258.1|  calmodulin                                         211   5e-66   
ref|XP_005724908.1|  PREDICTED: calmodulin-like isoform X1              212   5e-66   
ref|XP_009762209.1|  PREDICTED: calmodulin-7-like                       211   5e-66   
ref|XP_003277701.2|  PREDICTED: calmodulin                              211   5e-66   
ref|NP_001270011.1|  calmodulin 2 (phosphorylase kinase, delta)         211   5e-66   
gb|AAD34412.1|AF084428_1  calmodulin mutant SYNCAM60                    211   5e-66   
gb|AAD34413.1|AF084429_1  calmodulin mutant SYNCAM61                    211   5e-66   
gb|AAD34425.1|AF084441_1  calmodulin mutant SYNCAM13                    211   5e-66   
ref|XP_008119752.1|  PREDICTED: calmodulin                              213   5e-66   
ref|XP_010585228.1|  PREDICTED: calmodulin                              214   5e-66   
emb|CCD82978.1|  putative calmodulin                                    212   5e-66   
gb|KFO26283.1|  Calmodulin                                              211   5e-66   
ref|XP_003787945.1|  PREDICTED: calmodulin-like isoform 3               211   5e-66   
gb|AAD34261.1|AF084413_1  calmodulin mutant SYNCAM57C                   211   5e-66   
gb|AAD34262.1|AF084414_1  calmodulin mutant SYNCAM57D                   211   5e-66   
gb|AAD34258.1|AF084410_1  calmodulin mutant SYNCAM56                    211   5e-66   
ref|XP_009951281.1|  PREDICTED: calmodulin-A                            211   5e-66   
emb|CDQ64500.1|  unnamed protein product                                212   5e-66   
ref|XP_006972704.1|  PREDICTED: calmodulin-like                         211   6e-66   
dbj|BAE31579.1|  unnamed protein product                                211   6e-66   
ref|NP_001027633.1|  calmodulin                                         211   6e-66   
sp|Q39752.3|CALM_FAGSY  RecName: Full=Calmodulin; Short=CaM             210   6e-66   
ref|XP_001849785.1|  calmodulin                                         211   6e-66   
gb|AAD34411.1|AF084427_1  calmodulin mutant SYNCAM7                     210   6e-66   
gb|AAD34431.1|AF084447_1  calmodulin mutant SYNCAM37                    210   6e-66   
ref|XP_007432500.1|  PREDICTED: calmodulin isoform X1                   211   6e-66   
gb|ABV22336.1|  calmodulin                                              210   6e-66   
emb|CCA17080.1|  calmodulin putative                                    210   6e-66   
dbj|BAE31439.1|  unnamed protein product                                210   6e-66   
ref|XP_008639967.1|  PREDICTED: calmodulin                              211   6e-66   
gb|AAD34407.1|AF084423_1  calmodulin mutant SYNCAM67                    210   6e-66   
ref|XP_006067530.1|  PREDICTED: calmodulin isoform X1                   211   7e-66   
gb|AAD34269.1|AF084421_1  calmodulin mutant SYNCAM71A                   210   7e-66   
gb|ELK12789.1|  Calmodulin                                              211   7e-66   
gb|ACH46215.1|  putative calmodulin variant 1                           210   7e-66   
ref|XP_004274831.1|  PREDICTED: calmodulin-like                         210   7e-66   
gb|ADW78835.1|  calmodulin 1                                            210   7e-66   
gb|ABR21727.1|  calmodulin                                              210   7e-66   
ref|XP_011032413.1|  PREDICTED: calmodulin-like protein 8               210   7e-66   
emb|CCI42484.1|  unnamed protein product                                210   7e-66   
ref|XP_006125556.1|  PREDICTED: calmodulin-like isoform X3              210   7e-66   
ref|XP_007072738.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin 1...    210   7e-66   
sp|Q9U6D3.3|CALM_MYXGL  RecName: Full=Calmodulin; Short=CaM             210   7e-66   
ref|XP_007070442.1|  PREDICTED: calmodulin-like                         211   7e-66   
ref|XP_002805228.1|  PREDICTED: calmodulin-like isoform 2               210   7e-66   



>ref|XP_011091067.1| PREDICTED: calmodulin-like protein 11 [Sesamum indicum]
Length=150

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA VLNE+QI+EF+EAFSLFDKDGDG IT+EELATVIRSLD+NPTEEELQ+M+N+VD   
Sbjct  1    MAEVLNEEQIVEFREAFSLFDKDGDGCITIEELATVIRSLDQNPTEEELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLNLMAKKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMIREADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMIREADLDGDGQVNYDEFVKMMMAIG  150



>ref|XP_011073471.1| PREDICTED: calmodulin-like protein 8 [Sesamum indicum]
Length=151

 Score =   249 bits (635),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  513  VLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGA  334
            VLNE+QI+EFQEAFSLFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+N+VD+  NG 
Sbjct  5    VLNEEQIVEFQEAFSLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDSDGNGT  64

Query  333  IEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAE  154
            IEF EFLN ++K++++TD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+EE E
Sbjct  65   IEFAEFLNLMAKKIKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDEEVE  124

Query  153  QMIREADLDGDGQVNYDDFVKMMMNVG  73
            QMIREADLDGDGQVNYD+FVKMMM VG
Sbjct  125  QMIREADLDGDGQVNYDEFVKMMMTVG  151



>ref|XP_009611663.1| PREDICTED: calmodulin-like protein 8 [Nicotiana tomentosiformis]
 dbj|BAB61919.1| calmodulin NtCaM13 [Nicotiana tabacum]
Length=150

 Score =   248 bits (633),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M ++LN+DQI+E QEAFSLFD+DGDG ITVEELATVIRSLD+NPTEEELQ+M+ +VD+  
Sbjct  1    MGDILNQDQIVELQEAFSLFDRDGDGCITVEELATVIRSLDQNPTEEELQDMITEVDSDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M+DTD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFTEFLNLMAKKMKDTDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVN+D+FVKMMMNVG
Sbjct  121  EVEQMIKEADLDGDGQVNFDEFVKMMMNVG  150



>ref|XP_006350654.1| PREDICTED: calmodulin-like protein 11-like [Solanum tuberosum]
Length=150

 Score =   247 bits (630),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M ++LN DQI+E QEAFSLFD+DGDG ITVEELATVIRSLD+NPTEEELQ+M+ +VD+  
Sbjct  1    MGDILNNDQIVELQEAFSLFDRDGDGCITVEELATVIRSLDQNPTEEELQDMITEVDSDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M+DTD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFTEFLNLMAKKMKDTDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E +QMIREADLDGDGQVN+D+FVKMMMNVG
Sbjct  121  EVDQMIREADLDGDGQVNFDEFVKMMMNVG  150



>ref|XP_004241038.1| PREDICTED: calmodulin-like protein 8 [Solanum lycopersicum]
Length=149

 Score =   245 bits (626),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M +VLN DQI+E QEAFSLFD+DGDG ITVEELATVIRSLD+NPTEEELQ+M+ +VD+  
Sbjct  1    MGDVLNNDQIVELQEAFSLFDRDGDGCITVEELATVIRSLDQNPTEEELQDMITEVDSDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M+DTD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFTEFLNLMAKKMKDTDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E EQMI+EADLDGDGQVN+D+FVKMMMNV
Sbjct  121  EVEQMIKEADLDGDGQVNFDEFVKMMMNV  149



>ref|XP_009786057.1| PREDICTED: calmodulin-like protein 8 [Nicotiana sylvestris]
Length=150

 Score =   245 bits (625),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M ++LN++QI+E QEAFSLFD+DGDG ITVEELATVIRSLD+NPT+EELQ+M+ +VD+  
Sbjct  1    MGDILNQEQIVELQEAFSLFDRDGDGCITVEELATVIRSLDQNPTKEELQDMITEVDSDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M+DTD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFTEFLNLMAKKMKDTDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVN+D+FVKMMMNVG
Sbjct  121  EVEQMIKEADLDGDGQVNFDEFVKMMMNVG  150



>gb|KDP40249.1| hypothetical protein JCGZ_02247 [Jatropha curcas]
Length=150

 Score =   245 bits (625),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA VL E+QI+EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MAEVLTEEQIVEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLNLMAKKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVNYD+FVKMMM  G
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMTAG  150



>ref|XP_011030612.1| PREDICTED: calmodulin-like protein 8 [Populus euphratica]
Length=150

 Score =   244 bits (623),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI+EF+EAF LFDKDGDG IT+EELATVIRSLD+NPTEEELQ+M+++VD+  
Sbjct  1    MAEALTEEQIVEFREAFCLFDKDGDGCITLEELATVIRSLDQNPTEEELQDMISEVDSDR  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++K+M++TD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLSLMAKKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVNYD+FVKMMMNVG
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMNVG  150



>ref|XP_002314661.1| calmodulin 8 family protein [Populus trichocarpa]
 gb|EEF00832.1| calmodulin 8 family protein [Populus trichocarpa]
Length=150

 Score =   244 bits (622),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI+EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTEEEL +M+++VD+  
Sbjct  1    MAEALTEEQIVEFREAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELHDMISEVDSDR  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++K+M++TD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLSLMAKKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVNYD+FVKMMMNVG
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMNVG  150



>ref|XP_004296596.1| PREDICTED: calmodulin-like protein 11-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=150

 Score =   243 bits (620),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA VL+E+QI+EF+EAF LFDKDGDG IT+EELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MAEVLSEEQIVEFKEAFCLFDKDGDGCITIEELATVIRSLDQNPTEEELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++ +M++TD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLNLMANKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMTIG  150



>ref|XP_002283755.1| PREDICTED: calmodulin-like protein 11 [Vitis vinifera]
 emb|CAN70418.1| hypothetical protein VITISV_013814 [Vitis vinifera]
 emb|CBI26332.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   241 bits (615),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI+EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+ +VD   
Sbjct  1    MADVLSEEQIVEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMIREVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG+IEF EFLN ++K++++TD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT+E
Sbjct  61   NGSIEFAEFLNLMAKKVKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMN  79
            E EQMIREADLDGDGQVNYD+FVKMMM 
Sbjct  121  EVEQMIREADLDGDGQVNYDEFVKMMMT  148


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 51/114 (45%), Gaps = 40/114 (35%)
 Frame = -2

Query  294  MEDTDSEE---ELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREADLDG  124
            M D  SEE   E KEAF +FDKD +G I+  EL  V+ +L +  TEEE + MIRE D DG
Sbjct  1    MADVLSEEQIVEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMIREVDADG  60

Query  123  DGQVNYDDFVKM-------------------------------------MMNVG  73
            +G + + +F+ +                                     M+N+G
Sbjct  61   NGSIEFAEFLNLMAKKVKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLG  114



>ref|XP_011027358.1| PREDICTED: calmodulin-like protein 11 [Populus euphratica]
Length=150

 Score =   241 bits (614),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA VL E+QI+EF+EAF LFDKDGDG IT++ELATVIRSLD+NPTEEELQ+M+++VD+  
Sbjct  1    MAEVLTEEQIVEFKEAFCLFDKDGDGCITIDELATVIRSLDQNPTEEELQDMISEVDSDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL  ++K+ ++TD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLTLMAKKTKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E +QMI+EADLDGDGQVNYD+FVKMMMNVG
Sbjct  121  EVDQMIKEADLDGDGQVNYDEFVKMMMNVG  150



>gb|EYU23698.1| hypothetical protein MIMGU_mgv1a023732mg [Erythranthe guttata]
Length=150

 Score =   241 bits (614),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ LNE+QI+EFQEAFSLFDKDGDG IT+EELATVIRSLD+NPTEEEL EMMN+VD+  
Sbjct  1    MADALNEEQIVEFQEAFSLFDKDGDGCITIEELATVIRSLDQNPTEEELHEMMNEVDSDR  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN +S++M++ D+ EELKEAFKVFDKDQNGYISANELR V++NLGEKLT+E
Sbjct  61   NGTIEFAEFLNLMSRKMKEIDAGEELKEAFKVFDKDQNGYISANELRQVLMNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E +QMIREADLDGDGQVN+D+FVKMM  VG
Sbjct  121  EVQQMIREADLDGDGQVNFDEFVKMMTTVG  150



>ref|XP_010274270.1| PREDICTED: calmodulin-like protein 11 isoform X2 [Nelumbo nucifera]
Length=149

 Score =   240 bits (613),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL E+QI EFQEAF LFDKDGDG IT+EELATVIRSLD+NPTEEELQEM+++VD   
Sbjct  1    MADVLTEEQIAEFQEAFCLFDKDGDGCITIEELATVIRSLDQNPTEEELQEMISEVDVDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL  ++++M++TD+EEELKEAFKVFDKDQNGYISANELR+VM+NLGEKLT+E
Sbjct  61   NGTIEFGEFLGLMARKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMVNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E EQMI+EADLDGDGQVNYD+FV+MMM +
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVRMMMAI  149



>emb|CDO99124.1| unnamed protein product [Coffea canephora]
Length=150

 Score =   240 bits (612),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M  VLN++QI+EF+EAFSLFDKDGDG IT+EELATVIRSLD+NP+EEELQ+M+++VD   
Sbjct  1    MGEVLNQEQIVEFKEAFSLFDKDGDGCITIEELATVIRSLDQNPSEEELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K++++TD+EEELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLNLMAKKIQETDAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMIREADLDGDGQVNYD+FVKMM  +G
Sbjct  121  EVEQMIREADLDGDGQVNYDEFVKMMTTIG  150



>ref|XP_010069415.1| PREDICTED: calmodulin-like protein 11 [Eucalyptus grandis]
Length=150

 Score =   240 bits (612),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA++L ++QI+EF+EAF+LFDKDGDG IT+EELATVIRSLD+NPTE+ELQ+M+N+VD   
Sbjct  1    MADMLTQEQIVEFKEAFTLFDKDGDGCITLEELATVIRSLDQNPTEKELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++ +M++TD+EEELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLNLMANKMKETDAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMIREADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMIREADLDGDGQVNYDEFVKMMMTIG  150



>ref|XP_007223678.1| hypothetical protein PRUPE_ppa012907mg [Prunus persica]
 gb|EMJ24877.1| hypothetical protein PRUPE_ppa012907mg [Prunus persica]
Length=150

 Score =   239 bits (611),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI+EF+EAF LFDKDGDG ITV+ELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MADVLSEEQIVEFKEAFCLFDKDGDGCITVDELATVIRSLDQNPTEEELQDMISEVDVDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++ +M++TD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLSLMANKMKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMTIG  150



>ref|XP_002312558.1| calmodulin family protein [Populus trichocarpa]
 gb|EEE89925.1| calmodulin family protein [Populus trichocarpa]
Length=150

 Score =   239 bits (610),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA VL E+Q++EF+EAF LFDKDGDG IT++ELATVIRSLD+NPTEEELQ+M+++VD+  
Sbjct  1    MAEVLTEEQMVEFKEAFCLFDKDGDGCITIDELATVIRSLDQNPTEEELQDMISEVDSDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL  ++K+ ++TD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLTLMAKKTKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E +QMI+EADLDGDGQVNYD+FVKMMMNVG
Sbjct  121  EVDQMIKEADLDGDGQVNYDEFVKMMMNVG  150



>ref|XP_002517054.1| calmodulin, putative [Ricinus communis]
 gb|EEF45217.1| calmodulin, putative [Ricinus communis]
Length=150

 Score =   239 bits (610),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA +L E+QI+EF+EAF LFDKDGDG IT+EELATVIRSLD+NPTEEELQ+M+ +VD   
Sbjct  1    MAEILTEEQIVEFKEAFCLFDKDGDGCITIEELATVIRSLDQNPTEEELQDMITEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD+EEELKEAFKVFDKDQNGYISANELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLNLMAKKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMM  85
            E EQMI+EADLDGDGQVNYD+FVKMM
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMM  146



>gb|AFK40401.1| unknown [Medicago truncatula]
 gb|KEH41045.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=150

 Score =   239 bits (609),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA +LNEDQI+E +EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQEM+N+VD   
Sbjct  1    MAEILNEDQIVEIKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQEMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD++E+LKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFVEFLNLMAKKMKETDADEDLKEAFKVFDKDQNGYISASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E +QMI+EADLDGDGQVN+++FVKMMM +G
Sbjct  121  EVDQMIKEADLDGDGQVNFEEFVKMMMTIG  150



>ref|XP_006420057.1| hypothetical protein CICLE_v10006151mg [Citrus clementina]
 ref|XP_006489478.1| PREDICTED: calmodulin-like protein 8-like [Citrus sinensis]
 gb|ESR33297.1| hypothetical protein CICLE_v10006151mg [Citrus clementina]
 gb|KDO53966.1| hypothetical protein CISIN_1g031903mg [Citrus sinensis]
Length=150

 Score =   239 bits (609),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M+ VL  +QI+EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+N+VD+  
Sbjct  1    MSEVLTNEQIVEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDSDR  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT++
Sbjct  61   NGTIEFGEFLNLMAKKMKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDD  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMINEADLDGDGQVNYDEFVKMMMTIG  150



>gb|KHN05043.1| Calmodulin-like protein 11 [Glycine soja]
Length=150

 Score =   238 bits (608),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA++L+E+QI++F+EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MADILSEEQIVDFKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++K+++DTD+EEELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFDEFLSLMAKKVKDTDAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E EQMI+EADLDGDGQVNYD+FVKMMM V
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMTV  149



>ref|XP_007034907.1| Calmodulin 8 isoform 1 [Theobroma cacao]
 gb|EOY05833.1| Calmodulin 8 isoform 1 [Theobroma cacao]
Length=152

 Score =   238 bits (608),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M ++L E+QI+EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  3    MGDILTEEQIVEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADG  62

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT+E
Sbjct  63   NGTIEFAEFLNLMAKKMKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDE  122

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVNY++FVKMM  VG
Sbjct  123  EVEQMIKEADLDGDGQVNYEEFVKMMTTVG  152



>ref|XP_004497995.1| PREDICTED: calmodulin-like protein 11-like [Cicer arietinum]
Length=150

 Score =   238 bits (607),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA +LNE+QI+E +EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+N+VD   
Sbjct  1    MAEILNEEQIVEIKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD+EE+LKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFVEFLNLMAKKMKETDAEEDLKEAFKVFDKDQNGYISASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E +QMI+EADLDGDGQVNY++FVKMMM +G
Sbjct  121  EVDQMIKEADLDGDGQVNYEEFVKMMMTIG  150



>ref|XP_008341030.1| PREDICTED: calmodulin-like protein 11 isoform X2 [Malus domestica]
Length=150

 Score =   238 bits (607),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI+EF+EAF LFDKDGDG ITV+ELATVIRSLD+NPTE+ELQ+M+++VD   
Sbjct  1    MADVLSEEQIVEFKEAFCLFDKDGDGCITVDELATVIRSLDQNPTEKELQDMISEVDVDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++ +M++TD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLSLMANKMKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMTIG  150



>ref|XP_008224219.1| PREDICTED: calmodulin-like protein 11 isoform X2 [Prunus mume]
Length=150

 Score =   238 bits (607),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI+EF+EAF LFDKDGDG ITV+ELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MADVLSEEQIVEFKEAFCLFDKDGDGCITVDELATVIRSLDQNPTEEELQDMISEVDVDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++ ++++TD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLSLMANKIKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMTIG  150



>ref|XP_010279286.1| PREDICTED: calmodulin-like protein 11 [Nelumbo nucifera]
Length=149

 Score =   238 bits (606),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL ++QI EF+EAF LFDKDGDG IT+EELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MADVLTDEQIAEFREAFCLFDKDGDGCITIEELATVIRSLDQNPTEEELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL  ++++M++TD+EEELKEAFKVFDKDQNGYISANELRNVMINLGEKLT+E
Sbjct  61   NGTIEFGEFLTLMARKMKETDAEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E EQMIREADLDGDGQVNY++FV+MMM V
Sbjct  121  EVEQMIREADLDGDGQVNYEEFVRMMMAV  149



>ref|XP_009337272.1| PREDICTED: calmodulin-like protein 11 [Pyrus x bretschneideri]
Length=150

 Score =   238 bits (606),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI+EF+EAF LFDKDGDG ITV+ELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MADVLSEEQIVEFKEAFCLFDKDGDGCITVDELATVIRSLDQNPTEEELQDMISEVDVDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++ +M++TD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLSLMANKMKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMINEADLDGDGQVNYDEFVKMMMTIG  150



>ref|NP_001236170.1| uncharacterized protein LOC100500308 [Glycine max]
 gb|ACU15345.1| unknown [Glycine max]
Length=150

 Score =   238 bits (606),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA++L+E+QI++F+EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MADILSEEQIVDFKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++K+++DTD+EEELKEAFKVFDKDQNGY+SA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFDEFLSLMAKKVKDTDAEEELKEAFKVFDKDQNGYVSASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E EQMI+EADLDGDGQVNYD+FVKMMM V
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMTV  149



>gb|KHN15388.1| Calmodulin-like protein 8 [Glycine soja]
Length=150

 Score =   238 bits (606),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI E +EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+N+VD   
Sbjct  1    MADVLSEEQISEIKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD EE+LKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFVEFLNLMAKKMKETDEEEDLKEAFKVFDKDQNGYISASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMIEEADLDGDGQVNYDEFVKMMMTIG  150



>ref|NP_001236910.1| uncharacterized protein LOC100526987 [Glycine max]
 gb|ACU16024.1| unknown [Glycine max]
Length=150

 Score =   238 bits (606),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI E +EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+N+VDT  
Sbjct  1    MADVLSEEQIGEIKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDTDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD+EE+LKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFVEFLNLMAKKMKETDAEEDLKEAFKVFDKDQNGYISASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQV YD+FVKMMM +G
Sbjct  121  EVEQMIKEADLDGDGQVGYDEFVKMMMIIG  150



>ref|XP_004495421.1| PREDICTED: calmodulin-like protein 11-like [Cicer arietinum]
Length=150

 Score =   237 bits (605),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI++FQEAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MAHVLSEEQIVDFQEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++++++DTD+EEEL+EAFKVFDKDQNGYISA ELR+VMINLGEKL++E
Sbjct  61   NGTIEFDEFLNLMARKIKDTDAEEELREAFKVFDKDQNGYISATELRHVMINLGEKLSDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E EQMI+EADLDGDGQV+YD+FVKMMM V
Sbjct  121  EVEQMIKEADLDGDGQVDYDEFVKMMMTV  149



>gb|AFK42854.1| unknown [Lotus japonicus]
Length=150

 Score =   237 bits (604),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M ++L+E+QI++F+EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+ +VD   
Sbjct  1    MTDILSEEQIVDFKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMITEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++++++DTD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFDEFLNLMARKIKDTDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E EQMI+EADLDGDGQVNYD+FVKMMM V
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMTV  149



>ref|NP_001237902.1| calmodulin [Glycine max]
 gb|AAA34015.1| calmodulin [Glycine max]
 gb|ACU15622.1| unknown [Glycine max]
 gb|KHN30548.1| Calmodulin-like protein 11 [Glycine soja]
 prf||2121384D calmodulin
Length=150

 Score =   236 bits (603),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA++L+E+QI++F+EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MADILSEEQIVDFKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++K+++DTD+EEELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFDEFLSLMAKKVKDTDAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E EQMI+EADLDGDGQVNY++FVKMMM V
Sbjct  121  EVEQMIKEADLDGDGQVNYEEFVKMMMTV  149



>ref|XP_009376002.1| PREDICTED: calmodulin-like protein 11 [Pyrus x bretschneideri]
Length=150

 Score =   236 bits (602),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI+EF+EAF LFDKDGDG ITV+ELATVIRSLD+NPTE+EL +M+++VD   
Sbjct  1    MADVLSEEQIVEFKEAFCLFDKDGDGCITVDELATVIRSLDQNPTEKELHDMISEVDVDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++ +M++TD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLSLMANKMKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMIKEADLDGDGQVNYDEFVKMMMTIG  150



>ref|XP_003622346.1| Calmodulin-like protein [Medicago truncatula]
 gb|KEH42817.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=150

 Score =   236 bits (602),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI++F+EAFSLFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MAHVLSEEQIVDFKEAFSLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++++M+DTD+EEEL+EAFKVFDKDQNGYISA+ELR+VMINLGEKL++E
Sbjct  61   NGTIEFDEFLNLMARKMKDTDAEEELREAFKVFDKDQNGYISASELRHVMINLGEKLSDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E EQMI+EAD+DGDGQV++D+FVKMMM +
Sbjct  121  EVEQMIKEADMDGDGQVDFDEFVKMMMTI  149



>gb|ABD98034.1| calmodulin [Striga asiatica]
Length=150

 Score =   236 bits (601),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA++LNE+QI+EFQEAFSLFDKDGDG IT+EELATV+ SLD+NPTE+ELQ+M+N+VD+  
Sbjct  1    MADLLNEEQIVEFQEAFSLFDKDGDGCITIEELATVMGSLDQNPTEKELQDMINEVDSDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD+EEE++EAFKVFDKDQNGYISANELRNVM+NLGEKLT+E
Sbjct  61   NGTIEFAEFLNLMAKKMKETDAEEEIQEAFKVFDKDQNGYISANELRNVMMNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMIREADLDG GQVNYD+F KMM  +G
Sbjct  121  EVEQMIREADLDGGGQVNYDEFFKMMRTIG  150



>ref|XP_010274269.1| PREDICTED: calmodulin-like protein 11 isoform X1 [Nelumbo nucifera]
Length=150

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGD-GSITVEELATVIRSLDKNPTEEELQEMMNDVDTG  346
            MA+VL E+QI EFQEAF LFDKDGD G IT+EELATVIRSLD+NPTEEELQEM+++VD  
Sbjct  1    MADVLTEEQIAEFQEAFCLFDKDGDVGCITIEELATVIRSLDQNPTEEELQEMISEVDVD  60

Query  345  SNGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTE  166
             NG IEF EFL  ++++M++TD+EEELKEAFKVFDKDQNGYISANELR+VM+NLGEKLT+
Sbjct  61   GNGTIEFGEFLGLMARKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMVNLGEKLTD  120

Query  165  EEAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            EE EQMI+EADLDGDGQVNYD+FV+MMM +
Sbjct  121  EEVEQMIKEADLDGDGQVNYDEFVRMMMAI  150



>gb|EYU41429.1| hypothetical protein MIMGU_mgv1a021942mg [Erythranthe guttata]
Length=151

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  513  VLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGA  334
            VLN+DQI+EFQEAFSLFDK+GDG IT+EELATVIRSLD+NPT EEL++M+N+VD+  NG 
Sbjct  5    VLNKDQIIEFQEAFSLFDKNGDGCITIEELATVIRSLDQNPTVEELRDMINEVDSDGNGT  64

Query  333  IEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAE  154
            IEF+EF+  ++K+M+++D+EEELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE +
Sbjct  65   IEFEEFMTLMAKKMKESDAEEELKEAFKVFDKDQNGYISADELRHVMINLGEKLTDEEVK  124

Query  153  QMIREADLDGDGQVNYDDFVKMMMNVG  73
            QMI+EADLDGDGQVNYD+FVKMM+N+G
Sbjct  125  QMIKEADLDGDGQVNYDEFVKMMINIG  151



>ref|XP_004134112.1| PREDICTED: calmodulin-like protein 11-like [Cucumis sativus]
 ref|XP_008438603.1| PREDICTED: calmodulin-like protein 11 [Cucumis melo]
 gb|KGN56931.1| hypothetical protein Csa_3G144210 [Cucumis sativus]
Length=150

 Score =   235 bits (599),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M  VL+E+QI+EF+EAF LFDKDGDG IT+EELATVIRSLD+NPTEEELQ+M+ +VD   
Sbjct  1    MTEVLSEEQIVEFKEAFCLFDKDGDGCITIEELATVIRSLDQNPTEEELQDMIKEVDVDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K++++TD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT++
Sbjct  61   NGTIEFAEFLNLMAKKIKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDD  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVN+++FVKMMM VG
Sbjct  121  EVEQMIKEADLDGDGQVNFEEFVKMMMAVG  150



>gb|EYU26972.1| hypothetical protein MIMGU_mgv1a019086mg [Erythranthe guttata]
Length=151

 Score =   235 bits (599),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  513  VLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGA  334
            VLN+DQI+EFQEAFSLFDK+GDG IT+EELATVIRSLD+NPT E+L++M+N+VD+  NG 
Sbjct  5    VLNKDQIIEFQEAFSLFDKNGDGCITIEELATVIRSLDQNPTVEKLRDMINEVDSDGNGT  64

Query  333  IEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAE  154
            IEF+EF+  ++K+M+++D+EEELKEAFKVFDKDQNGYISA+ELR VMINLGEKLT+EE +
Sbjct  65   IEFEEFMTLMAKKMKESDAEEELKEAFKVFDKDQNGYISADELRQVMINLGEKLTDEEVK  124

Query  153  QMIREADLDGDGQVNYDDFVKMMMNVG  73
            QMIREADLDGDGQVNYD+FVKMM+N+G
Sbjct  125  QMIREADLDGDGQVNYDEFVKMMINIG  151



>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 
4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide
Length=149

 Score =   234 bits (598),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -2

Query  519  ANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSN  340
            A++L+E+QI++F+EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+++VD   N
Sbjct  1    ADILSEEQIVDFKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADGN  60

Query  339  GAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEE  160
            G IEF EFL+ ++K+++DTD+EEELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE
Sbjct  61   GTIEFDEFLSLMAKKVKDTDAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEE  120

Query  159  AEQMIREADLDGDGQVNYDDFVKMMMNV  76
             EQMI+EADLDGDGQVNY++FVKMMM V
Sbjct  121  VEQMIKEADLDGDGQVNYEEFVKMMMTV  148



>ref|XP_004296595.1| PREDICTED: calmodulin-like protein 11-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=161

 Score =   235 bits (599),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 138/161 (86%), Gaps = 11/161 (7%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDG-----------SITVEELATVIRSLDKNPTEEEL  376
            MA VL+E+QI+EF+EAF LFDKDGDG            IT+EELATVIRSLD+NPTEEEL
Sbjct  1    MAEVLSEEQIVEFKEAFCLFDKDGDGEFHTTMSSILGCITIEELATVIRSLDQNPTEEEL  60

Query  375  QEMMNDVDTGSNGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNV  196
            Q+M+++VD   NG IEF EFLN ++ +M++TD+EEELKEAFKVFDKDQNGYISANELR+V
Sbjct  61   QDMISEVDADGNGTIEFAEFLNLMANKMKETDAEEELKEAFKVFDKDQNGYISANELRHV  120

Query  195  MINLGEKLTEEEAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            MINLGEKLT+EE EQMI+EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  MINLGEKLTDEEVEQMIKEADLDGDGQVNYDEFVKMMMTIG  161



>ref|XP_010107731.1| Calmodulin-like protein 11 [Morus notabilis]
 gb|EXC16766.1| Calmodulin-like protein 11 [Morus notabilis]
Length=160

 Score =   235 bits (599),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 140/160 (88%), Gaps = 10/160 (6%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDG----------SITVEELATVIRSLDKNPTEEELQ  373
            MA+VL+E+QI+EF+EAF LFDKDGDG           IT+EELATVIRSLD+NPTEEELQ
Sbjct  1    MADVLSEEQIVEFKEAFCLFDKDGDGEFPAISSILGCITIEELATVIRSLDQNPTEEELQ  60

Query  372  EMMNDVDTGSNGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVM  193
            +M+++VD+  NG IEF EFL+ ++ +M++TD+EEEL+EAFKVFDKDQNGYISANELR+VM
Sbjct  61   DMISEVDSDGNGTIEFAEFLSLMANKMKETDAEEELREAFKVFDKDQNGYISANELRHVM  120

Query  192  INLGEKLTEEEAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            INLGEKLT+EE EQMIREADLDGDGQVNYD+FVKMMM +G
Sbjct  121  INLGEKLTDEEVEQMIREADLDGDGQVNYDEFVKMMMTIG  160



>ref|XP_002870301.1| hypothetical protein ARALYDRAFT_330049 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46560.1| hypothetical protein ARALYDRAFT_330049 [Arabidopsis lyrata subsp. 
lyrata]
Length=154

 Score =   234 bits (597),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
              L +DQI EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTE+ELQ+++ ++D+ SNG
Sbjct  7    TALTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELQDIITEIDSDSNG  66

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFLN ++K+++++D+EEELKEAFKVFDKDQNGYISA+EL +VMINLGEKLT+EE 
Sbjct  67   TIEFAEFLNLMAKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEV  126

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNVG  73
            EQMI+EADLDGDGQVNYD+FVKMM+N+G
Sbjct  127  EQMIKEADLDGDGQVNYDEFVKMMINIG  154



>gb|KHN10087.1| Calmodulin-like protein 11 [Glycine soja]
Length=152

 Score =   233 bits (595),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 139/152 (91%), Gaps = 2/152 (1%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI E +EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+N+VDT  
Sbjct  1    MADVLSEEQIGEIKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDTDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANE--LRNVMINLGEKLT  169
            NG IEF EFLN ++K+M++TD+EE+LKEAFKVFDKDQNGYISA+E  LR+VMINLGEKLT
Sbjct  61   NGTIEFVEFLNLMAKKMKETDAEEDLKEAFKVFDKDQNGYISASEGYLRHVMINLGEKLT  120

Query  168  EEEAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            +EE EQMI+EADLDGDGQV+YD+FVKMMM +G
Sbjct  121  DEEVEQMIKEADLDGDGQVDYDEFVKMMMIIG  152



>ref|XP_008391015.1| PREDICTED: calmodulin-like protein 11 isoform X2 [Malus domestica]
Length=150

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI+EF+EAF  FDKDGDG ITV+EL TVIRSLD+NPTE ELQ+M++ VD   
Sbjct  1    MADVLSEEQIVEFKEAFCJFDKDGDGCITVDELXTVIRSLDQNPTEXELQDMISXVDVDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL+ ++ +M++TD+EEELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFAEFLSLMANKMKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMINEADLDGDGQVNYDEFVKMMMTIG  150



>ref|XP_006285099.1| hypothetical protein CARUB_v10006432mg [Capsella rubella]
 gb|EOA17997.1| hypothetical protein CARUB_v10006432mg [Capsella rubella]
Length=151

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
              L +DQI EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTE+ELQE++ ++D+  NG
Sbjct  4    TALTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELQEIITEIDSDGNG  63

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFLN ++K++++ D+EEELKEAFKVFDKDQNGYISA+EL +VMINLGEKLT+EE 
Sbjct  64   TIEFAEFLNLIAKKLQENDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEV  123

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNVG  73
            EQMI+EADLDGDGQVNYD+FVKMM+N+G
Sbjct  124  EQMIKEADLDGDGQVNYDEFVKMMINIG  151



>gb|AFK43190.1| unknown [Lotus japonicus]
Length=150

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+++QI+E +EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+N+VD   
Sbjct  1    MADVLSQEQIVEIKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDADD  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD+E++LKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFVEFLNLMAKKMKETDAEDDLKEAFKVFDKDQNGYISASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E +QMI+EADLDGDGQVNY +FVKMM+ +G
Sbjct  121  EVDQMIQEADLDGDGQVNYGEFVKMMITIG  150



>gb|KFK23666.1| hypothetical protein AALP_AAs70636U001500 [Arabis alpina]
Length=151

 Score =   232 bits (591),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  510  LNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAI  331
            L +DQI+EF+EAF LFDKDGDG IT+EELATVIRSLD+NPTE+ELQ+M+ ++D+  NG I
Sbjct  6    LTQDQIIEFKEAFCLFDKDGDGCITLEELATVIRSLDQNPTEQELQDMITEIDSDGNGTI  65

Query  330  EFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQ  151
            EF EFLN ++K+++++D EEELKEAFKVFDKDQNGYISA+EL +VMINLGEKLT+EE EQ
Sbjct  66   EFAEFLNLMAKKLQESDVEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEVEQ  125

Query  150  MIREADLDGDGQVNYDDFVKMMMNVG  73
            MI+EADLDGDGQVNYD+FVKMM+N+G
Sbjct  126  MIKEADLDGDGQVNYDEFVKMMLNIG  151



>gb|AAA92677.1| calmodulin-like protein [Pisum sativum]
Length=150

 Score =   231 bits (590),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA++L+E+QI++F+EAF LFDKDGDG +TVEELATVIRSLD+NPTEEELQ+M+++VD   
Sbjct  1    MAHILSEEQIVDFKEAFGLFDKDGDGCVTVEELATVIRSLDQNPTEEELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++++M+DTD+EEEL+EAFKVFDKDQNGYIS +ELR+VM+NLGEKL++E
Sbjct  61   NGTIEFDEFLNLMARKMKDTDAEEELREAFKVFDKDQNGYISPSELRHVMMNLGEKLSDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E +QMI+EAD+DGDGQV+YDDFVKMMM +
Sbjct  121  EVKQMIKEADMDGDGQVDYDDFVKMMMAI  149



>ref|XP_007145921.1| hypothetical protein PHAVU_007G278900g [Phaseolus vulgaris]
 gb|ESW17915.1| hypothetical protein PHAVU_007G278900g [Phaseolus vulgaris]
Length=150

 Score =   231 bits (590),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+ +QI E +EAF LFDKDGDG ITVEELATVIRSLD+NPTEEELQ+M+N+VD+  
Sbjct  1    MADVLSAEQIGEIKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDSDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFL  ++K+M++TD+EE+LKEAFKVFDKDQNGYISA+ELR+VMINLGEKL++ 
Sbjct  61   NGTIEFVEFLTLMAKKMKETDAEEDLKEAFKVFDKDQNGYISASELRHVMINLGEKLSDA  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI+EADLDGDGQVNY++FVKMMM +G
Sbjct  121  EVEQMIKEADLDGDGQVNYEEFVKMMMTIG  150



>ref|XP_010917630.1| PREDICTED: calmodulin-like protein 11 [Elaeis guineensis]
Length=148

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
            ++L E+QI EFQEAF LFDKDGDG IT+EELATVIRSL +NPTEEELQ+M+++VD   NG
Sbjct  2    DILTEEQISEFQEAFCLFDKDGDGCITLEELATVIRSLGQNPTEEELQDMISEVDANGNG  61

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFL+ ++++M++TD+EEELKEAFKVFDKDQNGYISANELRNVMINLGEKLT+EE 
Sbjct  62   TIEFGEFLSLMARKMKETDAEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTDEEV  121

Query  156  EQMIREADLDGDGQVNYDDFVKMMM  82
            EQMIREAD+DGDGQVNY++FV+MMM
Sbjct  122  EQMIREADIDGDGQVNYEEFVRMMM  146



>ref|XP_008808019.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=148

 Score =   230 bits (587),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
            ++L E+QI EFQEAF LFDKDGDG IT+EELATVIRSL +NPTEEELQ+M+++VD   NG
Sbjct  2    DLLTEEQISEFQEAFCLFDKDGDGRITLEELATVIRSLGQNPTEEELQDMISEVDANGNG  61

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFL  ++++M++TD+EEELKEAFKVFDKDQNGYISANELRNVMINLGEKLT+EE 
Sbjct  62   TIEFGEFLGLMARKMKETDAEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTDEEV  121

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNV  76
            EQMIREAD+DGDGQVNY++FV+MMM V
Sbjct  122  EQMIREADIDGDGQVNYEEFVRMMMAV  148



>ref|NP_193200.1| calmodulin-like protein 8 [Arabidopsis thaliana]
 sp|O23320.1|CML8_ARATH RecName: Full=Calmodulin-like protein 8; Short=AtCaM-8 [Arabidopsis 
thaliana]
 gb|AAD53314.1|AF178074_1 calmodulin 8 [Arabidopsis thaliana]
 emb|CAB10243.1| calmodulin [Arabidopsis thaliana]
 emb|CAB78506.1| calmodulin [Arabidopsis thaliana]
 gb|ABD57513.1| At4g14640 [Arabidopsis thaliana]
 gb|AEE83470.1| calmodulin-like protein 8 [Arabidopsis thaliana]
Length=151

 Score =   230 bits (586),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
              L +DQI EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTE+EL +++ ++D+ SNG
Sbjct  4    TALTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNG  63

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFLN ++K+++++D+EEELKEAFKVFDKDQNGYISA+EL +VMINLGEKLT+EE 
Sbjct  64   TIEFAEFLNLMAKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEV  123

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNV  76
            EQMI+EADLDGDGQVNYD+FVKMM+N+
Sbjct  124  EQMIKEADLDGDGQVNYDEFVKMMINI  150



>ref|NP_001238254.1| calmodulin [Glycine max]
 gb|AAA33948.1| calmodulin [Glycine max]
 prf||2121384E calmodulin
Length=150

 Score =   229 bits (585),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+VL+E+QI E +EAF LFDKDGDG ITV+E  TVIRSL +NPTEEELQ+M+N+VD   
Sbjct  1    MADVLSEEQISEIKEAFGLFDKDGDGCITVDEFVTVIRSLVQNPTEEELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD EE+LKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+E
Sbjct  61   NGTIEFVEFLNLMAKKMKETDEEEDLKEAFKVFDKDQNGYISASELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E EQMI EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  EVEQMIEEADLDGDGQVNYDEFVKMMMTIG  150



>ref|XP_010421985.1| PREDICTED: calmodulin-like protein 8 [Camelina sativa]
Length=151

 Score =   229 bits (585),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
              L +DQI EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTE+ELQE++ ++D+  NG
Sbjct  4    TALTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELQEIITEIDSDGNG  63

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFLN + K++++ D EEELKEAFKVFDKDQNGYISA+EL +VMINLGEKLT+EE 
Sbjct  64   TIEFAEFLNLMDKKLQENDVEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEV  123

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNVG  73
            EQMI+EADLDGDGQVNYD+FVKMM+N+G
Sbjct  124  EQMIKEADLDGDGQVNYDEFVKMMINIG  151



>ref|XP_008224218.1| PREDICTED: calmodulin-like protein 8 isoform X1 [Prunus mume]
Length=161

 Score =   229 bits (585),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 138/161 (86%), Gaps = 11/161 (7%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDG-----------SITVEELATVIRSLDKNPTEEEL  376
            MA+VL+E+QI+EF+EAF LFDKDGDG            ITV+ELATVIRSLD+NPTEEEL
Sbjct  1    MADVLSEEQIVEFKEAFCLFDKDGDGEFPTIMSSILGCITVDELATVIRSLDQNPTEEEL  60

Query  375  QEMMNDVDTGSNGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNV  196
            Q+M+++VD   NG IEF EFL+ ++ ++++TD+EEELKEAFKVFDKDQNGYISA ELR+V
Sbjct  61   QDMISEVDVDGNGTIEFAEFLSLMANKIKETDAEEELKEAFKVFDKDQNGYISATELRHV  120

Query  195  MINLGEKLTEEEAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            MINLGEKLT+EE EQMI+EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  MINLGEKLTDEEVEQMIKEADLDGDGQVNYDEFVKMMMTIG  161



>ref|XP_008341029.1| PREDICTED: calmodulin-like protein 8 isoform X1 [Malus domestica]
Length=161

 Score =   229 bits (585),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 138/161 (86%), Gaps = 11/161 (7%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDG-----------SITVEELATVIRSLDKNPTEEEL  376
            MA+VL+E+QI+EF+EAF LFDKDGDG            ITV+ELATVIRSLD+NPTE+EL
Sbjct  1    MADVLSEEQIVEFKEAFCLFDKDGDGEFPTIISSILGCITVDELATVIRSLDQNPTEKEL  60

Query  375  QEMMNDVDTGSNGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNV  196
            Q+M+++VD   NG IEF EFL+ ++ +M++TD+EEELKEAFKVFDKDQNGYISA ELR+V
Sbjct  61   QDMISEVDVDGNGTIEFAEFLSLMANKMKETDAEEELKEAFKVFDKDQNGYISATELRHV  120

Query  195  MINLGEKLTEEEAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            MINLGEKLT+EE EQMI+EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  MINLGEKLTDEEVEQMIKEADLDGDGQVNYDEFVKMMMTIG  161



>ref|XP_006414669.1| hypothetical protein EUTSA_v10026490mg [Eutrema salsugineum]
 gb|ESQ56122.1| hypothetical protein EUTSA_v10026490mg [Eutrema salsugineum]
Length=151

 Score =   228 bits (582),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
              L +DQI+EF+EAF LFDKDGDG ITV+ELATVIRSLD+NPTE+ELQ+++ ++D+  NG
Sbjct  4    TALTKDQIIEFKEAFCLFDKDGDGCITVDELATVIRSLDQNPTEQELQDIITEIDSDGNG  63

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFLN ++K++++ D EEELKEAFKVFDKDQNGYISA+EL +VMINLGEKLT+EE 
Sbjct  64   TIEFAEFLNLMAKKLQENDVEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEV  123

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNVG  73
            EQMI+EADLDGDGQVNYD+FVKMM+N+G
Sbjct  124  EQMIKEADLDGDGQVNYDEFVKMMINIG  151



>ref|XP_010450019.1| PREDICTED: calmodulin-like protein 8 [Camelina sativa]
Length=151

 Score =   228 bits (582),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
              L +DQI EF+EAF LFD+DGDG ITVEELATVIRSLD+NPTE+ELQE++ ++D+  NG
Sbjct  4    TALTKDQITEFKEAFCLFDRDGDGCITVEELATVIRSLDQNPTEQELQEIITEIDSDGNG  63

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFLN + K++++ D EEELKEAFKVFDKDQNGYISA+EL +VMINLGEKLT+EE 
Sbjct  64   TIEFAEFLNLMDKKLQENDVEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEV  123

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNVG  73
            EQMI+EADLDGDGQVNYD+FVKMM+N+G
Sbjct  124  EQMIKEADLDGDGQVNYDEFVKMMINIG  151



>ref|XP_006406114.1| hypothetical protein EUTSA_v10021692mg [Eutrema salsugineum]
 gb|ESQ47567.1| hypothetical protein EUTSA_v10021692mg [Eutrema salsugineum]
Length=153

 Score =   228 bits (581),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  510  LNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAI  331
            L ++QIMEF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+N++D+  NG I
Sbjct  8    LTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMINEIDSDGNGTI  67

Query  330  EFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQ  151
            EF EFLN ++ ++++TD +EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE +Q
Sbjct  68   EFSEFLNLMANKIQETDVDEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQ  127

Query  150  MIREADLDGDGQVNYDDFVKMMMNVG  73
            MI+EADLDGDGQVNYD+FV+MMMN G
Sbjct  128  MIKEADLDGDGQVNYDEFVRMMMNSG  153



>ref|XP_010435099.1| PREDICTED: calmodulin-like protein 8 [Camelina sativa]
Length=151

 Score =   228 bits (581),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
              L + QI EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTE+ELQE++ ++D+  NG
Sbjct  4    TALTKYQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELQEIITEIDSDGNG  63

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFLN ++K++++ D EEELKEAFKVFDKDQNGYISA+EL +VMINLGEKLT+EE 
Sbjct  64   TIEFAEFLNLMAKKLQENDVEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEV  123

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNVG  73
            EQMI+EADLDGDGQVNYD+FVKMM+N+G
Sbjct  124  EQMIKEADLDGDGQVNYDEFVKMMINIG  151



>ref|XP_010440420.1| PREDICTED: calmodulin-like protein 8 [Camelina sativa]
Length=151

 Score =   228 bits (580),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
              L +DQI EF+EAF LFDKDGDG ITVEELATVIRSLD+NPTE+ELQE++ ++D+  NG
Sbjct  4    TALTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELQEIITEIDSDGNG  63

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFLN + K++++ D EEELKEAFKVFDKDQNGYISA+EL +VMINLGEKLT+EE 
Sbjct  64   TIEFAEFLNLMDKKLQENDVEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEV  123

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNVG  73
            EQMI+EADLDGDGQVNY++FVKMM+N+G
Sbjct  124  EQMIKEADLDGDGQVNYEEFVKMMINIG  151



>emb|CDY40824.1| BnaC01g31320D [Brassica napus]
Length=180

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  510  LNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAI  331
            L ++QIMEF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+N++D+  NG I
Sbjct  35   LTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMINEIDSDGNGTI  94

Query  330  EFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQ  151
            EF EFLN ++ ++++TD++EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE  Q
Sbjct  95   EFSEFLNLMANKIQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVAQ  154

Query  150  MIREADLDGDGQVNYDDFVKMMMNVG  73
            MI+EADLDGDGQVNYD+FV+MMM  G
Sbjct  155  MIKEADLDGDGQVNYDEFVRMMMTSG  180



>ref|XP_009145249.1| PREDICTED: calmodulin-like protein 11 [Brassica rapa]
Length=155

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  510  LNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAI  331
            L ++QIMEF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+N++D+  NG I
Sbjct  10   LTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMINEIDSDGNGTI  69

Query  330  EFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQ  151
            EF EFLN +  ++++TD++EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE +Q
Sbjct  70   EFSEFLNLMGSKIQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQ  129

Query  150  MIREADLDGDGQVNYDDFVKMMMNVG  73
            MI+EADLDGD QVNYD+FV+MMM  G
Sbjct  130  MIKEADLDGDSQVNYDEFVRMMMTSG  155



>ref|XP_009596618.1| PREDICTED: calmodulin-like protein 8 [Nicotiana tomentosiformis]
Length=167

 Score =   224 bits (572),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 137/157 (87%), Gaps = 5/157 (3%)
 Frame = -2

Query  546  SHQNKNGG---MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEEL  376
            +H+NK+     MA++L  DQ++E +EA  LFDKDGDG IT+EELATVIRSLD+NPTEEEL
Sbjct  10   THKNKSSRINIMADILKADQLIECEEA--LFDKDGDGCITIEELATVIRSLDQNPTEEEL  67

Query  375  QEMMNDVDTGSNGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNV  196
              M+++VD   NG  EF EFLN ++++M++TD+EEELKEAFKVFDKDQNGYISAN+LR+V
Sbjct  68   YRMISEVDADENGITEFTEFLNLITQKMKETDAEEELKEAFKVFDKDQNGYISANDLRHV  127

Query  195  MINLGEKLTEEEAEQMIREADLDGDGQVNYDDFVKMM  85
            MINLGEKLT+EEAEQMI+EADLDGDGQVN+DDFVKMM
Sbjct  128  MINLGEKLTDEEAEQMIKEADLDGDGQVNFDDFVKMM  164



>ref|XP_008391014.1| PREDICTED: calmodulin-2/4-like isoform X1 [Malus domestica]
Length=161

 Score =   224 bits (572),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 133/161 (83%), Gaps = 11/161 (7%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDG-----------SITVEELATVIRSLDKNPTEEEL  376
            MA+VL+E+QI+EF+EAF  FDKDGDG            ITV+EL TVIRSLD+NPTE EL
Sbjct  1    MADVLSEEQIVEFKEAFCJFDKDGDGEFPTIMSSVLGCITVDELXTVIRSLDQNPTEXEL  60

Query  375  QEMMNDVDTGSNGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNV  196
            Q+M++ VD   NG IEF EFL+ ++ +M++TD+EEELKEAFKVFDKDQNGYISA ELR+V
Sbjct  61   QDMISXVDVDGNGTIEFAEFLSLMANKMKETDAEEELKEAFKVFDKDQNGYISATELRHV  120

Query  195  MINLGEKLTEEEAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            MINLGEKLT+EE EQMI EADLDGDGQVNYD+FVKMMM +G
Sbjct  121  MINLGEKLTDEEVEQMINEADLDGDGQVNYDEFVKMMMTIG  161



>gb|ABG74924.1| calmodulin [Aegiceras corniculatum]
Length=151

 Score =   223 bits (569),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  525  GMANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTG  346
            GMA+ L EDQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD  
Sbjct  2    GMADQLTEDQISEFREAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  61

Query  345  SNGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTE  166
             NG I+F EFLN ++K+MEDTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+
Sbjct  62   GNGTIDFPEFLNLMAKKMEDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  121

Query  165  EEAEQMIREADLDGDGQVNYDDFVKMMM  82
            EE ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  122  EEVDEMIREADVDGDGQINYEEFVKVMM  149



>emb|CDY10686.1| BnaA05g16760D [Brassica napus]
Length=155

 Score =   223 bits (567),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  510  LNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAI  331
            L ++QIMEF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+N++D+  NG I
Sbjct  10   LTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMINEIDSDGNGTI  69

Query  330  EFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQ  151
            EF EFLN +  ++++TD++EELKEAFKVFDKDQNGYISA+ELR+VM NLGEKLT+EE +Q
Sbjct  70   EFSEFLNLMGSKIQETDADEELKEAFKVFDKDQNGYISASELRHVMSNLGEKLTDEEVDQ  129

Query  150  MIREADLDGDGQVNYDDFVKMMMNVG  73
            MI+EADL+GDGQVNYD+FV+MMM  G
Sbjct  130  MIKEADLEGDGQVNYDEFVRMMMTSG  155



>ref|XP_009108537.1| PREDICTED: calmodulin-like protein 8 [Brassica rapa]
Length=180

 Score =   223 bits (569),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  495  IMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEF  316
            IMEF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+N++D+  NG IEF EF
Sbjct  40   IMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMINEIDSDGNGTIEFSEF  99

Query  315  LNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREA  136
            LN ++ ++++TD++EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE  QMI+EA
Sbjct  100  LNLMANKIQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVAQMIKEA  159

Query  135  DLDGDGQVNYDDFVKMMMNVG  73
            DLDGDGQVNYD+FV+MMM  G
Sbjct  160  DLDGDGQVNYDEFVRMMMTSG  180



>ref|XP_009766879.1| PREDICTED: calmodulin-like protein 8 [Nicotiana sylvestris]
Length=148

 Score =   222 bits (566),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA++L  DQ++E  E  ++FDKDGDG IT+EELATVIRSLD+NPTEEEL  M+++VD   
Sbjct  1    MADILKADQLIECDEE-AVFDKDGDGCITIEELATVIRSLDQNPTEEELYHMISEVDADE  59

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++K+M++TD+EEELKEAFKVFDKDQNGYISAN+LR+VMINLGEKLT+E
Sbjct  60   NGIIEFTEFLNLITKKMKETDAEEELKEAFKVFDKDQNGYISANDLRHVMINLGEKLTDE  119

Query  162  EAEQMIREADLDGDGQVNYDDFVKMM  85
            EAEQMIREADLDGDGQVN+DDFVKMM
Sbjct  120  EAEQMIREADLDGDGQVNFDDFVKMM  145



>emb|CDY34215.1| BnaA01g24320D [Brassica napus]
Length=156

 Score =   223 bits (567),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  495  IMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEF  316
            IMEF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+N++D+  NG IEF EF
Sbjct  16   IMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMINEIDSDGNGTIEFSEF  75

Query  315  LNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREA  136
            LN ++ ++++TD++EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE  QMI+EA
Sbjct  76   LNLMANKIQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVAQMIKEA  135

Query  135  DLDGDGQVNYDDFVKMMMNVG  73
            DLDGDGQVNYD+FV+MMM  G
Sbjct  136  DLDGDGQVNYDEFVRMMMTSG  156



>ref|XP_009380569.1| PREDICTED: calmodulin-like [Musa acuminata subsp. malaccensis]
Length=194

 Score =   224 bits (570),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  534  KNGGMANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDV  355
            + GGMA  L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+V
Sbjct  42   RGGGMAEQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV  101

Query  354  DTGSNGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEK  175
            D   NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEK
Sbjct  102  DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK  161

Query  174  LTEEEAEQMIREADLDGDGQVNYDDFVKMMM  82
            LT+EE ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  162  LTDEEVDEMIREADVDGDGQINYEEFVKIMM  192



>ref|NP_188933.1| calmodulin-like protein 11 [Arabidopsis thaliana]
 sp|Q9LIK5.1|CML11_ARATH RecName: Full=Calmodulin-like protein 11 [Arabidopsis thaliana]
 gb|AAL16141.1|AF428309_1 AT3g22930/F5N5_10 [Arabidopsis thaliana]
 dbj|BAB03038.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM51601.1| AT3g22930/F5N5_10 [Arabidopsis thaliana]
 gb|AEE76692.1| calmodulin-like protein 11 [Arabidopsis thaliana]
Length=173

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  510  LNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAI  331
            L ++QIMEF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+ ++D+  NG I
Sbjct  28   LTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTI  87

Query  330  EFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQ  151
            EF EFLN ++ ++++TD++EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE +Q
Sbjct  88   EFSEFLNLMANQLQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQ  147

Query  150  MIREADLDGDGQVNYDDFVKMMM  82
            MI+EADLDGDGQVNYD+FV+MMM
Sbjct  148  MIKEADLDGDGQVNYDEFVRMMM  170


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  270  ELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREADLDGDGQVNYDDFVK  91
            E KEAF +FDKD +G I+A+EL  V+ +L +  TE+E + MI E D DG+G + + +F+ 
Sbjct  35   EFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTIEFSEFLN  94

Query  90   MMMN  79
            +M N
Sbjct  95   LMAN  98



>ref|XP_004302046.1| PREDICTED: calmodulin-like protein 11-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=150

 Score =   221 bits (563),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M  VL+E+QI EFQEAF LFDKDGDG IT+EELAT I+S+D+NPT EELQ M+N+VD   
Sbjct  1    MGEVLSEEQIAEFQEAFCLFDKDGDGCITIEELATAIKSVDQNPTAEELQSMINEVDIDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN + ++M++ D++EELKEAFKVFDKDQ+GYIS NELRNVMINLGE+LT+E
Sbjct  61   NGTIEFGEFLNVMVRKMKENDADEELKEAFKVFDKDQDGYISPNELRNVMINLGERLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            EAEQMIREADLDGDG VNY++FV MM+
Sbjct  121  EAEQMIREADLDGDGLVNYEEFVTMML  147



>gb|AAX31386.1| calmodulin [Aegiceras corniculatum]
Length=149

 Score =   221 bits (563),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L EDQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTEDQISEFREAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++K+MEDTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMAKKMEDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_009408507.1| PREDICTED: calmodulin-like protein 11 [Musa acuminata subsp. 
malaccensis]
Length=148

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
            ++L E+QI EFQEAF LFDKDGDG IT+EEL TVI+SL +NP+EEEL EM+ +VD+  NG
Sbjct  2    DLLTEEQISEFQEAFCLFDKDGDGCITLEELGTVIKSLGQNPSEEELHEMIREVDSDGNG  61

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFLN +S+++++T+ EEELKEAFKVFDKDQNGYISA+ELRNVM+NLGEKLT+EE 
Sbjct  62   TIEFGEFLNLMSRKVKETNVEEELKEAFKVFDKDQNGYISASELRNVMMNLGEKLTDEEV  121

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNV  76
            +QMIREADLDGDGQVNY++FV+MMM V
Sbjct  122  DQMIREADLDGDGQVNYEEFVRMMMAV  148


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (46%), Gaps = 37/103 (36%)
 Frame = -2

Query  270  ELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREADLDGDGQVNYDDFVK  91
            E +EAF +FDKD +G I+  EL  V+ +LG+  +EEE  +MIRE D DG+G + + +F+ 
Sbjct  11   EFQEAFCLFDKDGDGCITLEELGTVIKSLGQNPSEEELHEMIREVDSDGNGTIEFGEFLN  70

Query  90   M-------------------------------------MMNVG  73
            +                                     MMN+G
Sbjct  71   LMSRKVKETNVEEELKEAFKVFDKDQNGYISASELRNVMMNLG  113



>ref|XP_011080472.1| PREDICTED: calmodulin [Sesamum indicum]
Length=149

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADMDGDGQINYDEFVKVMM  147



>ref|XP_003624801.1| Calmodulin [Medicago truncatula]
 gb|AES81019.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=149

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>ref|NP_001042747.1| Os01g0279300 [Oryza sativa Japonica Group]
 sp|Q0JNL7.1|CALM3_ORYSJ RecName: Full=Calmodulin-3; Short=CaM-3 [Oryza sativa Japonica 
Group]
 dbj|BAA87825.1| calmodulin [Oryza sativa Japonica Group]
 dbj|BAF04661.1| Os01g0279300 [Oryza sativa Japonica Group]
 dbj|BAG86763.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54334.1| hypothetical protein OsJ_01307 [Oryza sativa Japonica Group]
Length=149

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVEEMIREADVDGDGQINYDEFVKVMM  147



>ref|XP_006298722.1| hypothetical protein CARUB_v10014817mg [Capsella rubella]
 gb|EOA31620.1| hypothetical protein CARUB_v10014817mg [Capsella rubella]
Length=157

 Score =   221 bits (562),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  501  DQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFK  322
            +QIMEF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+ ++D+  NG IEF 
Sbjct  15   EQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTIEFS  74

Query  321  EFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIR  142
            EFLN ++ ++++TD++EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE  QMI+
Sbjct  75   EFLNLMANQIQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVNQMIK  134

Query  141  EADLDGDGQVNYDDFVKMMMNVG  73
            EADLDGDGQVNYD+FV+MMM  G
Sbjct  135  EADLDGDGQVNYDEFVRMMMTNG  157



>ref|XP_004251248.1| PREDICTED: calmodulin [Solanum lycopersicum]
Length=180

 Score =   221 bits (564),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG*GGLMYAWFINPMWSTHNYK  13
            E ++MIREAD+DGDGQ+NYD+FVK+MM      ++ +  + P+  ++  K
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMMAKRRMKMVQSKSVKPISQSNGRK  170



>sp|O82018.3|CALM_MOUSC RecName: Full=Calmodulin; Short=CaM [Mougeotia scalaris]
 emb|CAA74111.1| Calmodulin [Mougeotia scalaris]
Length=149

 Score =   220 bits (561),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L E+QI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNGYISA + R+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAADWRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FVKMMM
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVKMMM  147



>ref|NP_001275359.1| calmodulin-5/6/7/8 [Solanum tuberosum]
 ref|XP_004228488.1| PREDICTED: calmodulin-5/6/7/8 [Solanum lycopersicum]
 sp|Q7DMN9.3|CALM5_SOLTU RecName: Full=Calmodulin-5/6/7/8; Short=CaM-5/6/7/8 [Solanum 
tuberosum]
 pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6
 gb|AAA62351.1| calmodulin [Solanum tuberosum]
 gb|AAA85155.1| calmodulin [Solanum tuberosum]
 gb|AAA85156.1| calmodulin [Solanum tuberosum]
 gb|AAA85157.1| calmodulin [Solanum tuberosum]
 emb|CAC84561.1| putative calmodulin [Solanum commersonii]
 gb|ABA40458.1| calmodulin 5/6/7/8-like protein [Solanum tuberosum]
 gb|ABA46768.1| putative calmodulin-like protein [Solanum tuberosum]
Length=149

 Score =   220 bits (561),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L EDQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>ref|XP_004142655.1| PREDICTED: calmodulin-like isoform 1 [Cucumis sativus]
 ref|XP_004142656.1| PREDICTED: calmodulin-like isoform 2 [Cucumis sativus]
 ref|XP_004172209.1| PREDICTED: calmodulin-like isoform 1 [Cucumis sativus]
 ref|XP_004172210.1| PREDICTED: calmodulin-like isoform 2 [Cucumis sativus]
 ref|XP_008464615.1| PREDICTED: calmodulin [Cucumis melo]
 gb|KGN54503.1| hypothetical protein Csa_4G340540 [Cucumis sativus]
Length=149

 Score =   220 bits (561),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLTEE
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTEE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>ref|XP_001765847.1| predicted protein [Physcomitrella patens]
 gb|EDQ69438.1| predicted protein [Physcomitrella patens]
Length=149

 Score =   220 bits (561),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEHLTEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MMM
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMM  147



>gb|ABK21927.1| unknown [Picea sitchensis]
Length=149

 Score =   220 bits (561),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MAN L E+QI EF+EAFSLFD+DGDGSIT +EL+TVIRSL +NPTE E+Q+M+N+VDT  
Sbjct  1    MANPLTEEQIAEFREAFSLFDRDGDGSITTKELSTVIRSLGQNPTEAEIQDMINEVDTDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F+EFL+ ++ +++D DS+EEL+EAFKVFDKDQNGYISA ELR+VMINLGEKLTEE
Sbjct  61   NGTIDFREFLDLMAHKIKDLDSDEELREAFKVFDKDQNGYISAAELRHVMINLGEKLTEE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E MI+EAD DGDGQVNY++FV+MMM
Sbjct  121  EVELMIKEADTDGDGQVNYEEFVRMMM  147



>gb|AFA89861.2| calmodulin 1 [Lilium longiflorum]
Length=149

 Score =   220 bits (560),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L EDQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADMDGDGQVNYEEFVRMML  147



>gb|AEG75427.1| calmodulin [Aquilaria microcarpa]
Length=149

 Score =   220 bits (560),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++K+M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>ref|XP_008798212.1| PREDICTED: calmodulin [Phoenix dactylifera]
Length=149

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVEEMIREADIDGDGQVNYEEFVRMML  147



>ref|XP_010511906.1| PREDICTED: calmodulin-like protein 11 [Camelina sativa]
Length=158

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -2

Query  510  LNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAI  331
            L  +QI EF+EAF LFDKDGDG IT  ELATVIRSLD+NPTE+ELQ+M+ ++D+  NG I
Sbjct  13   LTHEQITEFKEAFCLFDKDGDGCITAAELATVIRSLDQNPTEQELQDMITEIDSDGNGTI  72

Query  330  EFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQ  151
            EF EFLN ++ ++++TD +EELKEAFKVFDKDQNGYISA ELR+VMINLGEKLT+EE +Q
Sbjct  73   EFSEFLNLMANQIQETDVDEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDEEVDQ  132

Query  150  MIREADLDGDGQVNYDDFVKMMMNVG  73
            MI+EADLDGDGQVNYD+FV+MMM  G
Sbjct  133  MIKEADLDGDGQVNYDEFVRMMMTNG  158



>emb|CDY06478.1| BnaC06g11660D [Brassica napus]
Length=151

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  510  LNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAI  331
            L +D+I+ F+EAF LFDKDGDG ITVE+LA VIRSLD++PTE+E Q+++ ++D+  NG I
Sbjct  6    LTKDEIIGFKEAFCLFDKDGDGCITVEDLAIVIRSLDQHPTEQEFQDIITEIDSDGNGTI  65

Query  330  EFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQ  151
            EF EFLN ++K+++++D+EEELKE FKVFDKDQNGYISA+EL +VMINLGEKLT+EEAEQ
Sbjct  66   EFAEFLNLMAKKLQESDAEEELKEVFKVFDKDQNGYISASELSHVMINLGEKLTDEEAEQ  125

Query  150  MIREADLDGDGQVNYDDFVKMMMNVG  73
            MI+EADLDGDG VNYD+FVKMM+N+G
Sbjct  126  MIKEADLDGDGHVNYDEFVKMMINIG  151



>sp|A2WNH1.2|CALM3_ORYSI RecName: Full=Calmodulin-3; Short=CaM-3 [Oryza sativa Indica 
Group]
 emb|CAA78288.1| calmodulin [Oryza sativa Indica Group]
 gb|AAA33900.1| calmodulin [Oryza sativa Indica Group]
 gb|EEC70407.1| hypothetical protein OsI_01399 [Oryza sativa Indica Group]
Length=149

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>dbj|BAF31994.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF31995.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF31996.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF31997.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF31998.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF31999.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32000.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32001.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32002.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32003.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32004.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32005.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32006.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32007.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32008.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32009.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32010.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32011.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32012.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32013.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32014.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32015.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32016.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32017.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32018.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32019.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32020.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32021.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32022.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32023.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32024.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32025.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32026.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32027.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32028.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32029.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32030.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32031.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32032.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32033.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32034.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32035.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32036.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32037.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32038.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32039.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32040.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32041.1| putative calmodulin [Cryptomeria japonica]
 dbj|BAF32140.1| putative calmodulin [Taxodium distichum]
 gb|ACJ77055.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77056.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77057.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77058.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77059.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77060.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77061.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77062.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77063.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77064.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77065.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77066.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77067.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77068.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77069.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77070.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77071.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77072.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77073.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77074.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77075.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77076.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77077.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77078.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77079.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77080.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77081.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77082.1| putative calmodulin [Taxodium distichum var. imbricarium]
 gb|ACJ77083.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77084.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77085.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77086.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77087.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77088.1| putative calmodulin [Taxodium distichum var. distichum]
 gb|ACJ77089.1| putative calmodulin [Taxodium distichum var. distichum]
Length=149

 Score =   219 bits (558),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L EDQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMML  147



>ref|XP_004249098.1| PREDICTED: calmodulin [Solanum lycopersicum]
 ref|XP_006340365.1| PREDICTED: calmodulin-like [Solanum tuberosum]
 ref|XP_006364752.1| PREDICTED: calmodulin-like [Solanum tuberosum]
 ref|XP_006419159.1| hypothetical protein EUTSA_v10002700mg [Eutrema salsugineum]
 ref|XP_009126509.1| PREDICTED: calmodulin [Brassica rapa]
 ref|XP_009131839.1| PREDICTED: calmodulin [Brassica rapa]
 ref|XP_009630239.1| PREDICTED: calmodulin [Nicotiana tomentosiformis]
 ref|XP_009757652.1| PREDICTED: calmodulin [Nicotiana sylvestris]
 ref|XP_010557478.1| PREDICTED: calmodulin [Tarenaya hassleriana]
 sp|P93087.3|CALM_CAPAN RecName: Full=Calmodulin; Short=CaM [Capsicum annuum]
 gb|AAB46588.1| calmodulin [Capsicum annuum]
 gb|AAF65511.1| calmodulin [Capsicum annuum]
 dbj|BAB61915.1| calmodulin NtCaM9 [Nicotiana tabacum]
 dbj|BAB61916.1| calmodulin NtCaM10 [Nicotiana tabacum]
 emb|CAD20351.1| calmodulin 2 [Brassica oleracea]
 gb|AAS13433.1| calmodulin [Nicotiana attenuata]
 gb|AAT40502.1| Calmodulin , putative [Solanum demissum]
 gb|ABA81860.1| calmodulin-like [Solanum tuberosum]
 gb|ABE11610.1| calmodulin [Solanum chacoense]
 gb|ACF93134.1| calmodulin [Camellia oleifera]
 gb|ACM89455.1| calmodulin 2 [Camellia oleifera]
 gb|AFA26559.1| calmodulin [Brassica oleracea]
 gb|AFA26560.1| calmodulin [Brassica oleracea]
 gb|AFA26561.1| calmodulin [Brassica oleracea]
 gb|AFA26562.1| calmodulin [Brassica oleracea]
 gb|AFW90602.1| calmodulin [Solanum tuberosum]
 gb|ESQ37595.1| hypothetical protein EUTSA_v10002700mg [Eutrema salsugineum]
 gb|EYU35666.1| hypothetical protein MIMGU_mgv1a015693mg [Erythranthe guttata]
 gb|KFK33864.1| hypothetical protein AALP_AA5G069900 [Arabis alpina]
 emb|CDY16599.1| BnaC09g36740D [Brassica napus]
 emb|CDY09106.1| BnaA02g05320D [Brassica napus]
 emb|CDX88824.1| BnaA03g08250D [Brassica napus]
 emb|CDX87950.1| BnaC03g54460D [Brassica napus]
 emb|CDX70966.1| BnaC03g10500D [Brassica napus]
Length=149

 Score =   219 bits (558),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>ref|XP_001763057.1| predicted protein [Physcomitrella patens]
 gb|EDQ72262.1| predicted protein [Physcomitrella patens]
Length=149

 Score =   219 bits (558),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEHLTEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMM  85
            E ++MIREAD+DGDGQV+YD+FVKMM
Sbjct  121  EVDEMIREADVDGDGQVDYDEFVKMM  146


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  489  EFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEFLN  310
            E +EAF +FDKD +G I+  EL  V+ +L +  T+EE+ EM+ + D   +G +++ EF+ 
Sbjct  85   ELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVDYDEFVK  144

Query  309  ALSKR  295
             +  +
Sbjct  145  MMKAK  149



>ref|XP_007202636.1| hypothetical protein PRUPE_ppa012070mg [Prunus persica]
 gb|EMJ03835.1| hypothetical protein PRUPE_ppa012070mg [Prunus persica]
Length=184

 Score =   220 bits (561),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -2

Query  537  NKNGGMANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMND  358
            N+   MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+
Sbjct  31   NRQAPMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE  90

Query  357  VDTGSNGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGE  178
            VD   NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGE
Sbjct  91   VDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE  150

Query  177  KLTEEEAEQMIREADLDGDGQVNYDDFVKMMM  82
            KLT+EE ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  151  KLTDEEVDEMIREADVDGDGQINYEEFVKVMM  182



>ref|XP_009398373.1| PREDICTED: calmodulin-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=148

 Score =   219 bits (558),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  516  NVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNG  337
            ++L ++QI+EFQEAF LFDKDGDG IT+EEL TVI+SL ++P+EEELQEM+ +VD+  NG
Sbjct  2    DILTDEQIIEFQEAFCLFDKDGDGCITLEELGTVIKSLGQDPSEEELQEMIREVDSDGNG  61

Query  336  AIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEA  157
             IEF EFLN +++++++T+ EEELKEAFKVFDKDQNG+ISA ELRNVMINLGEKLT+EE 
Sbjct  62   TIEFGEFLNLMARKVKETNIEEELKEAFKVFDKDQNGFISATELRNVMINLGEKLTDEEV  121

Query  156  EQMIREADLDGDGQVNYDDFVKMMMNV  76
            +QMIREADLDGDGQVNY++FV+MMM V
Sbjct  122  DQMIREADLDGDGQVNYEEFVRMMMAV  148



>ref|XP_010243681.1| PREDICTED: calmodulin-like [Nelumbo nucifera]
Length=149

 Score =   219 bits (558),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVEEMIREADIDGDGQVNYEEFVRMML  147



>ref|XP_009120715.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin [Brassica rapa]
Length=160

 Score =   219 bits (559),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>ref|XP_003567308.1| PREDICTED: calmodulin-3 [Brachypodium distachyon]
 gb|AAC49582.1| calmodulin TaCaM2-2 [Triticum aestivum]
 gb|AAC49583.1| calmodulin TaCaM2-3 [Triticum aestivum]
 gb|EMS58580.1| Calmodulin-3 [Triticum urartu]
 emb|CDM82931.1| unnamed protein product [Triticum aestivum]
Length=149

 Score =   219 bits (557),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++M+READ+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMVREADVDGDGQINYDEFVKVMM  147



>dbj|BAA94696.1| calmodulin [Chara corallina]
 dbj|BAA94697.1| calmodulin [Chara corallina]
 dbj|BAA96536.1| calmodulin [Chara corallina]
Length=148

 Score =   219 bits (557),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  510  LNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAI  331
            L ++QI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   NG I
Sbjct  4    LTDEQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDVDGNGTI  63

Query  330  EFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQ  151
            +F EFLN ++++M+DTDSEEELKEAFKVFDKDQNGYISA ELR+VM NLGEKLT+EE ++
Sbjct  64   DFHEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAAELRHVMTNLGEKLTDEEVDE  123

Query  150  MIREADLDGDGQVNYDDFVKMMM  82
            MIREAD+DGDGQVNY++FVKMMM
Sbjct  124  MIREADVDGDGQVNYEEFVKMMM  146



>ref|XP_006854084.1| hypothetical protein AMTR_s00048p00127800 [Amborella trichopoda]
 gb|ERN15551.1| hypothetical protein AMTR_s00048p00127800 [Amborella trichopoda]
Length=149

 Score =   219 bits (557),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVEEMIREADVDGDGQVNYEEFVRMML  147



>ref|XP_010553894.1| PREDICTED: calmodulin-7-like [Tarenaya hassleriana]
 gb|ADN96172.1| calmodulin [Malus pumila]
Length=149

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVEEMIREADVDGDGQINYEEFVKIMM  147



>ref|XP_006369409.1| calmodulin-like protein 6a [Populus trichocarpa]
 ref|XP_011008391.1| PREDICTED: calmodulin [Populus euphratica]
 sp|P93171.3|CALM_HELAN RecName: Full=Calmodulin; Short=CaM [Helianthus annuus]
 gb|AAB68399.1| calmodulin [Helianthus annuus]
 gb|ERP65978.1| calmodulin-like protein 6a [Populus trichocarpa]
Length=149

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L EDQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_010936850.1| PREDICTED: calmodulin [Elaeis guineensis]
Length=149

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL+TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELSTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFSEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVRMML  147



>ref|XP_009150282.1| PREDICTED: calmodulin-like [Brassica rapa]
 ref|XP_009103571.1| PREDICTED: calmodulin-like [Brassica rapa]
 emb|CDY56411.1| BnaC04g54820D [Brassica napus]
 emb|CDY04474.1| BnaA07g13000D [Brassica napus]
Length=149

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++M+READ+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMVREADVDGDGQINYDEFVKVMM  147



>ref|XP_002507130.1| calmodulin [Micromonas sp. RCC299]
 gb|ACO68388.1| calmodulin [Micromonas sp. RCC299]
Length=149

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAF+LFDKDGDG+IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADTLTDEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKD NG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMQDTDSEEELKEAFKVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNYD+FVKMMM
Sbjct  121  EVDEMIREADVDGDGQVNYDEFVKMMM  147



>gb|AFK45794.1| unknown [Lotus japonicus]
Length=149

 Score =   218 bits (556),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_009417893.1| PREDICTED: calmodulin-3 [Musa acuminata subsp. malaccensis]
Length=149

 Score =   218 bits (556),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>emb|CDY30947.1| BnaA06g19660D [Brassica napus]
Length=209

 Score =   221 bits (562),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++M+READ+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMVREADVDGDGQINYDEFVKVMM  147



>ref|XP_009419686.1| PREDICTED: calmodulin-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   218 bits (556),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKIMM  147



>ref|XP_003056131.1| calmodulin [Micromonas pusilla CCMP1545]
 gb|EEH59507.1| calmodulin [Micromonas pusilla CCMP1545]
Length=149

 Score =   218 bits (556),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAF+LFDKDGDG+IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADTLTDEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKD NG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNYD+FVKMMM
Sbjct  121  EVDEMIREADVDGDGQVNYDEFVKMMM  147



>ref|XP_003632230.1| PREDICTED: calmodulin-7 isoform X1 [Vitis vinifera]
Length=180

 Score =   219 bits (559),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = -2

Query  489  EFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEFLN  310
            E +EAF +FDKD +G I+  EL  V+ +L +  T+EE+ EM+ + D   +G I ++EF+ 
Sbjct  85   ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  144

Query  309  ALSKRMEDTDSEEELK  262
             +  +      EE+ K
Sbjct  145  VMMAKRRKMRVEEKSK  160



>ref|XP_009402452.1| PREDICTED: calmodulin [Musa acuminata subsp. malaccensis]
Length=149

 Score =   218 bits (556),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>gb|ABG82015.1| calmodulin [Vigna radiata var. radiata]
Length=148

 Score =   218 bits (556),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>tpg|DAA45101.1| TPA: calmodulin3, partial [Zea mays]
Length=158

 Score =   218 bits (556),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|AAQ63461.1| calmodulin 4 [Daucus carota]
 gb|AAQ63462.1| calmodulin 8 [Daucus carota]
Length=150

 Score =   218 bits (555),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG  73
            E ++MIREAD+DGDGQ+NY++FVK+MM  G
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMAKG  150



>gb|ABR21756.1| calmodulin [Actinidia polygama]
Length=148

 Score =   218 bits (555),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADSLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_001760060.1| predicted protein [Physcomitrella patens]
 gb|EDQ75185.1| predicted protein [Physcomitrella patens]
Length=149

 Score =   218 bits (555),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M   L EDQI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MVEQLTEDQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT++
Sbjct  61   NGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVKMMM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKMMM  147



>gb|ADK23955.1| calmodulin [Aquilaria microcarpa]
 gb|ADK23956.1| calmodulin [Aquilaria microcarpa]
 gb|AEG75428.1| calmodulin [Aquilaria microcarpa]
Length=149

 Score =   218 bits (555),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++M+READ+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMVREADVDGDGQINYEEFVKVMM  147



>gb|ABR21759.1| calmodulin [Actinidia deliciosa var. chlorocarpa]
Length=148

 Score =   218 bits (555),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            +GAI+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   SGAIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|NP_176814.1| calmodulin 4 [Arabidopsis thaliana]
 ref|NP_198594.1| calmodulin 1 [Arabidopsis thaliana]
 ref|XP_002870564.1| hypothetical protein ARALYDRAFT_915929 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002888498.1| hypothetical protein ARALYDRAFT_894287 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006284698.1| hypothetical protein CARUB_v10005958mg [Capsella rubella]
 ref|XP_006302967.1| hypothetical protein CARUB_v10021106mg [Capsella rubella]
 ref|XP_006391396.1| hypothetical protein EUTSA_v10019293mg [Eutrema salsugineum]
 ref|XP_006405835.1| hypothetical protein EUTSA_v10027976mg [Eutrema salsugineum]
 ref|XP_010511465.1| PREDICTED: calmodulin-1 [Camelina sativa]
 ref|XP_010415183.1| PREDICTED: calmodulin-1 [Camelina sativa]
 ref|XP_010435687.1| PREDICTED: calmodulin-1 [Camelina sativa]
 ref|XP_010440887.1| PREDICTED: calmodulin-1 [Camelina sativa]
 ref|XP_010450539.1| PREDICTED: calmodulin-1 [Camelina sativa]
 ref|XP_010470516.1| PREDICTED: calmodulin-1 [Camelina sativa]
 sp|P0DH95.1|CALM1_ARATH RecName: Full=Calmodulin-1; Short=CaM-1 [Arabidopsis thaliana]
 sp|P0DH96.1|CALM4_ARATH RecName: Full=Calmodulin-4; Short=CaM-4 [Arabidopsis thaliana]
 gb|AAG51164.1|AC074025_14 calmodulin [Arabidopsis thaliana]
 gb|AAG52168.1|AC020665_13 calmodulin-4; 77432-76078 [Arabidopsis thaliana]
 gb|AAK44108.1|AF370293_1 putative calmodulin-4 protein [Arabidopsis thaliana]
 dbj|BAB10354.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAK82538.1| AT5g37780/K22F20_20 [Arabidopsis thaliana]
 gb|AAL24291.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL62019.1| AT5g37780/K22F20_20 [Arabidopsis thaliana]
 gb|AAL66935.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44950.1| putative calmodulin-4 protein [Arabidopsis thaliana]
 gb|AAM66012.1| calmodulin CAM1 [Arabidopsis thaliana]
 gb|EFH46823.1| hypothetical protein ARALYDRAFT_915929 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64757.1| hypothetical protein ARALYDRAFT_894287 [Arabidopsis lyrata subsp. 
lyrata]
 dbj|BAJ34428.1| unnamed protein product [Thellungiella halophila]
 gb|AED94230.1| calmodulin 1 [Arabidopsis thaliana]
 gb|AEE34505.1| calmodulin 4 [Arabidopsis thaliana]
 gb|EOA17596.1| hypothetical protein CARUB_v10005958mg [Capsella rubella]
 gb|EOA35865.1| hypothetical protein CARUB_v10021106mg [Capsella rubella]
 gb|ESQ28682.1| hypothetical protein EUTSA_v10019293mg [Eutrema salsugineum]
 gb|ESQ47288.1| hypothetical protein EUTSA_v10027976mg [Eutrema salsugineum]
Length=149

 Score =   218 bits (555),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++K+M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVEEMIREADVDGDGQINYEEFVKIMM  147



>gb|KDP45998.1| hypothetical protein JCGZ_14905 [Jatropha curcas]
Length=181

 Score =   219 bits (558),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>emb|CAA62150.1| Calmodulin [Physcomitrella patens]
Length=149

 Score =   218 bits (555),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L E+QI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADDLTEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMM  85
            E ++MIR+AD+DGDGQV+YD+FVKMM
Sbjct  121  EVDEMIRDADVDGDGQVDYDEFVKMM  146


 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  489  EFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEFLN  310
            E +EAF +FDKD +G I+  EL  V+ +L +  T+EE+ EM+ D D   +G +++ EF+ 
Sbjct  85   ELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIRDADVDGDGQVDYDEFVK  144

Query  309  ALSKR  295
             +  +
Sbjct  145  MMKAK  149



>ref|XP_004252866.2| PREDICTED: LOW QUALITY PROTEIN: calmodulin [Solanum lycopersicum]
Length=178

 Score =   219 bits (557),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  489  EFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEFLN  310
            E +EAF +FDKD +G I+  EL  V+ +L +  T+EE+ EM+ + D   +G I + EF+ 
Sbjct  85   ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDEFVK  144

Query  309  ALSKRME  289
             +  + E
Sbjct  145  VMMAKXE  151



>emb|CDX77060.1| BnaC04g38550D [Brassica napus]
Length=180

 Score =   219 bits (557),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ABK23242.1| unknown [Picea sitchensis]
 gb|ABR18064.1| unknown [Picea sitchensis]
Length=149

 Score =   218 bits (554),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L EDQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+++VD   
Sbjct  1    MAEQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMML  147



>ref|XP_009782644.1| PREDICTED: calmodulin-7-like isoform X1 [Nicotiana sylvestris]
Length=181

 Score =   219 bits (557),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_002963446.1| hypothetical protein SELMODRAFT_141966 [Selaginella moellendorffii]
 ref|XP_002971581.1| hypothetical protein SELMODRAFT_172372 [Selaginella moellendorffii]
 gb|EFJ27330.1| hypothetical protein SELMODRAFT_172372 [Selaginella moellendorffii]
 gb|EFJ35317.1| hypothetical protein SELMODRAFT_141966 [Selaginella moellendorffii]
Length=149

 Score =   218 bits (554),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L EDQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT++
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVKMM+
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKMML  147



>ref|XP_008811949.1| PREDICTED: calmodulin-7 isoform X1 [Phoenix dactylifera]
Length=182

 Score =   219 bits (557),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ABR21718.1| calmodulin [Actinidia melliana]
 gb|ABR21724.1| calmodulin [Clematoclethra scandens subsp. tomentella]
 gb|ABR21745.1| calmodulin [Actinidia polygama]
 gb|ABR21747.1| calmodulin [Actinidia melliana]
 gb|ABR21757.1| calmodulin [Actinidia polygama]
Length=148

 Score =   218 bits (554),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADSLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|AAL79908.1|AF474074_1 calmodulin [Stevia rebaudiana]
 gb|AAL73544.1| calmodulin [Stevia rebaudiana]
 gb|AAV88359.1| calmodulin [Hevea brasiliensis]
 gb|AAV88360.1| calmodulin [Hevea brasiliensis]
 gb|ABR21707.1| calmodulin [Actinidia chinensis]
 gb|ABR21710.1| calmodulin [Actinidia deliciosa var. deliciosa]
 gb|ABR21712.1| calmodulin [Actinidia eriantha f. alba]
 gb|ABR21713.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21714.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21715.1| calmodulin [Actinidia sabiifolia]
 gb|ABR21717.1| calmodulin [Actinidia sabiifolia]
 gb|ABR21720.1| calmodulin [Actinidia arguta]
 gb|ABR21721.1| calmodulin [Actinidia sabiifolia]
 gb|ABR21722.1| calmodulin [Actinidia polygama]
 gb|ABR21723.1| calmodulin [Actinidia valvata]
 gb|ABR21736.1| calmodulin [Clematoclethra scandens subsp. tomentella]
 gb|ABR21737.1| calmodulin [Clematoclethra scandens subsp. tomentella]
 gb|ABR21738.1| calmodulin [Clematoclethra scandens subsp. tomentella]
 gb|ABR21739.1| calmodulin [Actinidia deliciosa var. deliciosa]
 gb|ABR21740.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21742.1| calmodulin [Actinidia chinensis]
 gb|ABR21743.1| calmodulin [Actinidia sabiifolia]
 gb|ABR21748.1| calmodulin [Actinidia deliciosa var. deliciosa]
 gb|ABR21749.1| calmodulin [Actinidia sabiifolia]
 gb|ABR21751.1| calmodulin [Actinidia kolomikta]
 gb|ABR21752.1| calmodulin [Actinidia polygama]
 gb|ABR21753.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21755.1| calmodulin [Actinidia arguta]
 gb|ABR21758.1| calmodulin [Actinidia chinensis]
 gb|ABR21760.1| calmodulin [Actinidia eriantha f. alba]
 gb|ABR21763.1| calmodulin [Actinidia deliciosa var. deliciosa]
 gb|ABR21764.1| calmodulin [Actinidia melliana]
 gb|ABR21766.1| calmodulin [Clematoclethra scandens subsp. tomentella]
 gb|ABR21768.1| calmodulin [Actinidia polygama]
 gb|ABR21770.1| calmodulin [Saurauia tristyla]
Length=148

 Score =   218 bits (554),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_009140755.1| PREDICTED: calmodulin-7-like [Brassica rapa]
 emb|CDY48191.1| BnaA04g15550D [Brassica napus]
Length=179

 Score =   219 bits (557),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|KFK26360.1| hypothetical protein AALP_AA8G238300 [Arabis alpina]
 emb|CDY65072.1| BnaCnng45820D [Brassica napus]
Length=149

 Score =   218 bits (554),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MI+EAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIKEADVDGDGQINYDEFVKVMM  147



>ref|XP_009782645.1| PREDICTED: calmodulin-7-like isoform X2 [Nicotiana sylvestris]
Length=180

 Score =   219 bits (557),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ACL13151.1| calmodulin 1 [Capsicum annuum]
Length=149

 Score =   218 bits (554),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++K+M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADFDGDGQINYEEFVKVMM  147



>gb|ADT89773.1| calmodulin [Elaeis guineensis]
Length=152

 Score =   218 bits (554),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>emb|CDX92965.1| BnaA03g36870D [Brassica napus]
Length=154

 Score =   218 bits (554),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  495  IMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEF  316
            IME  EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+N++D+  NG IEF EF
Sbjct  14   IMELNEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMINEIDSDGNGTIEFSEF  73

Query  315  LNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREA  136
            LN ++ ++++TD++EELKEAFKVFDKDQNGYISA+ELR+VMI+LGEKLT+EE +QMI+EA
Sbjct  74   LNLMANKIQETDADEELKEAFKVFDKDQNGYISASELRHVMISLGEKLTDEEVDQMIKEA  133

Query  135  DLDGDGQVNYDDFVKMMMNVG  73
            DLDGDGQVNYD+FV+MMM  G
Sbjct  134  DLDGDGQVNYDEFVRMMMASG  154



>ref|XP_008364032.1| PREDICTED: calmodulin-like [Malus domestica]
Length=154

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M  VL E+QI+EFQEAF LFDKDGDG IT+EELAT ++ LD NPTEEELQ M+++VD   
Sbjct  6    MGEVLTEEQIVEFQEAFCLFDKDGDGCITIEELATAVKLLDPNPTEEELQNMISEVDVDG  65

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++++M++ D++EELKEAFKVFDKDQ+GYIS NELR+VM+NLGE+LT+E
Sbjct  66   NGTIEFGEFLNLMARKMKENDADEELKEAFKVFDKDQDGYISPNELRHVMVNLGERLTDE  125

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E EQMIREADLDGDG VNY++FV+MM+
Sbjct  126  EVEQMIREADLDGDGLVNYEEFVRMML  152



>ref|XP_010645766.1| PREDICTED: calmodulin [Vitis vinifera]
 emb|CAN72522.1| hypothetical protein VITISV_019208 [Vitis vinifera]
 emb|CBI38257.3| unnamed protein product [Vitis vinifera]
 emb|CDO98639.1| unnamed protein product [Coffea canephora]
Length=149

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMML  147



>gb|ABR21725.1| calmodulin [Clematoclethra scandens subsp. tomentella]
Length=148

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMANLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_009410443.1| PREDICTED: calmodulin-3-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEEL+EAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELREAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>gb|AAM34757.1|AF510075_1 calmodulin 1 [Ceratopteris richardii]
Length=149

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L  DQI EF+EAF LFDKDGDG IT +EL TV+RSL +NPTE ELQEM+N+VD   
Sbjct  1    MAEQLTTDQIAEFKEAFGLFDKDGDGCITTKELGTVMRSLGQNPTEAELQEMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMN  79
            E ++MIREAD+DGDGQVNY++FV+MM++
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMMLS  148



>ref|XP_010069460.1| PREDICTED: calmodulin [Eucalyptus grandis]
Length=149

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE EL++M+N+VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELRDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVEEMIREADVDGDGQVNYEEFVRMML  147



>emb|CAA61980.1| Calmodulin [Bidens pilosa]
Length=149

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISARELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_006374229.1| calmodulin-like protein 6a [Populus trichocarpa]
 ref|XP_011035530.1| PREDICTED: calmodulin-like [Populus euphratica]
 gb|ERP52026.1| calmodulin-like protein 6a [Populus trichocarpa]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M   L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MTEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVEEMIREADVDGDGQVNYEEFVRMML  147



>gb|KHN34595.1| Calmodulin [Glycine soja]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MAN L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MANQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_004299498.1| PREDICTED: calmodulin-like [Fragaria vesca subsp. vesca]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M   L E+QI EF+EAF LFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MTEQLTEEQIAEFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEEL+EAFKVFDKDQNGYISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFSEFLNLMARKMKDTDSEEELREAFKVFDKDQNGYISAAELRHVMANLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMN  79
            E ++MIREAD DGDGQVNYD+FV+MM+N
Sbjct  121  EVDEMIREADEDGDGQVNYDEFVRMMLN  148



>ref|NP_001236109.1| uncharacterized protein LOC100527439 [Glycine max]
 gb|ACU16530.1| unknown [Glycine max]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MAN L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MANQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMN  79
            E ++MIREAD+DGDGQ+NY++FVK+MM 
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMMT  148



>sp|P27164.2|CALM3_PETHY RecName: Full=Calmodulin-related protein [Petunia x hybrida]
 gb|AAA33705.1| calmodulin-related protein [Petunia x hybrida]
Length=184

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|NP_001049948.1| Os03g0319300 [Oryza sativa Japonica Group]
 ref|NP_001060691.1| Os07g0687200 [Oryza sativa Japonica Group]
 ref|NP_001136954.1| uncharacterized protein LOC100217114 [Zea mays]
 ref|NP_001042688.2| Os01g0267900 [Oryza sativa Japonica Group]
 ref|NP_001237883.1| calmodulin-2 [Glycine max]
 ref|NP_001266025.1| uncharacterized protein LOC101494641 [Cicer arietinum]
 ref|NP_001281081.1| uncharacterized protein LOC100192601 [Zea mays]
 ref|XP_002467948.1| hypothetical protein SORBIDRAFT_01g037010 [Sorghum bicolor]
 ref|XP_002441298.1| hypothetical protein SORBIDRAFT_09g024040 [Sorghum bicolor]
 ref|XP_003562430.1| PREDICTED: calmodulin [Brachypodium distachyon]
 ref|XP_003566831.1| PREDICTED: calmodulin [Brachypodium distachyon]
 ref|XP_004967736.1| PREDICTED: calmodulin-like [Setaria italica]
 ref|XP_004984568.1| PREDICTED: calmodulin-like isoform X1 [Setaria italica]
 ref|XP_006644038.1| PREDICTED: calmodulin-1-like [Oryza brachyantha]
 ref|XP_006649997.1| PREDICTED: calmodulin-1-like [Oryza brachyantha]
 ref|XP_008655487.1| PREDICTED: calmodulin [Zea mays]
 ref|XP_008660204.1| PREDICTED: calmodulin [Zea mays]
 ref|XP_010228691.1| PREDICTED: calmodulin [Brachypodium distachyon]
 sp|P62162.2|CALM_HORVU RecName: Full=Calmodulin; Short=CaM [Hordeum vulgare]
 sp|P62163.2|CALM2_SOYBN RecName: Full=Calmodulin-2; Short=CaM-2 [Glycine max]
 sp|A2WN93.2|CALM1_ORYSI RecName: Full=Calmodulin-1; Short=CaM-1 [Oryza sativa Indica 
Group]
 sp|Q0JNS6.2|CALM1_ORYSJ RecName: Full=Calmodulin-1; Short=CaM-1 [Oryza sativa Japonica 
Group]
 gb|AAL35329.1|AF441191_1 calmodulin [Oryza sativa]
 emb|CAA78287.1| calmodulin [Oryza sativa Indica Group]
 gb|AAA32938.1| calmodulin [Hordeum vulgare]
 gb|AAA03580.1| calmodulin [Glycine max]
 gb|AAA33901.1| calmodulin [Oryza sativa Indica Group]
 gb|AAA34237.1| calmodulin [Vigna radiata]
 gb|AAB36130.1| auxin-regulated calmodulin [Vigna radiata]
 emb|CAA70982.1| CaM protein [Cicer arietinum]
 gb|AAC49578.1| calmodulin TaCaM1-1 [Triticum aestivum]
 gb|AAC49579.1| calmodulin TaCaM1-2 [Triticum aestivum]
 gb|AAC49580.1| calmodulin TaCaM1-3 [Triticum aestivum]
 gb|AAC49584.1| calmodulin TaCaM3-1 [Triticum aestivum]
 gb|AAC49585.1| calmodulin TaCaM3-2 [Triticum aestivum]
 gb|AAC49586.1| calmodulin TaCaM3-3 [Triticum aestivum]
 gb|AAC49587.1| calmodulin TaCaM4-1 [Triticum aestivum]
 gb|AAC36059.1| calmodulin [Oryza sativa]
 dbj|BAA88540.1| calmodulin [Oryza sativa Japonica Group]
 dbj|BAC10352.1| calmodulin [Oryza sativa Japonica Group]
 dbj|BAD30293.1| calmodulin [Oryza sativa Japonica Group]
 gb|ABF95646.1| Calmodulin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11862.1| Os03g0319300 [Oryza sativa Japonica Group]
 dbj|BAF22605.1| Os07g0687200 [Oryza sativa Japonica Group]
 gb|EAY89788.1| hypothetical protein OsI_11331 [Oryza sativa Indica Group]
 gb|EAZ26731.1| hypothetical protein OsJ_10641 [Oryza sativa Japonica Group]
 gb|ABR25762.1| calmodulin, putative [Oryza sativa Indica Group]
 gb|ACF79610.1| unknown [Zea mays]
 gb|ACF82959.1| unknown [Zea mays]
 gb|ACF83645.1| unknown [Zea mays]
 gb|ACF83876.1| unknown [Zea mays]
 gb|ACG25000.1| calmodulin [Zea mays]
 gb|ACG32312.1| calmodulin [Zea mays]
 gb|ACG33186.1| calmodulin [Zea mays]
 gb|ACG43585.1| calmodulin [Zea mays]
 gb|ACG46140.1| calmodulin [Zea mays]
 dbj|BAG91765.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92729.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01268.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACJ84166.1| unknown [Medicago truncatula]
 gb|EEC70374.1| hypothetical protein OsI_01318 [Oryza sativa Indica Group]
 gb|EEC82716.1| hypothetical protein OsI_27397 [Oryza sativa Indica Group]
 gb|EEE67848.1| hypothetical protein OsJ_25643 [Oryza sativa Japonica Group]
 gb|EER94946.1| hypothetical protein SORBIDRAFT_01g037010 [Sorghum bicolor]
 gb|EES19728.1| hypothetical protein SORBIDRAFT_09g024040 [Sorghum bicolor]
 gb|ACT53871.1| calmodulin [Saccharum officinarum]
 gb|ACU19990.1| unknown [Glycine max]
 dbj|BAF04602.2| Os01g0267900 [Oryza sativa Japonica Group]
 dbj|BAJ85012.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99627.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88874.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFK47371.1| unknown [Medicago truncatula]
 gb|AFW79590.1| calmodulin [Zea mays]
 gb|AFW88536.1| calmodulin [Zea mays]
 tpg|DAA41802.1| TPA: calmodulin [Zea mays]
 tpg|DAA45102.1| TPA: calmodulin3 [Zea mays]
 tpg|DAA64210.1| TPA: calmodulin [Zea mays]
 gb|EMS51651.1| Calmodulin-related protein [Triticum urartu]
 gb|EMT28170.1| Calmodulin-related protein [Aegilops tauschii]
 gb|AGT16211.1| calmodulin [Saccharum hybrid cultivar R570]
 gb|AGT16609.1| calmodulin [Saccharum hybrid cultivar R570]
 gb|AGT17164.1| calmodulin [Saccharum hybrid cultivar R570]
 emb|CDM82802.1| unnamed protein product [Triticum aestivum]
 prf||1604476A calmodulin
 prf||2121384B calmodulin
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ACB32228.1| calmodulin [Beta vulgaris]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L++DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLSDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|NP_001105547.1| calmodulin2 [Zea mays]
 emb|CAA54583.1| calmodulin [Zea mays]
 gb|ACR34795.1| unknown [Zea mays]
 tpg|DAA54034.1| TPA: calmodulin2 [Zea mays]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>ref|XP_010271350.1| PREDICTED: calmodulin [Nelumbo nucifera]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMML  147



>gb|ACU22802.1| unknown [Glycine max]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VMINLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ACG63497.1| TCH [Ipomoea batatas]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADKLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_006378996.1| hypothetical protein POPTR_0009s02660g [Populus trichocarpa]
 gb|ERP56793.1| hypothetical protein POPTR_0009s02660g [Populus trichocarpa]
Length=179

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = -2

Query  489  EFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEFLN  310
            E +EAF +FDKD +G I+  EL  V+ +L +  T+EE+ EM+ + D   +G I ++EF+ 
Sbjct  85   ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  144

Query  309  AL--SKRMEDTDSEE  271
             +   KR   +DS+E
Sbjct  145  VMMAKKRKMRSDSKE  159



>emb|CBI24333.3| unnamed protein product [Vitis vinifera]
Length=153

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_009105204.1| PREDICTED: calmodulin-1 [Brassica rapa]
 emb|CDX96148.1| BnaA07g25830D [Brassica napus]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++K+M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+M+READ+DGDGQ+NY++FVK+MM
Sbjct  121  EVEEMVREADVDGDGQINYEEFVKIMM  147



>ref|XP_010551920.1| PREDICTED: calmodulin-7-like [Tarenaya hassleriana]
 ref|XP_010528533.1| PREDICTED: calmodulin-7-like [Tarenaya hassleriana]
 ref|XP_010520482.1| PREDICTED: calmodulin-7-like [Tarenaya hassleriana]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKIMM  147



>emb|CAC84562.1| putative calmodulin [Solanum commersonii]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTESELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLVARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|NP_189967.1| calmodulin 7 [Arabidopsis thaliana]
 ref|XP_002307936.1| calmodulin 6 family protein [Populus trichocarpa]
 ref|XP_002314234.1| calmodulin-like protein 6a [Populus trichocarpa]
 ref|XP_002322582.1| calmodulin 6 family protein [Populus trichocarpa]
 ref|XP_002515603.1| calmodulin, putative [Ricinus communis]
 ref|XP_002527384.1| calmodulin, putative [Ricinus communis]
 ref|XP_002877296.1| hypothetical protein ARALYDRAFT_484819 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004142178.1| PREDICTED: calmodulin-related protein-like [Cucumis sativus]
 ref|XP_004169960.1| PREDICTED: calmodulin-related protein-like [Cucumis sativus]
 ref|XP_004249344.1| PREDICTED: calmodulin-7 [Solanum lycopersicum]
 ref|XP_004288617.1| PREDICTED: calmodulin-related protein-like [Fragaria vesca subsp. 
vesca]
 ref|XP_004489627.1| PREDICTED: calmodulin-like [Cicer arietinum]
 ref|XP_006339234.1| PREDICTED: calmodulin-1-like [Solanum tuberosum]
 ref|XP_006286601.1| hypothetical protein CARUB_v10002202mg [Capsella rubella]
 ref|XP_006430433.1| hypothetical protein CICLE_v10013029mg [Citrus clementina]
 ref|XP_006430434.1| hypothetical protein CICLE_v10013030mg [Citrus clementina]
 ref|XP_006446395.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 ref|XP_006470427.1| PREDICTED: calmodulin-7-like [Citrus sinensis]
 ref|XP_006481977.1| PREDICTED: calmodulin-7-like [Citrus sinensis]
 ref|XP_006481978.1| PREDICTED: calmodulin-7-like [Citrus sinensis]
 ref|XP_007161842.1| hypothetical protein PHAVU_001G102700g [Phaseolus vulgaris]
 ref|XP_007212203.1| hypothetical protein PRUPE_ppa012912mg [Prunus persica]
 ref|XP_008240643.1| PREDICTED: calmodulin-7 [Prunus mume]
 ref|XP_008362433.1| PREDICTED: calmodulin-7 [Malus domestica]
 ref|XP_008392529.1| PREDICTED: calmodulin-7 [Malus domestica]
 ref|XP_008347105.1| PREDICTED: calmodulin-7 [Malus domestica]
 ref|XP_008449849.1| PREDICTED: calmodulin-7 [Cucumis melo]
 ref|XP_008786809.1| PREDICTED: calmodulin-7 [Phoenix dactylifera]
 ref|XP_008811950.1| PREDICTED: calmodulin-7 isoform X2 [Phoenix dactylifera]
 ref|XP_008777502.1| PREDICTED: calmodulin-7 [Phoenix dactylifera]
 ref|XP_009344980.1| PREDICTED: calmodulin-7 [Pyrus x bretschneideri]
 ref|XP_009345368.1| PREDICTED: calmodulin-7 [Pyrus x bretschneideri]
 ref|XP_009609538.1| PREDICTED: calmodulin-7 [Nicotiana tomentosiformis]
 ref|XP_009626334.1| PREDICTED: calmodulin-7 [Nicotiana tomentosiformis]
 ref|XP_009595177.1| PREDICTED: calmodulin-7 [Nicotiana tomentosiformis]
 ref|XP_009596008.1| PREDICTED: calmodulin-7 [Nicotiana tomentosiformis]
 ref|XP_009789056.1| PREDICTED: calmodulin-7 isoform X1 [Nicotiana sylvestris]
 ref|XP_009793724.1| PREDICTED: calmodulin-7 [Nicotiana sylvestris]
 ref|XP_009777145.1| PREDICTED: calmodulin-7 [Nicotiana sylvestris]
 ref|XP_010055427.1| PREDICTED: calmodulin-7 [Eucalyptus grandis]
 ref|XP_010031657.1| PREDICTED: calmodulin-7 [Eucalyptus grandis]
 ref|XP_010036419.1| PREDICTED: calmodulin-7 [Eucalyptus grandis]
 ref|XP_010093812.1| Calmodulin-related protein [Morus notabilis]
 ref|XP_010111286.1| Calmodulin-related protein [Morus notabilis]
 ref|XP_010251745.1| PREDICTED: calmodulin-7 [Nelumbo nucifera]
 ref|XP_010245162.1| PREDICTED: calmodulin-7 [Nelumbo nucifera]
 ref|XP_010503055.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010514736.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010420972.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010425827.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010454449.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010493243.1| PREDICTED: calmodulin-7 [Camelina sativa]
 ref|XP_010535757.1| PREDICTED: calmodulin-7 [Tarenaya hassleriana]
 ref|XP_010541708.1| PREDICTED: calmodulin-7 [Tarenaya hassleriana]
 ref|XP_010554753.1| PREDICTED: calmodulin-7 [Tarenaya hassleriana]
 ref|XP_010525466.1| PREDICTED: calmodulin-7 [Tarenaya hassleriana]
 ref|XP_010922112.1| PREDICTED: calmodulin-7 [Elaeis guineensis]
 ref|XP_010938924.1| PREDICTED: calmodulin-7 [Elaeis guineensis]
 ref|XP_010904705.1| PREDICTED: calmodulin-7 [Elaeis guineensis]
 ref|XP_010909101.1| PREDICTED: calmodulin-7 [Elaeis guineensis]
 ref|XP_011040684.1| PREDICTED: calmodulin-7 [Populus euphratica]
 ref|XP_011041320.1| PREDICTED: calmodulin-7 [Populus euphratica]
 ref|XP_011042023.1| PREDICTED: calmodulin-7 [Populus euphratica]
 ref|XP_011070027.1| PREDICTED: calmodulin-7 [Sesamum indicum]
 ref|XP_011079163.1| PREDICTED: calmodulin-7 [Sesamum indicum]
 ref|XP_011090191.1| PREDICTED: calmodulin-7 [Sesamum indicum]
 ref|XP_011090192.1| PREDICTED: calmodulin-7 [Sesamum indicum]
 ref|XP_011090193.1| PREDICTED: calmodulin-7 [Sesamum indicum]
 sp|P59220.2|CALM7_ARATH RecName: Full=Calmodulin-7; Short=CaM-7 [Arabidopsis thaliana]
 sp|P62199.2|CALM1_PETHY RecName: Full=Calmodulin-1; Short=CaM-1 [Petunia x hybrida]
 sp|P62200.2|CALM1_DAUCA RecName: Full=Calmodulin-1/11/16; Short=CaM-1/11/16 [Daucus carota]
 sp|P62201.2|CALM_LILLO RecName: Full=Calmodulin; Short=CaM [Lilium longiflorum]
 sp|P62202.2|CALM_BRYDI RecName: Full=Calmodulin; Short=CaM; AltName: Full=BC329 [Bryonia 
dioica]
 sp|Q7Y052.4|CALM_EUPCH RecName: Full=Calmodulin; Short=CaM [Euphorbia characias]
 pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The 
Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase
 pdb|4AQR|B Chain B, Crystal Structure Of A Calmodulin In Complex With The 
Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase
 gb|AAD53313.1|AF178073_1 calmodulin 7 [Arabidopsis thaliana]
 gb|AAG11418.1|AF292108_1 calmodulin [Prunus avium]
 gb|AAM81202.1|AF494219_1 calmodulin 1 [Medicago truncatula]
 emb|CAA42423.1| calmodulin [Daucus carota]
 emb|CAA78301.1| calmodulin [Lilium longiflorum]
 gb|AAA33706.1| calmodulin [Petunia x hybrida]
 gb|AAA33397.1| calmodulin [Lilium longiflorum]
 emb|CAA43143.1| Calmodulin [Malus domestica]
 gb|AAA92681.1| calmodulin [Pisum sativum]
 emb|CAB83153.1| calmodulin 7 [Arabidopsis thaliana]
 gb|AAG27432.1| calmodulin [Elaeis guineensis]
 dbj|BAB61909.1| calmodulin NtCaM3 [Nicotiana tabacum]
 dbj|BAB61910.1| calmodulin NtCaM4 [Nicotiana tabacum]
 dbj|BAB61911.1| calmodulin NtCaM5 [Nicotiana tabacum]
 dbj|BAB61912.1| calmodulin NtCaM6 [Nicotiana tabacum]
 dbj|BAB61913.1| calmodulin NtCaM7 [Nicotiana tabacum]
 dbj|BAB61914.1| calmodulin NtCaM8 [Nicotiana tabacum]
 dbj|BAB61917.1| calmodulin NtCaM11 [Nicotiana tabacum]
 dbj|BAB61918.1| calmodulin NtCaM12 [Nicotiana tabacum]
 gb|AAM66013.1| calmodulin 7 [Arabidopsis thaliana]
 gb|AAP55717.2| calmodulin [Euphorbia characias]
 gb|AAS55460.1| calmodulin cam-11 [Daucus carota]
 gb|AAS55461.1| calmodulin cam-16 [Daucus carota]
 gb|AAT73615.1| calmodulin cam-202 [Daucus carota]
 gb|AAT73617.1| calmodulin cam-204 [Daucus carota]
 gb|AAT73621.1| calmodulin cam-208 [Daucus carota]
 gb|AAT73622.1| calmodulin cam-209 [Daucus carota]
 emb|CAH58629.1| calmodulin [Plantago major]
 emb|CAH58630.1| calmodulin [Plantago major]
 emb|CAH57707.1| calmodulin [Quercus petraea]
 gb|AAX63770.1| calmodulin [Populus tomentosa]
 gb|ABA27138.1| calmodulin 2 [Catharanthus roseus]
 gb|ABF58929.1| At3g43810 [Arabidopsis thaliana]
 dbj|BAE99131.1| calmodulin 7 [Arabidopsis thaliana]
 gb|ABK62856.1| calmodulin [Scoparia dulcis]
 gb|ABK92605.1| unknown [Populus trichocarpa]
 gb|ABK92620.1| unknown [Populus trichocarpa]
 gb|ABK92710.1| unknown [Populus trichocarpa]
 gb|ABK93215.1| unknown [Populus trichocarpa]
 gb|ABK93782.1| unknown [Populus trichocarpa]
 gb|ABK93953.1| unknown [Populus trichocarpa]
 gb|ABK94234.1| unknown [Populus trichocarpa]
 gb|ABK94353.1| unknown [Populus trichocarpa]
 gb|ABK94577.1| unknown [Populus trichocarpa]
 gb|ABK94668.1| unknown [Populus trichocarpa]
 gb|ABK94734.1| unknown [Populus trichocarpa]
 gb|ABK94820.1| unknown [Populus trichocarpa]
 gb|ABQ32302.1| putative calmodulin [Artemisia annua]
 emb|CAN63123.1| hypothetical protein VITISV_010766 [Vitis vinifera]
 gb|ABS12105.1| calmodulin 1 [Morus nigra]
 gb|ACD74910.1| calmodulin [Vitis quinquangularis]
 gb|ACH63215.1| calmodulin [Rheum australe]
 gb|EEE88189.1| calmodulin-like protein 6a [Populus trichocarpa]
 gb|EEE91459.1| calmodulin 6 family protein [Populus trichocarpa]
 gb|EEF04343.1| calmodulin 6 family protein [Populus trichocarpa]
 gb|EEF35009.1| calmodulin, putative [Ricinus communis]
 gb|EEF46748.1| calmodulin, putative [Ricinus communis]
 gb|ACN60147.1| calmodulin [Lonicera japonica]
 gb|ACO52511.1| calmodulin [Panax ginseng]
 gb|ACS96443.1| calmodulin 7 [Jatropha curcas]
 gb|ACT99605.1| calmodulin [Morus alba var. multicaulis]
 gb|ADB03783.1| calmodulin [Ipomoea batatas]
 gb|EFH53555.1| hypothetical protein ARALYDRAFT_484819 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ADR80688.1| calmodulin [Hevea brasiliensis]
 gb|AEE77831.1| calmodulin 7 [Arabidopsis thaliana]
 gb|AEL29209.1| calmodulin [Betula platyphylla]
 gb|AEO19904.1| calmodulin 1 [Pyrus x bretschneideri]
 gb|AEO19905.1| calmodulin 2 [Pyrus x bretschneideri]
 gb|AFA89863.1| calmodulin 3 [Lilium longiflorum]
 gb|AFH96951.1| calmodulin [Eleutherococcus senticosus]
 gb|AFK40030.1| unknown [Medicago truncatula]
 gb|AFA89862.2| calmodulin 2 [Lilium longiflorum]
 gb|AFA89865.2| calmodulin 5 [Lilium longiflorum]
 gb|EMJ13402.1| hypothetical protein PRUPE_ppa012912mg [Prunus persica]
 gb|EOA19499.1| hypothetical protein CARUB_v10002202mg [Capsella rubella]
 gb|EPS72734.1| calmodulin [Genlisea aurea]
 gb|EPS72776.1| calmodulin [Genlisea aurea]
 gb|AGX27513.1| CAM6 [Populus tomentosa]
 gb|ESR43673.1| hypothetical protein CICLE_v10013029mg [Citrus clementina]
 gb|ESR43674.1| hypothetical protein CICLE_v10013030mg [Citrus clementina]
 gb|ESR59635.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 gb|ESW33836.1| hypothetical protein PHAVU_001G102700g [Phaseolus vulgaris]
 gb|EXB54663.1| Calmodulin-related protein [Morus notabilis]
 gb|EXC30764.1| Calmodulin-related protein [Morus notabilis]
 gb|AHM26653.1| calmodulin 1 [Pyrus x bretschneideri]
 gb|EYU20849.1| hypothetical protein MIMGU_mgv1a015694mg [Erythranthe guttata]
 gb|EYU35667.1| hypothetical protein MIMGU_mgv1a015677mg [Erythranthe guttata]
 gb|EYU35968.1| hypothetical protein MIMGU_mgv1a015696mg [Erythranthe guttata]
 gb|EYU46162.1| hypothetical protein MIMGU_mgv1a015681mg [Erythranthe guttata]
 gb|KDO57356.1| hypothetical protein CISIN_1g0315341mg [Citrus sinensis]
 gb|KDP31736.1| hypothetical protein JCGZ_14893 [Jatropha curcas]
 gb|AES75093.2| EF hand calcium-binding family protein [Medicago truncatula]
 emb|CDP14348.1| unnamed protein product [Coffea canephora]
 emb|CDP09666.1| unnamed protein product [Coffea canephora]
 gb|KGN54050.1| hypothetical protein Csa_4G279790 [Cucumis sativus]
 gb|KHG00922.1| Calmodulin-related [Gossypium arboreum]
 gb|KHG09065.1| Calmodulin-related [Gossypium arboreum]
 gb|KHG21051.1| Calmodulin-related [Gossypium arboreum]
 prf||1909349A calmodulin
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|AFA89864.1| calmodulin 4 [Lilium longiflorum]
 gb|KHF98916.1| Calmodulin [Gossypium arboreum]
 gb|KHG12364.1| Calmodulin [Gossypium arboreum]
Length=149

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>gb|ABR21750.1| calmodulin [Actinidia melliana]
Length=148

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N VD   
Sbjct  1    MADSLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINGVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_007015563.1| Calmodulin 5 [Theobroma cacao]
 gb|EOY33182.1| Calmodulin 5 [Theobroma cacao]
Length=184

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|KDO66347.1| hypothetical protein CISIN_1g0446441mg, partial [Citrus sinensis]
Length=148

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ADY38663.1| calmodulin-related protein CAM53 [Wolffia arrhiza]
Length=149

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147


 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  489  EFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEFLN  310
            E +EAF +FDKD +G I+  EL  V+ +L +  T+EE+ EM+ + D   +G I ++EF+ 
Sbjct  85   ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  144

Query  309  ALSKR  295
             +  R
Sbjct  145  VMMAR  149



>ref|XP_002154349.2| PREDICTED: calmodulin-like isoform 1 [Hydra vulgaris]
Length=149

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L E+QI EF+EAFSLFDKDGDG+IT +EL TV+RSL +NPTE ELQ+M+NDVD   
Sbjct  1    MADTLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINDVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFL  ++K+M+DTDSEEE+KEAF+VFDKD NG+ISA ELR+VM NLGEKLT E
Sbjct  61   NGTIDFPEFLTMMAKKMKDTDSEEEIKEAFRVFDKDGNGFISATELRHVMTNLGEKLTTE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMN  79
            E ++MI+EADLDGDGQVNY++FVKMM++
Sbjct  121  EVDEMIKEADLDGDGQVNYEEFVKMMVS  148



>gb|KDP23657.1| hypothetical protein JCGZ_23490 [Jatropha curcas]
Length=149

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M +VL E+QI EFQEAF L DKDGDG IT EELAT I+SLD+NPTEEELQ M+N+VD   
Sbjct  1    MGDVLTEEQINEFQEAFCLLDKDGDGRITFEELATAIKSLDQNPTEEELQTMINEVDVDG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG IEF EFLN ++++M++ +++EELKEAFKVFDKDQ+GYIS NELR VMINLGEKLT+E
Sbjct  61   NGTIEFGEFLNLMARKMKENEADEELKEAFKVFDKDQDGYISPNELRRVMINLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNV  76
            E EQMIREADLDGDG VNY++FV+MM+ V
Sbjct  121  ELEQMIREADLDGDGLVNYEEFVRMMLAV  149



>ref|XP_010271115.1| PREDICTED: calmodulin-like [Nelumbo nucifera]
Length=149

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMML  147



>emb|CAH57706.1| calmodulin [Quercus petraea]
Length=149

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLMEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEEL+EAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFSEFLNLMARKMKDTDSEEELREAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREADLDGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADLDGDGQVNYEEFVRMML  147



>tpg|DAA41801.1| TPA: calmodulin, partial [Zea mays]
Length=182

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_003632229.1| PREDICTED: calmodulin-7 isoform X2 [Vitis vinifera]
Length=158

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147


 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 49/79 (62%), Gaps = 5/79 (6%)
 Frame = -2

Query  489  EFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEFLN  310
            E +EAF +FDKD +G I+  EL  V+ +L +  T+EE+ EM+ + D   +G I ++EF+ 
Sbjct  85   ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  144

Query  309  ALSKRMEDTDSEEELKEAF  253
             +  +M+ T     ++EAF
Sbjct  145  VMMAKMQGT-----MEEAF  158



>ref|XP_009391621.1| PREDICTED: calmodulin [Musa acuminata subsp. malaccensis]
 ref|XP_009399942.1| PREDICTED: calmodulin [Musa acuminata subsp. malaccensis]
 ref|XP_009419839.1| PREDICTED: calmodulin [Musa acuminata subsp. malaccensis]
Length=149

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ABH12274.1| calmodulin [Betula halophila]
Length=149

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLIARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRRVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|AAW02790.1| calmodulin 2 [Codonopsis lanceolata]
Length=149

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVF KDQNGYISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFGKDQNGYISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADMDGDGQVNYEEFVRMML  147



>ref|XP_006446396.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 ref|XP_006446398.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 ref|XP_006446399.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 gb|ESR59636.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 gb|ESR59638.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
 gb|ESR59639.1| hypothetical protein CICLE_v10016866mg [Citrus clementina]
Length=183

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_009135834.1| PREDICTED: calmodulin-like protein 11 [Brassica rapa]
Length=161

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  495  IMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEF  316
            IME  EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+N++D+  NG IEF EF
Sbjct  21   IMELNEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMINEIDSDGNGTIEFSEF  80

Query  315  LNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREA  136
            LN ++ ++++TD++EELKEAFKVFDKDQNGYISA+ELR+VMI+LGEKLT+EE +QMI+EA
Sbjct  81   LNLMAIKIQETDADEELKEAFKVFDKDQNGYISASELRHVMISLGEKLTDEEVDQMIKEA  140

Query  135  DLDGDGQVNYDDFVKMMMNVG  73
            DLDGDGQVNYD+FV+MMM  G
Sbjct  141  DLDGDGQVNYDEFVRMMMASG  161



>ref|XP_006292807.1| hypothetical protein CARUB_v10019058mg [Capsella rubella]
 gb|EOA25705.1| hypothetical protein CARUB_v10019058mg [Capsella rubella]
Length=215

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|EYU24499.1| hypothetical protein MIMGU_mgv1a015687mg [Erythranthe guttata]
Length=149

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITSKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMML  147



>gb|AFK42827.1| unknown [Lotus japonicus]
Length=149

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+E FSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEVFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_004144099.1| PREDICTED: calmodulin-related protein-like [Cucumis sativus]
 ref|XP_004159338.1| PREDICTED: calmodulin-related protein-like [Cucumis sativus]
 ref|XP_008451038.1| PREDICTED: calmodulin-7-like [Cucumis melo]
 gb|KGN66386.1| hypothetical protein Csa_1G600260 [Cucumis sativus]
Length=149

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKIMM  147



>gb|ACG31089.1| calmodulin [Zea mays]
Length=149

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKXMM  147



>gb|ABK94169.1| unknown [Populus trichocarpa]
Length=149

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M   L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MTEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGRNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQV+Y++FV+MM+
Sbjct  121  EVEEMIREADVDGDGQVSYEEFVRMML  147



>ref|XP_009404694.1| PREDICTED: calmodulin-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>ref|NP_001055907.1| Os05g0491100 [Oryza sativa Japonica Group]
 ref|XP_006654579.1| PREDICTED: calmodulin-2-like [Oryza brachyantha]
 sp|Q6F332.3|CALM2_ORYSJ RecName: Full=Calmodulin-2; Short=CaM-2 [Oryza sativa Japonica 
Group]
 sp|A2Y609.1|CALM2_ORYSI RecName: Full=Calmodulin-2; Short=CaM-2 [Oryza sativa Indica 
Group]
 gb|AAL35328.1|AF441190_1 calmodulin [Oryza sativa]
 gb|AAC36058.1| calmodulin [Oryza sativa]
 gb|AAT69643.1| putative calmodulin [Oryza sativa Japonica Group]
 dbj|BAF17821.1| Os05g0491100 [Oryza sativa Japonica Group]
 gb|EAY98519.1| hypothetical protein OsI_20431 [Oryza sativa Indica Group]
 dbj|BAG87023.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99558.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00572.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64193.1| hypothetical protein OsJ_19025 [Oryza sativa Japonica Group]
Length=149

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++K+M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ABD60149.1| calmodulin [Vigna unguiculata]
 gb|ABQ45408.1| calmodulin [Triticum aestivum]
Length=148

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA +LR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAKLRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_010417845.1| PREDICTED: calmodulin-5 isoform X1 [Camelina sativa]
Length=181

 Score =   218 bits (554),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MI+EAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMM  147



>gb|AAF73157.1|AF150059_1 calmodulin [Brassica napus]
Length=149

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA+ELR+VM NLGEKLT++
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISADELRHVMTNLGEKLTDD  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 45/103 (44%), Gaps = 37/103 (36%)
 Frame = -2

Query  270  ELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREADLDGDGQVNYDDFVK  91
            E KEAF +FDKD +G I+  EL  VM +LG+  TE E + MI E D DG+G +++ +F+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN  71

Query  90   M-------------------------------------MMNVG  73
            +                                     M N+G
Sbjct  72   LMARKMKDTDSEEELKEAFRVFDKDQNGFISADELRHVMTNLG  114



>ref|XP_010510825.1| PREDICTED: calmodulin-5-like [Camelina sativa]
Length=181

 Score =   218 bits (554),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MI+EAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMM  147



>ref|XP_002317717.1| calmodulin-like protein 6a [Populus trichocarpa]
 ref|XP_011000741.1| PREDICTED: calmodulin [Populus euphratica]
 gb|ABK94542.1| unknown [Populus trichocarpa]
 gb|EEE95937.1| calmodulin-like protein 6a [Populus trichocarpa]
Length=149

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M+  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+++VD   
Sbjct  1    MSEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVEEMIREADVDGDGQVNYEEFVRMML  147



>ref|XP_004287204.1| PREDICTED: calmodulin-related protein-like [Fragaria vesca subsp. 
vesca]
Length=149

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD  S
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEVELQDMINEVDADS  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA+ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISASELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E  +MI+EAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVNEMIQEADVDGDGQINYEEFVKVMM  147



>gb|AAT73623.1| calmodulin cam-210 [Daucus carota]
Length=149

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++M+READ+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMVREADVDGDGQINYEEFVKVMM  147



>gb|AFW78488.1| calmodulin1 [Zea mays]
Length=198

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ABR21729.1| calmodulin [Actinidia melliana]
 gb|ABR21732.1| calmodulin [Actinidia deliciosa var. deliciosa]
 gb|ABR21733.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21734.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21735.1| calmodulin [Actinidia eriantha var. eriantha]
 gb|ABR21765.1| calmodulin [Actinidia kolomikta]
Length=148

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDS+EELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_001758487.1| predicted protein [Physcomitrella patens]
 gb|EDQ76889.1| predicted protein [Physcomitrella patens]
 gb|AHX36941.1| calmodulin, partial [Betula platyphylla]
Length=149

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M   L+E+QI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MVEQLSEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT++
Sbjct  61   NGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVKMMM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKMMM  147



>ref|NP_001275042.1| calmodulin-1 [Solanum tuberosum]
 gb|ACX85428.1| calmodulin isoform 1 [Solanum tuberosum]
Length=149

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+++VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLIARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVRMML  147



>ref|XP_006408585.1| hypothetical protein EUTSA_v10002103mg [Eutrema salsugineum]
 gb|ESQ50038.1| hypothetical protein EUTSA_v10002103mg [Eutrema salsugineum]
Length=180

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MI+EAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMM  147



>ref|NP_001167666.1| calmodulin [Zea mays]
 gb|ACG30831.1| calmodulin [Zea mays]
Length=149

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY +FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYVEFVKVMM  147



>ref|NP_001234786.1| calmodulin [Solanum lycopersicum]
 ref|XP_009589661.1| PREDICTED: calmodulin [Nicotiana tomentosiformis]
 ref|XP_009776698.1| PREDICTED: calmodulin [Nicotiana sylvestris]
 sp|P27161.2|CALM_SOLLC RecName: Full=Calmodulin; Short=CaM [Solanum lycopersicum]
 gb|AAA34144.1| calmodulin [Solanum lycopersicum]
 emb|CAA09302.1| calmodulin 3 protein [Capsicum annuum]
 dbj|BAB61907.1| calmodulin NtCaM1 [Nicotiana tabacum]
 dbj|BAB61908.1| calmodulin NtCaM2 [Nicotiana tabacum]
 emb|CAC84563.1| putative calmodulin [Solanum commersonii]
Length=149

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+++VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVRMML  147



>gb|ABN79277.1| calmodulin [Noccaea caerulescens]
Length=149

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKL++E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MI+EAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIKEADVDGDGQINYDEFVKVMM  147



>ref|NP_850097.1| calmodulin 5 [Arabidopsis thaliana]
 gb|AEC07925.1| calmodulin 5 [Arabidopsis thaliana]
Length=181

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MI+EAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMM  147



>gb|ABR21762.1| calmodulin [Actinidia eriantha f. alba]
Length=148

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+++VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ABR21711.1| calmodulin [Actinidia deliciosa var. chlorocarpa]
Length=148

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFL+ ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLSLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_002885531.1| hypothetical protein ARALYDRAFT_479802 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61790.1| hypothetical protein ARALYDRAFT_479802 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  495  IMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEF  316
            I+EF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+ ++D+  NG IEF EF
Sbjct  21   ILEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTIEFSEF  80

Query  315  LNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREA  136
            L  ++ ++++TD++EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE +QMI+EA
Sbjct  81   LTLMANQIQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMIKEA  140

Query  135  DLDGDGQVNYDDFVKMMMNVG  73
            DLDGDGQVNYD+FV+MMM  G
Sbjct  141  DLDGDGQVNYDEFVRMMMTNG  161



>gb|AAA16320.1| calmodulin [Bryonia dioica]
Length=149

 Score =   216 bits (550),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQTNYEEFVKVMM  147



>emb|CAA78057.1| calmodulin [Arabidopsis thaliana]
Length=149

 Score =   216 bits (550),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++K+M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E E+MIREAD+DGDGQ+N+++FVK+MM
Sbjct  121  EVEEMIREADVDGDGQINHEEFVKIMM  147



>ref|XP_008810798.1| PREDICTED: calmodulin-7-like [Phoenix dactylifera]
Length=149

 Score =   216 bits (550),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDS+EELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>emb|CAH57708.1| calmodulin [Quercus petraea]
Length=149

 Score =   216 bits (550),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT++
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>emb|CAA67054.1| calmodulin-2 [Capsicum annuum]
Length=149

 Score =   216 bits (550),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFL  ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLILMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NYD+FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKVMM  147



>gb|ABR21708.1| calmodulin [Actinidia chinensis]
Length=148

 Score =   216 bits (550),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEE+LKEAF++FDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEKLKEAFRIFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_002879035.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55294.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
Length=181

 Score =   217 bits (553),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MI+EAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMM  147



>gb|ABR21767.1| calmodulin [Actinidia kolomikta]
Length=148

 Score =   216 bits (550),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDS+EELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSDEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY+ FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEKFVKVMM  147



>gb|ACT53872.1| calmodulin [Saccharum officinarum]
Length=149

 Score =   216 bits (549),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+++N+VD   
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDIINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|AAT73614.1| calmodulin cam-201 [Daucus carota]
Length=149

 Score =   216 bits (549),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY +FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYVEFVKVMM  147



>gb|AGZ84228.1| calmodulin [Arachis hypogaea]
Length=149

 Score =   216 bits (549),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>emb|CDY55678.1| BnaC06g43530D [Brassica napus]
Length=149

 Score =   216 bits (549),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++K+M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++M+READ+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMVREADVDGDGQINYEEFVKIMM  147



>gb|ACF84469.1| unknown [Zea mays]
Length=149

 Score =   216 bits (549),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDG++NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGRINYEEFVKVMM  147



>gb|KFK39574.1| hypothetical protein AALP_AA3G262000 [Arabis alpina]
Length=140

 Score =   216 bits (549),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  492  MEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEFL  313
            MEF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+EL++M++++D+  NG IEF EFL
Sbjct  1    MEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELRDMISEIDSDGNGTIEFSEFL  60

Query  312  NALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREAD  133
            N ++ +++ TD +EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE +QMI+EAD
Sbjct  61   NLMANKIQITDVDEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMIKEAD  120

Query  132  LDGDGQVNYDDFVKMMMNVG  73
            LDGDGQVNYD+FV+MMM  G
Sbjct  121  LDGDGQVNYDEFVRMMMTSG  140



>gb|ABR21746.1| calmodulin [Actinidia valvata]
Length=148

 Score =   216 bits (549),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEA +VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEALRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_010488327.1| PREDICTED: calmodulin-like protein 11 [Camelina sativa]
Length=158

 Score =   216 bits (550),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  495  IMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEF  316
            I EF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+ ++D+  NG IEF EF
Sbjct  18   ITEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTIEFSEF  77

Query  315  LNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREA  136
            LN ++ ++++TD +EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE +QMI+EA
Sbjct  78   LNLMANQIQETDVDEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMIKEA  137

Query  135  DLDGDGQVNYDDFVKMMMNVG  73
            DLDGDGQVNYD+FV+MMM  G
Sbjct  138  DLDGDGQVNYDEFVRMMMTNG  158



>ref|XP_011073165.1| PREDICTED: calmodulin [Sesamum indicum]
Length=149

 Score =   216 bits (549),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+D DSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDADSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMML  147



>ref|NP_850860.1| calmodulin 6 [Arabidopsis thaliana]
 ref|XP_002874034.1| hypothetical protein ARALYDRAFT_489030 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q03509.2|CALM6_ARATH RecName: Full=Calmodulin-6; Short=CaM-6 [Arabidopsis thaliana]
 emb|CAA78059.1| calmodulin [Arabidopsis thaliana]
 gb|AAK91367.1| AT3g43810/T28A8_100 [Arabidopsis thaliana]
 gb|AAM16193.1| AT3g43810/T28A8_100 [Arabidopsis thaliana]
 gb|AAO73886.1| calmodulin-6 (CAM6) [Arabidopsis thaliana]
 gb|EFH50293.1| hypothetical protein ARALYDRAFT_489030 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92947.1| calmodulin 6 [Arabidopsis thaliana]
Length=149

 Score =   216 bits (549),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKL++E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_010466587.1| PREDICTED: calmodulin-like protein 11 [Camelina sativa]
Length=159

 Score =   216 bits (550),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  495  IMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEF  316
            I EF+EAF LFDKDGDG IT +ELATVIRSLD+NPTE+ELQ+M+ ++D+  NG IEF EF
Sbjct  19   ITEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTIEFSEF  78

Query  315  LNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEEEAEQMIREA  136
            LN ++ ++++TD +EELKEAFKVFDKDQNGYISA+ELR+VMINLGEKLT+EE +QMI+EA
Sbjct  79   LNLMANQIQETDVDEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMIKEA  138

Query  135  DLDGDGQVNYDDFVKMMMNVG  73
            DLDGDGQVNYD+FV+MMM  G
Sbjct  139  DLDGDGQVNYDEFVRMMMTNG  159



>ref|NP_001105490.1| calmodulin [Zea mays]
 ref|XP_004961667.1| PREDICTED: calmodulin-2-like isoform X3 [Setaria italica]
 ref|XP_007146213.1| hypothetical protein PHAVU_006G021800g [Phaseolus vulgaris]
 emb|CAA46150.1| calmodulin [Oryza sativa]
 emb|CAA74307.1| calmodulin [Zea mays]
 gb|AAD10246.1| calmodulin [Phaseolus vulgaris]
 gb|ABK56718.1| unknown [Hordeum vulgare]
 gb|ACF87450.1| unknown [Zea mays]
 gb|ACG24747.1| calmodulin [Zea mays]
 gb|ACG27341.1| calmodulin [Zea mays]
 dbj|BAJ85642.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99455.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFW78486.1| calmodulin1 isoform 1 [Zea mays]
 gb|AFW78487.1| calmodulin1 isoform 2 [Zea mays]
 gb|AFW82363.1| calmodulin isoform 1 [Zea mays]
 gb|AFW82364.1| calmodulin isoform 2 [Zea mays]
 gb|AFW90531.1| calmodulin [Phaseolus vulgaris]
 gb|EMS61705.1| Calmodulin [Triticum urartu]
 gb|EMT03295.1| Calmodulin [Aegilops tauschii]
 gb|ESW18207.1| hypothetical protein PHAVU_006G021800g [Phaseolus vulgaris]
 gb|AHY21740.1| calmodulin [Triticum turgidum subsp. durum]
Length=149

 Score =   216 bits (549),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|AAT73616.1| calmodulin cam-203 [Daucus carota]
Length=149

 Score =   216 bits (549),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDG++NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGRINYEEFVKVMM  147



>ref|XP_009123275.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin [Brassica rapa]
Length=149

 Score =   216 bits (549),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLG+KLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGKKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDG++NYD+FVK+MM
Sbjct  121  EMDEMIREADVDGDGRINYDEFVKVMM  147



>gb|EMS51119.1| Calmodulin [Triticum urartu]
Length=149

 Score =   216 bits (549),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT++
Sbjct  61   NGIIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ABR21744.1| calmodulin [Actinidia deliciosa var. deliciosa]
Length=148

 Score =   216 bits (549),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADSLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++ VK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEELVKVMM  147



>gb|ABR21761.1| calmodulin [Actinidia eriantha f. alba]
Length=148

 Score =   216 bits (549),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA E R+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAEPRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|NP_180271.1| calmodulin 5 [Arabidopsis thaliana]
 ref|NP_191239.1| calmodulin 3 [Arabidopsis thaliana]
 ref|NP_850344.1| calmodulin 2 [Arabidopsis thaliana]
 ref|XP_002878109.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002879909.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006290285.1| hypothetical protein CARUB_v10018192mg [Capsella rubella]
 ref|XP_006402949.1| hypothetical protein EUTSA_v10006295mg [Eutrema salsugineum]
 ref|XP_006411378.1| hypothetical protein EUTSA_v10017373mg [Eutrema salsugineum]
 ref|XP_009133468.1| PREDICTED: calmodulin-5 [Brassica rapa]
 ref|XP_009139073.1| PREDICTED: calmodulin-5 [Brassica rapa]
 ref|XP_009104021.1| PREDICTED: calmodulin-5 [Brassica rapa]
 ref|XP_010504586.1| PREDICTED: calmodulin-5 [Camelina sativa]
 ref|XP_010508758.1| PREDICTED: calmodulin-5 [Camelina sativa]
 ref|XP_010516281.1| PREDICTED: calmodulin-5 [Camelina sativa]
 ref|XP_010417846.1| PREDICTED: calmodulin-5 isoform X2 [Camelina sativa]
 ref|XP_010427517.1| PREDICTED: calmodulin-5 [Camelina sativa]
 sp|Q682T9.1|CALM5_ARATH RecName: Full=Calmodulin-5; Short=CaM-5 [Arabidopsis thaliana]
 sp|P0DH97.1|CALM2_ARATH RecName: Full=Calmodulin-2; Short=CaM-2 [Arabidopsis thaliana]
 sp|P0DH98.1|CALM3_ARATH RecName: Full=Calmodulin-3; Short=CaM-3 [Arabidopsis thaliana]
 pir||S53006 calmodulin - leaf mustard
 gb|AAA32763.1| calmodulin-2 [Arabidopsis thaliana]
 gb|AAA32764.1| calmodulin-3 [Arabidopsis thaliana]
 emb|CAA47690.1| calmodulin [Arabidopsis thaliana]
 gb|AAA19571.1| calmodulin [Brassica napus]
 gb|AAA87347.1| calmodulin [Brassica juncea]
 dbj|BAA08283.1| calmodulin [Arabidopsis thaliana]
 gb|AAD12000.1| calmodulin (cam2) [Arabidopsis thaliana]
 gb|AAC77861.1| calmodulin [Arabidopsis thaliana]
 emb|CAC00743.1| calmodulin-3 [Arabidopsis thaliana]
 gb|AAK76722.1| putative calmodulin-3 protein [Arabidopsis thaliana]
 gb|AAL09806.1| AT3g56800/T8M16_130 [Arabidopsis thaliana]
 gb|AAL38355.1| calmodulin (cam2) [Arabidopsis thaliana]
 gb|AAM14240.1| putative calmodulin-3 protein [Arabidopsis thaliana]
 gb|AAM62881.1| calmodulin-3 [Arabidopsis thaliana]
 gb|AAM91152.1| calmodulin cam2 [Arabidopsis thaliana]
 gb|AAN86184.1| putative calmodulin [Arabidopsis thaliana]
 dbj|BAD43041.1| calmodulin [Arabidopsis thaliana]
 dbj|BAD44618.1| calmodulin [Arabidopsis thaliana]
 gb|EFH54368.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56168.1| calmodulin-2 [Arabidopsis lyrata subsp. lyrata]
 dbj|BAJ33744.1| unnamed protein product [Thellungiella halophila]
 dbj|BAJ34240.1| unnamed protein product [Thellungiella halophila]
 gb|AEC07924.1| calmodulin 5 [Arabidopsis thaliana]
 gb|AEC09932.1| calmodulin 2 [Arabidopsis thaliana]
 gb|AEE79567.1| calmodulin 3 [Arabidopsis thaliana]
 gb|EOA23183.1| hypothetical protein CARUB_v10018192mg [Capsella rubella]
 gb|ESQ44402.1| hypothetical protein EUTSA_v10006295mg [Eutrema salsugineum]
 gb|ESQ52831.1| hypothetical protein EUTSA_v10017373mg [Eutrema salsugineum]
 gb|KFK34917.1| hypothetical protein AALP_AA5G210400 [Arabis alpina]
 gb|KFK36958.1| hypothetical protein AALP_AA4G194800 [Arabis alpina]
 emb|CDY51259.1| BnaCnng20380D [Brassica napus]
 emb|CDY47377.1| BnaC04g24860D [Brassica napus]
 emb|CDY35428.1| BnaA03g19320D [Brassica napus]
 emb|CDY27197.1| BnaA09g36050D [Brassica napus]
 emb|CDY22503.1| BnaC03g23130D [Brassica napus]
 emb|CDX76012.1| BnaA04g02760D [Brassica napus]
 emb|CDX67656.1| BnaA07g16960D [Brassica napus]
 prf||1803520A calmodulin 2
Length=149

 Score =   216 bits (549),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MI+EAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIKEADVDGDGQINYEEFVKVMM  147



>gb|ABR21741.1| calmodulin [Actinidia deliciosa var. chlorocarpa]
Length=148

 Score =   215 bits (548),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMRDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+ Y++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQIRYEEFVKVMM  147



>sp|P27163.2|CALM2_PETHY RecName: Full=Calmodulin-2; Short=CaM-2 [Petunia x hybrida]
 gb|AAA33725.1| calmodulin [Petunia x hybrida]
Length=149

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+++VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNGYISA ++R+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAADVRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADMDGDGQVNYEEFVRMML  147



>ref|NP_001238237.1| calmodulin [Glycine max]
 ref|NP_001236711.1| calmodulin [Glycine max]
 ref|NP_001242690.1| uncharacterized protein LOC100817351 [Glycine max]
 ref|XP_003519492.1| PREDICTED: calmodulin-like [Glycine max]
 ref|XP_003545473.1| PREDICTED: calmodulin-like isoform 1 [Glycine max]
 ref|XP_003617142.1| Calmodulin [Medicago truncatula]
 ref|XP_004491196.1| PREDICTED: calmodulin-like [Cicer arietinum]
 ref|XP_006832892.1| hypothetical protein AMTR_s00095p00113890 [Amborella trichopoda]
 ref|XP_007141556.1| hypothetical protein PHAVU_008G206000g [Phaseolus vulgaris]
 ref|XP_007151806.1| hypothetical protein PHAVU_004G076400g [Phaseolus vulgaris]
 sp|P17928.2|CALM_MEDSA RecName: Full=Calmodulin; Short=CaM [Medicago sativa]
 gb|AAM81203.1|AF494220_1 calmodulin 2 [Medicago truncatula]
 emb|CAA36644.1| unnamed protein product [Medicago sativa]
 gb|AAA34013.1| calmodulin [Glycine max]
 gb|AAA34014.1| calmodulin [Glycine max]
 gb|AAA34238.1| calmodulin [Vigna radiata]
 gb|AAD10244.1| calmodulin [Phaseolus vulgaris]
 gb|ACJ84019.1| unknown [Medicago truncatula]
 gb|ACU13174.1| unknown [Glycine max]
 gb|AET00101.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK39142.1| unknown [Medicago truncatula]
 gb|AFK45641.1| unknown [Lotus japonicus]
 gb|ERM98170.1| hypothetical protein AMTR_s00095p00113890 [Amborella trichopoda]
 gb|ESW13550.1| hypothetical protein PHAVU_008G206000g [Phaseolus vulgaris]
 gb|ESW23800.1| hypothetical protein PHAVU_004G076400g [Phaseolus vulgaris]
 gb|KHN15001.1| Calmodulin [Glycine soja]
 gb|KHN22536.1| Calmodulin [Glycine soja]
 gb|KHN24729.1| Calmodulin [Glycine soja]
 gb|KHN26018.1| Calmodulin [Glycine soja]
 gb|KHN38426.1| Calmodulin [Glycine soja]
 gb|KHN42153.1| Calmodulin [Glycine soja]
 gb|KHN43683.1| Calmodulin [Glycine soja]
 prf||2121384A calmodulin
 prf||2121384C calmodulin
Length=149

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_001755625.1| predicted protein [Physcomitrella patens]
 gb|EDQ79685.1| predicted protein [Physcomitrella patens]
Length=149

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            M   L+EDQI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+++VD   
Sbjct  1    MVEQLSEDQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+D+DSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT++
Sbjct  61   NGTIDFAEFLNLMARKMKDSDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVKMMM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKMMM  147



>gb|ABR21719.1| calmodulin [Actinidia kolomikta]
Length=148

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEE LKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEVLKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_007323358.1| hypothetical protein SERLADRAFT_401260 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007773954.1| calmodulin [Coniophora puteana RWD-64-598 SS2]
 gb|EGN94437.1| hypothetical protein SERLA73DRAFT_144174 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO19923.1| hypothetical protein SERLADRAFT_401260 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIW75961.1| calmodulin [Coniophora puteana RWD-64-598 SS2]
Length=149

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L+E+QI EF+EAFSLFDKDGDG+IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLSEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFL  ++++M DTDSEEE+KEAFKVFDKD NGYISA ELR+VM NLGEKLT+ 
Sbjct  61   NGTIDFPEFLTMMARKMRDTDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGEKLTDS  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMN  79
            E ++MIREAD+DGDGQ+NYD+FVKMM++
Sbjct  121  EVDEMIREADVDGDGQINYDEFVKMMLS  148



>ref|XP_006294957.1| hypothetical protein CARUB_v10024013mg [Capsella rubella]
 gb|EOA27855.1| hypothetical protein CARUB_v10024013mg [Capsella rubella]
Length=224

 Score =   218 bits (555),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  44   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  103

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  104  NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  163

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MI+EAD+DGDGQ+NY++FVK+MM
Sbjct  164  EVDEMIKEADVDGDGQINYEEFVKVMM  190



>gb|ACR15761.1| calmodulin isoform 1 [Solanum tuberosum]
Length=149

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+++VD   
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGE+LT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGERLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVRMML  147



>gb|ABK21279.1| unknown [Picea sitchensis]
Length=149

 Score =   215 bits (548),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L EDQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+++VD   
Sbjct  1    MAEQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+ 
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDG  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADVDGDGQVNYEEFVRMML  147



>ref|XP_006295105.1| hypothetical protein CARUB_v10024180mg [Capsella rubella]
 gb|EOA28003.1| hypothetical protein CARUB_v10024180mg [Capsella rubella]
Length=171

 Score =   216 bits (550),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  23   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  82

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  83   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  142

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MI+EAD+DGDGQ+NY++FVK+MM
Sbjct  143  EVDEMIKEADVDGDGQINYEEFVKVMM  169



>pdb|3WFN|B Chain B, Crystal Structure Of Nav1.6 Iq Motif In Complex With 
Apo-cam
 pdb|3WFN|C Chain C, Crystal Structure Of Nav1.6 Iq Motif In Complex With 
Apo-cam
 pdb|3WFN|D Chain D, Crystal Structure Of Nav1.6 Iq Motif In Complex With 
Apo-cam
 pdb|3WFN|E Chain E, Crystal Structure Of Nav1.6 Iq Motif In Complex With 
Apo-cam
Length=182

 Score =   216 bits (551),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L E+QI EF+EAFSLFDKDGDG+IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  7    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  66

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFL  ++++M+DTDSEEE++EAF+VFDKD NGYISA ELR+VM NLGEKLT+E
Sbjct  67   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE  126

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMNVG*GG  64
            E ++MIREAD+DGDGQVNY++FV+MM   G GG
Sbjct  127  EVDEMIREADIDGDGQVNYEEFVQMMTAKGGGG  159



>pir||S58314 calmodulin - moss (Physcomitrella patens)
Length=149

 Score =   215 bits (548),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L E+QI EF+EAFSLFDKDGDGSIT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADDLTEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ++R+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAADVRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMM  85
            E ++MIR+AD+DGDGQV+YD+FVKMM
Sbjct  121  EVDEMIRDADVDGDGQVDYDEFVKMM  146


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  489  EFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGSNGAIEFKEFLN  310
            E +EAF +FDKD +G I+  ++  V+ +L +  T+EE+ EM+ D D   +G +++ EF+ 
Sbjct  85   ELKEAFKVFDKDQNGFISAADVRHVMTNLGEKLTDEEVDEMIRDADVDGDGQVDYDEFVK  144

Query  309  ALSKR  295
             +  +
Sbjct  145  MMKAK  149



>ref|XP_007209738.1| hypothetical protein PRUPE_ppa012922mg [Prunus persica]
 ref|XP_008240397.1| PREDICTED: calmodulin-like [Prunus mume]
 gb|EMJ10937.1| hypothetical protein PRUPE_ppa012922mg [Prunus persica]
Length=149

 Score =   215 bits (548),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAF LFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQIAEFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEEL+EAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFSEFLNLMARKMKDTDSEEELREAFKVFDKDQNGFISAAELRHVMANLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMMN  79
            E ++MIREAD DGDGQVNY++FV+MM+N
Sbjct  121  EVDEMIREADEDGDGQVNYEEFVRMMLN  148



>gb|AAT73618.1| calmodulin cam-205 [Daucus carota]
Length=149

 Score =   215 bits (548),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG I  +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCIATKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|ABR21709.1| calmodulin [Actinidia chinensis]
Length=148

 Score =   215 bits (548),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L +DQI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEE KEAF+VFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEERKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>gb|AAT73609.1| calmodulin [Salvia miltiorrhiza]
Length=148

 Score =   215 bits (548),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA+ L ++QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MADPLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAF+VFD+DQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDRDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD+DGDGQ+NY++FVK+MM
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKVMM  147



>ref|XP_006849452.1| hypothetical protein AMTR_s00024p00073390 [Amborella trichopoda]
 gb|ERN11033.1| hypothetical protein AMTR_s00024p00073390 [Amborella trichopoda]
Length=218

 Score =   218 bits (554),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  522  MANVLNEDQIMEFQEAFSLFDKDGDGSITVEELATVIRSLDKNPTEEELQEMMNDVDTGS  343
            MA  L E+QI EF+EAFSLFDKDGDG IT +EL TV+RSL +NPTE ELQ+M+N+VD   
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  342  NGAIEFKEFLNALSKRMEDTDSEEELKEAFKVFDKDQNGYISANELRNVMINLGEKLTEE  163
            NG I+F EFLN ++++M+DTDSEEELKEAFKVFDKDQNG+ISA ELR+VM NLGEKLT+E
Sbjct  61   NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE  120

Query  162  EAEQMIREADLDGDGQVNYDDFVKMMM  82
            E ++MIREAD DGDGQVNY++FV+MM+
Sbjct  121  EVDEMIREADTDGDGQVNYEEFVRMML  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558743307496