BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c38032_g1_i1 len=1258 path=[1:0-1257]

Length=1258
                                                                      Score     E

ref|XP_009769036.1|  PREDICTED: glucose-induced degradation prote...    367   1e-122   
dbj|BAJ53170.1|  JHL18I08.4                                             365   7e-122   
ref|XP_009598032.1|  PREDICTED: glucose-induced degradation prote...    364   1e-121   
ref|XP_002280458.1|  PREDICTED: glucose-induced degradation prote...    363   2e-121   Vitis vinifera
gb|KHG06303.1|  Protein C20orf11                                        362   1e-120   
emb|CBI19773.3|  unnamed protein product                                361   2e-120   
ref|XP_006435081.1|  hypothetical protein CICLE_v10002444mg             361   2e-120   
ref|XP_007136042.1|  hypothetical protein PHAVU_009G013100g             357   7e-119   
ref|XP_007017657.1|  LisH and RanBPM domains containing protein i...    357   4e-118   
ref|NP_001239946.1|  uncharacterized protein LOC100801338               352   4e-117   
ref|XP_008221335.1|  PREDICTED: glucose-induced degradation prote...    351   2e-116   
ref|XP_010271533.1|  PREDICTED: glucose-induced degradation prote...    351   2e-116   
ref|XP_010672512.1|  PREDICTED: glucose-induced degradation prote...    350   3e-116   
ref|XP_003527884.1|  PREDICTED: glucose-induced degradation prote...    350   4e-116   
emb|CDP07459.1|  unnamed protein product                                350   4e-116   
ref|XP_006473578.1|  PREDICTED: glucose-induced degradation prote...    349   7e-116   
ref|XP_006341991.1|  PREDICTED: glucose-induced degradation prote...    348   3e-115   
ref|XP_009335745.1|  PREDICTED: glucose-induced degradation prote...    346   1e-114   
ref|XP_010320407.1|  PREDICTED: glucose-induced degradation prote...    346   1e-114   
ref|XP_007227500.1|  hypothetical protein PRUPE_ppa011330mg             346   2e-114   
ref|XP_009335728.1|  PREDICTED: glucose-induced degradation prote...    342   4e-113   
ref|XP_008466517.1|  PREDICTED: glucose-induced degradation prote...    342   5e-113   
ref|XP_009335737.1|  PREDICTED: glucose-induced degradation prote...    342   5e-113   
ref|XP_008388007.1|  PREDICTED: glucose-induced degradation prote...    341   1e-112   
ref|XP_006435080.1|  hypothetical protein CICLE_v10002444mg             340   2e-112   
ref|XP_007017658.1|  LisH and RanBPM domains containing protein i...    342   2e-112   
ref|XP_009335720.1|  PREDICTED: glucose-induced degradation prote...    338   3e-111   
ref|XP_004291400.1|  PREDICTED: glucose-induced degradation prote...    337   3e-111   
ref|XP_004147845.1|  PREDICTED: glucose-induced degradation prote...    337   6e-111   
ref|XP_008388006.1|  PREDICTED: glucose-induced degradation prote...    337   7e-111   
ref|XP_008796610.1|  PREDICTED: glucose-induced degradation prote...    338   2e-110   
ref|XP_010271531.1|  PREDICTED: glucose-induced degradation prote...    334   1e-109   
ref|XP_011028933.1|  PREDICTED: glucose-induced degradation prote...    333   3e-109   
ref|XP_010061257.1|  PREDICTED: glucose-induced degradation prote...    331   8e-109   
ref|XP_006341990.1|  PREDICTED: glucose-induced degradation prote...    330   2e-108   
ref|XP_008377185.1|  PREDICTED: glucose-induced degradation prote...    329   5e-108   
ref|XP_002302009.1|  RanBPM-related family protein                      329   5e-108   Populus trichocarpa [western balsam poplar]
ref|XP_010923261.1|  PREDICTED: glucose-induced degradation prote...    329   9e-108   
ref|XP_010320406.1|  PREDICTED: glucose-induced degradation prote...    328   2e-107   
ref|XP_004499207.1|  PREDICTED: glucose-induced degradation prote...    327   4e-107   
ref|XP_010519102.1|  PREDICTED: glucose-induced degradation prote...    326   9e-107   
ref|XP_011048846.1|  PREDICTED: glucose-induced degradation prote...    325   3e-106   
ref|XP_008804546.1|  PREDICTED: glucose-induced degradation prote...    324   6e-106   
ref|XP_010519101.1|  PREDICTED: glucose-induced degradation prote...    323   2e-105   
ref|XP_002306895.1|  RanBPM-related family protein                      322   4e-105   Populus trichocarpa [western balsam poplar]
ref|XP_011048842.1|  PREDICTED: glucose-induced degradation prote...    322   4e-105   
ref|XP_004970154.1|  PREDICTED: ran-binding protein 9-like              321   1e-104   
ref|XP_008804545.1|  PREDICTED: glucose-induced degradation prote...    319   4e-104   
gb|EYU32884.1|  hypothetical protein MIMGU_mgv1a013617mg                319   6e-104   
ref|NP_001044411.2|  Os01g0775600                                       318   9e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011028932.1|  PREDICTED: glucose-induced degradation prote...    317   3e-103   
ref|XP_002458584.1|  hypothetical protein SORBIDRAFT_03g036180          315   3e-102   Sorghum bicolor [broomcorn]
ref|XP_006644796.1|  PREDICTED: glucose-induced degradation prote...    315   3e-102   
ref|XP_010923262.1|  PREDICTED: glucose-induced degradation prote...    313   9e-102   
ref|XP_008804542.1|  PREDICTED: glucose-induced degradation prote...    314   5e-101   
ref|XP_011048843.1|  PREDICTED: glucose-induced degradation prote...    310   9e-101   
emb|CDM84438.1|  unnamed protein product                                310   2e-100   
ref|XP_003569937.1|  PREDICTED: glucose-induced degradation prote...    310   3e-100   
ref|XP_006838697.1|  hypothetical protein AMTR_s00002p00248930          308   9e-100   
ref|XP_011083893.1|  PREDICTED: glucose-induced degradation prote...    309   2e-99    
ref|XP_003589230.1|  C20orf11-like protein                              307   3e-99    
ref|XP_008804544.1|  PREDICTED: glucose-induced degradation prote...    307   4e-99    
ref|XP_008804541.1|  PREDICTED: glucose-induced degradation prote...    309   5e-99    
ref|XP_009403387.1|  PREDICTED: glucose-induced degradation prote...    306   6e-99    
gb|ACJ86236.1|  unknown                                                 305   3e-98    Medicago truncatula
gb|EEC71570.1|  hypothetical protein OsI_03937                          322   1e-97    Oryza sativa Indica Group [Indian rice]
gb|EEE55471.1|  hypothetical protein OsJ_03649                          322   1e-97    Oryza sativa Japonica Group [Japonica rice]
gb|KFK42934.1|  hypothetical protein AALP_AA1G057700                    302   3e-97    
ref|NP_001143881.1|  hypothetical protein                               300   1e-96    Zea mays [maize]
gb|EYU32885.1|  hypothetical protein MIMGU_mgv1a013617mg                299   2e-96    
ref|XP_010232419.1|  PREDICTED: glucose-induced degradation prote...    299   3e-96    
gb|EPS61808.1|  hypothetical protein M569_12982                         298   1e-95    
ref|XP_003544281.1|  PREDICTED: glucose-induced degradation prote...    296   4e-95    
ref|XP_002510460.1|  conserved hypothetical protein                     297   4e-94    Ricinus communis
ref|NP_563758.1|  LisH and RanBPM domains containing protein            293   1e-93    Arabidopsis thaliana [mouse-ear cress]
gb|ABK23979.1|  unknown                                                 291   3e-93    Picea sitchensis
gb|KHN12673.1|  UPF0559 protein                                         291   4e-93    
ref|XP_002889583.1|  hypothetical protein ARALYDRAFT_470618             290   7e-93    
gb|AFW84920.1|  hypothetical protein ZEAMMB73_836179                    290   9e-93    
ref|XP_006417961.1|  hypothetical protein EUTSA_v10008762mg             290   1e-92    
ref|XP_010485766.1|  PREDICTED: glucose-induced degradation prote...    289   3e-92    
ref|XP_008804543.1|  PREDICTED: glucose-induced degradation prote...    291   3e-92    
ref|XP_006435082.1|  hypothetical protein CICLE_v10002444mg             287   4e-92    
ref|XP_010475327.1|  PREDICTED: glucose-induced degradation prote...    284   2e-90    
ref|NP_001236297.1|  uncharacterized protein LOC100527710               283   4e-90    
ref|XP_010457721.1|  PREDICTED: glucose-induced degradation prote...    282   2e-89    
gb|EMS53305.1|  Protein C20orf11                                        283   6e-89    
ref|XP_006595917.1|  PREDICTED: glucose-induced degradation prote...    280   2e-88    
ref|XP_001776447.1|  predicted protein                                  278   4e-88    
gb|KDO84704.1|  hypothetical protein CISIN_1g027999mg                   275   2e-87    
emb|CDX86538.1|  BnaC08g01650D                                          276   2e-87    
ref|XP_006600155.1|  PREDICTED: uncharacterized protein LOC100527...    275   2e-86    
ref|XP_001756780.1|  predicted protein                                  274   3e-86    
ref|XP_008796611.1|  PREDICTED: glucose-induced degradation prote...    271   4e-86    
ref|XP_010110008.1|  Protein C20orf11-like protein                      272   6e-86    
ref|XP_006304078.1|  hypothetical protein CARUB_v10009937mg             275   1e-85    
emb|CDY15559.1|  BnaA08g28430D                                          270   5e-85    
ref|XP_009111008.1|  PREDICTED: glucose-induced degradation prote...    270   1e-84    
ref|XP_010923263.1|  PREDICTED: glucose-induced degradation prote...    267   3e-84    
gb|AFK38061.1|  unknown                                                 264   5e-83    
ref|XP_008654713.1|  PREDICTED: hypothetical protein isoform X1         262   5e-82    
ref|XP_010933012.1|  PREDICTED: glucose-induced degradation prote...    253   5e-79    
ref|XP_010933050.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-indu...    251   6e-78    
ref|XP_010933021.1|  PREDICTED: glucose-induced degradation prote...    242   8e-75    
ref|XP_010933029.1|  PREDICTED: glucose-induced degradation prote...    241   3e-74    
ref|XP_010933002.1|  PREDICTED: glucose-induced degradation prote...    241   4e-74    
ref|XP_002968915.1|  hypothetical protein SELMODRAFT_145745             230   2e-69    
gb|KDO84705.1|  hypothetical protein CISIN_1g027999mg                   227   2e-69    
ref|XP_007160711.1|  hypothetical protein PHAVU_001G010600g             219   4e-65    
gb|KHN20943.1|  UPF0559 protein                                         213   3e-63    
gb|ACN25413.1|  unknown                                                 196   2e-57    Zea mays [maize]
gb|KHN01740.1|  UPF0559 protein                                         191   4e-55    
ref|XP_006601705.1|  PREDICTED: glucose-induced degradation prote...    157   2e-42    
ref|XP_004336902.1|  RanBPMrelated, putative                            119   9e-28    
ref|NP_001156193.1|  uncharacterized protein LOC100164604               110   3e-24    Acyrthosiphon pisum
ref|XP_001851089.1|  conserved hypothetical protein                     109   3e-24    Culex quinquefasciatus
gb|EFW45236.2|  hypothetical protein CAOG_03242                         110   3e-24    
ref|XP_004364081.1|  pg4                                                109   4e-24    
ref|XP_008554198.1|  PREDICTED: glucose-induced degradation prote...    108   6e-24    
ref|XP_004282390.1|  PREDICTED: glucose-induced degradation prote...    108   7e-24    
ref|XP_006176492.1|  PREDICTED: glucose-induced degradation prote...    108   8e-24    
ref|XP_006896939.1|  PREDICTED: glucose-induced degradation prote...    108   9e-24    
ref|XP_007952871.1|  PREDICTED: glucose-induced degradation prote...    108   9e-24    
ref|NP_001171768.1|  uncharacterized protein LOC100376325               108   1e-23    Saccoglossus kowalevskii
ref|XP_007553622.1|  PREDICTED: glucose-induced degradation prote...    107   1e-23    
ref|XP_010888939.1|  PREDICTED: glucose-induced degradation prote...    107   1e-23    
ref|XP_007520376.1|  PREDICTED: glucose-induced degradation prote...    107   1e-23    
ref|XP_001493635.1|  PREDICTED: glucose-induced degradation prote...    107   2e-23    Equus caballus [domestic horse]
ref|XP_004370245.1|  PREDICTED: glucose-induced degradation prote...    107   2e-23    
ref|XP_004430262.1|  PREDICTED: glucose-induced degradation prote...    107   2e-23    
ref|NP_001007872.1|  glucose-induced degradation protein 8 homolog      107   2e-23    Gallus gallus [bantam]
ref|XP_004484048.1|  PREDICTED: glucose-induced degradation prote...    107   2e-23    
ref|XP_004716101.1|  PREDICTED: glucose-induced degradation prote...    107   2e-23    
ref|XP_005146842.1|  PREDICTED: glucose-induced degradation prote...    107   2e-23    
gb|ELT94445.1|  hypothetical protein CAPTEDRAFT_153259                  107   2e-23    
gb|ELR57596.1|  hypothetical protein M91_18932                          107   2e-23    
ref|NP_001032676.1|  glucose-induced degradation protein 8 homolog      107   2e-23    Bos taurus [bovine]
ref|XP_003421815.1|  PREDICTED: glucose-induced degradation prote...    107   2e-23    
ref|XP_001368152.1|  PREDICTED: glucose-induced degradation prote...    107   2e-23    Monodelphis domestica
ref|XP_006873417.1|  PREDICTED: glucose-induced degradation prote...    107   2e-23    
ref|XP_007475638.1|  PREDICTED: glucose-induced degradation prote...    107   3e-23    
ref|XP_008067745.1|  PREDICTED: glucose-induced degradation prote...    107   3e-23    
ref|NP_942038.1|  glucose-induced degradation protein 8 homolog         107   3e-23    Rattus norvegicus [brown rat]
ref|XP_003503169.1|  PREDICTED: glucose-induced degradation prote...    107   3e-23    
ref|NP_001090234.1|  uncharacterized protein LOC779137                  106   3e-23    Xenopus laevis [clawed frog]
ref|XP_004760063.1|  PREDICTED: glucose-induced degradation prote...    106   3e-23    
ref|XP_006676027.1|  hypothetical protein BATDEDRAFT_85821              107   3e-23    
ref|XP_545179.2|  PREDICTED: glucose-induced degradation protein ...    106   3e-23    Canis lupus familiaris [dogs]
ref|XP_002108684.1|  hypothetical protein TRIADDRAFT_20201              106   3e-23    Trichoplax adhaerens
ref|XP_006922026.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-indu...    106   4e-23    
gb|EDL07351.1|  RIKEN cDNA 2310003C23, isoform CRA_b                    106   4e-23    
ref|NP_001086830.1|  MGC83062 protein                                   106   5e-23    Xenopus laevis [clawed frog]
ref|XP_004070905.1|  PREDICTED: glucose-induced degradation prote...    106   5e-23    
ref|XP_003438969.1|  PREDICTED: glucose-induced degradation prote...    106   5e-23    
ref|XP_005798945.1|  PREDICTED: glucose-induced degradation prote...    106   5e-23    
ref|XP_009272180.1|  PREDICTED: glucose-induced degradation prote...    107   5e-23    
ref|XP_002666524.1|  PREDICTED: glucose-induced degradation prote...    106   5e-23    Danio rerio [leopard danio]
ref|XP_008578028.1|  PREDICTED: glucose-induced degradation prote...    106   5e-23    
emb|CAG03914.1|  unnamed protein product                                106   6e-23    Tetraodon nigroviridis
ref|XP_009325080.1|  PREDICTED: glucose-induced degradation prote...    107   6e-23    
ref|NP_957006.1|  glucose-induced degradation protein 8 homolog         105   6e-23    Danio rerio [leopard danio]
ref|XP_001600429.1|  PREDICTED: glucose-induced degradation prote...    105   7e-23    Nasonia vitripennis
ref|XP_002424638.1|  protein C20orf11, putative                         105   7e-23    Pediculus humanus corporis [human body lice]
ref|XP_003289509.1|  hypothetical protein DICPUDRAFT_48646              109   7e-23    
ref|XP_006639657.1|  PREDICTED: glucose-induced degradation prote...    105   7e-23    
ref|XP_008317745.1|  PREDICTED: glucose-induced degradation prote...    105   7e-23    
ref|XP_003779445.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-indu...    105   9e-23    
ref|XP_003963580.1|  PREDICTED: glucose-induced degradation prote...    105   9e-23    
ref|NP_060366.1|  glucose-induced degradation protein 8 homolog         105   9e-23    Homo sapiens [man]
ref|XP_003280191.1|  PREDICTED: glucose-induced degradation prote...    105   1e-22    
gb|AAH32120.1|  Chromosome 20 open reading frame 11                     105   1e-22    Homo sapiens [man]
ref|XP_007250046.1|  PREDICTED: glucose-induced degradation prote...    105   1e-22    
ref|XP_007231948.1|  PREDICTED: glucose-induced degradation prote...    105   1e-22    
ref|XP_001648371.1|  hypothetical protein AaeL_AAEL004052               105   1e-22    Aedes aegypti
ref|XP_004620334.1|  PREDICTED: glucose-induced degradation prote...    104   1e-22    
ref|XP_007909350.1|  PREDICTED: glucose-induced degradation prote...    104   2e-22    
gb|AGM32587.1|  CTLH/CRA C-terminal to lisH motif domain containi...    104   2e-22    
ref|XP_005096701.1|  PREDICTED: glucose-induced degradation prote...    104   3e-22    
gb|KDR08045.1|  Protein C20orf11                                        103   3e-22    
gb|ACM09382.1|  C20orf11 homolog                                        103   3e-22    Salmo salar
ref|XP_003403096.1|  PREDICTED: protein C20orf11-like                   103   4e-22    
ref|XP_006563839.1|  PREDICTED: glucose-induced degradation prote...    103   4e-22    
ref|XP_003489301.1|  PREDICTED: protein C20orf11-like                   103   4e-22    
dbj|GAM23411.1|  hypothetical protein SAMD00019534_065860               107   4e-22    
ref|XP_003694186.1|  PREDICTED: protein C20orf11-like                   103   4e-22    
gb|EFN79548.1|  Protein C20orf11                                        103   4e-22    
ref|XP_005183331.1|  PREDICTED: glucose-induced degradation prote...    103   4e-22    
ref|XP_005146843.1|  PREDICTED: glucose-induced degradation prote...    103   4e-22    
ref|XP_006167101.1|  PREDICTED: glucose-induced degradation prote...    103   4e-22    
ref|XP_309141.2|  AGAP000951-PB                                         103   5e-22    Anopheles gambiae str. PEST
ref|XP_005239917.1|  PREDICTED: glucose-induced degradation prote...    103   5e-22    
emb|CDQ60037.1|  unnamed protein product                                103   5e-22    
ref|XP_005708858.1|  hypothetical protein Gasu_04310                    103   7e-22    
ref|XP_010874154.1|  PREDICTED: glucose-induced degradation prote...    103   8e-22    
ref|XP_003705100.1|  PREDICTED: protein C20orf11-like                   102   8e-22    
gb|ENN77313.1|  hypothetical protein YQE_06139                          102   9e-22    
ref|XP_011060960.1|  PREDICTED: glucose-induced degradation prote...    102   1e-21    
ref|XP_003963390.1|  PREDICTED: glucose-induced degradation prote...    102   1e-21    
ref|NP_001134125.1|  CT011 protein                                      102   1e-21    Salmo salar
gb|EFX67736.1|  hypothetical protein DAPPUDRAFT_93654                   102   1e-21    
gb|ESA09735.1|  hypothetical protein GLOINDRAFT_348540                  102   2e-21    
ref|XP_003439069.1|  PREDICTED: glucose-induced degradation prote...    102   2e-21    
ref|XP_010788576.1|  PREDICTED: glucose-induced degradation prote...    102   2e-21    
gb|KFB40237.1|  hypothetical protein ZHAS_00007615                      102   2e-21    
gb|EFN73244.1|  Protein C20orf11                                        102   2e-21    
emb|CDQ69171.1|  unnamed protein product                                101   2e-21    
ref|XP_005801729.1|  PREDICTED: glucose-induced degradation prote...    101   2e-21    
emb|CDQ84029.1|  unnamed protein product                                101   2e-21    
ref|XP_008276051.1|  PREDICTED: glucose-induced degradation prote...    101   2e-21    
ref|XP_008892946.1|  hypothetical protein, variant 3                    101   2e-21    
ref|XP_001624093.1|  predicted protein                                  101   2e-21    Nematostella vectensis
ref|XP_010937007.1|  PREDICTED: glucose-induced degradation prote...    101   3e-21    
gb|EPS66129.1|  hypothetical protein M569_08647                         100   4e-21    
gb|EMT07617.1|  hypothetical protein F775_26637                       99.4    6e-21    
ref|XP_008892944.1|  hypothetical protein, variant 1                    101   6e-21    
ref|XP_004354796.1|  hypothetical protein DFA_09447                     103   6e-21    
ref|XP_009526448.1|  hypothetical protein PHYSODRAFT_331367             100   7e-21    
gb|AFK40878.1|  unknown                                               99.8    7e-21    
gb|EMP35844.1|  Protein C20orf11 like protein                           104   9e-21    
ref|XP_004070562.1|  PREDICTED: glucose-induced degradation prote...  99.8    1e-20    
ref|NP_001291048.1|  GID complex subunit 8                            99.8    1e-20    
ref|XP_008938478.1|  PREDICTED: glucose-induced degradation prote...  99.4    1e-20    
ref|XP_003593496.1|  hypothetical protein MTR_2g012810                99.8    1e-20    
gb|AFK42048.1|  unknown                                               99.8    1e-20    
ref|XP_008892945.1|  hypothetical protein, variant 2                    100   1e-20    
gb|EZA55876.1|  Protein C20orf11                                      99.4    1e-20    
ref|XP_002589118.1|  hypothetical protein BRAFLDRAFT_75099            99.4    1e-20    Branchiostoma floridae
ref|XP_008798010.1|  PREDICTED: glucose-induced degradation prote...  99.8    1e-20    
gb|ETK85511.1|  hypothetical protein, variant 3                       99.0    2e-20    
ref|XP_008067749.1|  PREDICTED: glucose-induced degradation prote...  98.2    2e-20    
ref|XP_002896982.1|  conserved hypothetical protein                   99.0    2e-20    
gb|ETI45545.1|  hypothetical protein, variant 3                       99.0    2e-20    
ref|XP_009382981.1|  PREDICTED: glucose-induced degradation prote...  98.6    2e-20    
ref|XP_008892943.1|  hypothetical protein PPTG_01405                  99.8    3e-20    
ref|XP_002402066.1|  LisH motif-containing protein                    98.6    3e-20    Ixodes scapularis [blacklegged tick]
ref|XP_006796417.1|  PREDICTED: glucose-induced degradation prote...  97.8    4e-20    
ref|XP_010888940.1|  PREDICTED: glucose-induced degradation prote...  97.4    4e-20    
ref|XP_010228921.1|  PREDICTED: glucose-induced degradation prote...  97.8    5e-20    
ref|XP_009413492.1|  PREDICTED: glucose-induced degradation prote...  98.2    5e-20    
gb|ETI45543.1|  hypothetical protein, variant 1                       98.6    5e-20    
gb|KDP20916.1|  hypothetical protein JCGZ_21387                       97.4    5e-20    
ref|XP_010057466.1|  PREDICTED: glucose-induced degradation prote...  97.4    6e-20    
ref|XP_004535093.1|  PREDICTED: glucose-induced degradation prote...  97.4    6e-20    
gb|EYU43405.1|  hypothetical protein MIMGU_mgv1a012712mg              97.8    6e-20    
gb|KFM69936.1|  hypothetical protein X975_06017                       97.8    6e-20    
ref|XP_629459.1|  hypothetical protein DDB_G0292780                     101   6e-20    Dictyostelium discoideum AX4
ref|XP_011043244.1|  PREDICTED: glucose-induced degradation prote...  97.8    6e-20    
ref|XP_002316637.2|  hypothetical protein POPTR_0011s04610g           97.8    6e-20    Populus trichocarpa [western balsam poplar]
ref|XP_010057465.1|  PREDICTED: glucose-induced degradation prote...  97.4    7e-20    
ref|XP_010041272.1|  PREDICTED: glucose-induced degradation prote...  97.4    7e-20    
ref|XP_010041273.1|  PREDICTED: glucose-induced degradation prote...  97.4    7e-20    
ref|XP_010228923.1|  PREDICTED: glucose-induced degradation prote...  97.1    7e-20    
ref|XP_010057463.1|  PREDICTED: glucose-induced degradation prote...  97.4    7e-20    
gb|ETN66710.1|  protein C20orf11                                      98.2    8e-20    
ref|XP_010041271.1|  PREDICTED: glucose-induced degradation prote...  97.1    8e-20    
gb|EDL20701.1|  mCG134288                                             95.9    9e-20    
ref|XP_006649695.1|  PREDICTED: glucose-induced degradation prote...  97.4    9e-20    
ref|XP_006347085.1|  PREDICTED: glucose-induced degradation prote...  97.1    1e-19    
ref|XP_010041269.1|  PREDICTED: glucose-induced degradation prote...  97.1    1e-19    
gb|ETK85509.1|  hypothetical protein, variant 1                       97.4    1e-19    
ref|XP_002521405.1|  Protein C20orf11, putative                       97.8    1e-19    Ricinus communis
gb|ETI45544.1|  hypothetical protein, variant 2                       97.4    1e-19    
gb|KFH66555.1|  hypothetical protein MVEG_07080                       97.1    1e-19    
gb|EAZ26188.1|  hypothetical protein OsJ_10057                        96.7    1e-19    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002962197.1|  hypothetical protein SELMODRAFT_437992           96.7    1e-19    
ref|XP_003558414.1|  PREDICTED: glucose-induced degradation prote...  97.1    1e-19    
ref|XP_008383793.1|  PREDICTED: glucose-induced degradation prote...  96.7    1e-19    
ref|XP_010686580.1|  PREDICTED: glucose-induced degradation prote...  96.3    1e-19    
ref|NP_001049484.1|  Os03g0235100                                     96.7    1e-19    Oryza sativa Japonica Group [Japonica rice]
gb|EYU43406.1|  hypothetical protein MIMGU_mgv1a012712mg              96.7    2e-19    
gb|EKC24371.1|  Protein C20orf11                                      97.8    2e-19    
ref|XP_010645358.1|  PREDICTED: glucose-induced degradation prote...  96.7    2e-19    
ref|XP_003593497.1|  hypothetical protein MTR_2g012810                95.5    2e-19    
ref|XP_010939957.1|  PREDICTED: glucose-induced degradation prote...  96.7    2e-19    
ref|XP_008787875.1|  PREDICTED: glucose-induced degradation prote...  96.3    2e-19    
ref|XP_004485740.1|  PREDICTED: glucose-induced degradation prote...  96.3    2e-19    
gb|EJU01075.1|  lish motif-containing protein                         95.9    2e-19    
ref|XP_006449279.1|  hypothetical protein CICLE_v10016453mg           95.5    2e-19    
gb|KDO75831.1|  hypothetical protein CISIN_1g026151mg                 95.5    2e-19    
gb|KDO75834.1|  hypothetical protein CISIN_1g026151mg                 95.5    2e-19    
ref|XP_006300545.1|  hypothetical protein CARUB_v10020867mg           95.9    2e-19    
ref|XP_004985085.1|  PREDICTED: glucose-induced degradation prote...  96.3    2e-19    
gb|ETI45542.1|  hypothetical protein F443_09901                       97.1    2e-19    
ref|XP_006449276.1|  hypothetical protein CICLE_v10016453mg           95.5    3e-19    
ref|XP_010278309.1|  PREDICTED: glucose-induced degradation prote...  95.9    3e-19    
gb|KDO75829.1|  hypothetical protein CISIN_1g026151mg                 95.5    3e-19    
ref|XP_006467855.1|  PREDICTED: glucose-induced degradation prote...  95.1    3e-19    
ref|XP_005646185.1|  hypothetical protein COCSUDRAFT_33734            95.5    3e-19    
ref|XP_002468210.1|  hypothetical protein SORBIDRAFT_01g041750        95.9    3e-19    
ref|XP_010418067.1|  PREDICTED: glucose-induced degradation prote...  95.9    3e-19    
emb|CDO99603.1|  unnamed protein product                              95.5    4e-19    
ref|XP_006300546.1|  hypothetical protein CARUB_v10020867mg           95.5    4e-19    
ref|XP_006467853.1|  PREDICTED: glucose-induced degradation prote...  95.5    4e-19    
ref|XP_003545868.1|  PREDICTED: glucose-induced degradation prote...  95.5    4e-19    
gb|KDO75825.1|  hypothetical protein CISIN_1g026151mg                 95.5    4e-19    
ref|XP_011086091.1|  PREDICTED: glucose-induced degradation prote...  95.5    4e-19    
ref|XP_006449273.1|  hypothetical protein CICLE_v10016453mg           95.1    5e-19    
ref|XP_010278313.1|  PREDICTED: glucose-induced degradation prote...  95.1    5e-19    
ref|XP_003543074.1|  PREDICTED: glucose-induced degradation prote...  95.1    5e-19    
ref|XP_011086092.1|  PREDICTED: glucose-induced degradation prote...  95.1    5e-19    
ref|XP_009776505.1|  PREDICTED: glucose-induced degradation prote...  95.1    5e-19    
ref|XP_006343256.1|  PREDICTED: glucose-induced degradation prote...  95.1    5e-19    
ref|XP_009379196.1|  PREDICTED: glucose-induced degradation prote...  95.1    5e-19    
ref|XP_010316719.1|  PREDICTED: glucose-induced degradation prote...  94.7    6e-19    
ref|XP_007211929.1|  hypothetical protein PRUPE_ppa010626mg           94.7    6e-19    
ref|XP_005993548.1|  PREDICTED: glucose-induced degradation prote...  94.7    6e-19    
ref|XP_008224989.1|  PREDICTED: glucose-induced degradation prote...  94.7    7e-19    
gb|EPB88436.1|  hypothetical protein HMPREF1544_04787                 94.7    7e-19    
ref|XP_004234130.1|  PREDICTED: glucose-induced degradation prote...  94.4    9e-19    
ref|NP_573315.1|  CG6617                                              94.0    1e-18    
gb|KHG13276.1|  hypothetical protein F383_04361                       94.4    1e-18    
ref|XP_009051547.1|  hypothetical protein LOTGIDRAFT_152785           93.6    1e-18    
ref|XP_002836564.1|  hypothetical protein                             95.9    1e-18    
ref|XP_001977689.1|  GG18105                                          94.0    1e-18    
ref|XP_010268778.1|  PREDICTED: glucose-induced degradation prote...  94.0    1e-18    
emb|CBJ48784.1|  conserved unknown protein                            94.0    1e-18    
emb|CEG72089.1|  Putative Lish motif-containing protein (Fragment)    94.4    1e-18    
ref|XP_011096270.1|  PREDICTED: glucose-induced degradation prote...  94.4    1e-18    
ref|XP_010418069.1|  PREDICTED: glucose-induced degradation prote...  94.0    1e-18    
ref|XP_010107058.1|  UPF0559 protein                                  94.0    1e-18    
gb|EQB77207.1|  hypothetical protein CB1_000262005                    93.2    1e-18    
gb|AFK40505.1|  unknown                                               93.6    1e-18    
ref|NP_001140963.1|  hypothetical protein                             94.0    1e-18    
ref|XP_010268774.1|  PREDICTED: glucose-induced degradation prote...  94.0    2e-18    
ref|XP_004146589.1|  PREDICTED: glucose-induced degradation prote...  94.0    2e-18    
ref|XP_009124623.1|  PREDICTED: glucose-induced degradation prote...  93.6    2e-18    
ref|XP_008442214.1|  PREDICTED: glucose-induced degradation prote...  93.2    2e-18    
ref|XP_005703548.1|  hypothetical protein Gasu_53660                  93.2    2e-18    
emb|CDY26332.1|  BnaA03g60080D                                        94.0    2e-18    
ref|XP_010057467.1|  PREDICTED: glucose-induced degradation prote...  93.2    2e-18    
ref|XP_001360567.2|  GA14944                                          93.2    2e-18    
ref|XP_010418071.1|  PREDICTED: glucose-induced degradation prote...  93.2    2e-18    
ref|NP_001077751.1|  LisH and RanBPM domain-containing protein        93.2    2e-18    
ref|XP_002016123.1|  GL11425                                          93.2    2e-18    
ref|XP_007148210.1|  hypothetical protein PHAVU_006G189300g           93.6    2e-18    
ref|XP_002888105.1|  hypothetical protein ARALYDRAFT_475208           93.2    2e-18    
ref|XP_010041274.1|  PREDICTED: glucose-induced degradation prote...  93.2    2e-18    
ref|XP_001965530.1|  GF22403                                          93.2    2e-18    
ref|XP_007025722.1|  LisH and RanBPM domains containing protein i...  93.2    2e-18    
ref|XP_009782974.1|  PREDICTED: glucose-induced degradation prote...  93.2    2e-18    
ref|XP_972067.1|  PREDICTED: glucose-induced degradation protein ...  92.8    3e-18    
ref|XP_002071815.1|  GK10189                                          92.8    3e-18    
ref|NP_974061.1|  LisH and RanBPM domain-containing protein           92.8    3e-18    
ref|XP_010057464.1|  PREDICTED: glucose-induced degradation prote...  93.2    3e-18    
ref|XP_009020446.1|  hypothetical protein HELRODRAFT_174754           92.8    3e-18    
ref|XP_008442205.1|  PREDICTED: glucose-induced degradation prote...  92.8    3e-18    
ref|XP_010041270.1|  PREDICTED: glucose-induced degradation prote...  92.8    3e-18    
ref|XP_009597591.1|  PREDICTED: glucose-induced degradation prote...  92.8    3e-18    
ref|XP_010418068.1|  PREDICTED: glucose-induced degradation prote...  92.8    3e-18    
ref|XP_005845500.1|  hypothetical protein CHLNCDRAFT_36609            92.8    3e-18    
gb|AAB71479.1|  Unknown protein                                       92.8    3e-18    
ref|XP_001354390.1|  GA19727                                          92.4    4e-18    
ref|XP_006841733.1|  hypothetical protein AMTR_s00003p00259190        93.2    4e-18    
emb|CDH53389.1|  protein                                              92.8    4e-18    
ref|XP_008383794.1|  PREDICTED: glucose-induced degradation prote...  92.8    4e-18    
ref|NP_176310.3|  LisH and RanBPM domain-containing protein           92.8    4e-18    
ref|XP_002305675.1|  hypothetical protein POPTR_0004s03780g           92.4    4e-18    
ref|XP_009104420.1|  PREDICTED: glucose-induced degradation prote...  92.4    4e-18    
ref|XP_010645360.1|  PREDICTED: glucose-induced degradation prote...  92.4    4e-18    
emb|CDY56787.1|  BnaA01g35990D                                        92.4    5e-18    
ref|XP_001991717.1|  GH12808                                          92.0    5e-18    
gb|KHG27477.1|  hypothetical protein F383_13127                       92.4    6e-18    
ref|XP_008653205.1|  PREDICTED: glucose-induced degradation prote...  93.2    6e-18    
ref|XP_008787877.1|  PREDICTED: glucose-induced degradation prote...  92.0    6e-18    
emb|CAG11275.1|  unnamed protein product                              92.4    6e-18    
gb|ACJ86017.1|  unknown                                               90.9    6e-18    
ref|XP_005535494.1|  hypothetical protein, conserved                  92.8    7e-18    
gb|AFK47469.1|  unknown                                               91.7    7e-18    
emb|CDS12208.1|  hypothetical protein LRAMOSA04403                    92.0    7e-18    
ref|XP_010533884.1|  PREDICTED: glucose-induced degradation prote...  91.7    7e-18    
gb|ELV11335.1|  Baculoviral IAP repeat-containing protein 7           93.6    8e-18    
ref|XP_004293565.1|  PREDICTED: glucose-induced degradation prote...  92.0    8e-18    
ref|XP_011086093.1|  PREDICTED: glucose-induced degradation prote...  90.9    9e-18    
gb|EMS52108.1|  UPF0559 protein                                       91.3    9e-18    
ref|XP_006392046.1|  hypothetical protein EUTSA_v10023660mg           91.3    1e-17    
emb|CBH32638.1|  conserved hypothetical protein, Hv-pg4 homolog,e...  91.3    1e-17    
ref|XP_006597413.1|  PREDICTED: glucose-induced degradation prote...  91.3    1e-17    
emb|CCG47994.1|  pg4, expressed                                       91.3    1e-17    
ref|XP_008475511.1|  PREDICTED: glucose-induced degradation prote...  91.3    1e-17    
gb|KDO75826.1|  hypothetical protein CISIN_1g026151mg                 91.3    1e-17    
ref|XP_006449274.1|  hypothetical protein CICLE_v10016453mg           91.3    1e-17    
ref|XP_009379336.1|  PREDICTED: glucose-induced degradation prote...  90.9    2e-17    
ref|XP_003387381.1|  PREDICTED: UPF0559 protein-like                  90.9    2e-17    
ref|XP_006392047.1|  hypothetical protein EUTSA_v10023660mg           90.9    2e-17    
ref|XP_008224990.1|  PREDICTED: glucose-induced degradation prote...  90.9    2e-17    
ref|XP_010473321.1|  PREDICTED: glucose-induced degradation prote...  89.7    2e-17    
ref|XP_010547375.1|  PREDICTED: glucose-induced degradation prote...  90.1    3e-17    
ref|XP_004302759.1|  PREDICTED: glucose-induced degradation prote...  90.5    3e-17    
ref|XP_004644251.1|  PREDICTED: solute carrier family 17 member 9     93.6    3e-17    
ref|XP_011027909.1|  PREDICTED: glucose-induced degradation prote...  89.7    3e-17    
ref|XP_783804.2|  PREDICTED: protein C20orf11-like                    89.7    3e-17    
ref|XP_010268777.1|  PREDICTED: glucose-induced degradation prote...  89.7    4e-17    
gb|ABK23060.1|  unknown                                               90.1    4e-17    
ref|XP_002055267.1|  GJ18886                                          89.4    4e-17    
gb|KEY66617.1|  hypothetical protein S7711_01911                      90.1    4e-17    
ref|XP_002677646.1|  hypothetical protein NAEGRDRAFT_36605            89.7    4e-17    
gb|KFX47298.1|  Glucose-induced degradation protein 8 like            89.4    4e-17    
ref|XP_005850257.1|  hypothetical protein CHLNCDRAFT_34313            91.7    5e-17    
ref|XP_003146101.1|  hypothetical protein LOAG_10529                  89.4    5e-17    
ref|XP_010547367.1|  PREDICTED: glucose-induced degradation prote...  89.7    5e-17    
emb|CDJ05474.1|  ran binding protein 9                                90.1    5e-17    
emb|CDO73491.1|  hypothetical protein BN946_scf185013.g126            89.4    5e-17    
ref|XP_008032844.1|  lish motif-containing protein                    89.4    5e-17    
gb|KFX47299.1|  Glucose-induced degradation protein 8 like            89.0    5e-17    
ref|XP_002382153.1|  conserved hypothetical protein                   89.7    6e-17    
emb|CDJ85648.1|  LisH dimerisation motif and Ran binding protein ...  91.3    6e-17    
ref|XP_004366298.1|  UPF0559 protein                                  89.4    6e-17    
ref|XP_001819155.2|  CTLH domain-containing protein                   89.7    6e-17    
gb|KHN81702.1|  Glucose-induced degradation protein 8 -like protein   89.7    7e-17    
ref|XP_007025723.1|  LisH and RanBPM domains containing protein i...  89.4    7e-17    
ref|XP_002795564.1|  conserved hypothetical protein                   89.4    7e-17    
ref|NP_611211.3|  CG18467                                             89.0    7e-17    
ref|XP_002009726.1|  GI15079                                          88.6    8e-17    
gb|EJW78284.1|  hypothetical protein WUBG_10805                       89.0    9e-17    
ref|XP_004687160.1|  PREDICTED: uncharacterized protein LOC101622124  92.4    9e-17    
gb|KFA62756.1|  hypothetical protein S40285_05027                     89.0    1e-16    
ref|XP_002146631.1|  conserved hypothetical protein                   89.0    1e-16    
gb|EPS31981.1|  hypothetical protein PDE_06940                        89.4    1e-16    
ref|XP_002146633.1|  conserved hypothetical protein                   89.0    1e-16    
ref|XP_006680178.1|  hypothetical protein BATDEDRAFT_89572            90.1    1e-16    
emb|CDP92062.1|  Protein BM-TAG-304, isoform b                        88.6    1e-16    
ref|XP_008802878.1|  PREDICTED: ran-binding protein 9-like            91.3    1e-16    
ref|XP_001902959.1|  Protein C20orf11 homolog                         88.2    1e-16    
ref|XP_010760994.1|  hypothetical protein PADG_05408                  88.6    2e-16    
emb|CDP92061.1|  Protein BM-TAG-304, isoform a                        88.2    2e-16    
ref|XP_002146632.1|  conserved hypothetical protein                   88.6    2e-16    
dbj|GAA38464.2|  hypothetical protein CLF_100334                      89.0    2e-16    
gb|ELK04402.1|  hypothetical protein PAL_GLEAN10024726                89.0    2e-16    
ref|XP_007879374.1|  hypothetical protein PFL1_03664                  88.6    2e-16    
gb|AAV65331.1|  pg4                                                   87.4    2e-16    
ref|XP_002146634.1|  conserved hypothetical protein                   87.8    2e-16    
ref|XP_001543921.1|  conserved hypothetical protein                   87.8    3e-16    
ref|XP_641761.2|  UPF0559 protein                                     87.4    3e-16    
ref|XP_008994491.1|  PREDICTED: glucose-induced degradation prote...  86.3    3e-16    
ref|XP_002092445.1|  GE11662                                          87.4    3e-16    
gb|EEH06738.1|  CTLH domain-containing protein                        87.4    4e-16    
emb|CDY15004.1|  BnaCnng04070D                                        86.3    4e-16    
dbj|GAM20264.1|  hypothetical protein SAMD00019534_034390             87.0    4e-16    
ref|XP_002081901.1|  GD11267                                          87.0    4e-16    
ref|XP_001975222.1|  GG20679                                          87.0    4e-16    
gb|KHG05931.1|  hypothetical protein F383_10432                       87.0    4e-16    
ref|XP_003284114.1|  hypothetical protein DICPUDRAFT_52718            86.7    4e-16    
dbj|GAA85811.1|  CTLH domain-containing protein                       87.4    4e-16    
dbj|GAM35738.1|  hypothetical protein TCE0_017r04295                  87.4    4e-16    
dbj|GAD99936.1|  hypothetical protein NFIA_082180                     87.4    6e-16    
ref|XP_001394891.1|  CTLH domain-containing protein                   87.0    6e-16    
gb|EFA81705.1|  UPF0559 protein                                       86.3    8e-16    
ref|XP_005706461.1|  SPla/RYanodine receptor (SPRY) domain-contai...  88.6    9e-16    
ref|XP_007841325.1|  hypothetical protein PFICI_14553                 85.9    9e-16    
gb|EPB90344.1|  hypothetical protein HMPREF1544_02870                 85.9    1e-15    
gb|EHK15833.1|  hypothetical protein TRIVIDRAFT_87674                 85.9    1e-15    
ref|XP_007418873.1|  hypothetical protein MELLADRAFT_73683            85.9    1e-15    
gb|EUC67208.1|  glucose-induced degradation-like protein              85.5    1e-15    
gb|EHB16219.1|  hypothetical protein GW7_04992                        84.3    1e-15    
gb|KDN51459.1|  hypothetical protein RSAG8_00004                      85.1    2e-15    
ref|XP_001758468.1|  predicted protein                                85.1    2e-15    
gb|EPZ31748.1|  CTLH/CRAto LisH motif domain-containing protein       88.6    2e-15    
ref|XP_003746655.1|  PREDICTED: protein C20orf11 homolog              85.1    2e-15    
ref|XP_010911815.1|  PREDICTED: ran-binding protein 10-like isofo...  87.8    2e-15    
ref|XP_006858527.1|  hypothetical protein AMTR_s00071p00153630        87.8    2e-15    
ref|XP_008383795.1|  PREDICTED: glucose-induced degradation prote...  85.1    2e-15    
ref|XP_005818617.1|  hypothetical protein GUITHDRAFT_91187            87.4    2e-15    
ref|XP_003175643.1|  CTLH domain-containing protein                   85.1    2e-15    
gb|AAW24976.1|  SJCHGC08993 protein                                   85.5    2e-15    
emb|CAX70622.1|  Protein C20orf11 homolog                             85.1    2e-15    
ref|XP_006377311.1|  hypothetical protein POPTR_0011s04610g           83.6    2e-15    
ref|XP_001690032.1|  predicted protein                                84.3    3e-15    
ref|XP_001783856.1|  predicted protein                                84.3    3e-15    
ref|XP_008596815.1|  ran binding protein in the microtubule-organ...  84.7    3e-15    
gb|EIE83620.1|  hypothetical protein RO3G_08325                       83.6    4e-15    
gb|EWC48625.1|  hypothetical protein DRE_01847                        84.3    4e-15    
gb|EGE84817.1|  CTLH domain-containing protein                        84.3    4e-15    
emb|CBI18750.3|  unnamed protein product                              84.7    5e-15    
gb|KHG14226.1|  hypothetical protein F383_06968                       83.6    5e-15    
gb|AAP46639.1|  PG4                                                   83.6    5e-15    
gb|EQL31482.1|  hypothetical protein, variant                         84.0    5e-15    
ref|XP_002620749.1|  CTLH domain-containing protein                   84.3    5e-15    
ref|XP_009119092.1|  PREDICTED: uncharacterized protein LOC103844074  80.1    6e-15    
ref|XP_001260168.1|  hypothetical protein NFIA_082180                 84.0    6e-15    
emb|CCD78456.1|  ran binding protein 9-related                        84.0    6e-15    
ref|XP_002034271.1|  GM21774                                          83.6    7e-15    
ref|XP_003234398.1|  hypothetical protein TERG_04992                  84.0    7e-15    
gb|EZF23684.1|  hypothetical protein H100_03672                       83.6    7e-15    
ref|XP_009416950.1|  PREDICTED: ran-binding protein 10                85.9    7e-15    
ref|XP_007763488.1|  lish motif-containing protein                    83.2    8e-15    
ref|XP_001779937.1|  predicted protein                                83.2    8e-15    
gb|EZF30260.1|  hypothetical protein H101_06101                       83.2    1e-14    
gb|EZF30261.1|  hypothetical protein H101_06101                       83.2    1e-14    
ref|XP_007390675.1|  hypothetical protein PHACADRAFT_247729           82.0    1e-14    
ref|XP_001609090.1|  hypothetical protein                             83.2    1e-14    
gb|KEQ85449.1|  hypothetical protein M438DRAFT_344771                 82.8    1e-14    
gb|EGD98040.1|  hypothetical protein TESG_05432                       83.2    1e-14    
emb|CDY47712.1|  BnaA10g04010D                                        79.7    1e-14    
tpe|CBF79510.1|  TPA: hypothetical protein ANIA_07501                 83.2    1e-14    
gb|EFX04468.1|  ctlh domain containing protein                        82.8    1e-14    
ref|XP_006665637.1|  CTLH domain-containing protein                   82.8    1e-14    
gb|EPZ34346.1|  CTLH/CRAto LisH motif domain-containing protein       82.8    1e-14    
ref|XP_002839342.1|  hypothetical protein                             82.0    1e-14    
ref|XP_002982208.1|  hypothetical protein SELMODRAFT_179372           84.7    2e-14    
ref|XP_005719040.1|  unnamed protein product                          85.1    2e-14    



>ref|XP_009769036.1| PREDICTED: glucose-induced degradation protein 8 homolog [Nicotiana 
sylvestris]
Length=215

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPRQYE I V+D DVHNIV+SYL HNCF DT+ESF ASTGMKQ    LEDM KRKRI
Sbjct  1     MDIDPRQYENIAVNDGDVHNIVMSYLEHNCFTDTLESFTASTGMKQTANHLEDMVKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             ++  LEGNVLKAIE TEQLAPDLLEKNKDLHFDLLSLHFV LVC+RKCTEALEFAQTKLA
Sbjct  61    YHLALEGNVLKAIELTEQLAPDLLEKNKDLHFDLLSLHFVGLVCSRKCTEALEFAQTKLA  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ YVEKLEDFMALLAY EPEKSPMFHLLSLEYRQ+V+DSLNRAILA++NLPSYSA
Sbjct  121   PFGKVQKYVEKLEDFMALLAYNEPEKSPMFHLLSLEYRQQVSDSLNRAILANSNLPSYSA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             VERLIQQ TVVRQ LSQE  KEG+ PFSLKDF+KS
Sbjct  181   VERLIQQTTVVRQCLSQESSKEGHPPFSLKDFMKS  215



>dbj|BAJ53170.1| JHL18I08.4 [Jatropha curcas]
 gb|KDP38571.1| hypothetical protein JCGZ_04496 [Jatropha curcas]
Length=215

 Score =   365 bits (936),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR YE + + D+D+HN+VLSYLVHNC+K+TVESFI+ TGMKQP  C++DMEKRKRI
Sbjct  1     MDVDPRHYEQVAIKDNDIHNVVLSYLVHNCYKETVESFISCTGMKQPADCVQDMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F + LEGNVLKAIE TE+LA DLLE NKDLHFDLLSLHF+ELVCTRKCTEALEFAQTKL 
Sbjct  61    FRYALEGNVLKAIELTEELAHDLLEINKDLHFDLLSLHFIELVCTRKCTEALEFAQTKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ YVEKLEDFMALLAYEEPEKSPMFHLLS+EYRQ+V D+LNRAILAHAN PSY+A
Sbjct  121   PFGKVQKYVEKLEDFMALLAYEEPEKSPMFHLLSMEYRQQVVDNLNRAILAHANRPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ+TVVRQSL+Q+ GK+G  PFSLKDFLK 
Sbjct  181   MERLIQQMTVVRQSLNQDHGKDGLQPFSLKDFLKG  215



>ref|XP_009598032.1| PREDICTED: glucose-induced degradation protein 8 homolog [Nicotiana 
tomentosiformis]
Length=215

 Score =   364 bits (934),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPRQYE I V+D DVHNIV+SYL HNCF DT+ESF ASTGMKQ    LEDMEKRKRI
Sbjct  1     MDIDPRQYEHIAVNDGDVHNIVMSYLEHNCFTDTLESFNASTGMKQNANHLEDMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             ++  LEGNVLKAIE TEQLAPDLLEKNKDLHFDLLSLHFV LVC+RKCTEALEFAQ KLA
Sbjct  61    YHLALEGNVLKAIELTEQLAPDLLEKNKDLHFDLLSLHFVGLVCSRKCTEALEFAQRKLA  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ YVEKLEDFMALLAY EPEKSPMFHLLSLEYRQ+V+DSLNRAILA++NLPSYSA
Sbjct  121   PFGKVQKYVEKLEDFMALLAYNEPEKSPMFHLLSLEYRQQVSDSLNRAILANSNLPSYSA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             VERLIQQ TVVRQ LSQE  KEG+ PFSLKDF+KS
Sbjct  181   VERLIQQTTVVRQCLSQESTKEGHPPFSLKDFMKS  215



>ref|XP_002280458.1| PREDICTED: glucose-induced degradation protein 8 homolog [Vitis 
vinifera]
Length=216

 Score =   363 bits (933),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MMDVDPRQYE   ++DSD+HNIVLSYLVHNCFK+TVESFI+ TGMKQP    EDMEKRKR
Sbjct  1     MMDVDPRQYENAAINDSDIHNIVLSYLVHNCFKETVESFISCTGMKQPADYQEDMEKRKR  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+F LEGN LKAIE TEQLA DLLEKNKDLHFDLLSLHFV+LVC+RKCTEALEFAQTKL
Sbjct  61    IFHFALEGNALKAIELTEQLADDLLEKNKDLHFDLLSLHFVKLVCSRKCTEALEFAQTKL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
              PFGKVQ+YVEKLEDFM LLAYEEPEKSPMFHLLSLEYRQ+VADSLNRA+LAHANLPS S
Sbjct  121   TPFGKVQNYVEKLEDFMTLLAYEEPEKSPMFHLLSLEYRQQVADSLNRALLAHANLPSCS  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             A+ERLIQQ TVVRQ L+QE  K+   PFSLKDFLKS
Sbjct  181   AMERLIQQTTVVRQCLNQELSKDPPPPFSLKDFLKS  216



>gb|KHG06303.1| Protein C20orf11 [Gossypium arboreum]
Length=215

 Score =   362 bits (928),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR YE I V+D+DVHNI++SYLVHNCFK+TVESFIA TGMKQP   LEDMEKRKRI
Sbjct  1     MDVDPRLYEQIAVNDTDVHNIIMSYLVHNCFKETVESFIACTGMKQPSDYLEDMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             + F LEGN LKAIE TEQLA +LLEKNKDLHFDLLSLHFVELVC+RKCTEALEFAQ KL 
Sbjct  61    YQFALEGNALKAIELTEQLATNLLEKNKDLHFDLLSLHFVELVCSRKCTEALEFAQMKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK Q YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQ VA+SLNRAILAH N P+Y+A
Sbjct  121   PFGKEQKYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQHVAESLNRAILAHGNHPTYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ L+QE  K+G LPFSLKDFLKS
Sbjct  181   MERLIQQTTVVRQCLNQEHAKDGPLPFSLKDFLKS  215



>emb|CBI19773.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPRQYE   ++DSD+HNIVLSYLVHNCFK+TVESFI+ TGMKQP    EDMEKRKRI
Sbjct  1     MDVDPRQYENAAINDSDIHNIVLSYLVHNCFKETVESFISCTGMKQPADYQEDMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+F LEGN LKAIE TEQLA DLLEKNKDLHFDLLSLHFV+LVC+RKCTEALEFAQTKL 
Sbjct  61    FHFALEGNALKAIELTEQLADDLLEKNKDLHFDLLSLHFVKLVCSRKCTEALEFAQTKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ+YVEKLEDFM LLAYEEPEKSPMFHLLSLEYRQ+VADSLNRA+LAHANLPS SA
Sbjct  121   PFGKVQNYVEKLEDFMTLLAYEEPEKSPMFHLLSLEYRQQVADSLNRALLAHANLPSCSA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ L+QE  K+   PFSLKDFLKS
Sbjct  181   MERLIQQTTVVRQCLNQELSKDPPPPFSLKDFLKS  215



>ref|XP_006435081.1| hypothetical protein CICLE_v10002444mg [Citrus clementina]
 ref|XP_006473577.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Citrus sinensis]
 gb|ESR48321.1| hypothetical protein CICLE_v10002444mg [Citrus clementina]
 gb|KDO84701.1| hypothetical protein CISIN_1g027999mg [Citrus sinensis]
Length=215

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPRQYE I ++D+D+HNIVLSYLVHNC+K+TV+SFI+ TGMKQP  CLEDME RKRI
Sbjct  1     MDVDPRQYEHIAINDNDIHNIVLSYLVHNCYKETVDSFISCTGMKQPANCLEDMEMRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
              +F LEGN LKAIE TE+LA DLLEKNKDLHFDLLSLHFVELVC+RKCTEALEFAQTKL 
Sbjct  61    LHFALEGNALKAIELTEELAQDLLEKNKDLHFDLLSLHFVELVCSRKCTEALEFAQTKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQ VAD+LNRAILAHA  P Y+A
Sbjct  121   PFGKVQKYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQHVADNLNRAILAHAERPRYAA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ T VRQ LSQE GK+ + PFSLKDF+KS
Sbjct  181   MERLIQQTTAVRQCLSQELGKDVHPPFSLKDFMKS  215



>ref|XP_007136042.1| hypothetical protein PHAVU_009G013100g [Phaseolus vulgaris]
 gb|ESW08036.1| hypothetical protein PHAVU_009G013100g [Phaseolus vulgaris]
Length=215

 Score =   357 bits (916),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPRQYE + ++D+D+H+IVLSYL+HNC+K++VESFI STG KQP   LEDM+KRKRI
Sbjct  1     MDLDPRQYENVAINDNDIHSIVLSYLIHNCYKESVESFITSTGTKQPSDYLEDMDKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+F LEGN LKAIE TEQLA D+LEKNKDL FDLLSLHFVELVC+RKCTEALEFAQTKL 
Sbjct  61    FHFALEGNALKAIELTEQLAQDILEKNKDLQFDLLSLHFVELVCSRKCTEALEFAQTKLG  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK   Y+EKLEDFMALLAY+EPEKSPMFHLLSLEYRQ+VADSLNRAILAH NLP Y+A
Sbjct  121   PFGKEPKYMEKLEDFMALLAYKEPEKSPMFHLLSLEYRQQVADSLNRAILAHLNLPRYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ LSQEPGK+G  PFSLKDFLKS
Sbjct  181   MERLIQQTTVVRQCLSQEPGKDGPPPFSLKDFLKS  215



>ref|XP_007017657.1| LisH and RanBPM domains containing protein isoform 1 [Theobroma 
cacao]
 gb|EOY14882.1| LisH and RanBPM domains containing protein isoform 1 [Theobroma 
cacao]
Length=274

 Score =   357 bits (917),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 205/250 (82%), Gaps = 7/250 (3%)
 Frame = -3

Query  1166  NHLLPRIFSPRPDRIFGGGEEFSGQTNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSY  987
             +H  PR+F      +F        + +   +C +M D+DPRQ+E + V+D+D+HNIV+SY
Sbjct  32    SHPPPRLF------VFFFSRTPKPKASVPVICPIM-DIDPRQFEHVAVNDNDIHNIVMSY  84

Query  986   LVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLE  807
             LVHNCFK+TVESFIA TGMKQP   LEDMEKRK+IF F LEGN L AIE TEQLA +LLE
Sbjct  85    LVHNCFKETVESFIACTGMKQPSDYLEDMEKRKKIFQFALEGNALMAIELTEQLATNLLE  144

Query  806   KNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPE  627
             KNKDLHFDLLSLHFVELVC+RKCTEALEFAQTKLAPF K Q YVEKLEDFMALLAYEEPE
Sbjct  145   KNKDLHFDLLSLHFVELVCSRKCTEALEFAQTKLAPFDKEQKYVEKLEDFMALLAYEEPE  204

Query  626   KSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNL  447
             KSPMFHLLSLEYRQ VA+SLNRAILAHAN PSY+A+ERLIQQ TVVRQ L+QE  K+G  
Sbjct  205   KSPMFHLLSLEYRQHVAESLNRAILAHANHPSYTAMERLIQQTTVVRQCLNQEHVKDGPP  264

Query  446   PFSLKDFLKS  417
             PFSLKDFLKS
Sbjct  265   PFSLKDFLKS  274



>ref|NP_001239946.1| uncharacterized protein LOC100801338 [Glycine max]
 gb|ACU18606.1| unknown [Glycine max]
 gb|KHN45887.1| UPF0559 protein [Glycine soja]
Length=214

 Score =   352 bits (904),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPRQYE + V+D+D+HNIVLSYL+HNC+K++VESFIA TG KQP   LEDM+KRKRI
Sbjct  1     MDLDPRQYENLAVNDNDIHNIVLSYLIHNCYKESVESFIACTGAKQPTDYLEDMDKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+F LEGN LKAIE TEQLA D+LE NKDL FDLLSLHFVELVC+RKCTEALEFAQTKL 
Sbjct  61    FHFALEGNALKAIELTEQLAKDILENNKDLQFDLLSLHFVELVCSRKCTEALEFAQTKLG  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK   Y+EKLEDFMALLAY+EPEKSPMFHLLSLEYRQ+VADSLNRAILAH NLPSY+A
Sbjct  121   PFGKEPKYMEKLEDFMALLAYKEPEKSPMFHLLSLEYRQQVADSLNRAILAHLNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ LSQE GK+G  PFSLKDFLKS
Sbjct  181   MERLIQQATVVRQCLSQEAGKDGP-PFSLKDFLKS  214



>ref|XP_008221335.1| PREDICTED: glucose-induced degradation protein 8 homolog [Prunus 
mume]
Length=215

 Score =   351 bits (900),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR Y  + ++D+D+HNIVLSYLVHNC+K++VESF+ASTGMKQP  CLEDMEKRKRI
Sbjct  1     MDVDPRHYNHVAINDNDIHNIVLSYLVHNCYKESVESFVASTGMKQPADCLEDMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+  +EGN LKAIE TEQLAPDLLEKNK+LHFDLLSLHFVELVC++KCTEALEFAQ +L 
Sbjct  61    FHCAVEGNALKAIELTEQLAPDLLEKNKELHFDLLSLHFVELVCSKKCTEALEFAQNQLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKV+ YV KLEDFMALLAYEEPEKSPMFHLLSL+YRQ+VADSLNRA+L H+NLP+Y+A
Sbjct  121   PFGKVEKYVSKLEDFMALLAYEEPEKSPMFHLLSLDYRQQVADSLNRAVLEHSNLPNYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ +S+E  K G   FSLKDF++S
Sbjct  181   MERLIQQTTVVRQCISEENAKNGPPTFSLKDFIRS  215



>ref|XP_010271533.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Nelumbo nucifera]
Length=216

 Score =   351 bits (900),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MMD+DPRQYE + ++D+DV NIVLSYLVHNCFK+T ESFIA TGMKQPD    D++KRK 
Sbjct  1     MMDLDPRQYEHVAINDNDVRNIVLSYLVHNCFKETAESFIACTGMKQPDDYPVDIDKRKP  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+F LEGN LKAIE TEQLA DLLE+NKDLHFDLLSLHFVELVC+RKCTEALEFAQTKL
Sbjct  61    IFHFALEGNALKAIELTEQLAHDLLEQNKDLHFDLLSLHFVELVCSRKCTEALEFAQTKL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
              PFGKV  YVEKLEDFMALLAYEEPEKSPMFHLLS+EYRQ+VADSLNRAILA+AN PSYS
Sbjct  121   TPFGKVHKYVEKLEDFMALLAYEEPEKSPMFHLLSMEYRQQVADSLNRAILAYANQPSYS  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             A+ERL+QQ  VVRQSL QE GK+G  PFSL  FLKS
Sbjct  181   AMERLVQQTAVVRQSLHQEFGKDGPSPFSLNKFLKS  216



>ref|XP_010672512.1| PREDICTED: glucose-induced degradation protein 8 homolog [Beta 
vulgaris subsp. vulgaris]
Length=215

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             M++DPRQYE +DVSDSD HNIVLSYLVHNCFK+TVESFI STG+KQP  CLED+++RKRI
Sbjct  1     MELDPRQYENVDVSDSDSHNIVLSYLVHNCFKETVESFIGSTGIKQPANCLEDIDRRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
               F LEG+ LKAIE TE+LAP LLE+NKDLHFDLLSLHFVELVC RKCTEALEFAQ KL 
Sbjct  61    IQFALEGSSLKAIELTEELAPGLLEENKDLHFDLLSLHFVELVCLRKCTEALEFAQKKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ YVEKLEDF+ALLAYEEPEKSPMFHL+SL+YRQ VAD LNRAILAHA  PSYS+
Sbjct  121   PFGKVQKYVEKLEDFVALLAYEEPEKSPMFHLVSLDYRQDVADKLNRAILAHAKQPSYSS  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ L+QE  K+   PFSLKDF+KS
Sbjct  181   LERLIQQTTVVRQRLNQENSKDAIPPFSLKDFIKS  215



>ref|XP_003527884.1| PREDICTED: glucose-induced degradation protein 8 homolog [Glycine 
max]
 gb|KHN22219.1| UPF0559 protein [Glycine soja]
Length=215

 Score =   350 bits (898),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 190/215 (88%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPRQYE + V+D+D+HNIVLSYL+HNC+K++VESFIA TG  QP   LEDM+KRKRI
Sbjct  1     MDLDPRQYENLAVNDNDIHNIVLSYLIHNCYKESVESFIACTGATQPADYLEDMDKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+F LEGN LKAIE TEQLA D+LE NKDL FDLLSLHFVELVC+RKCTEALEFAQTKL 
Sbjct  61    FHFALEGNALKAIELTEQLAKDILENNKDLQFDLLSLHFVELVCSRKCTEALEFAQTKLG  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK   Y+EKLEDFMALLAY+EPEKSPMFHLLSLEYRQ+VADSLNRAILAH NLPSY+A
Sbjct  121   PFGKEPKYMEKLEDFMALLAYKEPEKSPMFHLLSLEYRQQVADSLNRAILAHLNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ LSQE GK+   PFSLKDFL+S
Sbjct  181   MERLIQQATVVRQCLSQEAGKDAPPPFSLKDFLRS  215



>emb|CDP07459.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   350 bits (898),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPRQYE + ++DSD+HNIVLSYLVHNCFKDTVESF +ST M+Q    LEDMEKRK+I
Sbjct  1     MDIDPRQYENVVINDSDIHNIVLSYLVHNCFKDTVESFTSSTTMRQSVDHLEDMEKRKKI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+  LEGN L+AIE T Q+APDLLEKNKDLHFDLLSLHFVELVC+RKCTEAL FAQ++L 
Sbjct  61    FHSALEGNALEAIELTGQIAPDLLEKNKDLHFDLLSLHFVELVCSRKCTEALGFAQSELT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ +++KLEDF+ALLAYEEPEKSPMFHLLS EYRQ VADSLNRAILAHANLPSYSA
Sbjct  121   PFGKVQKHLKKLEDFIALLAYEEPEKSPMFHLLSSEYRQHVADSLNRAILAHANLPSYSA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERL+QQ+TVVRQ L +E GKEG+ PFSLKDF+KS
Sbjct  181   LERLVQQMTVVRQCLGEECGKEGHPPFSLKDFVKS  215



>ref|XP_006473578.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Citrus sinensis]
 gb|KDO84702.1| hypothetical protein CISIN_1g027999mg [Citrus sinensis]
Length=212

 Score =   349 bits (896),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 189/215 (88%), Gaps = 3/215 (1%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPRQYE I ++D+D+HNIVLSYLVHNC+K+TV+SFI+ TGMKQP  CLEDME RKRI
Sbjct  1     MDVDPRQYEHIAINDNDIHNIVLSYLVHNCYKETVDSFISCTGMKQPANCLEDMEMRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
              +F LEGN LKAIE TE+LA DLLEKNKDLHFDLLSLHFVELVC+RKCTEALEFAQTKL 
Sbjct  61    LHFALEGNALKAIELTEELAQDLLEKNKDLHFDLLSLHFVELVCSRKCTEALEFAQTKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQ VAD+LNRAIL     P Y+A
Sbjct  121   PFGKVQKYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQHVADNLNRAILER---PRYAA  177

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ T VRQ LSQE GK+ + PFSLKDF+KS
Sbjct  178   MERLIQQTTAVRQCLSQELGKDVHPPFSLKDFMKS  212



>ref|XP_006341991.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Solanum tuberosum]
Length=214

 Score =   348 bits (892),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPRQYE I V+D+DVH+IV+SYL H+CF DT+ESF  STG+KQ    LEDMEKRKRI
Sbjct  1     MDIDPRQYEDIAVNDNDVHSIVMSYLAHSCFTDTLESFTTSTGVKQTAN-LEDMEKRKRI  59

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             ++  LEG+VLKAIE TEQ APDLLEKNKDLHFDLLSLHFV LVC+RKCTEALEFAQ KLA
Sbjct  60    YHLALEGSVLKAIELTEQFAPDLLEKNKDLHFDLLSLHFVGLVCSRKCTEALEFAQAKLA  119

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ YVEKLEDFMALLAY EPEKSPMFHLLSLEYRQ+VADSLNRA+LA++NLPSYSA
Sbjct  120   PFGKVQKYVEKLEDFMALLAYNEPEKSPMFHLLSLEYRQQVADSLNRAMLANSNLPSYSA  179

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             VERL+QQ TVVRQ LSQE  KEG   F+LKDFLKS
Sbjct  180   VERLMQQTTVVRQCLSQESSKEGYPVFALKDFLKS  214



>ref|XP_009335745.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X4 [Pyrus x bretschneideri]
Length=215

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 187/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR +  + ++D+D+HNIVLSYLVHNC+K+TVESF+ASTG KQP  C+EDMEKR RI
Sbjct  1     MDVDPRHFNQVAINDNDIHNIVLSYLVHNCYKETVESFVASTGTKQPADCVEDMEKRNRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F   +EG  LKAIE TE+LAPDL+EKNKDLHFDLLSLHFVELVC +KCTEALEFAQ KL 
Sbjct  61    FQCAVEGEALKAIELTEELAPDLVEKNKDLHFDLLSLHFVELVCAKKCTEALEFAQNKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKV+ YV KLEDFMALLAY+EPEKSPMFHLLS EYRQ+VADSLNRA+L H+NLP+YSA
Sbjct  121   PFGKVEKYVTKLEDFMALLAYKEPEKSPMFHLLSFEYRQQVADSLNRAVLEHSNLPNYSA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ +S++  K GN PFSL DFL+S
Sbjct  181   MERLIQQTTVVRQCMSEDNAKNGNPPFSLNDFLRS  215



>ref|XP_010320407.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Solanum lycopersicum]
Length=214

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPRQYE I V+D+DVH+IV+SYL H+CF DT+ESF  S GM Q    LEDMEKRKRI
Sbjct  1     MDIDPRQYEDIAVNDNDVHSIVMSYLAHSCFTDTLESFTTSMGMNQTAN-LEDMEKRKRI  59

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             ++  LEG+VLKAIE T+Q APDLLEKNKDLHFDLLSLHFV LVC+RKCTEALEFAQ KLA
Sbjct  60    YHLALEGSVLKAIEITDQFAPDLLEKNKDLHFDLLSLHFVGLVCSRKCTEALEFAQAKLA  119

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ YVEKLEDFMALLAY EPEKSPMFHLLSLEYRQ+VADSLNRAILA++NLPSYSA
Sbjct  120   PFGKVQKYVEKLEDFMALLAYNEPEKSPMFHLLSLEYRQQVADSLNRAILANSNLPSYSA  179

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             VERL+QQ TVVRQ LSQE  KEG   F+LKDFLKS
Sbjct  180   VERLMQQTTVVRQCLSQESSKEGYPAFALKDFLKS  214



>ref|XP_007227500.1| hypothetical protein PRUPE_ppa011330mg [Prunus persica]
 gb|EMJ28699.1| hypothetical protein PRUPE_ppa011330mg [Prunus persica]
Length=215

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR Y  + ++D+D+H+IVLSYLVHNC+K++VESF+ASTGMKQP  C+EDMEKRKRI
Sbjct  1     MDVDPRHYNHVAINDNDIHSIVLSYLVHNCYKESVESFVASTGMKQPADCVEDMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+  +EGN LKAIE TEQLAPDLLEKNK+LHFDLLSLHFVELVC++KCTEALEFAQ +L 
Sbjct  61    FHCAVEGNALKAIELTEQLAPDLLEKNKELHFDLLSLHFVELVCSKKCTEALEFAQNQLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKV+ YV KLEDFMALLAYEEPEKSPMFHLLSL+YRQ+VADSLNRA+L H+NLP+Y+A
Sbjct  121   PFGKVEKYVSKLEDFMALLAYEEPEKSPMFHLLSLDYRQQVADSLNRAVLEHSNLPNYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ +S+E  K G   FSL DF++S
Sbjct  181   MERLIQQTTVVRQCISEENAKNGPPSFSLNDFIRS  215



>ref|XP_009335728.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=216

 Score =   342 bits (878),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 187/216 (87%), Gaps = 1/216 (0%)
 Frame = -3

Query  1061  MDVDPRQYETID-VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MDVDPR +  +  ++D+D+HNIVLSYLVHNC+K+TVESF+ASTG KQP  C+EDMEKR R
Sbjct  1     MDVDPRHFNQVQAINDNDIHNIVLSYLVHNCYKETVESFVASTGTKQPADCVEDMEKRNR  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF   +EG  LKAIE TE+LAPDL+EKNKDLHFDLLSLHFVELVC +KCTEALEFAQ KL
Sbjct  61    IFQCAVEGEALKAIELTEELAPDLVEKNKDLHFDLLSLHFVELVCAKKCTEALEFAQNKL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
              PFGKV+ YV KLEDFMALLAY+EPEKSPMFHLLS EYRQ+VADSLNRA+L H+NLP+YS
Sbjct  121   TPFGKVEKYVTKLEDFMALLAYKEPEKSPMFHLLSFEYRQQVADSLNRAVLEHSNLPNYS  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             A+ERLIQQ TVVRQ +S++  K GN PFSL DFL+S
Sbjct  181   AMERLIQQTTVVRQCMSEDNAKNGNPPFSLNDFLRS  216



>ref|XP_008466517.1| PREDICTED: glucose-induced degradation protein 8 homolog [Cucumis 
melo]
Length=215

 Score =   342 bits (877),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR Y+ I V+D D+ NIVLSYLVHNC+K+T ESF   TG+KQ    L DM KRKRI
Sbjct  1     MDVDPRHYDNIAVNDGDIQNIVLSYLVHNCYKETAESFTTCTGLKQHTDYLVDMAKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             ++F +EGN LKAIE TE++AP LLEKN+DLHFDLLSLHFVELVC+RKCTEALEFAQ KLA
Sbjct  61    YDFAVEGNALKAIELTEEVAPGLLEKNEDLHFDLLSLHFVELVCSRKCTEALEFAQVKLA  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK+  YVEKLEDFMALLAYEEPEKSPMFHLLS++YRQ+VA+SLNRAILAH NLPSY+A
Sbjct  121   PFGKLHKYVEKLEDFMALLAYEEPEKSPMFHLLSVDYRQRVAESLNRAILAHGNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLI+Q+TVVRQSLSQE GK+G   FSL+DFLKS
Sbjct  181   MERLIKQVTVVRQSLSQELGKDGFQSFSLRDFLKS  215



>ref|XP_009335737.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Pyrus x bretschneideri]
Length=216

 Score =   342 bits (877),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 187/216 (87%), Gaps = 1/216 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR +  + ++D+D+HNIVLSYLVHNC+K+TVESF+ASTG KQP  C+EDMEKR RI
Sbjct  1     MDVDPRHFNQVAINDNDIHNIVLSYLVHNCYKETVESFVASTGTKQPADCVEDMEKRNRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKC-TEALEFAQTKL  705
             F   +EG  LKAIE TE+LAPDL+EKNKDLHFDLLSLHFVELVC +KC TEALEFAQ KL
Sbjct  61    FQCAVEGEALKAIELTEELAPDLVEKNKDLHFDLLSLHFVELVCAKKCSTEALEFAQNKL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
              PFGKV+ YV KLEDFMALLAY+EPEKSPMFHLLS EYRQ+VADSLNRA+L H+NLP+YS
Sbjct  121   TPFGKVEKYVTKLEDFMALLAYKEPEKSPMFHLLSFEYRQQVADSLNRAVLEHSNLPNYS  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             A+ERLIQQ TVVRQ +S++  K GN PFSL DFL+S
Sbjct  181   AMERLIQQTTVVRQCMSEDNAKNGNPPFSLNDFLRS  216



>ref|XP_008388007.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Malus domestica]
Length=215

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 187/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR +  + ++D+D+HNIVLSYLVHNC+K+TVESF+ASTG KQP  C+EDMEKR RI
Sbjct  1     MDVDPRHFNQVAINDNDIHNIVLSYLVHNCYKETVESFVASTGTKQPADCVEDMEKRNRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F   +EG+ LKAIE T++LAPDLLEKNKDLHFDLLSLHFVELVC +KCTEALEFAQ KL 
Sbjct  61    FQCRVEGDALKAIELTKELAPDLLEKNKDLHFDLLSLHFVELVCAKKCTEALEFAQNKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKV+  V KLEDFMALLAYEEPEKSPMFHLLS +YRQ+VADSLNRA+L H+NLP+YSA
Sbjct  121   PFGKVEKDVTKLEDFMALLAYEEPEKSPMFHLLSFDYRQQVADSLNRAVLEHSNLPNYSA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ +S++  K GN PFSL DFL+S
Sbjct  181   LERLIQQTTVVRQCMSEDNAKNGNPPFSLYDFLRS  215



>ref|XP_006435080.1| hypothetical protein CICLE_v10002444mg [Citrus clementina]
 ref|XP_006473579.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Citrus sinensis]
 gb|ESR48320.1| hypothetical protein CICLE_v10002444mg [Citrus clementina]
Length=207

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -3

Query  1031  IDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVL  852
             + ++D+D+HNIVLSYLVHNC+K+TV+SFI+ TGMKQP  CLEDME RKRI +F LEGN L
Sbjct  3     LAINDNDIHNIVLSYLVHNCYKETVDSFISCTGMKQPANCLEDMEMRKRILHFALEGNAL  62

Query  851   KAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE  672
             KAIE TE+LA DLLEKNKDLHFDLLSLHFVELVC+RKCTEALEFAQTKL PFGKVQ YVE
Sbjct  63    KAIELTEELAQDLLEKNKDLHFDLLSLHFVELVCSRKCTEALEFAQTKLTPFGKVQKYVE  122

Query  671   KLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITV  492
             KLEDFMALLAYEEPEKSPMFHLLSLEYRQ VAD+LNRAILAHA  P Y+A+ERLIQQ T 
Sbjct  123   KLEDFMALLAYEEPEKSPMFHLLSLEYRQHVADNLNRAILAHAERPRYAAMERLIQQTTA  182

Query  491   VRQSLSQEPGKEGNLPFSLKDFLKS  417
             VRQ LSQE GK+ + PFSLKDF+KS
Sbjct  183   VRQCLSQELGKDVHPPFSLKDFMKS  207



>ref|XP_007017658.1| LisH and RanBPM domains containing protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY14883.1| LisH and RanBPM domains containing protein isoform 2, partial 
[Theobroma cacao]
Length=236

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 191/236 (81%), Gaps = 22/236 (9%)
 Frame = -3

Query  1058  DVDPRQYETI----------------------DVSDSDVHNIVLSYLVHNCFKDTVESFI  945
             D+DPRQ+E +                       V+D+D+HNIV+SYLVHNCFK+TVESFI
Sbjct  1     DIDPRQFEHVLCPSSGLICLHFGASISICLLQAVNDNDIHNIVMSYLVHNCFKETVESFI  60

Query  944   ASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHF  765
             A TGMKQP   LEDMEKRK+IF F LEGN L AIE TEQLA +LLEKNKDLHFDLLSLHF
Sbjct  61    ACTGMKQPSDYLEDMEKRKKIFQFALEGNALMAIELTEQLATNLLEKNKDLHFDLLSLHF  120

Query  764   VELVCTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQ  585
             VELVC+RKCTEALEFAQTKLAPF K Q YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQ
Sbjct  121   VELVCSRKCTEALEFAQTKLAPFDKEQKYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQ  180

Query  584   KVADSLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
              VA+SLNRAILAHAN PSY+A+ERLIQQ TVVRQ L+QE  K+G  PFSLKDFLKS
Sbjct  181   HVAESLNRAILAHANHPSYTAMERLIQQTTVVRQCLNQEHVKDGPPPFSLKDFLKS  236



>ref|XP_009335720.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=217

 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 187/217 (86%), Gaps = 2/217 (1%)
 Frame = -3

Query  1061  MDVDPRQYETID-VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MDVDPR +  +  ++D+D+HNIVLSYLVHNC+K+TVESF+ASTG KQP  C+EDMEKR R
Sbjct  1     MDVDPRHFNQVQAINDNDIHNIVLSYLVHNCYKETVESFVASTGTKQPADCVEDMEKRNR  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKC-TEALEFAQTK  708
             IF   +EG  LKAIE TE+LAPDL+EKNKDLHFDLLSLHFVELVC +KC TEALEFAQ K
Sbjct  61    IFQCAVEGEALKAIELTEELAPDLVEKNKDLHFDLLSLHFVELVCAKKCSTEALEFAQNK  120

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             L PFGKV+ YV KLEDFMALLAY+EPEKSPMFHLLS EYRQ+VADSLNRA+L H+NLP+Y
Sbjct  121   LTPFGKVEKYVTKLEDFMALLAYKEPEKSPMFHLLSFEYRQQVADSLNRAVLEHSNLPNY  180

Query  527   SAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             SA+ERLIQQ TVVRQ +S++  K GN PFSL DFL+S
Sbjct  181   SAMERLIQQTTVVRQCMSEDNAKNGNPPFSLNDFLRS  217



>ref|XP_004291400.1| PREDICTED: glucose-induced degradation protein 8 homolog [Fragaria 
vesca subsp. vesca]
Length=215

 Score =   337 bits (865),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDP  Y+ + ++++D H++VLSYLVHNC+ +TVE+F+ASTGMKQP  C +DMEKRK I
Sbjct  1     MDVDPSNYDQLAINENDTHDVVLSYLVHNCYIETVEAFVASTGMKQPADCNDDMEKRKSI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             ++  +EGNVLKAIE TEQLA DLLEKNKDLHFDLLSL FVELVC+RKCTEALEFAQT L 
Sbjct  61    YHCAVEGNVLKAIELTEQLANDLLEKNKDLHFDLLSLRFVELVCSRKCTEALEFAQTNLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKV+ +V KLEDFMALLAYEEPEKSPMFHLLS +YRQ+VADSLNRAILAH+NLPSY+A
Sbjct  121   PFGKVEKFVAKLEDFMALLAYEEPEKSPMFHLLSKDYRQQVADSLNRAILAHSNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ T VRQS+S++  K G+ PFSLKDFL S
Sbjct  181   MERLIQQTTAVRQSISEDNAKNGSQPFSLKDFLSS  215



>ref|XP_004147845.1| PREDICTED: glucose-induced degradation protein 8 homolog [Cucumis 
sativus]
 ref|XP_004167755.1| PREDICTED: glucose-induced degradation protein 8 homolog [Cucumis 
sativus]
 gb|KGN60001.1| hypothetical protein Csa_3G865360 [Cucumis sativus]
Length=215

 Score =   337 bits (863),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR Y+ I V+D D+ NIVLSYLVHNC+K+T ESF   TG+K     L DM KRKRI
Sbjct  1     MDVDPRHYDNIAVNDGDIQNIVLSYLVHNCYKETAESFTTCTGLKHHTDYLVDMAKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             ++F +EGN LKAIE TE++AP LLEK +DLHFDLLSLHFVELVC+RKCTEALEFAQ KLA
Sbjct  61    YDFAVEGNALKAIELTEEVAPGLLEKIEDLHFDLLSLHFVELVCSRKCTEALEFAQVKLA  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK+  YVEKLEDFMALLAYEEPEKSPMFHLLS++YRQ+VA+SLNRAILAH NLPSY+A
Sbjct  121   PFGKLHKYVEKLEDFMALLAYEEPEKSPMFHLLSVDYRQRVAESLNRAILAHGNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLI+Q+TVVRQSLSQE GK+G   FSL+DFLKS
Sbjct  181   MERLIKQVTVVRQSLSQELGKDGFQSFSLRDFLKS  215



>ref|XP_008388006.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Malus domestica]
Length=216

 Score =   337 bits (863),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 187/216 (87%), Gaps = 1/216 (0%)
 Frame = -3

Query  1061  MDVDPRQYETID-VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MDVDPR +  +  ++D+D+HNIVLSYLVHNC+K+TVESF+ASTG KQP  C+EDMEKR R
Sbjct  1     MDVDPRHFNQVQAINDNDIHNIVLSYLVHNCYKETVESFVASTGTKQPADCVEDMEKRNR  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF   +EG+ LKAIE T++LAPDLLEKNKDLHFDLLSLHFVELVC +KCTEALEFAQ KL
Sbjct  61    IFQCRVEGDALKAIELTKELAPDLLEKNKDLHFDLLSLHFVELVCAKKCTEALEFAQNKL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
              PFGKV+  V KLEDFMALLAYEEPEKSPMFHLLS +YRQ+VADSLNRA+L H+NLP+YS
Sbjct  121   TPFGKVEKDVTKLEDFMALLAYEEPEKSPMFHLLSFDYRQQVADSLNRAVLEHSNLPNYS  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             A+ERLIQQ TVVRQ +S++  K GN PFSL DFL+S
Sbjct  181   ALERLIQQTTVVRQCMSEDNAKNGNPPFSLYDFLRS  216



>ref|XP_008796610.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Phoenix dactylifera]
Length=305

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = -3

Query  1139  PRPDRIFGGGEEFSGQTNKQTLCRL-MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKD  963
             P P R  GG  + S       +    MMD+DPR YE + ++D D+ NIV SYLVHNCF +
Sbjct  64    PSPGRARGGFRKPSLPPAAFFIAEAAMMDLDPRHYEHVTINDGDIRNIVQSYLVHNCFNE  123

Query  962   TVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFD  783
             T ESF+A TGMKQP   L DM+KRK IF F LEGN LKAIE TEQLAP+LLE NKDLHFD
Sbjct  124   TAESFLACTGMKQPVDYLADMDKRKSIFRFALEGNALKAIELTEQLAPNLLEDNKDLHFD  183

Query  782   LLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLL  603
             LLSLHFV L+C+RKCTEALEFAQTKL PFGKV  YVEKLEDFMALLAYEEPEKSPMFHLL
Sbjct  184   LLSLHFVNLICSRKCTEALEFAQTKLTPFGKVHKYVEKLEDFMALLAYEEPEKSPMFHLL  243

Query  602   SLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             S ++RQ VAD LNRAILAHANLP YS++ERLIQQ TVVRQ L QE GK+G  PFSLK FL
Sbjct  244   SPDHRQNVADCLNRAILAHANLPCYSSMERLIQQATVVRQCLHQELGKDGPPPFSLKGFL  303

Query  422   KS  417
             K+
Sbjct  304   KN  305



>ref|XP_010271531.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Nelumbo nucifera]
Length=229

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MMD+DPRQYE + ++D+DV NIVLSYLVHNCFK+T ESFIA TGMKQPD    D++KRK 
Sbjct  1     MMDLDPRQYEHVAINDNDVRNIVLSYLVHNCFKETAESFIACTGMKQPDDYPVDIDKRKP  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+F LEGN LKAIE TEQLA DLLE+NKDLHFDLLSLHFVELVC+RKCTEALEFAQTKL
Sbjct  61    IFHFALEGNALKAIELTEQLAHDLLEQNKDLHFDLLSLHFVELVCSRKCTEALEFAQTKL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
              PFGKV  YVEKLEDFMALLAYEEPEKSPMFHLLS+EYRQ+VADSLNRAILA+AN PSYS
Sbjct  121   TPFGKVHKYVEKLEDFMALLAYEEPEKSPMFHLLSMEYRQQVADSLNRAILAYANQPSYS  180

Query  524   AVERLIQQITVVRQSLSQEPGK  459
             A+ERL+QQ  VVRQSL QE GK
Sbjct  181   AMERLVQQTAVVRQSLHQEFGK  202



>ref|XP_011028933.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Populus euphratica]
Length=215

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 181/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR YE I + DSD+HNIVLSYLVHNC+ +T+ESF+A +GM +P   +EDMEKRK I
Sbjct  1     MDVDPRHYEQIAIKDSDIHNIVLSYLVHNCYGETLESFVACSGMPEPADYIEDMEKRKGI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
                TLEGN LKA+E TEQ+A DLLE NKDLHFDLLSLHF +LVC +KCTEALEFAQ KL 
Sbjct  61    VRCTLEGNALKAVELTEQVACDLLENNKDLHFDLLSLHFADLVCAKKCTEALEFAQQKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK + YVEKLEDFMALLAYEEPEKSPMFHLL LEYRQ VAD LNRAILAH NLPSY+A
Sbjct  121   PFGKEKKYVEKLEDFMALLAYEEPEKSPMFHLLGLEYRQHVADKLNRAILAHTNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQSL+Q+ GK+G   FSLKDFLK 
Sbjct  181   IERLIQQTTVVRQSLNQDHGKDGIPLFSLKDFLKG  215



>ref|XP_010061257.1| PREDICTED: glucose-induced degradation protein 8 homolog [Eucalyptus 
grandis]
 ref|XP_010061258.1| PREDICTED: glucose-induced degradation protein 8 homolog [Eucalyptus 
grandis]
 gb|KCW68182.1| hypothetical protein EUGRSUZ_F01851 [Eucalyptus grandis]
Length=213

 Score =   331 bits (849),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 187/215 (87%), Gaps = 2/215 (1%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPRQYE + +++ D+H++VLSYLVHNCFK+TVES    TGMKQP  C EDMEKRKRI
Sbjct  1     MDVDPRQYEQVTINEDDIHSVVLSYLVHNCFKETVESLTTCTGMKQPASCCEDMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+F  EGN LKAI+ TE+LAPDLL++N DLHF+LL+LHFVELVC++ CTEALEFAQ+KLA
Sbjct  61    FHFAAEGNALKAIDLTEELAPDLLKENTDLHFNLLTLHFVELVCSKSCTEALEFAQSKLA  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK   YV+KLEDFMALLAYEEPEKSPMFHL+S +YRQ VADSLNRAILA+AN PS+S 
Sbjct  121   PFGK--EYVKKLEDFMALLAYEEPEKSPMFHLVSPDYRQSVADSLNRAILANANQPSHST  178

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLI+QI VVRQ LSQE GK+  LPFSL+DFLKS
Sbjct  179   LERLIKQIVVVRQLLSQEHGKDTFLPFSLRDFLKS  213



>ref|XP_006341990.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Solanum tuberosum]
Length=216

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPRQYE I V+D+DVH+IV+SYL H+CF DT+ESF  STG+KQ    LEDMEKRKRI
Sbjct  1     MDIDPRQYEDIAVNDNDVHSIVMSYLAHSCFTDTLESFTTSTGVKQTAN-LEDMEKRKRI  59

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             ++  LEG+VLKAIE TEQ APDLLEKNKDLHFDLLSLHFV LVC+RKCTEALEFAQ KLA
Sbjct  60    YHLALEGSVLKAIELTEQFAPDLLEKNKDLHFDLLSLHFVGLVCSRKCTEALEFAQAKLA  119

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ YVEKLEDFMALLAY EPEKSPMFHLLSLEYRQ+VADSLNRA+LA++NLPSYSA
Sbjct  120   PFGKVQKYVEKLEDFMALLAYNEPEKSPMFHLLSLEYRQQVADSLNRAMLANSNLPSYSA  179

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPF  441
             VERL+QQ TVVRQ LSQE  +  ++ F
Sbjct  180   VERLMQQTTVVRQCLSQESRRVSSICF  206



>ref|XP_008377185.1| PREDICTED: glucose-induced degradation protein 8 homolog [Malus 
domestica]
Length=215

 Score =   329 bits (844),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR +  + ++D+D+++IVLSYLVHNC+K+TVESF+ASTG KQP  C+EDMEKRKRI
Sbjct  1     MDVDPRHFNQVAINDNDINSIVLSYLVHNCYKETVESFVASTGTKQPADCVEDMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F   +EGN L AIE TE+LAP+LLEKNKDLHF LLSLHFVELVC +KCTEALEFAQ KLA
Sbjct  61    FQCAVEGNALXAIELTEELAPELLEKNKDLHFGLLSLHFVELVCAKKCTEALEFAQNKLA  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKV  YV KLED MALLAY+EPEKSP+FHLLSL++RQ+VADSLN+AIL H+NLP YSA
Sbjct  121   PFGKVDKYVTKLEDLMALLAYDEPEKSPVFHLLSLDHRQEVADSLNQAILGHSNLPDYSA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQ + ++  K GN PFSL+DF++S
Sbjct  181   LERLIQQTTVVRQCMIEDNVKNGNPPFSLEDFIRS  215



>ref|XP_002302009.1| RanBPM-related family protein [Populus trichocarpa]
 gb|EEE81282.1| RanBPM-related family protein [Populus trichocarpa]
Length=215

 Score =   329 bits (844),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR YE I + DSD+HNIVLSYLVHNC+ +T+ESF+A +GM +P   +EDMEKRK I
Sbjct  1     MDVDPRHYEQIAIKDSDIHNIVLSYLVHNCYGETLESFVACSGMPEPADFIEDMEKRKGI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
                 LEGN LKA+E TEQ+A DLLE NKDLHFDLLSLHF +LVC +KCTEALEFAQ KL 
Sbjct  61    VRCALEGNALKAVELTEQVAGDLLENNKDLHFDLLSLHFADLVCAKKCTEALEFAQKKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK + YVEKLEDFMALLAYEEPEKSP+FHLL LEYRQ VAD LNRAILAH NLPSY+A
Sbjct  121   PFGKEKKYVEKLEDFMALLAYEEPEKSPVFHLLGLEYRQHVADKLNRAILAHTNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVVRQSL+Q+ GK+G   FSLKDFLK 
Sbjct  181   IERLIQQTTVVRQSLNQDHGKDGIPLFSLKDFLKG  215



>ref|XP_010923261.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Elaeis guineensis]
Length=216

 Score =   329 bits (843),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MMD+DPR YE + ++D D  NIVLSYLVHNCF +T E+ +A TGMKQP   L DM+KRK 
Sbjct  1     MMDLDPRHYEHVAINDGDDRNIVLSYLVHNCFNETAETLLACTGMKQPVDYLVDMDKRKS  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+F LEGN LKAIE TEQLAP+LLE NKDLHFDLLSLHFV+L+C+RKCTEALEFAQTKL
Sbjct  61    IFHFALEGNALKAIELTEQLAPNLLEDNKDLHFDLLSLHFVDLICSRKCTEALEFAQTKL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             APFGKV  YVEKLEDFMALLAYEEPEKSP+F LLS ++RQ VAD LN+AILAHANLP YS
Sbjct  121   APFGKVHKYVEKLEDFMALLAYEEPEKSPLFRLLSPDHRQDVADCLNQAILAHANLPRYS  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             ++ERLIQQ TVVRQ L QE GK+G  PFSLK FLK+
Sbjct  181   SMERLIQQATVVRQCLHQELGKDGPPPFSLKGFLKN  216



>ref|XP_010320406.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Solanum lycopersicum]
Length=216

 Score =   328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 180/207 (87%), Gaps = 1/207 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPRQYE I V+D+DVH+IV+SYL H+CF DT+ESF  S GM Q    LEDMEKRKRI
Sbjct  1     MDIDPRQYEDIAVNDNDVHSIVMSYLAHSCFTDTLESFTTSMGMNQTAN-LEDMEKRKRI  59

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             ++  LEG+VLKAIE T+Q APDLLEKNKDLHFDLLSLHFV LVC+RKCTEALEFAQ KLA
Sbjct  60    YHLALEGSVLKAIEITDQFAPDLLEKNKDLHFDLLSLHFVGLVCSRKCTEALEFAQAKLA  119

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKVQ YVEKLEDFMALLAY EPEKSPMFHLLSLEYRQ+VADSLNRAILA++NLPSYSA
Sbjct  120   PFGKVQKYVEKLEDFMALLAYNEPEKSPMFHLLSLEYRQQVADSLNRAILANSNLPSYSA  179

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPF  441
             VERL+QQ TVVRQ LSQE  +  ++ F
Sbjct  180   VERLMQQTTVVRQCLSQESRRVSSICF  206



>ref|XP_004499207.1| PREDICTED: glucose-induced degradation protein 8 homolog [Cicer 
arietinum]
Length=216

 Score =   327 bits (838),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPRQYE   +++ DV NIV+SYL+HNC++++ ESFIASTG K+P   L++MEKRK+I
Sbjct  1     MDVDPRQYENTAINEKDVPNIVMSYLIHNCYEESAESFIASTGSKRPTDYLDNMEKRKKI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F++ LEGN LKAIE TEQL PD+LEKNKDL FDLLSLHFVELV +RKCTEALEFAQTKL+
Sbjct  61    FHYALEGNALKAIELTEQLTPDILEKNKDLLFDLLSLHFVELVRSRKCTEALEFAQTKLS  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK   Y+EKLEDFMALLAY+EPEKSPMFHLLSLEYRQ+ ADSLNR ILA+ NLPSY+A
Sbjct  121   PFGKEAKYMEKLEDFMALLAYKEPEKSPMFHLLSLEYRQQFADSLNRTILAYFNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLK  420
             +ERLIQQ T+VRQ L++E GKE   PFSLK+FLK
Sbjct  181   MERLIQQATLVRQCLNEEAGKEAPQPFSLKEFLK  214



>ref|XP_010519102.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Tarenaya hassleriana]
Length=215

 Score =   326 bits (836),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 183/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD DPRQ + I V DSD+HNIVLSYLVHNCF +T +S ++STG+KQP+  LE M++RKRI
Sbjct  1     MDTDPRQLDHIVVHDSDIHNIVLSYLVHNCFNETADSLVSSTGLKQPENYLEGMDRRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
               FTLEG  LKA+E TE LA  +LEKNK+LHFDLLSLHFVEL+C R CTEAL+FA+T+LA
Sbjct  61    IKFTLEGKALKAVELTEHLAEGMLEKNKELHFDLLSLHFVELLCARNCTEALQFARTRLA  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK Q YVEKLED MALLAYE+PEKSPMFHLLS E+RQ+VAD+LNRAIL HANLPSY+ 
Sbjct  121   PFGKDQKYVEKLEDVMALLAYEDPEKSPMFHLLSFEHRQRVADNLNRAILEHANLPSYTP  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ER+IQQ+TVVRQ L QE GK+G  PFSLKDFL+S
Sbjct  181   MERVIQQVTVVRQYLKQESGKDGFPPFSLKDFLQS  215



>ref|XP_011048846.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Populus euphratica]
Length=215

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR YE I + D+D+HNIVLSYLVHNC+++T+ESF+  TGM++P   +EDMEKRK I
Sbjct  1     MDVDPRHYEQIGIKDNDIHNIVLSYLVHNCYRETLESFVDCTGMREPADYIEDMEKRKGI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F   LEGN LKAIE TEQ+A DLLE NKDLHFDLLSLHFVELVC +KCTEALEFAQ KL 
Sbjct  61    FCCVLEGNALKAIELTEQVASDLLENNKDLHFDLLSLHFVELVCAKKCTEALEFAQNKLM  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK Q  +EKLEDF++LLAYEEPEKSPMFHLL  EY+Q VAD LNRAILAH NLPSY+A
Sbjct  121   PFGKEQKLLEKLEDFLSLLAYEEPEKSPMFHLLGSEYQQHVADKLNRAILAHRNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             VERLIQQ  VVRQSL+Q+ GK+   PFSLKDFLK 
Sbjct  181   VERLIQQTIVVRQSLNQDHGKDEIPPFSLKDFLKG  215



>ref|XP_008804546.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X6 [Phoenix dactylifera]
Length=216

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 182/216 (84%), Gaps = 0/216 (0%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MMD+DPR YE + V+DSDV NIVLSYLVHNCF +T ESF+A TGMKQP   L DM+KRK 
Sbjct  1     MMDLDPRHYEHVIVNDSDVRNIVLSYLVHNCFNETAESFLACTGMKQPVDYLVDMDKRKS  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+F L+GN LKAIE TEQLAP+LLE +KDLHFDLLSLHF++LVC+RKCTEALEFAQT+L
Sbjct  61    IFHFALDGNALKAIELTEQLAPNLLEDDKDLHFDLLSLHFIDLVCSRKCTEALEFAQTEL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
              P GK+  YVEKLED MALLAYEEPEKSPMFHLLS +YRQ +AD LNRAILA+ NLPSYS
Sbjct  121   TPLGKLHKYVEKLEDLMALLAYEEPEKSPMFHLLSSDYRQNIADCLNRAILAYPNLPSYS  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             ++ERLIQQ TVVRQ L QE  K+G   FSLK FLK+
Sbjct  181   SMERLIQQATVVRQFLHQELSKDGPPTFSLKAFLKN  216



>ref|XP_010519101.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Tarenaya hassleriana]
Length=216

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 183/216 (85%), Gaps = 1/216 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDV-SDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MD DPRQ + I V  DSD+HNIVLSYLVHNCF +T +S ++STG+KQP+  LE M++RKR
Sbjct  1     MDTDPRQLDHIQVVHDSDIHNIVLSYLVHNCFNETADSLVSSTGLKQPENYLEGMDRRKR  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             I  FTLEG  LKA+E TE LA  +LEKNK+LHFDLLSLHFVEL+C R CTEAL+FA+T+L
Sbjct  61    IIKFTLEGKALKAVELTEHLAEGMLEKNKELHFDLLSLHFVELLCARNCTEALQFARTRL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             APFGK Q YVEKLED MALLAYE+PEKSPMFHLLS E+RQ+VAD+LNRAIL HANLPSY+
Sbjct  121   APFGKDQKYVEKLEDVMALLAYEDPEKSPMFHLLSFEHRQRVADNLNRAILEHANLPSYT  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
              +ER+IQQ+TVVRQ L QE GK+G  PFSLKDFL+S
Sbjct  181   PMERVIQQVTVVRQYLKQESGKDGFPPFSLKDFLQS  216



>ref|XP_002306895.1| RanBPM-related family protein [Populus trichocarpa]
 gb|EEE93891.1| RanBPM-related family protein [Populus trichocarpa]
Length=215

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 178/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR YE I + D+D+HNIVLSYLVHNC+++T+ESF+  TGM +P   +EDMEKRK I
Sbjct  1     MDVDPRHYEQIGIKDNDIHNIVLSYLVHNCYRETLESFVDCTGMPEPADYIEDMEKRKGI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F   LEGN LKAIE TEQ+A DLLE N DLHFDLLSLHFVELVC +KCTEALEFAQ KL 
Sbjct  61    FCCVLEGNALKAIELTEQVACDLLENNNDLHFDLLSLHFVELVCAKKCTEALEFAQNKLM  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK Q  +EKLEDF++LLAYEEPEKSPMFHLL  EYRQ VAD LNRAILAH NLPSY+A
Sbjct  121   PFGKEQKLLEKLEDFLSLLAYEEPEKSPMFHLLGSEYRQHVADKLNRAILAHRNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             VERLIQQ  VVRQSL+Q+ GK+   PFSLKDFLK 
Sbjct  181   VERLIQQTIVVRQSLNQDHGKDEIPPFSLKDFLKG  215



>ref|XP_011048842.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Populus euphratica]
Length=215

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 179/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR YE I + D+D+HNIVLSYLVHNC+++T+ESF+  TGM++P   +EDMEKRK I
Sbjct  1     MDVDPRHYEQIGIKDNDIHNIVLSYLVHNCYRETLESFVDCTGMREPADYIEDMEKRKGI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F   LEGN LKAIE TEQ+A DLLE NKDLHFDLLSLHFVELVC +KCTEALEFAQ KL 
Sbjct  61    FCCVLEGNALKAIELTEQVASDLLENNKDLHFDLLSLHFVELVCAKKCTEALEFAQNKLM  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK Q  +EKLEDF++LLAYEEPEKSPMFHLL  EY+Q VAD LNRAILAH NLPSY+A
Sbjct  121   PFGKEQKLLEKLEDFLSLLAYEEPEKSPMFHLLGSEYQQHVADKLNRAILAHRNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             VERLIQQ  VVRQSL+Q+ GK+    FSLKDFLK 
Sbjct  181   VERLIQQTIVVRQSLNQDHGKDEIPSFSLKDFLKG  215



>ref|XP_004970154.1| PREDICTED: ran-binding protein 9-like [Setaria italica]
Length=216

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 183/215 (85%), Gaps = 2/215 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRK  888
             MMD+DPR YE + VSD+DV NIVLSYL+HNCFK+T E+F++STG+K P DY + +++KRK
Sbjct  1     MMDLDPRLYENVSVSDNDVRNIVLSYLMHNCFKETAETFLSSTGLKLPIDYSV-NVDKRK  59

Query  887   RIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTK  708
              IFNF LEGN LKAIE TE+LAP+LLE + DLHFDLLSLHF+ELV +RKCTEALEF Q K
Sbjct  60    AIFNFVLEGNALKAIELTEELAPNLLENDMDLHFDLLSLHFIELVRSRKCTEALEFGQKK  119

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             L  FGKV  YVEKLEDFMALLAYEEPEKSPMFHLLS EYRQ VADSLNRA+LAHANLP+Y
Sbjct  120   LTSFGKVPKYVEKLEDFMALLAYEEPEKSPMFHLLSPEYRQNVADSLNRAVLAHANLPAY  179

Query  527   SAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             S++ER++QQ TVVRQ L QE GK+   PFSLK FL
Sbjct  180   SSLERVVQQATVVRQYLQQEVGKDSYPPFSLKAFL  214



>ref|XP_008804545.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X5 [Phoenix dactylifera]
Length=218

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 182/218 (83%), Gaps = 2/218 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MMD+DPR YE + V+DSDV NIVLSYLVHNCF +T ESF+A TGMKQP   L DM+KRK 
Sbjct  1     MMDLDPRHYEHVIVNDSDVRNIVLSYLVHNCFNETAESFLACTGMKQPVDYLVDMDKRKS  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+F L+GN LKAIE TEQLAP+LLE +KDLHFDLLSLHF++LVC+RKCTEALEFAQT+L
Sbjct  61    IFHFALDGNALKAIELTEQLAPNLLEDDKDLHFDLLSLHFIDLVCSRKCTEALEFAQTEL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL--AHANLPS  531
              P GK+  YVEKLED MALLAYEEPEKSPMFHLLS +YRQ +AD LNRAIL  A+ NLPS
Sbjct  121   TPLGKLHKYVEKLEDLMALLAYEEPEKSPMFHLLSSDYRQNIADCLNRAILVSAYPNLPS  180

Query  530   YSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             YS++ERLIQQ TVVRQ L QE  K+G   FSLK FLK+
Sbjct  181   YSSMERLIQQATVVRQFLHQELSKDGPPTFSLKAFLKN  218



>gb|EYU32884.1| hypothetical protein MIMGU_mgv1a013617mg [Erythranthe guttata]
Length=215

 Score =   319 bits (817),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 178/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD DP+QYE I V++SD+H IV+SYLVHNCFKDT+ESF+A T +KQP   LE M+KRKRI
Sbjct  1     MDADPKQYENIAVNESDIHKIVVSYLVHNCFKDTLESFVACTRVKQPIDHLEGMDKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             FNF L+GN  KAIE TE+  P LLE+NKDLHFDLLSL+FVELVC+RK  EAL FAQ K  
Sbjct  61    FNFALDGNASKAIELTEEFVPGLLEENKDLHFDLLSLNFVELVCSRKIDEALGFAQLKFT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK Q YVEKLEDFMALLAYEEPEKSPMFHLLS E+RQ VADSLNRAILA   LPS+S 
Sbjct  121   PFGKEQKYVEKLEDFMALLAYEEPEKSPMFHLLSEEHRQHVADSLNRAILAQTKLPSFSV  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             +ERLIQQ TVV+Q LSQE  K+G+ PFSL DFLKS
Sbjct  181   MERLIQQTTVVKQYLSQESSKDGHQPFSLADFLKS  215



>ref|NP_001044411.2| Os01g0775600 [Oryza sativa Japonica Group]
 dbj|BAD53233.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG87430.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00785.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06325.2| Os01g0775600 [Oryza sativa Japonica Group]
Length=216

 Score =   318 bits (816),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 183/215 (85%), Gaps = 2/215 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRK  888
             MMD+DPR YE + VSD+DV NIVLSYL+HNCFK+T E+F++STG++ P DY + D++KRK
Sbjct  1     MMDLDPRLYENVSVSDNDVRNIVLSYLMHNCFKETAETFLSSTGLELPVDYTV-DVDKRK  59

Query  887   RIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTK  708
              IF+F LEGN LKAI+ TE+LAP+LLE + DLHFDLLSLHF+ELV +RKCTEALEF Q K
Sbjct  60    AIFSFVLEGNALKAIDLTEELAPNLLENDMDLHFDLLSLHFIELVRSRKCTEALEFGQKK  119

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             L PFGKV  YVEKLEDFMALLAYEEPEKSPMFHLLS EYRQ VADSLNRA+LAHAN P+Y
Sbjct  120   LTPFGKVPKYVEKLEDFMALLAYEEPEKSPMFHLLSPEYRQNVADSLNRAVLAHANRPAY  179

Query  527   SAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             S++ER+IQQ TVVRQ L QE GK+   PFSLK FL
Sbjct  180   SSLERVIQQATVVRQYLQQEVGKDSYPPFSLKAFL  214



>ref|XP_011028932.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Populus euphratica]
Length=219

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR YE I + DSD+HNIVLSYLVHNC+ +T+ESF+A +GM +P   +EDMEKRK I
Sbjct  1     MDVDPRHYEQIAIKDSDIHNIVLSYLVHNCYGETLESFVACSGMPEPADYIEDMEKRKGI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
                TLEGN LKA+E TEQ+A DLLE NKDLHFDLLSLHF +LVC +KCTEALEFAQ KL 
Sbjct  61    VRCTLEGNALKAVELTEQVACDLLENNKDLHFDLLSLHFADLVCAKKCTEALEFAQQKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK + YVEKLEDFMALLAYEEPEKSPMFHLL LEYRQ VAD LNRAILAH NLPSY+A
Sbjct  121   PFGKEKKYVEKLEDFMALLAYEEPEKSPMFHLLGLEYRQHVADKLNRAILAHTNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNL  447
             +ERLIQQ TVVRQSL+Q+ G +  +
Sbjct  181   IERLIQQTTVVRQSLNQDHGWDSTI  205



>ref|XP_002458584.1| hypothetical protein SORBIDRAFT_03g036180 [Sorghum bicolor]
 gb|EES03704.1| hypothetical protein SORBIDRAFT_03g036180 [Sorghum bicolor]
Length=216

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 183/215 (85%), Gaps = 2/215 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRK  888
             MM++DPR YE + VSD+DV NIVLSYL+HNCFK+T E+F++STG+K P DY + D++KRK
Sbjct  1     MMELDPRLYENVSVSDNDVRNIVLSYLMHNCFKETAETFLSSTGLKLPVDYTV-DVDKRK  59

Query  887   RIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTK  708
              IFNF LEGN LKAIE T+++AP+LLE + DLHFDLLSLHF+ELV +RKCTEALEF Q K
Sbjct  60    AIFNFVLEGNALKAIELTKEMAPNLLENDMDLHFDLLSLHFIELVRSRKCTEALEFGQKK  119

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             L  FGKV  YVEKLEDFMALLAYEEPEKSPMFHLLS ++RQ VADSLNRA+LAHANLP+Y
Sbjct  120   LTSFGKVPKYVEKLEDFMALLAYEEPEKSPMFHLLSPDHRQNVADSLNRAVLAHANLPAY  179

Query  527   SAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             S++ER++QQ TVVRQ L QE GK+   PFSLK FL
Sbjct  180   SSLERVVQQATVVRQYLQQEVGKDSYPPFSLKAFL  214



>ref|XP_006644796.1| PREDICTED: glucose-induced degradation protein 8 homolog [Oryza 
brachyantha]
Length=216

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 182/215 (85%), Gaps = 2/215 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRK  888
             MMD+DPR YE + VSD+DV NIVLSYL+HNCFK+T E+F++STG++ P DY + D++KRK
Sbjct  1     MMDLDPRLYENVSVSDNDVRNIVLSYLMHNCFKETAETFLSSTGLELPVDYTV-DVDKRK  59

Query  887   RIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTK  708
              IF+F LEGN LKAI+ TE+LAP+LLE + DLHFDLLSLHF+ELV +RKCTEALEF Q +
Sbjct  60    AIFSFVLEGNALKAIDLTEELAPNLLENDMDLHFDLLSLHFIELVRSRKCTEALEFGQKR  119

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             L PFGKV  YVEKLEDFMALLAYEEPEKSPMFHLLS EYRQ VADSLNRA+LAHA  P+Y
Sbjct  120   LTPFGKVPKYVEKLEDFMALLAYEEPEKSPMFHLLSPEYRQNVADSLNRAVLAHAKRPAY  179

Query  527   SAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             S++ER+IQQ TVVRQ L QE GK+   PFSLK FL
Sbjct  180   SSLERVIQQATVVRQYLQQEVGKDSYPPFSLKAFL  214



>ref|XP_010923262.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Elaeis guineensis]
Length=205

 Score =   313 bits (802),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MMD+DPR YE + ++D D  NIVLSYLVHNCF +T E+ +A TGMKQP   L DM+KRK 
Sbjct  1     MMDLDPRHYEHVAINDGDDRNIVLSYLVHNCFNETAETLLACTGMKQPVDYLVDMDKRKS  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+F LEGN LKAIE TEQLAP+LLE NKDLHFDLLSLHFV+L+C+RKCTEALEFAQTKL
Sbjct  61    IFHFALEGNALKAIELTEQLAPNLLEDNKDLHFDLLSLHFVDLICSRKCTEALEFAQTKL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             APFGKV  YVEKLEDFMALLAYEEPEKSP+F LLS ++RQ VAD LN+AILAHANLP YS
Sbjct  121   APFGKVHKYVEKLEDFMALLAYEEPEKSPLFRLLSPDHRQDVADCLNQAILAHANLPRYS  180

Query  524   AVERLIQQITVVRQSLSQEPGK  459
             ++ERLIQQ TVVRQ L QE GK
Sbjct  181   SMERLIQQATVVRQCLHQELGK  202



>ref|XP_008804542.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Phoenix dactylifera]
Length=288

 Score =   314 bits (805),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MMD+DPR YE + V+DSDV NIVLSYLVHNCF +T ESF+A TGMKQP   L DM+KRK 
Sbjct  1     MMDLDPRHYEHVIVNDSDVRNIVLSYLVHNCFNETAESFLACTGMKQPVDYLVDMDKRKS  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+F L+GN LKAIE TEQLAP+LLE +KDLHFDLLSLHF++LVC+RKCTEALEFAQT+L
Sbjct  61    IFHFALDGNALKAIELTEQLAPNLLEDDKDLHFDLLSLHFIDLVCSRKCTEALEFAQTEL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
              P GK+  YVEKLED MALLAYEEPEKSPMFHLLS +YRQ +AD LNRAILA+ NLPSYS
Sbjct  121   TPLGKLHKYVEKLEDLMALLAYEEPEKSPMFHLLSSDYRQNIADCLNRAILAYPNLPSYS  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGN  450
             ++ERLIQQ TVVRQ L QE  K  N
Sbjct  181   SMERLIQQATVVRQFLHQELSKVHN  205



>ref|XP_011048843.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Populus euphratica]
 ref|XP_011048847.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Populus euphratica]
Length=205

 Score =   310 bits (795),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR YE I + D+D+HNIVLSYLVHNC+++T+ESF+  TGM++P   +EDMEKRK I
Sbjct  1     MDVDPRHYEQIGIKDNDIHNIVLSYLVHNCYRETLESFVDCTGMREPADYIEDMEKRKGI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F   LEGN LKAIE TEQ+A DLLE NKDLHFDLLSLHFVELVC +KCTEALEFAQ KL 
Sbjct  61    FCCVLEGNALKAIELTEQVASDLLENNKDLHFDLLSLHFVELVCAKKCTEALEFAQNKLM  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK Q  +EKLEDF++LLAYEEPEKSPMFHLL  EY+Q VAD LNRAILAH NLPSY+A
Sbjct  121   PFGKEQKLLEKLEDFLSLLAYEEPEKSPMFHLLGSEYQQHVADKLNRAILAHRNLPSYTA  180

Query  521   VERLIQQITVVRQSLSQEPGK  459
             VERLIQQ  VVRQSL+Q+ GK
Sbjct  181   VERLIQQTIVVRQSLNQDHGK  201



>emb|CDM84438.1| unnamed protein product [Triticum aestivum]
Length=216

 Score =   310 bits (794),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 180/215 (84%), Gaps = 2/215 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRK  888
             MMD+DPR YE   VSD+DV NIVLSYL+HNCFK+T E+F++STG+K P DY + D++KRK
Sbjct  1     MMDLDPRLYEDASVSDNDVRNIVLSYLMHNCFKETAETFLSSTGLKLPVDYTV-DVDKRK  59

Query  887   RIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTK  708
              I NF +EG+ +KAIE TE+LAP+LLE + DLHFDL+SLHF+EL+ +RKCTEALEF Q K
Sbjct  60    AILNFVVEGDAVKAIELTEELAPNLLENDMDLHFDLISLHFIELIRSRKCTEALEFGQKK  119

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             L PFGKV  YVEKLEDFMALLAYEEPEKSPMFHLL+ EYRQ VADSLNRAILAHANLP+Y
Sbjct  120   LTPFGKVSKYVEKLEDFMALLAYEEPEKSPMFHLLAPEYRQNVADSLNRAILAHANLPAY  179

Query  527   SAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             S++ER+IQQ TVVRQ L QE  K+   PF LK FL
Sbjct  180   SSLERVIQQSTVVRQYLQQEVDKDSYPPFCLKAFL  214



>ref|XP_003569937.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Brachypodium distachyon]
Length=216

 Score =   310 bits (793),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 181/215 (84%), Gaps = 2/215 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRK  888
             MM++DPR YE + VSD+DV ++VLSYL+HNCFK+T E+F++STG K P DY + D++KRK
Sbjct  1     MMELDPRLYENVSVSDTDVRDVVLSYLMHNCFKETAETFLSSTGQKLPVDYTV-DVDKRK  59

Query  887   RIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTK  708
              I NF LEG+ LKAIE TE+LAP+LLE + DLHFDLLSLHF+ELV +RKCTEALEF Q +
Sbjct  60    AILNFVLEGDSLKAIELTEELAPNLLENDMDLHFDLLSLHFIELVRSRKCTEALEFGQKR  119

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             L PFGKV  YV KLEDFMALLAYEEPEKSPMFHLLS EYRQ VADSLNRAILA+ANLP+Y
Sbjct  120   LTPFGKVPKYVVKLEDFMALLAYEEPEKSPMFHLLSPEYRQNVADSLNRAILANANLPAY  179

Query  527   SAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             S++ER+IQQ TVVRQ L QE GK+   PFSLK FL
Sbjct  180   SSLERVIQQSTVVRQYLQQEVGKDSYPPFSLKAFL  214



>ref|XP_006838697.1| hypothetical protein AMTR_s00002p00248930 [Amborella trichopoda]
 gb|ERN01266.1| hypothetical protein AMTR_s00002p00248930 [Amborella trichopoda]
Length=215

 Score =   308 bits (789),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRKR  885
             MD+DPRQYE +DV+D DV N+VLSYLVHNCFK T E+FIASTGMK P DY + D+++RK 
Sbjct  1     MDLDPRQYEHLDVNDIDVRNVVLSYLVHNCFKGTAETFIASTGMKHPADYPI-DIDRRKP  59

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+  +EG+ LKAIE TE LAP+LLE+ +DLHFDLLSLH+VELV +RKCTEAL+FAQ  L
Sbjct  60    IFHCAMEGDGLKAIELTELLAPNLLEETRDLHFDLLSLHYVELVRSRKCTEALQFAQANL  119

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
               FGK++ YVEKLED +ALLAY+EPEKSPMFH LS +YRQ+VA+SLNRA+LAHANLPSYS
Sbjct  120   TSFGKIEKYVEKLEDLLALLAYDEPEKSPMFHFLSKDYRQEVAESLNRALLAHANLPSYS  179

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             ++E+L++QITVVRQ L QE GKEG   FSLKDFLK+
Sbjct  180   SMEKLLKQITVVRQYLHQELGKEGPPTFSLKDFLKN  215



>ref|XP_011083893.1| PREDICTED: glucose-induced degradation protein 8 homolog [Sesamum 
indicum]
Length=256

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 179/256 (70%), Gaps = 41/256 (16%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSD-----------------------------------------SDVH  1005
             MD DPRQYE I +                                           +D+H
Sbjct  1     MDADPRQYENIVIDSCLLMCWFYHNISGRGECPMTSDGHSYQFASVFCYLYWRSFINDIH  60

Query  1004  NIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQL  825
              IV SYLVHNCFKDT+ESFIA TG+KQP   LEDMEKRKRIF+F L+GN  KAIE TE+ 
Sbjct  61    KIVRSYLVHNCFKDTLESFIACTGVKQPVDHLEDMEKRKRIFHFALDGNASKAIELTEEF  120

Query  824   APDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALL  645
             AP LLE+NKDLHFDLLSLHFVELVC+RK  EAL FAQ+K  PFGK Q YVEKLEDFMALL
Sbjct  121   APGLLEENKDLHFDLLSLHFVELVCSRKIDEALGFAQSKFTPFGKEQKYVEKLEDFMALL  180

Query  644   AYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEP  465
             AYEEPEKSPMFHLLS E+R  VADSLNRAILAH  LPSYS +ERLIQQ TVVRQ LSQE 
Sbjct  181   AYEEPEKSPMFHLLSSEHRHHVADSLNRAILAHTKLPSYSEMERLIQQTTVVRQCLSQEF  240

Query  464   GKEGNLPFSLKDFLKS  417
             GK+G   FSLKDFLKS
Sbjct  241   GKDGQQLFSLKDFLKS  256



>ref|XP_003589230.1| C20orf11-like protein [Medicago truncatula]
 gb|AES59481.1| LisH and RanBPM domain protein [Medicago truncatula]
Length=216

 Score =   307 bits (786),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPRQY+ I +S+ DV NIVLSYL+HNC++++ ESF+A TG K+P   L++MEKRK+I
Sbjct  1     MDVDPRQYDNIAISEKDVSNIVLSYLIHNCYEESAESFMAGTGAKRPTDYLDNMEKRKKI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+  LEGN LKAIE TEQL P++L KN DL FDLLSLHFVELV +RKCTEAL+FAQTKL+
Sbjct  61    FHSVLEGNALKAIELTEQLTPEILVKNTDLLFDLLSLHFVELVRSRKCTEALDFAQTKLS  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK   Y EKL+DFMALLAY+EPE SPMFHLLSLEYRQ++ADSLNR ILA+ NLP+Y+A
Sbjct  121   PFGKDGQYTEKLQDFMALLAYKEPEDSPMFHLLSLEYRQELADSLNRTILAYFNLPNYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLK  420
             +E+LIQQ TVVRQ L++E GK+    FSLK+FLK
Sbjct  181   MEKLIQQTTVVRQCLNEEAGKDAPQVFSLKEFLK  214



>ref|XP_008804544.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X4 [Phoenix dactylifera]
Length=226

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 172/204 (84%), Gaps = 2/204 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MMD+DPR YE + V+DSDV NIVLSYLVHNCF +T ESF+A TGMKQP   L DM+KRK 
Sbjct  1     MMDLDPRHYEHVIVNDSDVRNIVLSYLVHNCFNETAESFLACTGMKQPVDYLVDMDKRKS  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+F L+GN LKAIE TEQLAP+LLE +KDLHFDLLSLHF++LVC+RKCTEALEFAQT+L
Sbjct  61    IFHFALDGNALKAIELTEQLAPNLLEDDKDLHFDLLSLHFIDLVCSRKCTEALEFAQTEL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL--AHANLPS  531
              P GK+  YVEKLED MALLAYEEPEKSPMFHLLS +YRQ +AD LNRAIL  A+ NLPS
Sbjct  121   TPLGKLHKYVEKLEDLMALLAYEEPEKSPMFHLLSSDYRQNIADCLNRAILVSAYPNLPS  180

Query  530   YSAVERLIQQITVVRQSLSQEPGK  459
             YS++ERLIQQ TVVRQ L QE  K
Sbjct  181   YSSMERLIQQATVVRQFLHQELSK  204



>ref|XP_008804541.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Phoenix dactylifera]
Length=290

 Score =   309 bits (792),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 173/207 (84%), Gaps = 2/207 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR  885
             MMD+DPR YE + V+DSDV NIVLSYLVHNCF +T ESF+A TGMKQP   L DM+KRK 
Sbjct  1     MMDLDPRHYEHVIVNDSDVRNIVLSYLVHNCFNETAESFLACTGMKQPVDYLVDMDKRKS  60

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IF+F L+GN LKAIE TEQLAP+LLE +KDLHFDLLSLHF++LVC+RKCTEALEFAQT+L
Sbjct  61    IFHFALDGNALKAIELTEQLAPNLLEDDKDLHFDLLSLHFIDLVCSRKCTEALEFAQTEL  120

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL--AHANLPS  531
              P GK+  YVEKLED MALLAYEEPEKSPMFHLLS +YRQ +AD LNRAIL  A+ NLPS
Sbjct  121   TPLGKLHKYVEKLEDLMALLAYEEPEKSPMFHLLSSDYRQNIADCLNRAILVSAYPNLPS  180

Query  530   YSAVERLIQQITVVRQSLSQEPGKEGN  450
             YS++ERLIQQ TVVRQ L QE  K  N
Sbjct  181   YSSMERLIQQATVVRQFLHQELSKVHN  207



>ref|XP_009403387.1| PREDICTED: glucose-induced degradation protein 8 homolog [Musa 
acuminata subsp. malaccensis]
Length=215

 Score =   306 bits (784),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+DPR Y+ + +SDSD+ NIVLSYLVHNCFK+T E+F+  TGM QP   L DMEKRK I
Sbjct  1     MDLDPRLYDHVAISDSDIRNIVLSYLVHNCFKETAETFLTCTGMNQPVDYLLDMEKRKSI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
              +FT+EGN LKAIE TEQL P+LLE NKDL FDLLSLHF++LV +RKC EALEFAQTKL 
Sbjct  61    LHFTMEGNALKAIELTEQLVPNLLEDNKDLCFDLLSLHFIDLVRSRKCMEALEFAQTKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGKV  +V KLEDF+ LLAYEEPEKSPMFHLLS EYR+ +AD LNRAIL  ANLPSYS+
Sbjct  121   PFGKVPKFVGKLEDFITLLAYEEPEKSPMFHLLSPEYRENIADCLNRAILDRANLPSYSS  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             +ERLIQQ  VVR  L QE GK+G+ PFSLK FL
Sbjct  181   MERLIQQAAVVRHVLHQELGKDGHPPFSLKAFL  213



>gb|ACJ86236.1| unknown [Medicago truncatula]
Length=216

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPRQY+ I +S+ DV NIVLSYL+HNC++++ ESF+A TG K+P   L++MEKRK+I
Sbjct  1     MDVDPRQYDNIAISEKDVSNIVLSYLIHNCYEESAESFMAGTGAKRPTDYLDNMEKRKKI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+  LEGN LKAIE TEQL P++L KN DL FDLLSLHFVELV +RKCTEAL+FAQTKL+
Sbjct  61    FHSVLEGNALKAIELTEQLTPEILVKNTDLLFDLLSLHFVELVRSRKCTEALDFAQTKLS  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK   Y EKL+DFMALLAY+EPE SPMFHLLSLEYRQ++ADSLNR ILA+ NLP+Y+A
Sbjct  121   PFGKDGQYTEKLQDFMALLAYKEPEDSPMFHLLSLEYRQELADSLNRTILAYFNLPNYTA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLK  420
             + +LIQQ TVVRQ L++E GK+    FSLK+FLK
Sbjct  181   MGKLIQQTTVVRQCLNEEAGKDAPQVFSLKEFLK  214



>gb|EEC71570.1| hypothetical protein OsI_03937 [Oryza sativa Indica Group]
Length=833

 Score =   322 bits (824),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 183/215 (85%), Gaps = 2/215 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRK  888
             MMD+DPR YE + VSD+DV NIVLSYL+HNCFK+T E+F++STG++ P DY + D++KRK
Sbjct  1     MMDLDPRLYENVSVSDNDVRNIVLSYLMHNCFKETAETFLSSTGLELPVDYTV-DVDKRK  59

Query  887   RIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTK  708
              IF+F LEGN LKAI+ TE+LAP+LLE + DLHFDLLSLHF+ELV +RKCTEALEF Q K
Sbjct  60    AIFSFVLEGNALKAIDLTEELAPNLLENDMDLHFDLLSLHFIELVRSRKCTEALEFGQKK  119

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             L PFGKV  YVEKLEDFMALLAYEEPEKSPMFHLLS EYRQ VADSLNRA+LAHAN P+Y
Sbjct  120   LTPFGKVPKYVEKLEDFMALLAYEEPEKSPMFHLLSPEYRQNVADSLNRAVLAHANRPAY  179

Query  527   SAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             S++ER+IQQ TVVRQ L QE GK+   PFSLK FL
Sbjct  180   SSLERVIQQATVVRQYLQQEVGKDSYPPFSLKAFL  214



>gb|EEE55471.1| hypothetical protein OsJ_03649 [Oryza sativa Japonica Group]
Length=833

 Score =   322 bits (824),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 183/215 (85%), Gaps = 2/215 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRK  888
             MMD+DPR YE + VSD+DV NIVLSYL+HNCFK+T E+F++STG++ P DY + D++KRK
Sbjct  1     MMDLDPRLYENVSVSDNDVRNIVLSYLMHNCFKETAETFLSSTGLELPVDYTV-DVDKRK  59

Query  887   RIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTK  708
              IF+F LEGN LKAI+ TE+LAP+LLE + DLHFDLLSLHF+ELV +RKCTEALEF Q K
Sbjct  60    AIFSFVLEGNALKAIDLTEELAPNLLENDMDLHFDLLSLHFIELVRSRKCTEALEFGQKK  119

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             L PFGKV  YVEKLEDFMALLAYEEPEKSPMFHLLS EYRQ VADSLNRA+LAHAN P+Y
Sbjct  120   LTPFGKVPKYVEKLEDFMALLAYEEPEKSPMFHLLSPEYRQNVADSLNRAVLAHANRPAY  179

Query  527   SAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             S++ER+IQQ TVVRQ L QE GK+   PFSLK FL
Sbjct  180   SSLERVIQQATVVRQYLQQEVGKDSYPPFSLKAFL  214



>gb|KFK42934.1| hypothetical protein AALP_AA1G057700 [Arabis alpina]
Length=213

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -3

Query  1055  VDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFN  876
             +DPRQ+E I V D+D+H+IV+SYL+HNCF +T +S  +STG+KQP    +++E+RK+I +
Sbjct  1     MDPRQFEHIVVKDNDIHSIVMSYLLHNCFNETADSLASSTGIKQPAIDRDNLERRKQIIH  60

Query  875   FTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPF  696
             F LE   LKA+E TEQL  DLLEKNKDLHFDLL LHFVELVC   CTEALEFAQT+LAPF
Sbjct  61    FILEKKALKAVELTEQLGQDLLEKNKDLHFDLLCLHFVELVCAGNCTEALEFAQTRLAPF  120

Query  695   GKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVE  516
             GKVQ YVEKLED MALLAYE+PEKSPMFHLLS EYRQ+VAD+LNR IL HAN  SY+ VE
Sbjct  121   GKVQKYVEKLEDVMALLAYEDPEKSPMFHLLSSEYRQQVADNLNRTILEHANQSSYTPVE  180

Query  515   RLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             RLIQ +TVVRQ L++E GK+   PFSLKD LK 
Sbjct  181   RLIQHVTVVRQYLTEENGKDAYPPFSLKDSLKG  213



>ref|NP_001143881.1| hypothetical protein [Zea mays]
 gb|ACG36187.1| hypothetical protein [Zea mays]
 gb|AFW84919.1| hypothetical protein ZEAMMB73_836179 [Zea mays]
Length=215

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 178/214 (83%), Gaps = 2/214 (1%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRKR  885
             M++DPR YE + VSD+DV NIVLSYL+HNCFK+T E+F++STG+  P DY + D++KRK 
Sbjct  1     MELDPRLYENVSVSDNDVRNIVLSYLMHNCFKETAEAFLSSTGLNLPVDYSV-DVDKRKA  59

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IFNF LEGN LKAIE TE++AP+LLE + DLHFDLLSLHF+ELV ++K TEAL+F Q KL
Sbjct  60    IFNFVLEGNALKAIELTEEMAPNLLENDMDLHFDLLSLHFIELVRSKKFTEALDFGQKKL  119

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
               F KV  Y+EKLEDFMALLAYEEPEKSPMFHLLS E+RQ VA+ LNRA+LAHANLP+YS
Sbjct  120   TSFQKVTKYIEKLEDFMALLAYEEPEKSPMFHLLSPEHRQNVAEGLNRAVLAHANLPAYS  179

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             ++ER++QQ TVVRQ L QE GK+   PFSLK FL
Sbjct  180   SLERVVQQATVVRQYLQQEVGKDSYPPFSLKAFL  213



>gb|EYU32885.1| hypothetical protein MIMGU_mgv1a013617mg [Erythranthe guttata]
Length=202

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD DP+QYE I V++SD+H IV+SYLVHNCFKDT+ESF+A T +KQP   LE M+KRKRI
Sbjct  1     MDADPKQYENIAVNESDIHKIVVSYLVHNCFKDTLESFVACTRVKQPIDHLEGMDKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             FNF L+GN  KAIE TE+  P LLE+NKDLHFDLLSL+FVELVC+RK  EAL FAQ K  
Sbjct  61    FNFALDGNASKAIELTEEFVPGLLEENKDLHFDLLSLNFVELVCSRKIDEALGFAQLKFT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK Q YVEKLEDFMALLAYEEPEKSPMFHLLS E+RQ VADSLNRAILA   LPS+S 
Sbjct  121   PFGKEQKYVEKLEDFMALLAYEEPEKSPMFHLLSEEHRQHVADSLNRAILAQTKLPSFSV  180

Query  521   VERLIQQITVVRQSLSQEPGK  459
             +ERLIQQ TVV+Q LSQE  K
Sbjct  181   MERLIQQTTVVKQYLSQESSK  201



>ref|XP_010232419.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Brachypodium distachyon]
Length=207

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = -3

Query  1064  MMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRK  888
             MM++DPR YE + VSD+DV ++VLSYL+HNCFK+T E+F++STG K P DY + D++KRK
Sbjct  1     MMELDPRLYENVSVSDTDVRDVVLSYLMHNCFKETAETFLSSTGQKLPVDYTV-DVDKRK  59

Query  887   RIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTK  708
              I NF LEG+ LKAIE TE+LAP+LLE + DLHFDLLSLHF+ELV +RKCTEALEF Q +
Sbjct  60    AILNFVLEGDSLKAIELTEELAPNLLENDMDLHFDLLSLHFIELVRSRKCTEALEFGQKR  119

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             L PFGKV  YV KLEDFMALLAYEEPEKSPMFHLLS EYRQ VADSLNRAILA+ANLP+Y
Sbjct  120   LTPFGKVPKYVVKLEDFMALLAYEEPEKSPMFHLLSPEYRQNVADSLNRAILANANLPAY  179

Query  527   SAVERLIQQITVVRQSLSQEPGK  459
             S++ER+IQQ TVVRQ L QE GK
Sbjct  180   SSLERVIQQSTVVRQYLQQEVGK  202



>gb|EPS61808.1| hypothetical protein M569_12982, partial [Genlisea aurea]
Length=214

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 173/214 (81%), Gaps = 0/214 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD DPR+YE I V+++D+H IV SYL+H+CF+DT+ESF+A  G+K      EDM++RKRI
Sbjct  1     MDTDPREYEKIVVNENDIHKIVQSYLIHHCFRDTLESFLACIGVKPSVENSEDMDRRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+F L+GN  KAIE T + AP LLE+NKDLHFD+LSL FVE VCTRK  EAL FAQ+K  
Sbjct  61    FHFALDGNASKAIELTNEYAPGLLEENKDLHFDILSLQFVEFVCTRKIEEALAFAQSKFT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK Q YV KLEDFMALLAYEEPEKSPMFHLLS ++R +VA++LNRAILAH   P YSA
Sbjct  121   PFGKDQKYVAKLEDFMALLAYEEPEKSPMFHLLSSDHRHQVAENLNRAILAHTKQPGYSA  180

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLK  420
             +ERLIQQ TVV+Q LSQE  K+GN PFSLKDFLK
Sbjct  181   MERLIQQTTVVKQCLSQECFKDGNEPFSLKDFLK  214



>ref|XP_003544281.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Glycine max]
Length=215

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 180/216 (83%), Gaps = 3/216 (1%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPRQYE I ++++DV+NI+LSYL+HNC+K++ ESFI+ TGMKQP   LE+MEKRKRI
Sbjct  1     MDVDPRQYEQIAINENDVNNIILSYLIHNCYKESSESFISCTGMKQPADHLENMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+  LEGNVLKAIE T QLA D+LE N DL FDLLSLHFV+LVC++K TEALEFAQTKL+
Sbjct  61    FHHALEGNVLKAIELTGQLAQDILENNNDLLFDLLSLHFVDLVCSKKWTEALEFAQTKLS  120

Query  701   PFG-KVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             P+  K Q Y++K+E FM+LLAYE P + PMFHL+ L+YRQ+V DSLN+ ILAH NLP ++
Sbjct  121   PYSVKEQKYMDKIEGFMSLLAYENPVECPMFHLIGLDYRQQVVDSLNQTILAHFNLPIHT  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             A+ERLIQQ +VVRQ LSQE G  G  PFSLKDFLKS
Sbjct  181   AMERLIQQTSVVRQCLSQEDG--GPPPFSLKDFLKS  214



>ref|XP_002510460.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52647.1| conserved hypothetical protein [Ricinus communis]
Length=303

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR YE + + D+D+H+IVLSYLVHNC+K+TVESFIA TGMKQP  CL+DMEKRKRI
Sbjct  1     MDVDPRHYEQVAIKDNDIHSIVLSYLVHNCYKETVESFIACTGMKQPADCLDDMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F + LEG+ LKAIE TE+LA DLLE NKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL 
Sbjct  61    FQYALEGSALKAIELTEELAHDLLENNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             PFGKVQ +VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQ+VAD++NRAIL
Sbjct  121   PFGKVQKFVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQQVADNMNRAIL  170



>ref|NP_563758.1| LisH and RanBPM domains containing protein [Arabidopsis thaliana]
 gb|AAF80129.1|AC024174_11 Contains similarity to an unknown protein product from Homo sapiens 
gi|7020818. ESTs gb|T45317, gb|AV561025, gb|AV524849 
come from this gene [Arabidopsis thaliana]
 gb|AAM62740.1| unknown [Arabidopsis thaliana]
 gb|AAO44043.1| At1g06060 [Arabidopsis thaliana]
 dbj|BAE99479.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27935.1| LisH and RanBPM domains containing protein [Arabidopsis thaliana]
Length=213

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -3

Query  1055  VDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFN  876
             +DPRQ+E   V+D+D+H+IV+SYL+HNCF +T +S  +STG+KQP    ++ME+RK+I +
Sbjct  1     MDPRQFEHTVVADNDIHSIVMSYLLHNCFNETADSLASSTGVKQPAIDRDNMERRKQIIH  60

Query  875   FTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPF  696
             F LE   LKA E TEQLA DLLEKNKDL FDLL LHFVEL+C   CTEAL+F +T+LAPF
Sbjct  61    FILERKALKAFELTEQLAQDLLEKNKDLQFDLLCLHFVELICAGNCTEALKFGKTRLAPF  120

Query  695   GKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVE  516
             GKV+ YVEKLED MALLAYE+PEKSPMFHLLS EYRQ+VAD+LNR IL H N PSY+ +E
Sbjct  121   GKVKKYVEKLEDVMALLAYEDPEKSPMFHLLSSEYRQQVADNLNRTILEHTNHPSYTPME  180

Query  515   RLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             R+IQQ+TVVRQ L++E GK+   PFSLKD LK 
Sbjct  181   RIIQQVTVVRQYLTEENGKDAFPPFSLKDSLKG  213



>gb|ABK23979.1| unknown [Picea sitchensis]
Length=209

 Score =   291 bits (746),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 173/204 (85%), Gaps = 2/204 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRKRIFNFTLEGNVLK  849
             ++D+DV NIVLSYL+HNCFK+T E+FI+ TGMKQP DY + D++KRK I+NF LEGN LK
Sbjct  7     INDNDVRNIVLSYLMHNCFKETAETFISCTGMKQPADYPV-DIDKRKPIYNFALEGNALK  65

Query  848   AIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVEK  669
             AIE T QLAP+LL++NKDLHFDLLSLHFVELV   KCTEAL FAQ +L  FGK   YV+K
Sbjct  66    AIELTNQLAPELLQENKDLHFDLLSLHFVELVRKMKCTEALLFAQNELTAFGKQDRYVDK  125

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITVV  489
             LED MALLAYEEPEKSPMF+LLS++YRQ VADSLNRAILAHANLPSY+++ERLIQQ TVV
Sbjct  126   LEDCMALLAYEEPEKSPMFYLLSMDYRQSVADSLNRAILAHANLPSYTSMERLIQQTTVV  185

Query  488   RQSLSQEPGKEGNLPFSLKDFLKS  417
             RQ L+QE GK+G   FSL  FLK+
Sbjct  186   RQWLNQELGKDGPPLFSLPAFLKN  209



>gb|KHN12673.1| UPF0559 protein [Glycine soja]
Length=215

 Score =   291 bits (745),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 177/216 (82%), Gaps = 3/216 (1%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDP QYE I +++ DV+NI+LSYL+HNC+K++ ESFI+ TGMKQP   LE+MEKRKRI
Sbjct  1     MDVDPCQYEQIAINEKDVNNIILSYLIHNCYKESSESFISCTGMKQPADHLENMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+  LEGNVLKAIE T QLA D+LE N DL FDLLSLHFV+LVC+++  EALEFAQTKL+
Sbjct  61    FHHALEGNVLKAIELTGQLAQDILENNNDLLFDLLSLHFVDLVCSKEWAEALEFAQTKLS  120

Query  701   PFG-KVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             PF  K Q Y+EK+E FM+LLAYE P + PMFHL+ L+YRQ+V DSLN+ ILAH NLP ++
Sbjct  121   PFSVKEQKYMEKIEGFMSLLAYENPVECPMFHLIGLDYRQQVVDSLNQTILAHFNLPIHT  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             A+ERLIQQ +VVRQ LSQE G  G  PFSLKDFLKS
Sbjct  181   AMERLIQQTSVVRQCLSQEDG--GPPPFSLKDFLKS  214



>ref|XP_002889583.1| hypothetical protein ARALYDRAFT_470618 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65842.1| hypothetical protein ARALYDRAFT_470618 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   290 bits (743),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -3

Query  1055  VDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFN  876
             +DPRQ+    V D+D+H+IV+SYL+HNCF +T +S  + TG+KQP    +++E+RK+I +
Sbjct  1     MDPRQFAHTVVDDNDIHSIVMSYLLHNCFNETADSLASCTGVKQPAIDRDNLERRKQIIH  60

Query  875   FTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPF  696
             F LE   LKA+E TEQLA DLLEKNKDLHFDLL LHFV+ VC   CTEALEFAQT+LAPF
Sbjct  61    FILERKALKAVELTEQLAQDLLEKNKDLHFDLLCLHFVDRVCAGNCTEALEFAQTRLAPF  120

Query  695   GKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVE  516
             GKV  YVEKLED MALLAYE+PEKSPMFHLLS EYRQ+VAD+LNR IL H N PSY+ +E
Sbjct  121   GKVPKYVEKLEDVMALLAYEDPEKSPMFHLLSSEYRQQVADNLNRTILEHTNHPSYTPME  180

Query  515   RLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             R+IQQ+TVVRQ L++E GK+   PFSLKD LK 
Sbjct  181   RIIQQVTVVRQYLTEENGKDAFPPFSLKDSLKG  213



>gb|AFW84920.1| hypothetical protein ZEAMMB73_836179 [Zea mays]
Length=206

 Score =   290 bits (742),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP-DYCLEDMEKRKR  885
             M++DPR YE + VSD+DV NIVLSYL+HNCFK+T E+F++STG+  P DY + D++KRK 
Sbjct  1     MELDPRLYENVSVSDNDVRNIVLSYLMHNCFKETAEAFLSSTGLNLPVDYSV-DVDKRKA  59

Query  884   IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKL  705
             IFNF LEGN LKAIE TE++AP+LLE + DLHFDLLSLHF+ELV ++K TEAL+F Q KL
Sbjct  60    IFNFVLEGNALKAIELTEEMAPNLLENDMDLHFDLLSLHFIELVRSKKFTEALDFGQKKL  119

Query  704   APFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
               F KV  Y+EKLEDFMALLAYEEPEKSPMFHLLS E+RQ VA+ LNRA+LAHANLP+YS
Sbjct  120   TSFQKVTKYIEKLEDFMALLAYEEPEKSPMFHLLSPEHRQNVAEGLNRAVLAHANLPAYS  179

Query  524   AVERLIQQITVVRQSLSQEPGK  459
             ++ER++QQ TVVRQ L QE GK
Sbjct  180   SLERVVQQATVVRQYLQQEVGK  201



>ref|XP_006417961.1| hypothetical protein EUTSA_v10008762mg [Eutrema salsugineum]
 gb|ESQ36314.1| hypothetical protein EUTSA_v10008762mg [Eutrema salsugineum]
Length=213

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -3

Query  1055  VDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFN  876
             +DPRQ+E I V D+D+H+IV+SYL+HNCF +T +S  + T  KQP    ++ME+RK+I +
Sbjct  1     MDPRQFEHIVVDDNDIHSIVMSYLLHNCFNETADSLASCTATKQPAIDRDNMERRKQIIH  60

Query  875   FTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPF  696
               LE   LKA+E TEQLA DLLEKNKDLHFDLL LHFVELVC  KCTEALEFAQT+LAPF
Sbjct  61    SILEKKALKAVELTEQLAQDLLEKNKDLHFDLLCLHFVELVCAGKCTEALEFAQTRLAPF  120

Query  695   GKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVE  516
             GKVQ Y+ KLED MALLAYE+ EKSPMFHLLS E+RQ+VAD+LNR IL HAN PSY+ +E
Sbjct  121   GKVQKYIHKLEDAMALLAYEDHEKSPMFHLLSYEHRQQVADNLNRTILEHANNPSYTPME  180

Query  515   RLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             RL+QQ+TV RQ L++E GK+   PFSLKD L+ 
Sbjct  181   RLLQQVTVARQYLTEENGKDAFPPFSLKDSLRG  213



>ref|XP_010485766.1| PREDICTED: glucose-induced degradation protein 8 homolog [Camelina 
sativa]
Length=217

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 173/217 (80%), Gaps = 0/217 (0%)
 Frame = -3

Query  1067  LMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRK  888
             +  D+DPRQ+E   V D+D+H+IV+SYL+HNCF +T +S  + TG+KQP    +++++RK
Sbjct  1     MYTDMDPRQFEHSVVDDNDIHSIVMSYLLHNCFNETADSLASCTGVKQPSDDRDNIQRRK  60

Query  887   RIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTK  708
             +I +F +E   LKA+E TEQLA DLLEKNKDLHFDLL LHFVELVC RKC EA+EFA+T 
Sbjct  61    QIIHFVMEMKALKAVELTEQLAKDLLEKNKDLHFDLLRLHFVELVCARKCNEAIEFAKTI  120

Query  707   LAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSY  528
             LAPFG V  YVEKLED MALLAY++PEKSP+FHLLS EYRQ+VAD+LNR IL H N PSY
Sbjct  121   LAPFGTVHKYVEKLEDAMALLAYDDPEKSPLFHLLSSEYRQQVADNLNRTILEHTNQPSY  180

Query  527   SAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             + +ER+IQ +TVVRQ L++E GK+   PFSLKD LK 
Sbjct  181   TPMERIIQHVTVVRQYLTEENGKDAFPPFSLKDSLKG  217



>ref|XP_008804543.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Phoenix dactylifera]
Length=286

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 163/194 (84%), Gaps = 2/194 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V+DSDV NIVLSYLVHNCF +T ESF+A TGMKQP   L DM+KRK IF+F L+GN LKA
Sbjct  10    VNDSDVRNIVLSYLVHNCFNETAESFLACTGMKQPVDYLVDMDKRKSIFHFALDGNALKA  69

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVEKL  666
             IE TEQLAP+LLE +KDLHFDLLSLHF++LVC+RKCTEALEFAQT+L P GK+  YVEKL
Sbjct  70    IELTEQLAPNLLEDDKDLHFDLLSLHFIDLVCSRKCTEALEFAQTELTPLGKLHKYVEKL  129

Query  665   EDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL--AHANLPSYSAVERLIQQITV  492
             ED MALLAYEEPEKSPMFHLLS +YRQ +AD LNRAIL  A+ NLPSYS++ERLIQQ TV
Sbjct  130   EDLMALLAYEEPEKSPMFHLLSSDYRQNIADCLNRAILVSAYPNLPSYSSMERLIQQATV  189

Query  491   VRQSLSQEPGKEGN  450
             VRQ L QE  K  N
Sbjct  190   VRQFLHQELSKVHN  203



>ref|XP_006435082.1| hypothetical protein CICLE_v10002444mg [Citrus clementina]
 gb|ESR48322.1| hypothetical protein CICLE_v10002444mg [Citrus clementina]
 gb|KDO84703.1| hypothetical protein CISIN_1g027999mg [Citrus sinensis]
Length=172

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP  CLEDME RKRI +F LEGN LKAIE TE+LA DLLEKNKDLHFDLLSLHFVELV
Sbjct  1    MKQPANCLEDMEMRKRILHFALEGNALKAIELTEELAQDLLEKNKDLHFDLLSLHFVELV  60

Query  752  CTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVAD  573
            C+RKCTEALEFAQTKL PFGKVQ YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQ VAD
Sbjct  61   CSRKCTEALEFAQTKLTPFGKVQKYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQHVAD  120

Query  572  SLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
            +LNRAILAHA  P Y+A+ERLIQQ T VRQ LSQE GK+ + PFSLKDF+KS
Sbjct  121  NLNRAILAHAERPRYAAMERLIQQTTAVRQCLSQELGKDVHPPFSLKDFMKS  172



>ref|XP_010475327.1| PREDICTED: glucose-induced degradation protein 8 homolog [Camelina 
sativa]
Length=213

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -3

Query  1055  VDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFN  876
             +DPRQ+E   V D D+H+IV+SYL+HNCF +T +S  + TG+K P    +++++RK+I +
Sbjct  1     MDPRQFEHSVVDDKDIHSIVMSYLLHNCFNETADSLASCTGVKLPADDRDNIQRRKQIIH  60

Query  875   FTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPF  696
             F LE   LKA+E TEQLA DLLEKNKDLHFDLL LHFVELVC RKC EA+EFA+T LAPF
Sbjct  61    FVLEMKALKAVELTEQLAKDLLEKNKDLHFDLLRLHFVELVCARKCNEAIEFAKTILAPF  120

Query  695   GKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVE  516
             G VQ YVEKLED MALLAY++PEKSP+FHLLS EYRQ+VAD LNR IL H N PSY+ +E
Sbjct  121   GTVQKYVEKLEDAMALLAYDDPEKSPLFHLLSSEYRQQVADDLNRTILEHTNQPSYTPME  180

Query  515   RLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             R+IQ +TVVRQ L++E GK+   PFSLKD LK 
Sbjct  181   RIIQHVTVVRQYLTEENGKDAFPPFSLKDSLKG  213



>ref|NP_001236297.1| uncharacterized protein LOC100527710 [Glycine max]
 gb|ACU16856.1| unknown [Glycine max]
Length=215

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 174/216 (81%), Gaps = 3/216 (1%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDP QYE I +++ DV+NI+LSYL+HNC+K++  SFI+ TGMKQP   LE+MEKRKRI
Sbjct  1     MDVDPCQYEQIAINEKDVNNIILSYLIHNCYKESSGSFISCTGMKQPADHLENMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+  LEGNVLKAIE T QLA D+LE N DL FDLLSLHFV+LVC+++  EALEFAQTKL+
Sbjct  61    FHHALEGNVLKAIELTGQLAQDILENNNDLLFDLLSLHFVDLVCSKEWAEALEFAQTKLS  120

Query  701   PFG-KVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             PF  K Q Y+EK+E FM+LLAYE P + PMFHL+ L+YRQ+V DSLN+ ILAH NLP ++
Sbjct  121   PFSVKEQKYMEKIEGFMSLLAYENPVECPMFHLIGLDYRQQVVDSLNQTILAHFNLPIHT  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             A+ERLIQQ +VVRQ LS E G  G  PFSLKD LKS
Sbjct  181   AMERLIQQTSVVRQCLSLEDG--GPPPFSLKDILKS  214



>ref|XP_010457721.1| PREDICTED: glucose-induced degradation protein 8 homolog [Camelina 
sativa]
Length=214

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 172/214 (80%), Gaps = 1/214 (0%)
 Frame = -3

Query  1055  VDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTG-MKQPDYCLEDMEKRKRIF  879
             +DPRQ+E   V D+D+H+IV+SYL+HNCF +T +S  + TG +KQP    +++++RK+I 
Sbjct  1     MDPRQFEHSVVGDNDIHSIVMSYLLHNCFNETADSLASCTGGVKQPAGDRDNIQRRKQII  60

Query  878   NFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAP  699
             +F LE   LKA+E T+QLA DLLEKNKDLHFDLL LHFVELVC RKC EA+EFA+T LAP
Sbjct  61    HFVLEMKALKAVELTDQLAKDLLEKNKDLHFDLLRLHFVELVCARKCNEAIEFAKTILAP  120

Query  698   FGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAV  519
             FG VQ YVEKLED MALLAY++PEKSP+FHLLS EYRQ+VAD+LNR IL H N PSY+ +
Sbjct  121   FGTVQKYVEKLEDAMALLAYDDPEKSPLFHLLSSEYRQQVADNLNRTILEHTNQPSYTPM  180

Query  518   ERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             ER+IQ +TVVRQ L++E GK+   PF+LKD LK 
Sbjct  181   ERIIQHVTVVRQYLTEENGKDAFPPFALKDSLKG  214



>gb|EMS53305.1| Protein C20orf11 [Triticum urartu]
Length=300

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 183/257 (71%), Gaps = 26/257 (10%)
 Frame = -3

Query  1151  RIFSPRPDRIFGGGEEFSGQTNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNC  972
             R+F  R    FG G    G+       R  +D          VSD+DV NIVLSYL+HNC
Sbjct  54    RVFLVREGPNFGDGVVVVGKKRD----RFFVD-------NKSVSDNDVRNIVLSYLMHNC  102

Query  971   FKDTVESFIASTGMKQP-DYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKD  795
             FK+T E+F++STG+K P DY + D++KRK I NF +EG+ +KAIE TE+LAP+LLE + D
Sbjct  103   FKETAETFLSSTGLKLPVDYTV-DVDKRKAILNFVVEGDAVKAIELTEELAPNLLENDMD  161

Query  794   LHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPM  615
             LHFDL+SLHF+EL+ +RKCTEALEF Q KL PFGKV  YVEKLEDFMALLAYEEPEKSPM
Sbjct  162   LHFDLISLHFIELIRSRKCTEALEFGQKKLTPFGKVSKYVEKLEDFMALLAYEEPEKSPM  221

Query  614   FHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNL----  447
             FHLL+ EYRQ VADSLNRAILAHANLP+YS++ER+IQQ TVVRQ L QE  K  +     
Sbjct  222   FHLLAPEYRQNVADSLNRAILAHANLPAYSSLERVIQQSTVVRQYLQQEVDKHHDAYMTF  281

Query  446   ---------PFSLKDFL  423
                      PF LK FL
Sbjct  282   ELLEQDSYPPFCLKAFL  298



>ref|XP_006595917.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Glycine max]
Length=223

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPRQYE I ++++DV+NI+LSYL+HNC+K++ ESFI+ TGMKQP   LE+MEKRKRI
Sbjct  1     MDVDPRQYEQIAINENDVNNIILSYLIHNCYKESSESFISCTGMKQPADHLENMEKRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F+  LEGNVLKAIE T QLA D+LE N DL FDLLSLHFV+LVC++K TEALEFAQTKL+
Sbjct  61    FHHALEGNVLKAIELTGQLAQDILENNNDLLFDLLSLHFVDLVCSKKWTEALEFAQTKLS  120

Query  701   PFG-KVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             P+  K Q Y++K+E FM+LLAYE P + PMFHL+ L+YRQ+V DSLN+ ILAH NLP ++
Sbjct  121   PYSVKEQKYMDKIEGFMSLLAYENPVECPMFHLIGLDYRQQVVDSLNQTILAHFNLPIHT  180

Query  524   AVERLIQQITVVRQSLSQE  468
             A+ERLIQQ +VVRQ LSQE
Sbjct  181   AMERLIQQTSVVRQCLSQE  199



>ref|XP_001776447.1| predicted protein [Physcomitrella patens]
 gb|EDQ58714.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 169/216 (78%), Gaps = 1/216 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR +E + VSDS+V  IVLSYLVHNCFK+T ESFIA +GMK+   C  D++KRK I
Sbjct  1     MDVDPRLFENVKVSDSEVRKIVLSYLVHNCFKETAESFIACSGMKRTADCSVDIDKRKPI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             +N  LEGN LKAIE T +LA DLL  N D+HFDLL LHF+ELV  + C  ALEFAQ +L 
Sbjct  61    YNHVLEGNALKAIELTNELAVDLLTSNPDVHFDLLILHFIELVRAKDCASALEFAQKELR  120

Query  701   PFGK-VQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             PFGK ++  ++KL+D MALLAY++PE SPMFH LSLEYR  VAD+LN A+LAHANLPSY+
Sbjct  121   PFGKLLERCLDKLQDCMALLAYDDPETSPMFHYLSLEYRHSVADALNSAVLAHANLPSYT  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             ++ERL+Q  TVVRQ L+QE GK+G   F+LK FLKS
Sbjct  181   SMERLLQHTTVVRQRLNQELGKDGPPTFTLKAFLKS  216



>gb|KDO84704.1| hypothetical protein CISIN_1g027999mg [Citrus sinensis]
Length=169

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 149/172 (87%), Gaps = 3/172 (2%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP  CLEDME RKRI +F LEGN LKAIE TE+LA DLLEKNKDLHFDLLSLHFVELV
Sbjct  1    MKQPANCLEDMEMRKRILHFALEGNALKAIELTEELAQDLLEKNKDLHFDLLSLHFVELV  60

Query  752  CTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVAD  573
            C+RKCTEALEFAQTKL PFGKVQ YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQ VAD
Sbjct  61   CSRKCTEALEFAQTKLTPFGKVQKYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQHVAD  120

Query  572  SLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
            +LNRAIL     P Y+A+ERLIQQ T VRQ LSQE GK+ + PFSLKDF+KS
Sbjct  121  NLNRAILER---PRYAAMERLIQQTTAVRQCLSQELGKDVHPPFSLKDFMKS  169



>emb|CDX86538.1| BnaC08g01650D [Brassica napus]
Length=213

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -3

Query  1055  VDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFN  876
             +DPRQ+E I V D+D+ +IV+SYL+HNCF +T +S  ++TG+ QP    ++ME+RK+I +
Sbjct  1     MDPRQFEHIVVKDNDIQSIVMSYLLHNCFDETADSLASTTGIHQPVIDRDNMERRKQIMH  60

Query  875   FTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPF  696
               LE   LKA+E TEQL  DLLEKNKDLHFDLL LHFVELVC  K  EALEFA+T LAPF
Sbjct  61    CILEKKALKAVELTEQLGQDLLEKNKDLHFDLLCLHFVELVCDGKSKEALEFAKTSLAPF  120

Query  695   GKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVE  516
             G VQ YV KLED +ALLAYE+PEKSPMF+LLS EYRQ+VAD+LNR +L HAN PSY+ +E
Sbjct  121   GMVQKYVGKLEDAIALLAYEDPEKSPMFYLLSSEYRQQVADNLNRTLLEHANQPSYTPME  180

Query  515   RLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             RL+QQ+TV RQ L++E GK+   PFSLKD++K 
Sbjct  181   RLLQQVTVARQYLTEENGKDAFPPFSLKDYVKG  213



>ref|XP_006600155.1| PREDICTED: uncharacterized protein LOC100527710 isoform X1 [Glycine 
max]
Length=229

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 174/230 (76%), Gaps = 17/230 (7%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKR-  885
             MDVDP QYE I +++ DV+NI+LSYL+HNC+K++ ESFI+ TGMKQP   LE+MEKRK  
Sbjct  1     MDVDPCQYEQIAINEKDVNNIILSYLIHNCYKESSESFISCTGMKQPADHLENMEKRKSS  60

Query  884   -------------IFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTR  744
                          IF+  LEGNVLKAIE T QLA D+LE N DL FDLLSLHFV+LVC++
Sbjct  61    KASLMDKFHSSLGIFHHALEGNVLKAIELTGQLAQDILENNNDLLFDLLSLHFVDLVCSK  120

Query  743   KCTEALEFAQTKLAPFG-KVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSL  567
             +  EALEFAQTKL+PF  K Q Y+EK+E FM+LLAYE P + PMFHL+ L+YRQ+V DSL
Sbjct  121   EWAEALEFAQTKLSPFSVKEQKYMEKIEGFMSLLAYENPVECPMFHLIGLDYRQQVVDSL  180

Query  566   NRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             N+ ILAH NLP ++A+ERLIQQ +VVRQ LS E G  G  PFSLKD LKS
Sbjct  181   NQTILAHFNLPIHTAMERLIQQTSVVRQCLSLEDG--GPPPFSLKDILKS  228



>ref|XP_001756780.1| predicted protein [Physcomitrella patens]
 gb|EDQ78377.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 165/216 (76%), Gaps = 1/216 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR +E + VSD +V  IVLSYLVHNCFK+T E+FIA +GMK+   C  D++KRK I
Sbjct  1     MDVDPRLFENVKVSDGEVRKIVLSYLVHNCFKETAETFIACSGMKRTADCSVDIDKRKPI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             +N  LEGN  KAIE T QLA DLL  N D+HFDLL+LHF+ELV  + C  ALEFAQ +L 
Sbjct  61    YNHVLEGNASKAIELTNQLAVDLLTSNPDVHFDLLTLHFIELVRAKDCASALEFAQKELR  120

Query  701   PFGKVQS-YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             PFGK Q  Y++KL+D MALLAYE PE SPMF+ LS EYR  VAD+LN A+LAHANLPSY+
Sbjct  121   PFGKQQGRYLDKLQDCMALLAYENPETSPMFNYLSPEYRHSVADALNSAVLAHANLPSYT  180

Query  524   AVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             ++ERL+Q  TVVRQ L QE GK+G   F+LK FLKS
Sbjct  181   SMERLLQHTTVVRQRLHQELGKDGPPIFTLKAFLKS  216



>ref|XP_008796611.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Phoenix dactylifera]
Length=172

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP   L DM+KRK IF F LEGN LKAIE TEQLAP+LLE NKDLHFDLLSLHFV L+
Sbjct  1    MKQPVDYLADMDKRKSIFRFALEGNALKAIELTEQLAPNLLEDNKDLHFDLLSLHFVNLI  60

Query  752  CTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVAD  573
            C+RKCTEALEFAQTKL PFGKV  YVEKLEDFMALLAYEEPEKSPMFHLLS ++RQ VAD
Sbjct  61   CSRKCTEALEFAQTKLTPFGKVHKYVEKLEDFMALLAYEEPEKSPMFHLLSPDHRQNVAD  120

Query  572  SLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             LNRAILAHANLP YS++ERLIQQ TVVRQ L QE GK+G  PFSLK FLK+
Sbjct  121  CLNRAILAHANLPCYSSMERLIQQATVVRQCLHQELGKDGPPPFSLKGFLKN  172



>ref|XP_010110008.1| Protein C20orf11-like protein [Morus notabilis]
 gb|EXC25026.1| Protein C20orf11-like protein [Morus notabilis]
Length=203

 Score =   272 bits (696),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 160/199 (80%), Gaps = 5/199 (3%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MDVDPR Y+ + ++D+D+HN+V+SYLVHNC+K+T ESFIA TGMKQ    +EDME+RKRI
Sbjct  1     MDVDPRHYDHVAINDNDIHNVVISYLVHNCYKETAESFIACTGMKQSADHIEDMERRKRI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
              N+ LEGN L+AIE TEQL  DLLEKNK+LHFD+LSLHFV LV +RKCTEALEFAQTKL 
Sbjct  61    INYALEGNALEAIELTEQLGHDLLEKNKELHFDVLSLHFVNLVRSRKCTEALEFAQTKLT  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLP----  534
             PFGK+  YV KLEDF+ALLAYEEPEKSPMFHLLS++YRQ+VADSLNRAIL   +      
Sbjct  121   PFGKMDKYVSKLEDFLALLAYEEPEKSPMFHLLSMDYRQQVADSLNRAILGCTSSIFIER  180

Query  533   -SYSAVERLIQQITVVRQS  480
              S   +E++  +I +  QS
Sbjct  181   FSQKLIEKIFARIAIKGQS  199



>ref|XP_006304078.1| hypothetical protein CARUB_v10009937mg [Capsella rubella]
 gb|EOA36976.1| hypothetical protein CARUB_v10009937mg [Capsella rubella]
Length=284

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 168/218 (77%), Gaps = 0/218 (0%)
 Frame = -3

Query  1070  RLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKR  891
             R   D+DPRQ+E I V D D+H+IV+SYL+HNCF +T +S  + TG+KQ     +++E+R
Sbjct  67    RTATDMDPRQFEDIVVDDKDIHSIVMSYLLHNCFNETADSLASCTGVKQLAVDSDNIERR  126

Query  890   KRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQT  711
             K+I +F LE   +KAIE TEQLA DLLEKNKDLHFDLL LHFVE VC     EAL+FA+T
Sbjct  127   KQIIHFILERKAMKAIELTEQLAQDLLEKNKDLHFDLLCLHFVERVCAGNTREALDFART  186

Query  710   KLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +L PFG+VQ+YV KLED MALLAYE+P  SPMFHLLS E+RQ+VAD+LNR IL H N PS
Sbjct  187   RLTPFGEVQNYVGKLEDAMALLAYEDPGTSPMFHLLSPEHRQQVADNLNRTILEHTNQPS  246

Query  530   YSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             Y+ +ER+IQQ TVVRQ L++E GK+   PFSLKD LK 
Sbjct  247   YTPMERIIQQATVVRQYLTEENGKDAFPPFSLKDSLKG  284



>emb|CDY15559.1| BnaA08g28430D [Brassica napus]
Length=213

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 166/213 (78%), Gaps = 0/213 (0%)
 Frame = -3

Query  1055  VDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFN  876
             +DPRQ E I V D+D+ +IV+SYL+HNCF +T +S  ++TG+ QP    +++E+RK+I +
Sbjct  1     MDPRQLEHIVVKDNDIQSIVMSYLLHNCFDETADSLASTTGINQPVIDRDNLERRKQIMH  60

Query  875   FTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPF  696
               LE   LKA+E TEQL  DLLEKNK LHFDLL LHFVEL+C  K  EALEFA+T LAPF
Sbjct  61    CILEKKALKAVELTEQLGQDLLEKNKGLHFDLLCLHFVELICDGKSKEALEFAKTSLAPF  120

Query  695   GKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVE  516
             G VQ YV KLED +ALLAYE+PEKSPMF+LLS EYRQ+VAD LNR +L HAN PSY+ +E
Sbjct  121   GMVQKYVGKLEDAIALLAYEDPEKSPMFYLLSSEYRQQVADDLNRTLLEHANQPSYTPME  180

Query  515   RLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             RL+QQ+TV RQ L++E GK+   PFSLKD++K 
Sbjct  181   RLLQQVTVTRQYLTEENGKDAFPPFSLKDYVKG  213



>ref|XP_009111008.1| PREDICTED: glucose-induced degradation protein 8 homolog [Brassica 
rapa]
Length=213

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 168/213 (79%), Gaps = 0/213 (0%)
 Frame = -3

Query  1055  VDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFN  876
             +DPRQ E I V D+D+ +IV+SYL+HNCF +T +S  ++TG+ QP    +++E+RK+I +
Sbjct  1     MDPRQLEHIVVKDNDIQSIVMSYLLHNCFDETADSLASTTGINQPVIDRDNLERRKQIMH  60

Query  875   FTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPF  696
               LE   LKA+E TEQL  +LLEKNKDLHFDLL LHFVEL+C  K  EALEFA+T LAPF
Sbjct  61    CILEKKALKAVELTEQLGQELLEKNKDLHFDLLCLHFVELICDGKSKEALEFAKTSLAPF  120

Query  695   GKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVE  516
             G VQ YV KLED +ALLAYE+PEKSPMF+LLS EYRQ+VAD+LNR +L HA+ PSY+ +E
Sbjct  121   GMVQKYVGKLEDAIALLAYEDPEKSPMFYLLSSEYRQQVADNLNRTLLEHASQPSYTPME  180

Query  515   RLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             RL+QQ+TV RQ L++E GK+   PFSLKD++K 
Sbjct  181   RLLQQVTVARQYLTEENGKDAFPPFSLKDYVKG  213



>ref|XP_010923263.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Elaeis guineensis]
 ref|XP_010923264.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Elaeis guineensis]
Length=172

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP   L DM+KRK IF+F LEGN LKAIE TEQLAP+LLE NKDLHFDLLSLHFV+L+
Sbjct  1    MKQPVDYLVDMDKRKSIFHFALEGNALKAIELTEQLAPNLLEDNKDLHFDLLSLHFVDLI  60

Query  752  CTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVAD  573
            C+RKCTEALEFAQTKLAPFGKV  YVEKLEDFMALLAYEEPEKSP+F LLS ++RQ VAD
Sbjct  61   CSRKCTEALEFAQTKLAPFGKVHKYVEKLEDFMALLAYEEPEKSPLFRLLSPDHRQDVAD  120

Query  572  SLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             LN+AILAHANLP YS++ERLIQQ TVVRQ L QE GK+G  PFSLK FLK+
Sbjct  121  CLNQAILAHANLPRYSSMERLIQQATVVRQCLHQELGKDGPPPFSLKGFLKN  172



>gb|AFK38061.1| unknown [Lotus japonicus]
Length=191

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             M+ DPRQYE I +++ D+ NIVLSYL+HNC++++VESFI+ TG+K+P   LE+MEKRK+I
Sbjct  1     MEPDPRQYEKIAINEKDIPNIVLSYLIHNCYEESVESFISCTGIKKPADYLENMEKRKKI  60

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
             F++ LE N LKAIE TEQLA D+LE NKDL F LLSLHFVELV +RKCTEALEFAQTKL+
Sbjct  61    FHYALERNALKAIELTEQLAKDILENNKDLLFYLLSLHFVELVRSRKCTEALEFAQTKLS  120

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
             PFGK Q Y++ LEDFMALLAY+EPEKSP+FHLLS EYRQ+VAD LNRAILA+ NLPS++A
Sbjct  121   PFGKEQKYMQNLEDFMALLAYQEPEKSPVFHLLSPEYRQQVADRLNRAILAYFNLPSHTA  180

Query  521   V  519
             +
Sbjct  181   M  181



>ref|XP_008654713.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=189

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = -3

Query  983  VHNCFKDTVESFIASTGMKQP-DYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLE  807
            +HNCFK+T E+F++STG+  P DY + D++KRK IFNF LEGN LKAIE TE++AP+LLE
Sbjct  1    MHNCFKETAEAFLSSTGLNLPVDYSV-DVDKRKAIFNFVLEGNALKAIELTEEMAPNLLE  59

Query  806  KNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPE  627
             + DLHFDLLSLHF+ELV ++K TEAL+F Q KL  F KV  Y+EKLEDFMALLAYEEPE
Sbjct  60   NDMDLHFDLLSLHFIELVRSKKFTEALDFGQKKLTSFQKVTKYIEKLEDFMALLAYEEPE  119

Query  626  KSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNL  447
            KSPMFHLLS E+RQ VA+ LNRA+LAHANLP+YS++ER++QQ TVVRQ L QE GK+   
Sbjct  120  KSPMFHLLSPEHRQNVAEGLNRAVLAHANLPAYSSLERVVQQATVVRQYLQQEVGKDSYP  179

Query  446  PFSLKDFL  423
            PFSLK FL
Sbjct  180  PFSLKAFL  187



>ref|XP_010933012.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Elaeis guineensis]
Length=172

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP   L DM+KRK I +F L+GN LKAIE TEQLAP+LLE +KDL+FDLLSLHF++LV
Sbjct  1    MKQPVDYLVDMDKRKSIVHFALDGNALKAIELTEQLAPNLLEDDKDLYFDLLSLHFIDLV  60

Query  752  CTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVAD  573
            C+RKCTEALEFAQTKL P G+V  YV+KLED MALLAYEEPEKSPMFHLLS +YRQ +AD
Sbjct  61   CSRKCTEALEFAQTKLTPLGRVHKYVQKLEDLMALLAYEEPEKSPMFHLLSSDYRQNIAD  120

Query  572  SLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             LN+AILAHANLPSYS++ERLIQQ TVVRQ L QE  K+G   FSLK FLK+
Sbjct  121  CLNQAILAHANLPSYSSMERLIQQATVVRQFLHQELSKDGPPKFSLKAFLKN  172



>ref|XP_010933050.1| PREDICTED: LOW QUALITY PROTEIN: glucose-induced degradation protein 
8 homolog [Elaeis guineensis]
Length=172

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP   L DM+KRK I +F L+GN LKAIE TEQLAP+LLE +KDL+FDLLSLHF++LV
Sbjct  1    MKQPVDYLVDMDKRKSIVHFALDGNALKAIELTEQLAPNLLEDDKDLYFDLLSLHFIDLV  60

Query  752  CTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVAD  573
            C+RKCTEALEFAQTKL P G+V  YV+KLED MALLAYEEPEKSPMFHLLS +Y Q +AD
Sbjct  61   CSRKCTEALEFAQTKLTPLGRVHKYVQKLEDLMALLAYEEPEKSPMFHLLSSDYXQNIAD  120

Query  572  SLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFLKS  417
             LN+AILAHANLPSYS++ERLIQQ TVVRQ L QE  K+G   FSLK FLK+
Sbjct  121  CLNQAILAHANLPSYSSMERLIQQATVVRQFLHQEFSKDGPPKFSLKAFLKN  172



>ref|XP_010933021.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Elaeis guineensis]
Length=166

 Score =   242 bits (618),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP   L DM+KRK I +F L+GN LKAIE TEQLAP+LLE +KDL+FDLLSLHF++LV
Sbjct  1    MKQPVDYLVDMDKRKSIVHFALDGNALKAIELTEQLAPNLLEDDKDLYFDLLSLHFIDLV  60

Query  752  CTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVAD  573
            C+RKCTEALEFAQTKL P G+V  YV+KLED MALLAYEEPEKSPMFHLLS +YRQ +AD
Sbjct  61   CSRKCTEALEFAQTKLTPLGRVHKYVQKLEDLMALLAYEEPEKSPMFHLLSSDYRQNIAD  120

Query  572  SLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKE  456
             LN+AILAHANLPSYS++ERLIQQ TVVRQ L QE  K+
Sbjct  121  CLNQAILAHANLPSYSSMERLIQQATVVRQFLHQELSKQ  159



>ref|XP_010933029.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X4 [Elaeis guineensis]
Length=164

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP   L DM+KRK I +F L+GN LKAIE TEQLAP+LLE +KDL+FDLLSLHF++LV
Sbjct  1    MKQPVDYLVDMDKRKSIVHFALDGNALKAIELTEQLAPNLLEDDKDLYFDLLSLHFIDLV  60

Query  752  CTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVAD  573
            C+RKCTEALEFAQTKL P G+V  YV+KLED MALLAYEEPEKSPMFHLLS +YRQ +AD
Sbjct  61   CSRKCTEALEFAQTKLTPLGRVHKYVQKLEDLMALLAYEEPEKSPMFHLLSSDYRQNIAD  120

Query  572  SLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGK  459
             LN+AILAHANLPSYS++ERLIQQ TVVRQ L QE  K
Sbjct  121  CLNQAILAHANLPSYSSMERLIQQATVVRQFLHQELSK  158



>ref|XP_010933002.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Elaeis guineensis]
Length=178

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP   L DM+KRK I +F L+GN LKAIE TEQLAP+LLE +KDL+FDLLSLHF++LV
Sbjct  1    MKQPVDYLVDMDKRKSIVHFALDGNALKAIELTEQLAPNLLEDDKDLYFDLLSLHFIDLV  60

Query  752  CTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVAD  573
            C+RKCTEALEFAQTKL P G+V  YV+KLED MALLAYEEPEKSPMFHLLS +YRQ +AD
Sbjct  61   CSRKCTEALEFAQTKLTPLGRVHKYVQKLEDLMALLAYEEPEKSPMFHLLSSDYRQNIAD  120

Query  572  SLNRAILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEG  453
             LN+AILAHANLPSYS++ERLIQQ TVVRQ L QE  K  
Sbjct  121  CLNQAILAHANLPSYSSMERLIQQATVVRQFLHQELSKSS  160



>ref|XP_002968915.1| hypothetical protein SELMODRAFT_145745 [Selaginella moellendorffii]
 ref|XP_002989963.1| hypothetical protein SELMODRAFT_160466 [Selaginella moellendorffii]
 gb|EFJ08976.1| hypothetical protein SELMODRAFT_160466 [Selaginella moellendorffii]
 gb|EFJ30031.1| hypothetical protein SELMODRAFT_145745 [Selaginella moellendorffii]
Length=210

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMK-QPDYCLEDMEKRKRIFNFTLEG  861
             E + V D+DV  ++L YLVHNCFK+T E+FIAST M    D+ + D+++RK I+N  + G
Sbjct  4     ENVKVDDNDVKKVLLGYLVHNCFKETAEAFIASTEMNCSADFSM-DIDRRKPIYNHVMGG  62

Query  860   NVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQS  681
               LKAI+ T  +AP LL  NKDLHFDLL+LHF+ELV +R    ALEFAQ +L PFGK + 
Sbjct  63    EPLKAIDLTNGVAPGLLLDNKDLHFDLLTLHFIELVRSRNAIGALEFAQRELTPFGKEKH  122

Query  680   YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQ  501
             YV+KL+D MALLAY EPE SP+F LLS++YRQ +AD LNRA+L H  LPSY+++ERL+QQ
Sbjct  123   YVDKLQDCMALLAYSEPETSPLFSLLSVDYRQNIADMLNRALLDHGKLPSYTSMERLLQQ  182

Query  500   ITVVRQSLSQE-PGKEGNLPFSLKDFL  423
              T+V Q L QE  GK+ +  F+L+ FL
Sbjct  183   FTLVSQRLQQEQGGKDLHASFTLRTFL  209



>gb|KDO84705.1| hypothetical protein CISIN_1g027999mg [Citrus sinensis]
Length=129

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP  CLEDME RKRI +F LEGN LKAIE TE+LA DLLEKNKDLHFDLLSLHFVELV
Sbjct  1    MKQPANCLEDMEMRKRILHFALEGNALKAIELTEELAQDLLEKNKDLHFDLLSLHFVELV  60

Query  752  CTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVAD  573
            C+RKCTEALEFAQTKL PFGKVQ YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQ VAD
Sbjct  61   CSRKCTEALEFAQTKLTPFGKVQKYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQHVAD  120

Query  572  SLNRAILA  549
            +LNRAIL 
Sbjct  121  NLNRAILG  128



>ref|XP_007160711.1| hypothetical protein PHAVU_001G010600g [Phaseolus vulgaris]
 gb|ESW32705.1| hypothetical protein PHAVU_001G010600g [Phaseolus vulgaris]
Length=225

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 151/213 (71%), Gaps = 3/213 (1%)
 Frame = -3

Query  1061  MDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRI  882
             MD+ P  YE I +++ DV+NI+LSYL HN ++++ E+FIA  GM++P   LE M+ +KRI
Sbjct  12    MDIHPSHYEEIAINEQDVNNIILSYLAHNFYEESSEAFIACIGMQRPAEYLESMQTKKRI  71

Query  881   FNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLA  702
              N+ LEGN LKAIE  EQL+ D+L+ NKDL  DLLSLHFV LVC++K  EA+EFAQ  ++
Sbjct  72    VNYVLEGNSLKAIELIEQLSQDILKNNKDLMLDLLSLHFVVLVCSQKWAEAVEFAQANMS  131

Query  701   PFGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA  522
              +     Y E++EDFM+LLA++   +SPM HL +  YR  V  +LN A+L H NLP+ S 
Sbjct  132   SYASHSIYSERVEDFMSLLAFKNILESPMAHLTTTGYRHHVVGNLNVALLEHFNLPNCST  191

Query  521   VERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
             +ERL+QQ+T+VR+ L +  G     PFSL++FL
Sbjct  192   MERLMQQLTLVREDLRRMKGLP---PFSLRNFL  221



>gb|KHN20943.1| UPF0559 protein [Glycine soja]
Length=180

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = -3

Query  932  MKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELV  753
            MKQP   LE+MEKRKRIF+  LEGNVLKAIE T QLA D+LE N DL FDLLSLHFV+LV
Sbjct  1    MKQPADHLENMEKRKRIFHHALEGNVLKAIELTGQLAQDILENNNDLLFDLLSLHFVDLV  60

Query  752  CTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVA  576
            C+++ TEALEFAQTKL+PF  K Q Y++K+E FM+LLAYE P + PMFHL+ L+YRQ+V 
Sbjct  61   CSKEWTEALEFAQTKLSPFSVKEQKYMDKIEGFMSLLAYENPVECPMFHLIGLDYRQQVV  120

Query  575  DSLNRAILAHANLPSYSAVERLIQQITVVRQSLSQE  468
            DSLN+ ILAH NLP ++A+ERLIQQ +VVRQ LSQE
Sbjct  121  DSLNQTILAHFNLPIHTAMERLIQQTSVVRQCLSQE  156



>gb|ACN25413.1| unknown [Zea mays]
 gb|AFW84921.1| hypothetical protein ZEAMMB73_836179 [Zea mays]
Length=137

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  827  LAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVEKLEDFMAL  648
            +AP+LLE + DLHFDLLSLHF+ELV ++K TEAL+F Q KL  F KV  Y+EKLEDFMAL
Sbjct  1    MAPNLLENDMDLHFDLLSLHFIELVRSKKFTEALDFGQKKLTSFQKVTKYIEKLEDFMAL  60

Query  647  LAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITVVRQSLSQE  468
            LAYEEPEKSPMFHLLS E+RQ VA+ LNRA+LAHANLP+YS++ER++QQ TVVRQ L QE
Sbjct  61   LAYEEPEKSPMFHLLSPEHRQNVAEGLNRAVLAHANLPAYSSLERVVQQATVVRQYLQQE  120

Query  467  PGKEGNLPFSLKDFL  423
             GK+   PFSLK FL
Sbjct  121  VGKDSYPPFSLKAFL  135



>gb|KHN01740.1| UPF0559 protein, partial [Glycine soja]
Length=152

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 122/154 (79%), Gaps = 4/154 (3%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +++ D +NI+LSYL+HNC+K++ +SFI+ TGMKQP   LE+MEKRKRIF+ TLEGNVLKA
Sbjct  2     INEKDANNIILSYLIHNCYKESSKSFISCTGMKQPADHLENMEKRKRIFHHTLEGNVLKA  61

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             IE   Q   D+LE N DL FDLLSLHFV+LVC++   E+LEFA TKL+ F  K Q Y+EK
Sbjct  62    IELKGQPTQDILENNNDLLFDLLSLHFVDLVCSK---ESLEFAHTKLSLFSVKEQKYMEK  118

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSL  567
             +E FM+LLAYE P + PMFHL+ L+YRQ+V DSL
Sbjct  119   IEGFMSLLAYENPVECPMFHLIGLDYRQQVVDSL  152



>ref|XP_006601705.1| PREDICTED: glucose-induced degradation protein 8 homolog [Glycine 
max]
Length=140

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +++ DV+NI+LSYL+HNC+K++ ESFI+ TGMKQP   LE+MEKRKRIF+  LEGNV
Sbjct  17    AMAINEKDVNNIILSYLIHNCYKESSESFISCTGMKQPADHLENMEKRKRIFHHALEGNV  76

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPF  696
             LKAIE T +LA D+LE N DL FDLLSLHFV+LVC+++  EALEFAQ KL+PF
Sbjct  77    LKAIELTGKLAQDILENNNDLLFDLLSLHFVDLVCSKEWAEALEFAQIKLSPF  129



>ref|XP_004336902.1| RanBPMrelated, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR14889.1| RanBPMrelated, putative [Acanthamoeba castellanii str. Neff]
Length=229

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 119/200 (60%), Gaps = 2/200 (1%)
 Frame = -3

Query  1043  QYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLE-DMEKRKRIFNFTL  867
             + E ++V+  DV  +VL+YL+H+C+ DT ++FI +  + +    L   +++RK I +   
Sbjct  9     EIEAVEVNPYDVRVLVLNYLLHHCYVDTAQAFIEACNLHEEGKMLRVAVQQRKDIVDLVR  68

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              G + +AI+      P LL+K+ ++ F LL   F+EL+  RK  EAL FAQ + +P  K 
Sbjct  69    GGAIDEAIKLIRSAFPQLLDKHPEVRFKLLCQRFIELIRQRKKEEALLFAQKEWSPHAKD  128

Query  686   Q-SYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERL  510
               S +++L+D  AL+AYE+PE SP+   ++ +Y+ ++A  +N AIL H  L   +A+E +
Sbjct  129   DPSLLDELQDVFALIAYEDPETSPVCQYMAEDYKDQIALRVNSAILEHHGLAGEAALEVV  188

Query  509   IQQITVVRQSLSQEPGKEGN  450
             ++ +  +RQ +++     G 
Sbjct  189   LRHLAALRQVMAEGRRASGG  208



>ref|NP_001156193.1| uncharacterized protein LOC100164604 [Acyrthosiphon pisum]
 dbj|BAH71477.1| ACYPI005600 [Acyrthosiphon pisum]
Length=230

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 97/172 (56%), Gaps = 2/172 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             E + V+  D++ ++++YLV   FK+  E F    G+  P   L  +  R ++      G 
Sbjct  21    ENMKVNRKDMNKLIMNYLVSEGFKEAAEKFEQEAGISSP-LKLNTLGNRIKVIESVQSGK  79

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQ-S  681
             + +AI    QL P LL+ ++DL+F L  LH +EL+      EAL FAQ KL+  G+   +
Sbjct  80    MQEAITLINQLYPGLLDDDRDLYFHLQQLHLIELIKEGNIEEALVFAQAKLSEVGEGNPT  139

Query  680   YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
              + +LE  +ALLA+EEP+KSP   LL   +RQKV+  LN AIL   N P+ +
Sbjct  140   ILTELERTLALLAFEEPQKSPFADLLQTTHRQKVSSELNAAILRFHNQPTIT  191



>ref|XP_001851089.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS33035.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=228

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 94/155 (61%), Gaps = 2/155 (1%)
 Frame = -3

Query  1013  DVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQT  834
             D++ ++++YLV   FK+  E F A +G+ +P   L  ++ R  I      G V +A+ Q 
Sbjct  28    DINKLIMNYLVTEGFKEAAEKFQAESGV-EPSVDLSSLDNRILIREAVQNGRVQEAVRQV  86

Query  833   EQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYV-EKLEDF  657
              QL P+LL+ ++ L+F L  LH +EL+   K  +AL FAQT+++  G+    V  +LE  
Sbjct  87    NQLHPELLDNDRYLYFHLQQLHLIELIRAGKIEDALTFAQTQISEAGESNPEVLNELERT  146

Query  656   MALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +ALLA+E+P+KSP   LL   +RQKVA  LN AIL
Sbjct  147   LALLAFEQPQKSPFADLLDQTHRQKVASELNAAIL  181



>gb|EFW45236.2| hypothetical protein CAOG_03242 [Capsaspora owczarzaki ATCC 30864]
Length=254

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 96/167 (57%), Gaps = 2/167 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             +++ VS S ++ +V++YLV   +KD  E F +  G + P   L  +E R  I      G 
Sbjct  21    DSVSVSKSSLNRLVMNYLVIEGYKDAAERFASECG-ETPTVDLSSIEDRMCIRTAVQRGA  79

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQ-S  681
             + +AIE    L PD+L+ N  L F L     +EL+   +  EAL FAQ++LAP G+ Q  
Sbjct  80    IEEAIELVNDLNPDILDTNPKLCFQLQLQRLIELIRAGQIDEALAFAQSELAPRGEEQPQ  139

Query  680   YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHAN  540
             ++E+LE  +ALLA++    SP+ HLL L  RQK A +LN AILA  N
Sbjct  140   FLEELEKALALLAFDNQRTSPVGHLLDLAQRQKTASALNAAILASQN  186



>ref|XP_004364081.1| pg4 [Capsaspora owczarzaki ATCC 30864]
Length=242

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 96/167 (57%), Gaps = 2/167 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             +++ VS S ++ +V++YLV   +KD  E F +  G + P   L  +E R  I      G 
Sbjct  3     DSVSVSKSSLNRLVMNYLVIEGYKDAAERFASECG-ETPTVDLSSIEDRMCIRTAVQRGA  61

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQ-S  681
             + +AIE    L PD+L+ N  L F L     +EL+   +  EAL FAQ++LAP G+ Q  
Sbjct  62    IEEAIELVNDLNPDILDTNPKLCFQLQLQRLIELIRAGQIDEALAFAQSELAPRGEEQPQ  121

Query  680   YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHAN  540
             ++E+LE  +ALLA++    SP+ HLL L  RQK A +LN AILA  N
Sbjct  122   FLEELEKALALLAFDNQRTSPVGHLLDLAQRQKTASALNAAILASQN  168



>ref|XP_008554198.1| PREDICTED: glucose-induced degradation protein 8 homolog [Microplitis 
demolitor]
Length=225

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+  P   L  M+ R RI +    G + +A +   
Sbjct  25    MNNLIMNYLVTEGFKEAAEKFQQESGVG-PTIELNSMDDRIRIRDAVQNGRIQEATDLVN  83

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYV-EKLEDFM  654
             QL P+LL+ ++ L+F L  LH +EL+ T +  EAL+FAQ +L+  G+    +  +LE  +
Sbjct  84    QLHPELLDNDRYLYFHLQQLHLIELIRTGRIEEALQFAQEQLSEAGESDDNILSELERTL  143

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             ALLA+EEP+KSP   LL   +RQK+A  LN AIL
Sbjct  144   ALLAFEEPQKSPFSDLLHPSHRQKIASELNTAIL  177



>ref|XP_004282390.1| PREDICTED: glucose-induced degradation protein 8 homolog [Orcinus 
orca]
 ref|XP_004310764.1| PREDICTED: glucose-induced degradation protein 8 homolog [Tursiops 
truncatus]
 ref|XP_007111998.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Physeter catodon]
 ref|XP_007111999.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Physeter catodon]
 ref|XP_007185267.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Balaenoptera acutorostrata scammoni]
 ref|XP_007185268.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Balaenoptera acutorostrata scammoni]
 ref|XP_007462314.1| PREDICTED: glucose-induced degradation protein 8 homolog [Lipotes 
vexillifer]
Length=228

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    LEG + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILEGQIPEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALVNSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEDSPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_006176492.1| PREDICTED: glucose-induced degradation protein 8 homolog [Camelus 
ferus]
 ref|XP_006209732.1| PREDICTED: glucose-induced degradation protein 8 homolog [Vicugna 
pacos]
 ref|XP_010952650.1| PREDICTED: glucose-induced degradation protein 8 homolog [Camelus 
bactrianus]
 ref|XP_010986163.1| PREDICTED: glucose-induced degradation protein 8 homolog [Camelus 
dromedarius]
Length=228

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRHLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_006896939.1| PREDICTED: glucose-induced degradation protein 8 homolog [Elephantulus 
edwardii]
Length=228

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R RI    L+G +  A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIRIREMILKGQIQGA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDSPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_007952871.1| PREDICTED: glucose-induced degradation protein 8 homolog [Orycteropus 
afer afer]
Length=228

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R RI    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIRIREMLLKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDSPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|NP_001171768.1| uncharacterized protein LOC100376325 [Saccoglossus kowalevskii]
Length=228

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 103/181 (57%), Gaps = 6/181 (3%)
 Frame = -3

Query  1058  DVDPRQY----ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKR  891
             DVDP ++     T+ ++ +D++ +++ YLV   FK+  E F   +G+ QP   L+ +++R
Sbjct  9     DVDPDEWMEKLHTLHITRADMNRLIMDYLVTEGFKEAAEKFKIESGI-QPSVDLDTLDER  67

Query  890   KRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQT  711
              +I +    G +  AI     L P+LL+ ++ L+F L   H +EL+  ++  +ALE+AQ 
Sbjct  68    IQIRDAIQNGRIEDAIALVNDLHPELLDNDRYLYFHLQQQHLIELIRNKRIEQALEYAQI  127

Query  710   KLAPFGKVQSYV-EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLP  534
              LA  G+  S V  +LE  +ALLA+E PE SP   LL    RQKVA  LN AIL   N  
Sbjct  128   HLAERGEENSDVLPELERTLALLAFENPESSPFAELLHPSQRQKVASELNAAILEMENRE  187

Query  533   S  531
             S
Sbjct  188   S  188



>ref|XP_007553622.1| PREDICTED: glucose-induced degradation protein 8 homolog [Poecilia 
formosa]
Length=229

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ ++KR +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDKRIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_010888939.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Esox lucius]
Length=231

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  24    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  82

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  83    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESREC  142

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA+E PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   LSEMERTLALLAFENPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  191



>ref|XP_007520376.1| PREDICTED: glucose-induced degradation protein 8 homolog [Erinaceus 
europaeus]
Length=228

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_001493635.1| PREDICTED: glucose-induced degradation protein 8 homolog [Equus 
caballus]
 ref|XP_008527399.1| PREDICTED: glucose-induced degradation protein 8 homolog [Equus 
przewalskii]
Length=228

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_004370245.1| PREDICTED: glucose-induced degradation protein 8 homolog [Trichechus 
manatus latirostris]
Length=228

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGV-EPSVDLETLDERIKIREMVLKGRIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I +   L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IARINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL+   RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDSPEESPFGDLLNTMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_004430262.1| PREDICTED: glucose-induced degradation protein 8 homolog [Ceratotherium 
simum simum]
Length=228

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|NP_001007872.1| glucose-induced degradation protein 8 homolog [Gallus gallus]
 ref|XP_003212075.1| PREDICTED: glucose-induced degradation protein 8 homolog [Meleagris 
gallopavo]
 sp|Q5ZKQ7.1|GID8_CHICK RecName: Full=Glucose-induced degradation protein 8 homolog [Gallus 
gallus]
 emb|CAG31686.1| hypothetical protein RCJMB04_9k15 [Gallus gallus]
Length=228

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    ISLINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_004484048.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
1 [Dasypus novemcinctus]
 ref|XP_004484049.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
2 [Dasypus novemcinctus]
Length=228

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_004716101.1| PREDICTED: glucose-induced degradation protein 8 homolog [Echinops 
telfairi]
Length=228

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRLESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDSPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_005146842.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Melopsittacus undulatus]
 ref|XP_009966248.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Tyto alba]
 gb|KFV52310.1| Glucose-induced degradation protein 8 [Tyto alba]
Length=228

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>gb|ELT94445.1| hypothetical protein CAPTEDRAFT_153259 [Capitella teleta]
Length=228

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 108/187 (58%), Gaps = 2/187 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
             ++ ++ +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I     +GN+
Sbjct  21    SLHITRADMNRLIMNYLVTEGFKEAAEKFRTESGV-EPLVDLDTLDERIKIREAIQQGNI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     + P+LL+ N+ L F L   H +EL+  ++  +ALEFAQ+ LA  G + Q  
Sbjct  80    QEAISLVNDIHPELLDNNRYLFFHLQQQHLIELIRHQQVEQALEFAQSHLAEHGEESQDI  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQI  498
             + +LE  MALLA+E PE SP   LL    RQKVA  LN AIL   N      + RL++ +
Sbjct  140   LLELERVMALLAFENPETSPFGELLHPSQRQKVASELNAAILEIENREQTPKLARLLKLL  199

Query  497   TVVRQSL  477
                ++ L
Sbjct  200   MWSQEEL  206



>gb|ELR57596.1| hypothetical protein M91_18932, partial [Bos mutus]
Length=229

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  25    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  83

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  84    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  143

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE SP   LL++  RQKV   +N+A+L + N  S
Sbjct  144   MERTLALLAFDNPEDSPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|NP_001032676.1| glucose-induced degradation protein 8 homolog [Bos taurus]
 ref|XP_004014463.1| PREDICTED: glucose-induced degradation protein 8 homolog [Ovis 
aries]
 ref|XP_005214613.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Bos taurus]
 ref|XP_005701448.1| PREDICTED: glucose-induced degradation protein 8 homolog [Capra 
hircus]
 ref|XP_005885633.1| PREDICTED: glucose-induced degradation protein 8 homolog [Myotis 
brandtii]
 ref|XP_005894049.1| PREDICTED: glucose-induced degradation protein 8 homolog [Bos 
mutus]
 ref|XP_005971067.1| PREDICTED: glucose-induced degradation protein 8 homolog [Pantholops 
hodgsonii]
 ref|XP_006106724.1| PREDICTED: glucose-induced degradation protein 8 homolog [Myotis 
lucifugus]
 ref|XP_006769598.1| PREDICTED: glucose-induced degradation protein 8 homolog [Myotis 
davidii]
 ref|XP_006068913.1| PREDICTED: glucose-induced degradation protein 8 homolog [Bubalus 
bubalis]
 ref|XP_008155334.1| PREDICTED: glucose-induced degradation protein 8 homolog [Eptesicus 
fuscus]
 ref|XP_010834888.1| PREDICTED: glucose-induced degradation protein 8 homolog [Bison 
bison bison]
 sp|Q32L52.1|GID8_BOVIN RecName: Full=Glucose-induced degradation protein 8 homolog [Bos 
taurus]
 gb|AAI09763.1| Chromosome 20 open reading frame 11 ortholog [Bos taurus]
 tpg|DAA23167.1| TPA: protein C20orf11 homolog [Bos taurus]
 gb|ELK25841.1| hypothetical protein MDA_GLEAN10009553 [Myotis davidii]
 gb|EPQ19813.1| Protein like protein [Myotis brandtii]
Length=228

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEDSPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_003421815.1| PREDICTED: glucose-induced degradation protein 8 homolog [Loxodonta 
africana]
 ref|XP_010599447.1| PREDICTED: glucose-induced degradation protein 8 homolog [Loxodonta 
africana]
Length=228

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDSPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_001368152.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Monodelphis domestica]
 ref|XP_001505440.1| PREDICTED: glucose-induced degradation protein 8 homolog [Ornithorhynchus 
anatinus]
 ref|XP_002198589.1| PREDICTED: glucose-induced degradation protein 8 homolog [Taeniopygia 
guttata]
 ref|XP_003220750.1| PREDICTED: glucose-induced degradation protein 8 homolog [Anolis 
carolinensis]
 ref|XP_003757662.1| PREDICTED: protein C20orf11 homolog [Sarcophilus harrisii]
 ref|XP_005025839.1| PREDICTED: glucose-induced degradation protein 8 homolog [Anas 
platyrhynchos]
 ref|XP_005057383.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Ficedula albicollis]
 ref|XP_005057384.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Ficedula albicollis]
 ref|XP_005057385.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Ficedula albicollis]
 ref|XP_005239916.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Falco peregrinus]
 ref|XP_005302948.1| PREDICTED: glucose-induced degradation protein 8 homolog [Chrysemys 
picta bellii]
 ref|XP_005444939.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Falco cherrug]
 ref|XP_005489139.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Zonotrichia albicollis]
 ref|XP_005489140.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Zonotrichia albicollis]
 ref|XP_005422208.1| PREDICTED: glucose-induced degradation protein 8 homolog [Geospiza 
fortis]
 ref|XP_005524864.1| PREDICTED: glucose-induced degradation protein 8 homolog [Pseudopodoces 
humilis]
 ref|XP_005499642.1| PREDICTED: glucose-induced degradation protein 8 homolog [Columba 
livia]
 ref|XP_006021697.1| PREDICTED: glucose-induced degradation protein 8 homolog [Alligator 
sinensis]
 ref|XP_006126251.1| PREDICTED: glucose-induced degradation protein 8 homolog [Pelodiscus 
sinensis]
 ref|XP_006258927.1| PREDICTED: glucose-induced degradation protein 8 homolog [Alligator 
mississippiensis]
 ref|XP_007059869.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Chelonia mydas]
 ref|XP_007437149.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Python bivittatus]
 ref|XP_007437150.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Python bivittatus]
 ref|XP_008108384.1| PREDICTED: glucose-induced degradation protein 8 homolog [Anolis 
carolinensis]
 ref|XP_008496029.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Calypte anna]
 ref|XP_008632901.1| PREDICTED: glucose-induced degradation protein 8 homolog [Corvus 
brachyrhynchos]
 ref|XP_008931056.1| PREDICTED: glucose-induced degradation protein 8 homolog [Manacus 
vitellinus]
 ref|XP_009076389.1| PREDICTED: glucose-induced degradation protein 8 homolog [Acanthisitta 
chloris]
 ref|XP_009091361.1| PREDICTED: glucose-induced degradation protein 8 homolog [Serinus 
canaria]
 ref|XP_009272181.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Aptenodytes forsteri]
 ref|XP_009272182.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Aptenodytes forsteri]
 ref|XP_009325081.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Pygoscelis adeliae]
 ref|XP_009325082.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Pygoscelis adeliae]
 ref|XP_009484442.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Pelecanus crispus]
 ref|XP_009459871.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Nipponia nippon]
 ref|XP_009507053.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Phalacrocorax carbo]
 ref|XP_009561356.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Cuculus canorus]
 ref|XP_009583086.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Fulmarus glacialis]
 ref|XP_009669116.1| PREDICTED: glucose-induced degradation protein 8 homolog [Struthio 
camelus australis]
 ref|XP_009641991.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Egretta garzetta]
 ref|XP_009807422.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Gavia stellata]
 ref|XP_009708274.1| PREDICTED: glucose-induced degradation protein 8 homolog [Cariama 
cristata]
 ref|XP_009867590.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Apaloderma vittatum]
 ref|XP_009908256.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Picoides pubescens]
 ref|XP_009891749.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Charadrius vociferus]
 ref|XP_009926477.1| PREDICTED: glucose-induced degradation protein 8 homolog [Haliaeetus 
albicilla]
 ref|XP_009926478.1| PREDICTED: glucose-induced degradation protein 8 homolog [Haliaeetus 
albicilla]
 ref|XP_009932169.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Opisthocomus hoazin]
 ref|XP_009959952.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Leptosomus discolor]
 ref|XP_010014946.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Nestor notabilis]
 ref|XP_009990161.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Tauraco erythrolophus]
 ref|XP_009996916.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Chaetura pelagica]
 ref|XP_010133043.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Buceros rhinoceros silvestris]
 ref|XP_010157713.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Eurypyga helias]
 ref|XP_010173610.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Caprimulgus carolinensis]
 ref|XP_010075928.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Pterocles gutturalis]
 ref|XP_010187670.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Mesitornis unicolor]
 ref|XP_010113811.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Chlamydotis macqueenii]
 ref|XP_010201673.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Colius striatus]
 ref|XP_010211132.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Tinamus guttatus]
 ref|XP_010288394.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Phaethon lepturus]
 ref|XP_010305341.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Balearica regulorum gibbericeps]
 ref|XP_010395151.1| PREDICTED: glucose-induced degradation protein 8 homolog [Corvus 
cornix cornix]
 ref|XP_010567832.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Haliaeetus leucocephalus]
 ref|XP_010567833.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Haliaeetus leucocephalus]
 gb|EMC83498.1| Protein C20orf11 like protein [Columba livia]
 gb|EOA96897.1| Protein C20orf11-like protein, partial [Anas platyrhynchos]
 gb|ETE61940.1| Protein C20orf11-like protein [Ophiophagus hannah]
 gb|KFM03916.1| Glucose-induced degradation protein 8 [Aptenodytes forsteri]
 gb|KFO05725.1| Glucose-induced degradation protein 8 [Balearica regulorum gibbericeps]
 gb|KFO53280.1| Glucose-induced degradation protein 8 [Corvus brachyrhynchos]
 gb|KFO77787.1| Glucose-induced degradation protein 8 [Cuculus canorus]
 gb|KFO83447.1| Glucose-induced degradation protein 8 [Buceros rhinoceros silvestris]
 gb|KFP04037.1| Glucose-induced degradation protein 8 [Calypte anna]
 gb|KFP19980.1| Glucose-induced degradation protein 8 [Egretta garzetta]
 gb|KFP26051.1| Glucose-induced degradation protein 8 [Colius striatus]
 gb|KFP34653.1| Glucose-induced degradation protein 8 [Chlamydotis macqueenii]
 gb|KFP49026.1| Glucose-induced degradation protein 8 [Cathartes aura]
 gb|KFP56223.1| Glucose-induced degradation protein 8 [Cariama cristata]
 gb|KFP70772.1| Glucose-induced degradation protein 8 [Acanthisitta chloris]
 gb|KFP76153.1| Glucose-induced degradation protein 8 [Apaloderma vittatum]
 gb|KFP95431.1| Glucose-induced degradation protein 8 [Haliaeetus albicilla]
 gb|KFQ02364.1| Glucose-induced degradation protein 8 [Leptosomus discolor]
 gb|KFQ24722.1| Glucose-induced degradation protein 8 [Mesitornis unicolor]
 gb|KFQ42859.1| Glucose-induced degradation protein 8 [Nestor notabilis]
 gb|KFQ62856.1| Glucose-induced degradation protein 8 [Pelecanus crispus]
 gb|KFQ64470.1| Glucose-induced degradation protein 8 [Phaethon lepturus]
 gb|KFQ75639.1| Glucose-induced degradation protein 8 [Phoenicopterus ruber ruber]
 gb|KFQ94317.1| Glucose-induced degradation protein 8 [Nipponia nippon]
 gb|KFR10168.1| Glucose-induced degradation protein 8 [Opisthocomus hoazin]
 gb|KFU90362.1| Protein C20orf11 [Chaetura pelagica]
 gb|KFU98858.1| Glucose-induced degradation protein 8 [Tauraco erythrolophus]
 gb|KFU99111.1| Glucose-induced degradation protein 8 [Pterocles gutturalis]
 gb|KFV41655.1| Glucose-induced degradation protein 8 [Gavia stellata]
 gb|KFV62523.1| Glucose-induced degradation protein 8 [Picoides pubescens]
 gb|KFV72891.1| Glucose-induced degradation protein 8 [Struthio camelus australis]
 gb|KFV90317.1| Glucose-induced degradation protein 8 [Eurypyga helias]
 gb|KFV95464.1| Glucose-induced degradation protein 8 [Fulmarus glacialis]
 gb|KFW69092.1| Glucose-induced degradation protein 8 [Pygoscelis adeliae]
 gb|KFW75506.1| Glucose-induced degradation protein 8 [Manacus vitellinus]
 gb|KFW77058.1| Glucose-induced degradation protein 8 [Phalacrocorax carbo]
 gb|KFZ45585.1| Glucose-induced degradation protein 8 [Caprimulgus carolinensis]
 gb|KFZ53809.1| Glucose-induced degradation protein 8 [Podiceps cristatus]
 gb|KGL76024.1| Glucose-induced degradation protein 8 [Tinamus guttatus]
 gb|KGM00051.1| Glucose-induced degradation protein 8 [Charadrius vociferus]
Length=228

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_006873417.1| PREDICTED: glucose-induced degradation protein 8 homolog [Chrysochloris 
asiatica]
Length=228

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDSPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_007475638.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Monodelphis domestica]
Length=241

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  34    NLHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQI  92

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  93    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  152

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  153   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  201



>ref|XP_008067745.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Tarsius syrichta]
Length=228

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL +  RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDSPEESPFGDLLHMMQRQKVWSEVNQAVLDYENRES  188



>ref|NP_942038.1| glucose-induced degradation protein 8 homolog [Rattus norvegicus]
 ref|NP_083883.1| glucose-induced degradation protein 8 homolog [Mus musculus]
 ref|NP_001276581.1| glucose-induced degradation protein 8 homolog [Mus musculus]
 ref|NP_001276580.1| glucose-induced degradation protein 8 homolog [Mus musculus]
 ref|XP_003462858.1| PREDICTED: glucose-induced degradation protein 8 homolog [Cavia 
porcellus]
 ref|XP_003787814.1| PREDICTED: protein C20orf11 homolog [Otolemur garnettii]
 ref|XP_004908205.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Heterocephalus glaber]
 ref|XP_004908206.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Heterocephalus glaber]
 ref|XP_004841094.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Heterocephalus glaber]
 ref|XP_004841095.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Heterocephalus glaber]
 ref|XP_004841096.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Heterocephalus glaber]
 ref|XP_005362795.1| PREDICTED: glucose-induced degradation protein 8 homolog [Microtus 
ochrogaster]
 ref|XP_005325372.1| PREDICTED: glucose-induced degradation protein 8 homolog [Ictidomys 
tridecemlineatus]
 ref|XP_005410059.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Chinchilla lanigera]
 ref|XP_005410060.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Chinchilla lanigera]
 ref|XP_005410061.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Chinchilla lanigera]
 ref|XP_005410062.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X4 [Chinchilla lanigera]
 ref|XP_006976127.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Peromyscus maniculatus bairdii]
 ref|XP_006976128.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Peromyscus maniculatus bairdii]
 ref|XP_010636213.1| PREDICTED: glucose-induced degradation protein 8 homolog [Fukomys 
damarensis]
 ref|XP_010636222.1| PREDICTED: glucose-induced degradation protein 8 homolog [Fukomys 
damarensis]
 ref|XP_010636232.1| PREDICTED: glucose-induced degradation protein 8 homolog [Fukomys 
damarensis]
 sp|Q9D7M1.1|GID8_MOUSE RecName: Full=Glucose-induced degradation protein 8 homolog; 
AltName: Full=Two hybrid-associated protein 1 with RanBPM; Short=Twa1 
[Mus musculus]
 dbj|BAB26074.1| unnamed protein product [Mus musculus]
 gb|AAO18337.1| BWK-1 [Rattus norvegicus]
 gb|AAH59022.1| RIKEN cDNA 2310003C23 gene [Mus musculus]
 gb|EDL07349.1| RIKEN cDNA 2310003C23, isoform CRA_a [Mus musculus]
 gb|EDL07350.1| RIKEN cDNA 2310003C23, isoform CRA_a [Mus musculus]
 gb|EDL88791.1| Bwk1 leukemia-related gene, isoform CRA_b [Rattus norvegicus]
 gb|EDL88792.1| Bwk1 leukemia-related gene, isoform CRA_b [Rattus norvegicus]
 gb|EHB17801.1| hypothetical protein GW7_09740 [Heterocephalus glaber]
Length=228

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL +  RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDSPEESPFGDLLHMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_003503169.1| PREDICTED: glucose-induced degradation protein 8 homolog [Cricetulus 
griseus]
 ref|XP_004669554.1| PREDICTED: glucose-induced degradation protein 8 homolog [Jaculus 
jaculus]
 ref|XP_007608695.1| PREDICTED: glucose-induced degradation protein 8 homolog [Cricetulus 
griseus]
 ref|XP_008841474.1| PREDICTED: glucose-induced degradation protein 8 homolog [Nannospalax 
galili]
 gb|EGW11063.1| Protein C20orf11-like [Cricetulus griseus]
 gb|ERE70678.1| putative protein C20orf11 like protein [Cricetulus griseus]
Length=228

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL +  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDSPEESPFGDLLHMMQRQKVWSEVNQAVLDYENRES  188



>ref|NP_001090234.1| uncharacterized protein LOC779137 [Xenopus laevis]
 ref|XP_002944197.1| PREDICTED: glucose-induced degradation protein 8 homolog [Xenopus 
(Silurana) tropicalis]
 gb|AAH77481.1| MGC82520 protein [Xenopus laevis]
Length=228

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLESLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE SP   LL++  RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDNPEDSPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_004760063.1| PREDICTED: glucose-induced degradation protein 8 homolog [Mustela 
putorius furo]
 ref|XP_004785915.1| PREDICTED: glucose-induced degradation protein 8 homolog [Mustela 
putorius furo]
Length=228

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL +  RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDNPEESPFGDLLHMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_006676027.1| hypothetical protein BATDEDRAFT_85821 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83232.1| hypothetical protein BATDEDRAFT_85821 [Batrachochytrium dendrobatidis 
JAM81]
Length=251

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 93/162 (57%), Gaps = 2/162 (1%)
 Frame = -3

Query  1031  IDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVL  852
             +  S +D++ +V++YLV   +KD  E F   +G+  P   L  +E R  I N    GN+ 
Sbjct  42    VKSSKNDLNRLVMNYLVIEGYKDAAEKFSVESGLA-PAVDLMTVEDRMNIRNDIQNGNIE  100

Query  851   KAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQ-SYV  675
              AIE+   L P++L+ N  L F L     +EL+   K TEA+EFAQ +LAP G+    ++
Sbjct  101   AAIERVNDLDPEILDTNPKLFFHLQQQKLIELIRNNKITEAIEFAQEELAPRGEENPEFL  160

Query  674   EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILA  549
              +LE  MALLA+E+  KSP+  LL+   RQK A  LN AIL 
Sbjct  161   NELERTMALLAFEDTYKSPVGDLLNHSQRQKTASELNAAILT  202



>ref|XP_545179.2| PREDICTED: glucose-induced degradation protein 8 homolog isoformX1 
[Canis lupus familiaris]
 ref|XP_002925778.1| PREDICTED: protein C20orf11 homolog [Ailuropoda melanoleuca]
 ref|XP_003983347.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Felis catus]
 ref|XP_004410189.1| PREDICTED: glucose-induced degradation protein 8 homolog [Odobenus 
rosmarus divergens]
 ref|XP_005635330.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Canis lupus familiaris]
 ref|XP_005635331.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Canis lupus familiaris]
 ref|XP_005635332.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X4 [Canis lupus familiaris]
 ref|XP_006751630.1| PREDICTED: glucose-induced degradation protein 8 homolog [Leptonychotes 
weddellii]
 ref|XP_006929653.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Felis catus]
 ref|XP_007087080.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Panthera tigris altaica]
 ref|XP_007087081.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Panthera tigris altaica]
 ref|XP_008686391.1| PREDICTED: glucose-induced degradation protein 8 homolog [Ursus 
maritimus]
 ref|XP_008686392.1| PREDICTED: glucose-induced degradation protein 8 homolog [Ursus 
maritimus]
 gb|EFB27920.1| hypothetical protein PANDA_015329 [Ailuropoda melanoleuca]
Length=228

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL +  RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDNPEESPFGDLLHMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_002108684.1| hypothetical protein TRIADDRAFT_20201 [Trichoplax adhaerens]
 gb|EDV29482.1| hypothetical protein TRIADDRAFT_20201 [Trichoplax adhaerens]
Length=209

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 104/192 (54%), Gaps = 1/192 (1%)
 Frame = -3

Query  1031  IDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVL  852
             ++V   D++ ++++Y V   +K+  E F   +G   P    + +EKR +I N   +G++ 
Sbjct  1     MEVQRGDLNRLIMNYFVTEGYKEAAEKFQIESGTPIPILSSDSLEKRMKITNAVHDGDIS  60

Query  851   KAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYV  675
              AI     + PD+L+ N  L+F L     +EL+  +    AL+FAQT LA  G +   ++
Sbjct  61    TAIYLVNAVYPDILDSNPQLYFHLQQQKLIELIRKKDIETALDFAQTHLADRGIENPQFL  120

Query  674   EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQIT  495
             E+LE  MALLA+EEPE S    LL+   RQKVA  LN AIL   +  S + V  LI+ + 
Sbjct  121   EELERTMALLAFEEPESSSFSDLLNSSQRQKVASELNAAILEEEDCNSSTKVAELIKLLV  180

Query  494   VVRQSLSQEPGK  459
               ++ L +   K
Sbjct  181   WSQRELDKSKVK  192



>ref|XP_006922026.1| PREDICTED: LOW QUALITY PROTEIN: glucose-induced degradation protein 
8 homolog [Pteropus alecto]
Length=228

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMLLKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP    LS+  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEESPFGDXLSMMQRQKVWSEVNQAVLDYENRES  188



>gb|EDL07351.1| RIKEN cDNA 2310003C23, isoform CRA_b [Mus musculus]
Length=230

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  26    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  84

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  85    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  144

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL +  RQKV   +N+A+L + N  S
Sbjct  145   MERTLALLAFDSPEESPFGDLLHMMQRQKVWSEVNQAVLDYENRES  190



>ref|NP_001086830.1| MGC83062 protein [Xenopus laevis]
 gb|AAH77519.1| MGC83062 protein [Xenopus laevis]
Length=228

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLESLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE SP   LL++  RQKV   +N++IL + N  S
Sbjct  140   LTEMERTLALLAFDNPEDSPFGDLLNMMQRQKVWSEVNQSILDYENRES  188



>ref|XP_004070905.1| PREDICTED: glucose-induced degradation protein 8 homolog [Oryzias 
latipes]
Length=229

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_003438969.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Oreochromis niloticus]
 ref|XP_004546457.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Maylandia zebra]
 ref|XP_004546458.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Maylandia zebra]
 ref|XP_005448541.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Oreochromis niloticus]
 ref|XP_005731664.1| PREDICTED: glucose-induced degradation protein 8 homolog [Pundamilia 
nyererei]
 ref|XP_005930717.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Haplochromis burtoni]
 ref|XP_005930718.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Haplochromis burtoni]
 ref|XP_006794178.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Neolamprologus brichardi]
 ref|XP_006794179.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Neolamprologus brichardi]
 ref|XP_008276187.1| PREDICTED: glucose-induced degradation protein 8 homolog [Stegastes 
partitus]
 ref|XP_010752895.1| PREDICTED: glucose-induced degradation protein 8 homolog [Larimichthys 
crocea]
Length=229

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_005798945.1| PREDICTED: glucose-induced degradation protein 8 homolog [Xiphophorus 
maculatus]
 ref|XP_008412616.1| PREDICTED: glucose-induced degradation protein 8 homolog [Poecilia 
reticulata]
Length=229

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_009272180.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Aptenodytes forsteri]
Length=269

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_002666524.1| PREDICTED: glucose-induced degradation protein 8 homolog [Danio 
rerio]
Length=229

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMVLKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_008578028.1| PREDICTED: glucose-induced degradation protein 8 homolog [Galeopterus 
variegatus]
Length=228

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGRI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +A+     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAVALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL +  RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDSPEESPFGDLLHMMQRQKVWSEVNQAVLDYENRES  188



>emb|CAG03914.1| unnamed protein product [Tetraodon nigroviridis]
Length=229

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDTLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_009325080.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Pygoscelis adeliae]
Length=269

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|NP_957006.1| glucose-induced degradation protein 8 homolog [Danio rerio]
 sp|Q6PC55.1|GID8_DANRE RecName: Full=Glucose-induced degradation protein 8 homolog [Danio 
rerio]
 gb|AAH59468.1| Zgc:73100 [Danio rerio]
Length=228

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 104/169 (62%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P+  L+ +++R +I    L+G +
Sbjct  21    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPNVDLDSLDERIKIREMVLKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQ++LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQSQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_001600429.1| PREDICTED: glucose-induced degradation protein 8 homolog [Nasonia 
vitripennis]
 ref|XP_008212013.1| PREDICTED: glucose-induced degradation protein 8 homolog [Nasonia 
vitripennis]
 ref|XP_008212014.1| PREDICTED: glucose-induced degradation protein 8 homolog [Nasonia 
vitripennis]
 ref|XP_008212015.1| PREDICTED: glucose-induced degradation protein 8 homolog [Nasonia 
vitripennis]
Length=230

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 95/154 (62%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+  P   L  ++ R RI +    G + +A +   
Sbjct  30    MNNLIMNYLVTEGFKEAAEKFQQESGVG-PTVELNSLDDRIRIRDAIQNGRIEEAKDLVN  88

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV-QSYVEKLEDFM  654
             QL P+LL+ ++ LHF L  LH +EL+ T +  EAL+FAQ +L+  G+  ++ + +LE  +
Sbjct  89    QLHPELLDNDRYLHFHLQQLHLIELIRTGRIEEALQFAQEQLSEAGESDENILSELERTL  148

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             ALLA++EP KSP   LL   +RQK+A  LN AIL
Sbjct  149   ALLAFDEPHKSPFSDLLHPTHRQKIASELNAAIL  182



>ref|XP_002424638.1| protein C20orf11, putative [Pediculus humanus corporis]
 gb|EEB11900.1| protein C20orf11, putative [Pediculus humanus corporis]
Length=229

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 100/172 (58%), Gaps = 2/172 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             E++ +  SD++ ++++YLV   FK+  E F   +G+  P   L+ +++R +I +    G 
Sbjct  20    ESLHIQRSDINKLIMNYLVTEGFKEAAEKFQQESGIS-PGTALDSLDERIKIRDAIQNGA  78

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQ-S  681
             + +A     +L P+LL+ ++ L+F L  LH +EL+   K  EAL FAQ +L+  G+   +
Sbjct  79    IQEATAMVNELHPELLDSDRYLYFHLQQLHLIELIRANKLEEALHFAQEQLSEAGESDPN  138

Query  680   YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
              + +LE  +ALLA+EEP  SP   LL   +RQK+A  LN AIL   N  S +
Sbjct  139   ALAELERTLALLAFEEPLSSPFSDLLQPSHRQKIASELNAAILKMENRESTT  190



>ref|XP_003289509.1| hypothetical protein DICPUDRAFT_48646 [Dictyostelium purpureum]
 gb|EGC33976.1| hypothetical protein DICPUDRAFT_48646 [Dictyostelium purpureum]
Length=468

 Score =   109 bits (272),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 102/174 (59%), Gaps = 3/174 (2%)
 Frame = -3

Query  1001  IVLSYLVHNCFKDTVESFIASTGM--KQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQ  828
             +VLSYL+H+ + +TV+ F  +TG   +  D  ++D++ R++I     +GNV K I +  +
Sbjct  267   LVLSYLIHHGYSETVKLFAKTTGTDGESIDNQIDDIKNRQKISELLSKGNVEKVINELNR  326

Query  827   LAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQ-SYVEKLEDFMA  651
             + P+ L++ KD+ F LL   F+E++      EA+EF Q +L+ F      Y  +L +  +
Sbjct  327   IYPNFLKERKDILFKLLCQKFIEMIKNSPIEEAMEFGQRELSSFSNDSVEYENQLNEIFS  386

Query  650   LLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITVV  489
             L+AY +P  SP+ HLL    R ++ + LN A+L H N  S   +E++++Q  VV
Sbjct  387   LIAYTDPFSSPIGHLLEKSKRDQIVNDLNCALLVHCNKSSTPVLEKIVKQAKVV  440



>ref|XP_006639657.1| PREDICTED: glucose-induced degradation protein 8 homolog [Lepisosteus 
oculatus]
Length=229

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSIDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEDSPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_008317745.1| PREDICTED: glucose-induced degradation protein 8 homolog [Cynoglossus 
semilaevis]
 ref|XP_008317746.1| PREDICTED: glucose-induced degradation protein 8 homolog [Cynoglossus 
semilaevis]
Length=229

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEDSPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_003779445.1| PREDICTED: LOW QUALITY PROTEIN: glucose-induced degradation protein 
8 homolog [Pongo abelii]
Length=228

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 100/166 (60%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL    RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_003963580.1| PREDICTED: glucose-induced degradation protein 8 homolog [Takifugu 
rubripes]
Length=229

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDTLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
               AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QGAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|NP_060366.1| glucose-induced degradation protein 8 homolog [Homo sapiens]
 ref|NP_001247668.1| glucose-induced degradation protein 8 homolog [Macaca mulatta]
 ref|XP_001147288.1| PREDICTED: glucose-induced degradation protein 8 homolog [Pan 
troglodytes]
 ref|XP_003904563.1| PREDICTED: glucose-induced degradation protein 8 homolog [Papio 
anubis]
 ref|XP_004062553.1| PREDICTED: glucose-induced degradation protein 8 homolog [Gorilla 
gorilla gorilla]
 ref|XP_005569600.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Macaca fascicularis]
 ref|XP_005569601.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Macaca fascicularis]
 ref|XP_008009715.1| PREDICTED: glucose-induced degradation protein 8 homolog [Chlorocebus 
sabaeus]
 ref|XP_008961470.1| PREDICTED: glucose-induced degradation protein 8 homolog [Pan 
paniscus]
 ref|XP_008961471.1| PREDICTED: glucose-induced degradation protein 8 homolog [Pan 
paniscus]
 ref|XP_009435853.1| PREDICTED: glucose-induced degradation protein 8 homolog [Pan 
troglodytes]
 ref|XP_009435855.1| PREDICTED: glucose-induced degradation protein 8 homolog [Pan 
troglodytes]
 ref|XP_010363515.1| PREDICTED: glucose-induced degradation protein 8 homolog [Rhinopithecus 
roxellana]
 ref|XP_010341490.1| PREDICTED: glucose-induced degradation protein 8 homolog [Saimiri 
boliviensis boliviensis]
 sp|Q9NWU2.1|GID8_HUMAN RecName: Full=Glucose-induced degradation protein 8 homolog; 
AltName: Full=Two hybrid-associated protein 1 with RanBPM; Short=Twa1 
[Homo sapiens]
 dbj|BAA91285.1| unnamed protein product [Homo sapiens]
 gb|EAW75318.1| chromosome 20 open reading frame 11, isoform CRA_a [Homo sapiens]
 gb|EAW75319.1| chromosome 20 open reading frame 11, isoform CRA_a [Homo sapiens]
 gb|EHH19526.1| Two hybrid-associated protein 1 with RanBPM [Macaca mulatta]
 gb|EHH65175.1| Two hybrid-associated protein 1 with RanBPM [Macaca fascicularis]
Length=228

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 100/166 (60%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL    RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_003280191.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
1 [Nomascus leucogenys]
 ref|XP_004090095.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
2 [Nomascus leucogenys]
Length=228

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 100/166 (60%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    VQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL    RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRES  188



>gb|AAH32120.1| Chromosome 20 open reading frame 11 [Homo sapiens]
 gb|ADQ32232.1| chromosome 20 open reading frame 11 [synthetic construct]
 gb|AIC56602.1| C20orf11, partial [synthetic construct]
Length=228

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 101/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSLDLETLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL    RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_007250046.1| PREDICTED: glucose-induced degradation protein 8 homolog [Astyanax 
mexicanus]
Length=229

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRLESGI-EPSVDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
               AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QDAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_007231948.1| PREDICTED: glucose-induced degradation protein 8 homolog [Astyanax 
mexicanus]
Length=229

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQ++LA  G + +  
Sbjct  81    QEAISLINSLHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQSQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_001648371.1| hypothetical protein AaeL_AAEL004052 [Aedes aegypti]
 gb|EAT44580.1| AAEL004052-PA [Aedes aegypti]
Length=228

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 93/163 (57%), Gaps = 2/163 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             ET      D++ ++++YLV   FK+  E F A +G+ +P   L  ++ R  I      G 
Sbjct  20    ETFPFKQDDINKLIMNYLVTEGFKEAAEKFQAESGV-EPSVDLSSLDNRILIREAVQNGR  78

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSY  678
             + +A     QL P+LL+ ++ L+F L  LH +EL+   K  EAL FAQT+++  G+    
Sbjct  79    IQEATHLVNQLHPELLDNDRYLYFHLQQLHLIELIRAGKIEEALTFAQTQISEAGESNPE  138

Query  677   V-EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             V  +LE  +ALLA+E+P+ SP   LL   +RQKVA  LN AIL
Sbjct  139   VLNELERTLALLAFEKPQNSPFADLLDQTHRQKVASELNAAIL  181



>ref|XP_004620334.1| PREDICTED: glucose-induced degradation protein 8 homolog [Sorex 
araneus]
Length=200

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G++ +AI    
Sbjct  1     MNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGHIQEAIALVN  59

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFM  654
              L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + ++E  +
Sbjct  60    SLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTEMERTL  119

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  120   ALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  160



>ref|XP_007909350.1| PREDICTED: glucose-induced degradation protein 8 homolog [Callorhinchus 
milii]
Length=228

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 100/166 (60%), Gaps = 2/166 (1%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRVESGI-EPSVDLDTLDERIKIREVILNGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE SP   LL++  RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEDSPFGDLLNMMQRQKVWSEVNQAVLDYENRES  188



>gb|AGM32587.1| CTLH/CRA C-terminal to lisH motif domain containing protein [Coptotermes 
formosanus]
Length=229

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 99/172 (58%), Gaps = 2/172 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             E++ +  +D++ ++++YLV   FK+  E F   +G+  P   L+ ++ R RI +    G 
Sbjct  20    ESLHIQRADMNKLIMNYLVTEGFKEAAEKFQQESGI-SPSMELDSLDDRIRIRDAIQSGR  78

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSY  678
             + +A     QL P+LL+ ++ L+F L  LH +EL+   +  EAL FAQ +L+  G+    
Sbjct  79    IQEATALVNQLHPELLDNDRYLYFHLQQLHLIELIRNGEIEEALHFAQEQLSEAGESDPT  138

Query  677   V-EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             V  +LE  +ALLA+EEP+K P   LL   +RQKVA  LN AIL   N  S +
Sbjct  139   VLNELERTLALLAFEEPKKCPFRDLLHPTHRQKVASELNAAILKMENRESTT  190



>ref|XP_005096701.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Aplysia californica]
 ref|XP_005096702.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Aplysia californica]
 ref|XP_005096703.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Aplysia californica]
 ref|XP_005096704.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X4 [Aplysia californica]
Length=231

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 105/190 (55%), Gaps = 2/190 (1%)
 Frame = -3

Query  1100  SGQTNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP  921
             SG   +  L +   D    +  T  V  +D++ ++++YLV   FK+  E F A +G+  P
Sbjct  6     SGDRGEDRLVKDAKDAWMAELGTQHVGRADMNKLIMNYLVTEGFKEAAEKFSAESGIS-P  64

Query  920   DYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRK  741
                L+ ++ R RI    LEG V++AI     L P+LL+ ++ L+F L     +EL+  ++
Sbjct  65    TVNLDTLDDRIRIREAILEGRVMEAISLINSLYPELLDSDRYLYFRLQQQELIELIKAKE  124

Query  740   CTEALEFAQTKLAP-FGKVQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLN  564
                AL+FAQT+L+    +  + + +LE  +ALLA+++PE SP   LL    RQKVA  +N
Sbjct  125   LESALDFAQTRLSERVEENPNVLPELEKTLALLAFDDPESSPFGELLHPSQRQKVASEVN  184

Query  563   RAILAHANLP  534
              AIL   + P
Sbjct  185   SAILETDSTP  194



>gb|KDR08045.1| Protein C20orf11 [Zootermopsis nevadensis]
Length=229

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 99/172 (58%), Gaps = 2/172 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             E + +  +D++ ++++YLV   FK+  E F   +G+  P   L+ ++ R RI +    G 
Sbjct  20    EGLHIQRADMNKLIMNYLVTEGFKEAAEKFQQESGI-SPSMELDSLDDRIRIRDAIQSGR  78

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSY  678
             + +A     QL P+LL+ ++ L+F L  LH +EL+ + +  EAL FAQ +L+  G+    
Sbjct  79    IQEATALVNQLHPELLDNDRYLYFHLQQLHLIELIRSGEIEEALHFAQEQLSEAGESDPT  138

Query  677   V-EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
             V  +LE  +ALLA+EEP+K P   LL   +RQKVA  LN AIL   N  S +
Sbjct  139   VLNELERTLALLAFEEPKKCPFRDLLHPTHRQKVASELNAAILKMENRESTT  190



>gb|ACM09382.1| C20orf11 homolog [Salmo salar]
Length=229

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 103/169 (61%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G++
Sbjct  22    NVQIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGHI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+  + L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINHLHPELLDTKRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDTPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_003403096.1| PREDICTED: protein C20orf11-like [Bombus terrestris]
Length=230

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+ +P   L  ++ R RI      G + +A +   
Sbjct  30    MNNLIMNYLVTEGFKEAAEKFQQESGV-EPTVDLSSLDDRIRIREAIQNGRIQEATDLVN  88

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE-KLEDFM  654
             QL P+LL+ ++ L+F L  LH +EL+ T K  EAL+FAQ +L+  G+    +  +LE  +
Sbjct  89    QLHPELLDNDRYLYFHLQQLHLIELIRTGKIEEALQFAQDRLSEAGESDDIILCELERTL  148

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             ALLA++EP KSP   LL   +RQK+A  LN AIL
Sbjct  149   ALLAFDEPHKSPYSDLLHPTHRQKIASELNAAIL  182



>ref|XP_006563839.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Apis mellifera]
 ref|XP_006607555.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Apis dorsata]
 ref|XP_006607556.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Apis dorsata]
Length=230

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+ +P   L  ++ R RI      G + +A +   
Sbjct  30    MNNLIMNYLVTEGFKEAAEKFQQESGV-EPTVDLSSLDDRIRIREAIQNGRIQEATDLVN  88

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE-KLEDFM  654
             QL P+LL+ ++ L+F L  LH +EL+ T K  EAL+FAQ +L+  G+    +  +LE  +
Sbjct  89    QLHPELLDNDRYLYFHLQQLHLIELIRTGKIEEALQFAQDRLSEAGESDDVILCELERTL  148

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             ALLA++EP KSP   LL   +RQK+A  LN AIL
Sbjct  149   ALLAFDEPHKSPYSDLLHPTHRQKIASELNAAIL  182



>ref|XP_003489301.1| PREDICTED: protein C20orf11-like [Bombus impatiens]
Length=230

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+ +P   L  ++ R RI      G + +A +   
Sbjct  30    MNNLIMNYLVTEGFKEAAEKFQQESGV-EPTVDLSSLDDRIRIREAIQNGRIQEATDLVN  88

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE-KLEDFM  654
             QL P+LL+ ++ L+F L  LH +EL+ T K  EAL+FAQ +L+  G+    +  +LE  +
Sbjct  89    QLHPELLDNDRYLYFHLQQLHLIELIRTGKIEEALQFAQDRLSEAGESDDIILCELERTL  148

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             ALLA++EP KSP   LL   +RQK+A  LN AIL
Sbjct  149   ALLAFDEPHKSPYSDLLHPTHRQKIASELNAAIL  182



>dbj|GAM23411.1| hypothetical protein SAMD00019534_065860 [Acytostelium subglobosum 
LB1]
Length=445

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 99/170 (58%), Gaps = 3/170 (2%)
 Frame = -3

Query  1001  IVLSYLVHNCFKDTVESFIASTGMKQP--DYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQ  828
             +VL YL+H+ + +TV+ F  +TG      D  L+D++ R+RI    L+G++ K   +  +
Sbjct  245   LVLGYLMHHGYPETVKLFAKATGTNDNNLDLQLDDIKNRQRISELLLKGDIDKVTAELNR  304

Query  827   LAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGK-VQSYVEKLEDFMA  651
             L PD L K +D+ F L    F+E++ +    + + F Q +L  F +  + Y   L +  +
Sbjct  305   LYPDFLNKRRDILFKLHCQKFIEMIKSEPIEDTMAFGQKELYRFAQESEEYESSLREVFS  364

Query  650   LLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQ  501
             L+AY++P  SP+ HLL +E R+ + + LN A+L H N PS   +E++++Q
Sbjct  365   LIAYQDPYTSPVSHLLHIERREPIVNDLNCALLVHCNKPSTPVLEKIVRQ  414



>ref|XP_003694186.1| PREDICTED: protein C20orf11-like [Apis florea]
 ref|XP_006563840.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Apis mellifera]
 ref|XP_006607557.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Apis dorsata]
Length=224

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+ +P   L  ++ R RI      G + +A +   
Sbjct  30    MNNLIMNYLVTEGFKEAAEKFQQESGV-EPTVDLSSLDDRIRIREAIQNGRIQEATDLVN  88

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE-KLEDFM  654
             QL P+LL+ ++ L+F L  LH +EL+ T K  EAL+FAQ +L+  G+    +  +LE  +
Sbjct  89    QLHPELLDNDRYLYFHLQQLHLIELIRTGKIEEALQFAQDRLSEAGESDDVILCELERTL  148

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             ALLA++EP KSP   LL   +RQK+A  LN AIL
Sbjct  149   ALLAFDEPHKSPYSDLLHPTHRQKIASELNAAIL  182



>gb|EFN79548.1| Protein C20orf11 [Harpegnathos saltator]
Length=230

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+  P   L  ++ R RI +    G + +A +   
Sbjct  30    MNNLIMNYLVTEGFKEAAEKFQQESGVG-PTVELSSLDDRIRIRDAIQNGRIQEATDLVN  88

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE-KLEDFM  654
             QL P+LL+ ++ L+F L  LH +EL+ T +  EAL+FAQ KL+  G+    +  +LE  +
Sbjct  89    QLHPELLDNDRYLYFHLQQLHLIELIRTGRIEEALQFAQDKLSEAGESDDNILCELERTL  148

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             ALLA++EP KSP   LL   +RQK+A  LN AIL
Sbjct  149   ALLAFDEPHKSPFSDLLHPTHRQKIASELNAAIL  182



>ref|XP_005183331.1| PREDICTED: glucose-induced degradation protein 8 homolog [Musca 
domestica]
Length=229

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/225 (31%), Positives = 120/225 (53%), Gaps = 13/225 (6%)
 Frame = -3

Query  1097  GQTNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPD  918
             G T ++ + RL         E      +D++ ++++YLV   FK+  E F    G+ +P 
Sbjct  9     GITKEEWMMRL---------EQFPFKQADMNRLIMNYLVTEGFKEAAEKFQVEAGLLEPS  59

Query  917   YCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKC  738
               L  ++ R  I      G + +A +   QL P+LL+ ++ L+F L  L  +EL+   K 
Sbjct  60    VELNSLDDRILIREAIQNGRIQEATQLVNQLHPELLDSDRYLYFHLQQLQLIELIRAGKI  119

Query  737   TEALEFAQTKLAPFGK-VQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNR  561
              EAL FAQT+L+  G+ +   + +LE  +ALLA+E+P++SP  +LL   +RQK+A  LN 
Sbjct  120   EEALSFAQTRLSEAGEDIPEVLCELERTLALLAFEKPQESPFSYLLEQSHRQKIASELNA  179

Query  560   AILAHANLPSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDF  426
             AIL   +  S  +  +++  + ++  + S+   +E N P  +KD 
Sbjct  180   AILKSEH--SADSTPKIMFLLKLIMWAQSKLDAREVNYP-KMKDL  221



>ref|XP_005146843.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Melopsittacus undulatus]
 ref|XP_009966249.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Tyto alba]
Length=227

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGK-VQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G+  +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQ-HLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  141

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  142   MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  187



>ref|XP_006167101.1| PREDICTED: glucose-induced degradation protein 8 homolog [Tupaia 
chinensis]
Length=228

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 101/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ ++ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTHRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE SP   LL +  RQKV   +N+A+L + N  S
Sbjct  140   LTEMERTLALLAFDSPEDSPFGDLLHVMQRQKVWSEVNQAVLDYENRES  188



>ref|XP_309141.2| AGAP000951-PB [Anopheles gambiae str. PEST]
 ref|XP_001688166.1| AGAP000951-PA [Anopheles gambiae str. PEST]
 ref|XP_003437152.1| AGAP000951-PC [Anopheles gambiae str. PEST]
 gb|EAA04925.2| AGAP000951-PB [Anopheles gambiae str. PEST]
 gb|EDO64476.1| AGAP000951-PA [Anopheles gambiae str. PEST]
 gb|EGK96272.1| AGAP000951-PC [Anopheles gambiae str. PEST]
Length=228

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 92/163 (56%), Gaps = 2/163 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             ET      D++ ++++YLV   FK+  E F A +G+  P   L  ++ R +I      G 
Sbjct  20    ETFPFKQDDINKLIMNYLVTEGFKEAAEKFQAESGVT-PSVDLNSLDNRIQIREAVQNGF  78

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSY  678
             + +A     QL P+LL+ ++ L+F L  LH +EL+   K  EAL FAQT+++  G+    
Sbjct  79    IQEATHLVNQLHPELLDNDRYLYFHLQQLHLIELIRAGKIEEALTFAQTQISEAGESNPE  138

Query  677   V-EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             V  +LE  +ALLA+E P+ SP   LL   +RQKVA  LN AIL
Sbjct  139   VLNELERTLALLAFETPQHSPFADLLGHSHRQKVASELNAAIL  181



>ref|XP_005239917.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Falco peregrinus]
 ref|XP_005444940.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Falco cherrug]
 ref|XP_007059870.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Chelonia mydas]
 ref|XP_008496030.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Calypte anna]
 ref|XP_009484443.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Pelecanus crispus]
 ref|XP_009459872.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Nipponia nippon]
 ref|XP_009507061.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Phalacrocorax carbo]
 ref|XP_009561357.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Cuculus canorus]
 ref|XP_009583087.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Fulmarus glacialis]
 ref|XP_009641992.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Egretta garzetta]
 ref|XP_009807423.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Gavia stellata]
 ref|XP_009867591.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Apaloderma vittatum]
 ref|XP_009908257.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Picoides pubescens]
 ref|XP_009891751.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Charadrius vociferus]
 ref|XP_009932170.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Opisthocomus hoazin]
 ref|XP_009959959.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Leptosomus discolor]
 ref|XP_010014947.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Nestor notabilis]
 ref|XP_009990162.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Tauraco erythrolophus]
 ref|XP_009996917.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Chaetura pelagica]
 ref|XP_010133044.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Buceros rhinoceros silvestris]
 ref|XP_010157720.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Eurypyga helias]
 ref|XP_010173618.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Caprimulgus carolinensis]
 ref|XP_010075929.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Pterocles gutturalis]
 ref|XP_010187671.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Mesitornis unicolor]
 ref|XP_010113819.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Chlamydotis macqueenii]
 ref|XP_010201674.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Colius striatus]
 ref|XP_010211133.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Tinamus guttatus]
 ref|XP_010288401.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Phaethon lepturus]
 ref|XP_010305342.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Balearica regulorum gibbericeps]
 ref|XP_010567834.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Haliaeetus leucocephalus]
Length=227

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGK-VQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G+  +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQ-HLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  141

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  142   MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  187



>emb|CDQ60037.1| unnamed protein product [Oncorhynchus mykiss]
Length=229

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 101/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+  P   L+ +++R +I    L+G +
Sbjct  22    NVQIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-DPSVDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+  + L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINHLHPELLDTRRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDTPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_005708858.1| hypothetical protein Gasu_04310 [Galdieria sulphuraria]
 gb|EME32338.1| hypothetical protein Gasu_04310 [Galdieria sulphuraria]
Length=280

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 83/278 (30%), Positives = 133/278 (48%), Gaps = 51/278 (18%)
 Frame = -3

Query  1115  GGEEFSGQTNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESF----  948
             G E+   QT  +T+       +P + ET   S+  +  ++LSY  H+CF  T ESF    
Sbjct  6     GTEQLETQTGGETVEE--QSDNPVETETF--SNQYLEQLILSYFKHHCFSKTAESFASEL  61

Query  947   --------IASTGMKQPDYC------------LEDMEKRKRIFNFTLEGNVLKAIEQ---  837
                     I+ T  +  +              LE ++ RKR++    +G+ L  ++    
Sbjct  62    AGEVKVEPISVTTTESLNVLIPRQIQLLDKQELELLDLRKRVWQLIKKGDCLTGLDWANV  121

Query  836   ----------TEQLAP--DLLEKN-KDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPF  696
                       T Q  P  D LE     + F +   HFVEL+   K  EAL FA++KL P 
Sbjct  122   VLRRSIQGSGTTQFKPEDDCLETYFPKVAFRVFCHHFVELIRQNKPLEALSFAKSKLGPL  181

Query  695   GKV-QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL------AHANL  537
                  S++E+ +D++ALLAYE+PEKSP FHL+SLE R + A+ +N  ++      +   L
Sbjct  182   CDTDSSFIERFQDYLALLAYEDPEKSPEFHLMSLEERDETAEEVNGCLVNFQVYYSLGIL  241

Query  536   PSYSAVERLIQQITVVRQSLSQEPGKEGNLPFSLKDFL  423
               +S +ERL++Q+ V   +LS+         +S  D++
Sbjct  242   GRFSLLERLVRQLGVTMDTLSELSDSNKEKKWSFHDYV  279



>ref|XP_010874154.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Esox lucius]
Length=243

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 114/203 (56%), Gaps = 13/203 (6%)
 Frame = -3

Query  1103  FSGQTNKQTLCRLMM-------DVDPRQY----ETIDVSDSDVHNIVLSYLVHNCFKDTV  957
             +   T K+T  + MM       D+   ++      + +  +D++ ++++YLV   FK+  
Sbjct  2     YPTWTMKETFGQFMMSYAEKPEDITREEWMEKLNNVHIQRADMNRLIMNYLVTEGFKEAA  61

Query  956   ESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLL  777
             E F   +G+ +P   L+ +++R +I    L+G + +AI     L P+LL+ N+ L+F L 
Sbjct  62    EKFRMESGI-EPSVDLDSLDERIKIREMILKGQIQEAIALINSLHPELLDTNRYLYFHLQ  120

Query  776   SLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFMALLAYEEPEKSPMFHLLS  600
               H +EL+  R+   ALEFAQ++LA  G + +  + ++E  +ALLA++ PE+SP   LL+
Sbjct  121   QQHLIELIRLRETEAALEFAQSQLAEQGEESRECLTEMERTLALLAFDNPEESPFGDLLN  180

Query  599   LEYRQKVADSLNRAILAHANLPS  531
                RQKV   +N+++L + N  S
Sbjct  181   TMQRQKVWSEVNQSVLDYENRES  203



>ref|XP_003705100.1| PREDICTED: protein C20orf11-like [Megachile rotundata]
Length=230

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 92/154 (60%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+ +P   L  ++ R RI      G + +A     
Sbjct  30    MNNLIMNYLVTEGFKEAAEKFQQESGV-EPTVDLSSLDDRIRIREAIQNGRIQEATNLVN  88

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE-KLEDFM  654
             QL P+LL+ ++ L+F L  LH +EL+ T K  EAL+FAQ +L+  G+    +  +LE  +
Sbjct  89    QLHPELLDNDRYLYFHLQQLHLIELIRTGKIEEALQFAQDRLSEAGESDDNILCELERTL  148

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             ALLA++EP KSP   LL   +RQK+A  LN AIL
Sbjct  149   ALLAFDEPHKSPYSDLLHPTHRQKIASELNAAIL  182



>gb|ENN77313.1| hypothetical protein YQE_06139, partial [Dendroctonus ponderosae]
 gb|ERL91541.1| hypothetical protein D910_08871 [Dendroctonus ponderosae]
Length=227

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 103/182 (57%), Gaps = 6/182 (3%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             E  DV  S+++ ++++YLV   FK+  E F   +G+  PD  L  ++ R RI +  + G 
Sbjct  18    EDNDVGRSNMNKLIMNYLVTEGFKEAAEKFQQESGIATPD-NLHSLDDRMRIRDAIMNGR  76

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV-QS  681
             + +A     QL  +LL+ ++ L+F L  LH +EL+ + K  EAL FAQ+ L+  G+   S
Sbjct  77    IEEATTLINQLHSELLDNDRYLYFRLRQLHLLELIRSNKIEEALAFAQSHLSEAGEEDHS  136

Query  680   YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILA----HANLPSYSAVER  513
              + +LE  +ALLA+E+P  SP   LL   +RQKVA  +N AIL      +  P  S + +
Sbjct  137   VLIELERTIALLAFEDPLSSPFGDLLEPSHRQKVAGEVNAAILKMEHQESTAPKISTLLK  196

Query  512   LI  507
             LI
Sbjct  197   LI  198



>ref|XP_011060960.1| PREDICTED: glucose-induced degradation protein 8 homolog [Acromyrmex 
echinatior]
 gb|EGI61445.1| Protein C20orf11 [Acromyrmex echinatior]
Length=231

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 108/186 (58%), Gaps = 3/186 (2%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+  P   L  ++ R RI +    G++ +A +   
Sbjct  31    MNNMIMNYLVTEGFKEAAEKFQQESGVG-PTVELSTLDDRIRIRDAVQNGHIQEATDLVN  89

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE-KLEDFM  654
             QL P+LL+ ++ L+F L  LH +EL+ T +  EAL+FAQ +L+  G+    +  +LE  +
Sbjct  90    QLHPELLDNDRYLYFHLQQLHLIELIRTGRVEEALQFAQDQLSEAGESDDNILCELERTL  149

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSA-VERLIQQITVVRQSL  477
             ALLA++EP KSP   LL   +RQK+A  LN AIL   +  S S  +  L++ I   ++ L
Sbjct  150   ALLAFDEPHKSPFSDLLHPTHRQKIAGELNAAILKMEHRESSSPRLNNLLKMILWAQEEL  209

Query  476   SQEPGK  459
              ++  K
Sbjct  210   DKKKVK  215



>ref|XP_003963390.1| PREDICTED: glucose-induced degradation protein 8 homolog [Takifugu 
rubripes]
Length=228

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 113/193 (59%), Gaps = 2/193 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  21    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRVESGI-EPSVDLDSLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
               AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQ++LA  G + +  
Sbjct  80    QDAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQSQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQI  498
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+ +L + N  S   + +L++ +
Sbjct  140   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQCVLDYENRESTPKLAKLLKLL  199

Query  497   TVVRQSLSQEPGK  459
               V+  L Q+  K
Sbjct  200   LWVQNELDQKKVK  212



>ref|NP_001134125.1| CT011 protein [Salmo salar]
 gb|ACI66306.1| C20orf11 homolog [Salmo salar]
 emb|CDQ87724.1| unnamed protein product [Oncorhynchus mykiss]
Length=229

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQ++LA  G + +  
Sbjct  81    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQSQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL+   RQKV   +N+++L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNTMQRQKVWSEVNQSVLDYENRES  189



>gb|EFX67736.1| hypothetical protein DAPPUDRAFT_93654 [Daphnia pulex]
Length=230

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 95/163 (58%), Gaps = 2/163 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             E + +  ++++ +V++YLV   FK+  E F    G K P   LE +++R +I +    G 
Sbjct  21    ENVHLPRTNMNRLVMNYLVTEGFKEAAEKFALEAGFKAP-AELERLDERIKIRDAIQAGK  79

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQ-S  681
             + +A     QL PDLL+ ++ L F L   H +EL+  +   EAL+FAQ  LA  G+   +
Sbjct  80    IQEATALVNQLHPDLLDSDRYLFFHLQQQHLIELIRQKNIEEALKFAQEHLAERGEQNPA  139

Query  680   YVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              + +LE  +ALLA+++PEKSP   LL   +RQ+VA  LN AIL
Sbjct  140   ILGELERTLALLAFDDPEKSPFGDLLHTSHRQRVASELNAAIL  182



>gb|ESA09735.1| hypothetical protein GLOINDRAFT_348540 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX55128.1| hypothetical protein RirG_228160 [Rhizophagus irregularis DAOM 
197198w]
Length=249

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 103/185 (56%), Gaps = 2/185 (1%)
 Frame = -3

Query  1100  SGQTNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP  921
             +G ++ Q+   +  D   ++ E + +  +D++ ++++Y V   +KD  E+F    G+  P
Sbjct  5     TGTSSHQSKKVVTKDDWVKKLEDVKIDKNDLNKLIMNYFVIEGYKDAAETFSQECGL-LP  63

Query  920   DYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRK  741
                ++ ++ R  I N    GNV +AIE+   L P++L+ N  L+F L     +E +   K
Sbjct  64    SIDVDSIQDRMNIRNAIQNGNVEEAIERVNDLNPEILDTNPKLYFHLQQQRLIEYIREGK  123

Query  740   CTEALEFAQTKLAPFGKVQ-SYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLN  564
               EALEFAQ +LAP G+    ++E+LE  MALLA+++   SP+  LL    RQ+ A  LN
Sbjct  124   IAEALEFAQDELAPRGEENPEFLEELERTMALLAFDDTTVSPVGDLLHPSQRQRTASELN  183

Query  563   RAILA  549
              AIL 
Sbjct  184   AAILT  188



>ref|XP_003439069.1| PREDICTED: glucose-induced degradation protein 8 homolog [Oreochromis 
niloticus]
 ref|XP_004546078.1| PREDICTED: glucose-induced degradation protein 8 homolog [Maylandia 
zebra]
 ref|XP_005740518.1| PREDICTED: glucose-induced degradation protein 8 homolog [Pundamilia 
nyererei]
 ref|XP_005931862.1| PREDICTED: glucose-induced degradation protein 8 homolog [Haplochromis 
burtoni]
 ref|XP_006796416.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X1 [Neolamprologus brichardi]
Length=228

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 101/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  21    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
               AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQ++LA  G + +  
Sbjct  80    QDAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQSQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+ +L + N  S
Sbjct  140   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQCVLDYENRES  188



>ref|XP_010788576.1| PREDICTED: glucose-induced degradation protein 8 homolog [Notothenia 
coriiceps]
Length=228

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 101/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  21    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
               AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQ++LA  G + +  
Sbjct  80    QDAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQSQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+ +L + N  S
Sbjct  140   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQCVLDYENRES  188



>gb|KFB40237.1| hypothetical protein ZHAS_00007615 [Anopheles sinensis]
Length=228

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 92/163 (56%), Gaps = 2/163 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             ET      D++ ++++YLV   FK+  E F A +G+  P   L  ++ R  I      G 
Sbjct  20    ETFPFKQEDINKLIMNYLVTEGFKEAAEKFQAESGVV-PSVDLNSLDNRILIREAVQNGF  78

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSY  678
             + +A     QL P+LL+ ++ L+F L  LH +EL+   K  EAL FAQT+++  G+    
Sbjct  79    IQEATHLVNQLHPELLDNDRYLYFHLQQLHLIELIRAGKIEEALTFAQTQISEAGESNPE  138

Query  677   V-EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             V  +LE  +ALLA+E+P+ SP   LL   +RQKVA  LN AIL
Sbjct  139   VLNELERTLALLAFEKPQNSPFADLLDQTHRQKVASELNAAIL  181



>gb|EFN73244.1| Protein C20orf11 [Camponotus floridanus]
Length=230

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+  P   L  +++R RI +    G + +A     
Sbjct  31    MNNLIMNYLVTEGFKEAAEKFQQESGVG-PTVELSSLDERIRIRDAIQNGRIQEATNLVN  89

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE-KLEDFM  654
             QL P+LL+ ++ L+F L  LH +EL+ T +  EAL+FAQ +L+  G+    +  +LE  +
Sbjct  90    QLHPELLDNDRYLYFHLQQLHLIELIRTGRVEEALQFAQDQLSEAGESDDNILCELERTL  149

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             ALLA++EP KSP   LL   +RQK+A  LN AIL
Sbjct  150   ALLAFDEPHKSPFSDLLHPTHRQKIASELNAAIL  183



>emb|CDQ69171.1| unnamed protein product [Oncorhynchus mykiss]
Length=229

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIRELILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+  + L+F L   H +EL+  ++   ALEFAQT+LA  G + +  
Sbjct  81    QEAIALINSLHPELLDTKRYLYFHLQQQHLIELIRLQETESALEFAQTQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  189



>ref|XP_005801729.1| PREDICTED: glucose-induced degradation protein 8 homolog [Xiphophorus 
maculatus]
 ref|XP_007557684.1| PREDICTED: glucose-induced degradation protein 8 homolog [Poecilia 
formosa]
 ref|XP_008412158.1| PREDICTED: glucose-induced degradation protein 8 homolog [Poecilia 
reticulata]
Length=228

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 101/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  21    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIRELILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
               AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQ++LA  G + +  
Sbjct  80    QDAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQSQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+ +L + N  S
Sbjct  140   LTEMERTLALLAFDNPEESPFGDLLNIMQRQKVWSEVNQCVLDYENRES  188



>emb|CDQ84029.1| unnamed protein product [Oncorhynchus mykiss]
Length=229

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 102/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     + P+LL+ N+ L+F L   H +EL+  R+   ALEFAQ++LA  G + +  
Sbjct  81    QEAIALINSMHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQSQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL+   RQKV   +N+++L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNTMQRQKVWSEVNQSVLDYENRES  189



>ref|XP_008276051.1| PREDICTED: glucose-induced degradation protein 8 homolog [Stegastes 
partitus]
 ref|XP_010749773.1| PREDICTED: glucose-induced degradation protein 8 homolog [Larimichthys 
crocea]
Length=228

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 100/169 (59%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  21    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
               AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQ++LA  G + +  
Sbjct  80    QDAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETEAALEFAQSQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE SP   LL++  RQKV   +N+ +L + N  S
Sbjct  140   LTEMERTLALLAFDNPEDSPFGDLLNMMQRQKVWSEVNQCVLDYENRES  188



>ref|XP_008892946.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETN21119.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
Length=247

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 90/154 (58%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++ +V+ YLV   +++  E+F   +G K P   L+ +++R RI    L+G + KA  +  
Sbjct  52    MNRLVMDYLVGKGYREVAEAFWRDSGTK-PHVDLQSVQERMRIQQLLLKGQIQKARGKLA  110

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFM  654
              + P+ LEKN  + F L     +EL+      EAL+FA   LAPFG K   ++ ++E  M
Sbjct  111   SMDPEFLEKNSGMDFLLAKQELIELIKAHNIEEALQFAIKNLAPFGQKSPQFLHEIERTM  170

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +++A++ P +SP+ HLL    R++VAD +N AIL
Sbjct  171   SVIAFKNPSESPLGHLLEQAQRRRVADEVNSAIL  204



>ref|XP_001624093.1| predicted protein [Nematostella vectensis]
 sp|A7SWD3.1|GID8_NEMVE RecName: Full=Glucose-induced degradation protein 8 homolog [Nematostella 
vectensis]
 gb|EDO31993.1| predicted protein [Nematostella vectensis]
Length=225

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 92/156 (59%), Gaps = 2/156 (1%)
 Frame = -3

Query  1016  SDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQ  837
             ++++ +++ YLV   +K+  E F   +G  QP   L+ ++ R +I     +G++ +A+  
Sbjct  24    AEMNRLIMDYLVTEGYKEAAEKFRIESGT-QPTAPLDSLDDRIKIREAVQKGDLEQAVSM  82

Query  836   TEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQS-YVEKLED  660
             T +L PD+L+ N+ L+F L     +EL+  +    A+EFAQ + +  G+    Y+E+LE 
Sbjct  83    TNKLNPDILDSNQQLYFHLQQQRLIELIREKDIEAAVEFAQGQFSEQGQESGRYLEELEQ  142

Query  659   FMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              MALLA++ PE+SP   LL    RQKVA  LN AIL
Sbjct  143   TMALLAFDNPEESPFGDLLHTSQRQKVASELNAAIL  178



>ref|XP_010937007.1| PREDICTED: glucose-induced degradation protein 8 homolog [Elaeis 
guineensis]
Length=242

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 112/214 (52%), Gaps = 5/214 (2%)
 Frame = -3

Query  1100  SGQTNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP  921
             S  T+K+ + R   D   R+ + + +   D++ +V+++LV   + +  E F   +G  +P
Sbjct  16    SMSTSKKVITR---DEWERKLKDVKIRKEDMNKLVMNFLVTEGYVEAAEKFRIESGT-EP  71

Query  920   DYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRK  741
             D  L  M  R  +      GNV  AIE+   L P +L+ N  L+F L     +EL+ + K
Sbjct  72    DIDLATMTDRMAVKKAVQSGNVKDAIEKVNDLNPMILDTNPRLYFHLQQQRLIELIRSGK  131

Query  740   CTEALEFAQTKLAPFGKV-QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLN  564
               EALEFAQ +LAP G+  QS++E+LE  +ALLA+E+ +  P   LL +  R K A  +N
Sbjct  132   VEEALEFAQEELAPRGEENQSFLEELERTVALLAFEDVKNCPYGELLDVSQRLKTASEVN  191

Query  563   RAILAHANLPSYSAVERLIQQITVVRQSLSQEPG  462
              AIL   +      + RL++ +   +  L ++  
Sbjct  192   AAILTSQSHEKDPKLPRLLKMLVWAQNQLDEKAA  225



>gb|EPS66129.1| hypothetical protein M569_08647, partial [Genlisea aurea]
Length=225

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 103/193 (53%), Gaps = 2/193 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             ++   + V   D++ +V+++LV   + +  E F   +G  +PD  L  +  R  +     
Sbjct  15    KKLNDVKVRKEDMNKLVMNFLVTEGYVEAAEKFRLESGT-EPDIDLATITDRMTVKKAVQ  73

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
             +GNV  AIE+   L P++L+ N  L F L     +EL+   K  EALEFAQ +LAP G+ 
Sbjct  74    DGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKVEEALEFAQEELAPRGEE  133

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERL  510
              QS++E+LE  +ALLA+E+    P+ HLL +  R K A  +N AIL   +      +  L
Sbjct  134   NQSFLEELERTVALLAFEDAANCPVGHLLDMSQRLKTASEVNAAILTSQSHEKDPKLPSL  193

Query  509   IQQITVVRQSLSQ  471
             ++ +  V+  L +
Sbjct  194   LKMLVWVQNQLDE  206



>gb|EMT07617.1| hypothetical protein F775_26637 [Aegilops tauschii]
Length=192

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 105/192 (55%), Gaps = 6/192 (3%)
 Frame = -3

Query  1091  TNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYC  912
             T+K+ + R   D   R+   + +   D++ +V+++LV   F D  + F   +G  QPD  
Sbjct  3     TSKKVVTR---DEWERKLRDVKIRKEDMNRLVMNFLVTEGFVDAADKFRVESGT-QPDID  58

Query  911   LEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTE  732
             L  +  R  +      GNV +AIE+   L P +L+ N +L+F L     +EL+   K  E
Sbjct  59    LATITDRMEVEKAGQSGNVQEAIEKINDLNPTILDTNPELYFHLQQQKLIELIRAGKINE  118

Query  731   ALEFAQTKLAPFGKV-QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAI  555
             ALEFAQ +LAP G+  Q+++E++E  +ALL +E+ +  P   LL +  R K A  +N AI
Sbjct  119   ALEFAQEELAPRGEENQAFLEEIEKTVALLVFEDVKNCPYGELLDVSQRLKTASEVNAAI  178

Query  554   L-AHANLPSYSA  522
             L + ++   Y+A
Sbjct  179   LTSQSHEKEYAA  190



>ref|XP_008892944.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETN21117.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
Length=274

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 90/154 (58%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++ +V+ YLV   +++  E+F   +G K P   L+ +++R RI    L+G + KA  +  
Sbjct  52    MNRLVMDYLVGKGYREVAEAFWRDSGTK-PHVDLQSVQERMRIQQLLLKGQIQKARGKLA  110

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFM  654
              + P+ LEKN  + F L     +EL+      EAL+FA   LAPFG K   ++ ++E  M
Sbjct  111   SMDPEFLEKNSGMDFLLAKQELIELIKAHNIEEALQFAIKNLAPFGQKSPQFLHEIERTM  170

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +++A++ P +SP+ HLL    R++VAD +N AIL
Sbjct  171   SVIAFKNPSESPLGHLLEQAQRRRVADEVNSAIL  204



>ref|XP_004354796.1| hypothetical protein DFA_09447 [Dictyostelium fasciculatum]
 gb|EGG16412.1| hypothetical protein DFA_09447 [Dictyostelium fasciculatum]
Length=445

 Score =   103 bits (257),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 110/200 (55%), Gaps = 12/200 (6%)
 Frame = -3

Query  1001  IVLSYLVHNCFKDTVESFIASTGM------KQPDYCLEDMEKRKRIFNFTLEGNVLKAIE  840
             +VL YL+H+ + +TV+ F ++TG+       Q DY    ++ R+ I +  L G + K I 
Sbjct  251   LVLGYLIHHGYPETVKLFASATGIVDDTLNSQLDY----IKNRQTILDLLLNGEIEKVII  306

Query  839   QTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVEKLED  660
             +  +L PD L+K KD+ F L    F+E++      + + F   +L  F  +  Y   L +
Sbjct  307   ELNRLYPDFLQKRKDILFKLQCQKFIEMIKHSPIEDTMAFGTKELYSF--LPEYENSLHE  364

Query  659   FMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITVVRQS  480
               +L+AY++P KSP+ HLL  E R+ +A  LN A+L ++N PS   +ER+++Q  VV   
Sbjct  365   IFSLIAYQDPFKSPVAHLLDKERREPIAKDLNCALLVYSNKPSTPILERVVRQTKVVMDE  424

Query  479   LSQEPGKEGNLPFSLKDFLK  420
               ++     ++  ++ +FL+
Sbjct  425   SVKKNACPSSIFMNVNEFLQ  444



>ref|XP_009526448.1| hypothetical protein PHYSODRAFT_331367 [Phytophthora sojae]
 gb|EGZ17390.1| hypothetical protein PHYSODRAFT_331367 [Phytophthora sojae]
Length=247

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 88/154 (57%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++ +V+ YLV   +++  E+F   +G + P   L+ +++R  I    L+G + KA  +  
Sbjct  52    MNRLVMDYLVGKGYREVAEAFWRDSGTR-PHVDLQSVQERMSIQQLLLKGQIQKARSKLA  110

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFM  654
              + PD LEKN  + F L     +EL+      EAL+FA   LAPFG K   ++ ++E  M
Sbjct  111   NMNPDFLEKNNGMDFLLAKQELIELIKAHNIEEALQFAIKNLAPFGQKSPQFLHEIERTM  170

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +++A++ P  SP+ HLL    R++VAD +N AIL
Sbjct  171   SVIAFKNPSDSPLGHLLEQAQRRRVADEVNSAIL  204



>gb|AFK40878.1| unknown [Medicago truncatula]
Length=206

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             ++   + +   D++ +V+++LV   F D  E F   +G  +PD  L  +  R  +     
Sbjct  31    KKLNNVKIRKEDMNKLVMNFLVTEGFVDAAEKFRKESGT-EPDIDLATITDRMAVKKAVQ  89

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV  AIE+   L P++L+ N  L F L     +EL+   K  EALEFAQ +LAP G+ 
Sbjct  90    SGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKIEEALEFAQEELAPRGEE  149

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              QS++E+LE  +ALLA+E+    P+  LL +  R K A  +N AIL
Sbjct  150   NQSFLEELERTVALLAFEDVSNCPVGELLDISQRLKTASEVNAAIL  195



>gb|EMP35844.1| Protein C20orf11 like protein [Chelonia mydas]
Length=725

 Score =   104 bits (260),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 115/193 (60%), Gaps = 2/193 (1%)
 Frame = -3

Query  1031  IDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVL  852
             + +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + 
Sbjct  22    LHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQ  80

Query  851   KAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYV  675
             +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  +
Sbjct  81    EAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECL  140

Query  674   EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQIT  495
              ++E  +ALLA++ PE+SP   LL++  RQKV   +N+A+L + N  S   + +L++ + 
Sbjct  141   TEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLL  200

Query  494   VVRQSLSQEPGKE  456
               +  L Q+ G +
Sbjct  201   WAQNELDQKKGDD  213



>ref|XP_004070562.1| PREDICTED: glucose-induced degradation protein 8 homolog [Oryzias 
latipes]
Length=228

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 100/169 (59%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G V
Sbjct  21    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQV  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
               AI     L P+LL+ N+ L+F L   H +EL+  ++   ALEFAQ++LA  G + +  
Sbjct  80    QDAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLKETEAALEFAQSQLADQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL+   RQKV   +N+ +L + N  S
Sbjct  140   LSEMERTLALLAFDNPEESPFGDLLNTMQRQKVWSEVNQCVLDYENRES  188



>ref|NP_001291048.1| GID complex subunit 8 [Esox lucius]
 gb|ACO14179.1| C20orf11 homolog [Esox lucius]
Length=229

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 101/169 (60%), Gaps = 2/169 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  22    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  80

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+L + N+ L+F L   H +EL+  R+   ALEFAQ++LA  G + +  
Sbjct  81    QEAIALINSLHPELPDTNRYLYFHLQQQHLIELIRLRETEAALEFAQSQLAEQGEESREC  140

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL+   RQKV   +N+++L + N  S
Sbjct  141   LTEMERTLALLAFDNPEESPFGDLLNTMQRQKVWSEVNQSVLDYENRES  189



>ref|XP_008938478.1| PREDICTED: glucose-induced degradation protein 8 homolog [Merops 
nubicus]
Length=225

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 100/166 (60%), Gaps = 5/166 (3%)
 Frame = -3

Query  1025  VSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKA  846
             +  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G + +A
Sbjct  24    IQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQIQEA  82

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEK  669
             I     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + +
Sbjct  83    IALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTE  142

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             +E  +ALLA++ PE+  M +++    RQKV   +N+A+L + N  S
Sbjct  143   MERTLALLAFDNPEECDMLNMMQ---RQKVWSEVNQAVLDYENRES  185



>ref|XP_003593496.1| hypothetical protein MTR_2g012810 [Medicago truncatula]
 gb|AES63747.1| LisH and RanBPM domain protein [Medicago truncatula]
Length=241

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             ++   + +   D++ +V+++LV   F D  E F   +G  +PD  L  +  R  +     
Sbjct  31    KKLNNVKIRKEDMNKLVMNFLVTEGFVDAAEKFRKESGT-EPDIDLATITDRMAVKKAVQ  89

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV  AIE+   L P++L+ N  L F L     +EL+   K  EALEFAQ +LAP G+ 
Sbjct  90    SGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKIEEALEFAQEELAPRGEE  149

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              QS++E+LE  +ALLA+E+    P+  LL +  R K A  +N AIL
Sbjct  150   NQSFLEELERTVALLAFEDVSNCPVGELLDISQRLKTASEVNAAIL  195



>gb|AFK42048.1| unknown [Medicago truncatula]
Length=241

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             ++   + +   D++ +V+++LV   F D  E F   +G  +PD  L  +  R  +     
Sbjct  31    KKLNNVKIRKEDMNKLVMNFLVTEGFVDAAEKFRKESGT-EPDIDLATITDRMAVKKAVQ  89

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV  AIE+   L P++L+ N  L F L     +EL+   K  EALEFAQ +LAP G+ 
Sbjct  90    SGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKIEEALEFAQEELAPRGEE  149

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              QS++E+LE  +ALLA+E+    P+  LL +  R K A  +N AIL
Sbjct  150   NQSFLEELERTVALLAFEDVSNCPVGELLDISQRLKTASEVNAAIL  195



>ref|XP_008892945.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETN21118.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
Length=269

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 90/154 (58%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++ +V+ YLV   +++  E+F   +G K P   L+ +++R RI    L+G + KA  +  
Sbjct  74    MNRLVMDYLVGKGYREVAEAFWRDSGTK-PHVDLQSVQERMRIQQLLLKGQIQKARGKLA  132

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFM  654
              + P+ LEKN  + F L     +EL+      EAL+FA   LAPFG K   ++ ++E  M
Sbjct  133   SMDPEFLEKNSGMDFLLAKQELIELIKAHNIEEALQFAIKNLAPFGQKSPQFLHEIERTM  192

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +++A++ P +SP+ HLL    R++VAD +N AIL
Sbjct  193   SVIAFKNPSESPLGHLLEQAQRRRVADEVNSAIL  226



>gb|EZA55876.1| Protein C20orf11 [Cerapachys biroi]
Length=230

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 91/154 (59%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++N++++YLV   FK+  E F   +G+      L  M+ R RI +    G + +A     
Sbjct  30    MNNLIMNYLVTEGFKEAAEKFQQESGVGLT-VELSSMDDRIRIRDAIQNGRIQEATSLVN  88

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE-KLEDFM  654
             QL P+LL+ ++ L+F L  LH +EL+ T +  EAL+FAQ +L+  G+    +  +LE  +
Sbjct  89    QLHPELLDNDRYLYFHLQQLHLIELIRTGRVEEALQFAQDQLSEAGESDDNILCELERTL  148

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             ALLA++EP KSP   LL   +RQKVA  LN AIL
Sbjct  149   ALLAFDEPHKSPFSDLLHPTHRQKVASELNAAIL  182



>ref|XP_002589118.1| hypothetical protein BRAFLDRAFT_75099 [Branchiostoma floridae]
 gb|EEN45129.1| hypothetical protein BRAFLDRAFT_75099 [Branchiostoma floridae]
Length=228

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 106/193 (55%), Gaps = 2/193 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
             ++ +S +D++ ++++YLV   FK+  E F    G+   +   E +++R +I +   +G +
Sbjct  21    SLHISRADMNRLIMNYLVTEGFKEAAEKFRVEAGIPM-NMDTESLDERIKIRDAIQKGEI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYV  675
              +A+     L P+LL+ N+ L+F L   H +EL+  +    AL++AQT LA  G+  + V
Sbjct  80    EEAMALVNNLHPELLDDNRYLYFHLQQQHLIELIRKKDVEGALQYAQTHLAERGEENADV  139

Query  674   -EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQI  498
               +LE  +ALLA+E PE SP   LL    RQKVA  LN AIL   N  S   +  +++ +
Sbjct  140   LNELEKTLALLAFENPEDSPFGELLHPSQRQKVASELNSAILEVENRESTPKLANMLKLL  199

Query  497   TVVRQSLSQEPGK  459
                +  L Q+  K
Sbjct  200   LWAQHELDQKKVK  212



>ref|XP_008798010.1| PREDICTED: glucose-induced degradation protein 8 homolog [Phoenix 
dactylifera]
Length=242

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 99/183 (54%), Gaps = 5/183 (3%)
 Frame = -3

Query  1091  TNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYC  912
             T+K+ + R   D   R+ + + +   D++ +V+++LV   F +  E F   +G  +P   
Sbjct  19    TSKKVITR---DEWERKLKDVKIRKEDMNKLVMNFLVTEGFVEAAEKFRIESGT-EPGID  74

Query  911   LEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTE  732
             L  +  R  +      GNV  AIE+   L P +L  N  LHF L     +EL+   K  E
Sbjct  75    LGTITDRMAVKKAVQFGNVKDAIEKVNDLNPMILYANPQLHFHLQQQRLIELIRIGKVEE  134

Query  731   ALEFAQTKLAPFGKV-QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAI  555
             ALEFAQ +LAP GK  QS++E+LE  +ALLA+E+ +  P   LL +  R K A  +N AI
Sbjct  135   ALEFAQEELAPRGKENQSFLEELERTVALLAFEDVKNCPYGELLDVSQRLKTASEVNAAI  194

Query  554   LAH  546
             LA+
Sbjct  195   LAN  197



>gb|ETK85511.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETL38937.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETL92059.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETP15352.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
Length=229

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 89/154 (58%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++ +V+ YLV   +++  E+F   +G K P   L+ +++R  I    L+G + KA  +  
Sbjct  52    MNRLVMDYLVGKGYREVAEAFWRDSGTK-PHVDLQSVQERMSIQQLLLKGQIQKARGKLA  110

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFM  654
              + P+ LEKN  + F L     +EL+      EAL+FA   LAPFG K   ++ ++E  M
Sbjct  111   SMDPEFLEKNSGMDFLLAKQELIELIKAHNIEEALQFAIKNLAPFGQKSPQFLHEIERTM  170

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +++A++ P +SP+ HLL    R++VAD +N AIL
Sbjct  171   SVIAFKNPSESPLGHLLEQAQRRRVADEVNSAIL  204



>ref|XP_008067749.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Tarsius syrichta]
Length=206

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 93/153 (61%), Gaps = 2/153 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + V  +D++ ++++YLV   FK+  E F   +G+ +P   LE +++R +I    L+G +
Sbjct  21    NLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLETLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSY  678
              +AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  
Sbjct  80    QEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESREC  139

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKV  579
             + ++E  +ALLA++ PE+SP   LL +  RQKV
Sbjct  140   LTEMERTLALLAFDSPEESPFGDLLHMMQRQKV  172



>ref|XP_002896982.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY66463.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=241

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 89/154 (58%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++ +V+ YLV   +++  E+F   +G K P   L+ +++R  I    L+G + KA  +  
Sbjct  49    MNRLVMDYLVGKGYREVAEAFWRDSGTK-PHVDLQSVQERMSIQQLLLKGQIQKARGKLA  107

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFM  654
              + P+ LEKN  + F L     +EL+      EAL+FA   LAPFG K   ++ ++E  M
Sbjct  108   NMDPEFLEKNSGMDFLLAKQELIELIKVHDIEEALQFAIKNLAPFGQKSPQFLHEIERTM  167

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +++A++ P +SP+ HLL    R++VAD +N AIL
Sbjct  168   SVIAFKNPSESPLGHLLEQAQRRRVADEVNSAIL  201



>gb|ETI45545.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
 gb|ETK85510.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL38936.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL92058.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETM45356.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETO74186.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976]
 gb|ETP15351.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
 gb|ETP43438.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
Length=247

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 89/154 (58%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++ +V+ YLV   +++  E+F   +G K P   L+ +++R  I    L+G + KA  +  
Sbjct  52    MNRLVMDYLVGKGYREVAEAFWRDSGTK-PHVDLQSVQERMSIQQLLLKGQIQKARGKLA  110

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFM  654
              + P+ LEKN  + F L     +EL+      EAL+FA   LAPFG K   ++ ++E  M
Sbjct  111   SMDPEFLEKNSGMDFLLAKQELIELIKAHNIEEALQFAIKNLAPFGQKSPQFLHEIERTM  170

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +++A++ P +SP+ HLL    R++VAD +N AIL
Sbjct  171   SVIAFKNPSESPLGHLLEQAQRRRVADEVNSAIL  204



>ref|XP_009382981.1| PREDICTED: glucose-induced degradation protein 8 homolog [Musa 
acuminata subsp. malaccensis]
Length=225

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 93/166 (56%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             R+ + + +S  D++ +V+++LV   + D  E F   +G  +PD  L  +  R  +     
Sbjct  13    RKLKDVKISKKDMNKLVMNFLVTEGYVDAAEKFRIESGT-EPDIDLATITDRMAVKKALQ  71

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV  AIE+   L P +L+ N  L+F L     +EL+ T    EALEFAQ +LAP G+ 
Sbjct  72    SGNVEDAIEKVNDLNPTILDTNPQLYFHLQQQRLIELIRTGNVEEALEFAQEELAPRGEE  131

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              Q+++E+LE  +ALLA+++ +  P   LL +  R K A  LN AIL
Sbjct  132   NQNFLEELERTVALLAFDDVKNCPYGELLDVSQRLKTASELNAAIL  177



>ref|XP_008892943.1| hypothetical protein PPTG_01405 [Phytophthora parasitica INRA-310]
 gb|ETN21116.1| hypothetical protein PPTG_01405 [Phytophthora parasitica INRA-310]
Length=296

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 90/154 (58%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++ +V+ YLV   +++  E+F   +G K P   L+ +++R RI    L+G + KA  +  
Sbjct  74    MNRLVMDYLVGKGYREVAEAFWRDSGTK-PHVDLQSVQERMRIQQLLLKGQIQKARGKLA  132

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFM  654
              + P+ LEKN  + F L     +EL+      EAL+FA   LAPFG K   ++ ++E  M
Sbjct  133   SMDPEFLEKNSGMDFLLAKQELIELIKAHNIEEALQFAIKNLAPFGQKSPQFLHEIERTM  192

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +++A++ P +SP+ HLL    R++VAD +N AIL
Sbjct  193   SVIAFKNPSESPLGHLLEQAQRRRVADEVNSAIL  226



>ref|XP_002402066.1| LisH motif-containing protein [Ixodes scapularis]
 gb|EEC09451.1| LisH motif-containing protein [Ixodes scapularis]
Length=240

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 97/169 (57%), Gaps = 2/169 (1%)
 Frame = -3

Query  1037  ETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGN  858
             E + +  +D++ ++++YLV   FK+  E F   +G+  P   L+ +++R RI +   +G 
Sbjct  33    EGVHIQRADMNRLIMNYLVTEGFKEAAEKFKLESGVTSP-VDLDSLDERIRIRDCIQQGR  91

Query  857   VLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSY  678
             VL+A+     + P+LL+ ++ L F L   H +EL+   +  EAL +AQ  L+  G+    
Sbjct  92    VLEAVALLNDIRPELLDNDRYLLFHLQQQHLIELIRDGRTEEALAYAQDHLSERGEENPQ  151

Query  677   V-EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLP  534
             V  +LE  +ALLA+EEP+ SP   LL   +RQKVA  +N A+L   + P
Sbjct  152   VLSELERTLALLAFEEPQTSPFGDLLHPSHRQKVASEVNAALLEDQHSP  200



>ref|XP_006796417.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Neolamprologus brichardi]
Length=226

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 101/169 (60%), Gaps = 4/169 (2%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
              + +  +D++ ++++YLV   FK+  E F   +G+ +P   L+ +++R +I    L+G +
Sbjct  21    NVHIQRADMNRLIMNYLVTEGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQI  79

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGK-VQSY  678
               AI     L P+LL+ N+ L+F L   H +EL+  R+   ALEFAQ++LA  G+  +  
Sbjct  80    QDAIALINSLHPELLDTNRYLYFHLQ--HLIELIRLRETEAALEFAQSQLAEQGEESREC  137

Query  677   VEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             + ++E  +ALLA++ PE+SP   LL++  RQKV   +N+ +L + N  S
Sbjct  138   LTEMERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQCVLDYENRES  186



>ref|XP_010888940.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Esox lucius]
 ref|XP_010888941.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Esox lucius]
 ref|XP_010888942.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Esox lucius]
Length=199

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 92/155 (59%), Gaps = 2/155 (1%)
 Frame = -3

Query  992  SYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDL  813
             ++    FK+  E F   +G+ +P   L+ +++R +I    L+G + +AI     L P+L
Sbjct  6    GHIFQQGFKEAAEKFRMESGI-EPSVDLDSLDERIKIREMILKGQIQEAIALINSLHPEL  64

Query  812  LEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFMALLAYE  636
            L+ N+ L+F L   H +EL+  R+   ALEFAQT+LA  G + +  + ++E  +ALLA+E
Sbjct  65   LDTNRYLYFHLQQQHLIELIRLRETESALEFAQTQLAEQGEESRECLSEMERTLALLAFE  124

Query  635  EPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPS  531
             PE+SP   LL++  RQKV   +N+A+L + N  S
Sbjct  125  NPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRES  159



>ref|XP_010228921.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Brachypodium distachyon]
 ref|XP_010228922.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X2 [Brachypodium distachyon]
Length=226

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 91/166 (55%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             R+   + +   D++ +V+++LV   F D  + F   +G  QPD  L  +  R  +     
Sbjct  15    RKLRDVKIRKEDMNRLVMNFLVTEGFVDAADKFRIESGT-QPDIDLATITDRMEVKKAVQ  73

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV +AIE+   L P +L+ N  L+F L     +EL+   K  EALEFAQ +LAP G+ 
Sbjct  74    SGNVQEAIEKINDLNPTILDTNPQLYFHLQQQKLIELIRVGKINEALEFAQEELAPRGEE  133

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              Q+++E++E  +ALL +E+ +  P   LL +  R K A  +N AIL
Sbjct  134   NQAFLEEIEKTVALLVFEDVKNCPYGELLDVSQRLKTASEVNAAIL  179



>ref|XP_009413492.1| PREDICTED: glucose-induced degradation protein 8 homolog [Musa 
acuminata subsp. malaccensis]
Length=242

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 93/166 (56%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             R+ + + +   D++ +V+++LV   + +  E F   +G  +PD  L  +  R  +     
Sbjct  31    RKLKDVKIRKEDMNKLVMNFLVTEGYVEAAEKFRVESGT-EPDIDLATITDRMAVKKALQ  89

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV  AIE+   L P +L+ N  L+F L     +EL+ + K  EALEFAQ +LAP G+ 
Sbjct  90    SGNVEDAIEKVNDLNPTILDTNPQLYFHLQQQRLIELIRSGKIEEALEFAQEELAPRGEE  149

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              QS++E+LE  +ALLA+E+ +  P   LL +  R K A  LN AIL
Sbjct  150   NQSFLEELERTVALLAFEDVKNCPYGELLDVSQRLKTASELNAAIL  195



>gb|ETI45543.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETM45354.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETO74184.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
 gb|ETP43436.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=274

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 89/154 (58%), Gaps = 2/154 (1%)
 Frame = -3

Query  1010  VHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNVLKAIEQTE  831
             ++ +V+ YLV   +++  E+F   +G K P   L+ +++R  I    L+G + KA  +  
Sbjct  52    MNRLVMDYLVGKGYREVAEAFWRDSGTK-PHVDLQSVQERMSIQQLLLKGQIQKARGKLA  110

Query  830   QLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFG-KVQSYVEKLEDFM  654
              + P+ LEKN  + F L     +EL+      EAL+FA   LAPFG K   ++ ++E  M
Sbjct  111   SMDPEFLEKNSGMDFLLAKQELIELIKAHNIEEALQFAIKNLAPFGQKSPQFLHEIERTM  170

Query  653   ALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +++A++ P +SP+ HLL    R++VAD +N AIL
Sbjct  171   SVIAFKNPSESPLGHLLEQAQRRRVADEVNSAIL  204



>gb|KDP20916.1| hypothetical protein JCGZ_21387 [Jatropha curcas]
Length=226

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 98/181 (54%), Gaps = 5/181 (3%)
 Frame = -3

Query  1091  TNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYC  912
             T+K+ + R   +   ++   + +   D++ +V+++LV   + D  E F   +G  +PD  
Sbjct  3     TSKKVITREEWE---KKLNDVKIRKEDMNKLVMNFLVTEGYVDAAEKFRMESGT-EPDID  58

Query  911   LEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTE  732
             L  +  R  +      GNV  AIE+   L P++L+ N  L F L     +EL+   K  E
Sbjct  59    LATITDRMAVKKAVQSGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKVEE  118

Query  731   ALEFAQTKLAPFGKV-QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAI  555
             ALEFAQ +LAP G+  QS++E+LE  +ALLA+E+    P+  LL +  R K A  +N AI
Sbjct  119   ALEFAQEELAPRGEENQSFLEELERTVALLAFEDVTNCPVGELLDISQRLKTASEVNAAI  178

Query  554   L  552
             L
Sbjct  179   L  179



>ref|XP_010057466.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X4 [Eucalyptus grandis]
 gb|KCW74636.1| hypothetical protein EUGRSUZ_E03361 [Eucalyptus grandis]
Length=229

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             ++   + +   D++ +V+++LV   F D  E F   +G  +PD  L  +  R  +     
Sbjct  17    KRLNDVKIKKEDMNKLVMNFLVTEGFVDAAEKFRKESGT-EPDIDLSTITDRMAVKKAVQ  75

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV  AIE+   L P++L+ N  L F L     +EL+   K  EALEFAQ +LAP G+ 
Sbjct  76    CGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKVEEALEFAQEELAPRGEE  135

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              QS++E+LE  +ALLA+E+    P+  LL +  R K A  +N AIL
Sbjct  136   NQSFLEELERTVALLAFEDVSNCPVGDLLDMSQRLKTASEVNAAIL  181



>ref|XP_004535093.1| PREDICTED: glucose-induced degradation protein 8 homolog [Ceratitis 
capitata]
Length=229

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             R+ E      SD++ ++++YLV   FK+  E F    G+ +P   L  ++ R  I     
Sbjct  17    RKLEQFPYKQSDMNRLIMNYLVTEGFKEAAEKFQLEAGL-EPSVELSSLDDRILIREAVQ  75

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGK-  690
              G + +A     QL P+LL+ ++ L F L  L  +EL+   K  EAL FAQ KL+  G+ 
Sbjct  76    NGRIQEATHLVNQLHPELLDNDRYLFFHLQQLQLIELIRGGKIEEALTFAQNKLSEAGED  135

Query  689   VQSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
             +   + +LE  +ALLA+E+P+ SP   LL   +RQK+A  LN AIL
Sbjct  136   IPEALNELERTLALLAFEKPQNSPFSDLLEQSHRQKIASELNAAIL  181



>gb|EYU43405.1| hypothetical protein MIMGU_mgv1a012712mg [Erythranthe guttata]
Length=238

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 110/213 (52%), Gaps = 5/213 (2%)
 Frame = -3

Query  1103  FSGQTNKQTLCRLMMDVDPRQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQ  924
             F+  T+K+ + R   +   ++   + V   D++ +V+++LV   F +  E F   +G  +
Sbjct  11    FNIATSKKVITRADWE---KKLNDVKVKKEDMNKLVMNFLVTEGFVEAAEKFRFESGT-E  66

Query  923   PDYCLEDMEKRKRIFNFTLEGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTR  744
             PD  L  +  R  +      GNV  AIE+   L P++L+ N  L F L     +EL+   
Sbjct  67    PDIDLATITDRMEVKKAVQSGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNG  126

Query  743   KCTEALEFAQTKLAPFGKV-QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSL  567
             K  EALEFAQ +LAP G+  Q ++E+LE  +ALLA+E+    P+  LL +  R K A  +
Sbjct  127   KVEEALEFAQEELAPRGEENQGFLEELERTVALLAFEDVTNCPVGELLDISQRLKTASEV  186

Query  566   NRAILAHANLPSYSAVERLIQQITVVRQSLSQE  468
             N AIL   +      +  L++ +  V+  L ++
Sbjct  187   NAAILTSQSHEKDPKLPSLLKMLIWVQNQLDEK  219



>gb|KFM69936.1| hypothetical protein X975_06017, partial [Stegodyphus mimosarum]
Length=248

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 99/171 (58%), Gaps = 2/171 (1%)
 Frame = -3

Query  1034  TIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTLEGNV  855
             ++ +  +D++ ++++YLV   FK   E F   +G+ QP   L+ +++R +I +    G +
Sbjct  40    SLHMQRADMNRLIMNYLVTEGFKGAAEKFRIESGI-QPTVDLDTLDERIKIRDAIQNGKI  98

Query  854   LKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYV  675
              +AI     L P+LL+ ++ L F L   H +EL+  R   EAL++AQ +LA  G+    V
Sbjct  99    QEAIHLVNNLHPELLDCDRYLFFHLQQQHLIELIRERNIEEALKYAQEQLAERGEENKEV  158

Query  674   -EKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYS  525
               +LE  +ALLA++EPE+SP   LL   +RQK+A  +N +IL   N  S +
Sbjct  159   LSELERTLALLAFDEPERSPFGDLLHPSHRQKIASEVNASILEMENRESTT  209



>ref|XP_629459.1| hypothetical protein DDB_G0292780 [Dictyostelium discoideum AX4]
 gb|EAL61064.1| hypothetical protein DDB_G0292780 [Dictyostelium discoideum AX4]
Length=471

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 109/202 (54%), Gaps = 3/202 (1%)
 Frame = -3

Query  1019  DSDVHNIVLSYLVHNCFKDTVESFIASTGMKQP--DYCLEDMEKRKRIFNFTLEGNVLKA  846
             DS    +VLSYL+H+ + +TV+ F  +TG      +  L+D++ R+RI     +GN+ + 
Sbjct  265   DSISTQLVLSYLMHHGYSETVKLFAKATGTDGDSLNSQLDDIKNRQRISELLSKGNIDEV  324

Query  845   IEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKVQSYVE-K  669
             I++ + + P+ L +N+D+ F LL   F+E++ T    E + F Q +L+ F       E  
Sbjct  325   IKELDNIYPNFLTQNRDIQFKLLCQKFIEMIKTSPIEETMAFGQNQLSNFSFESKECESN  384

Query  668   LEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAILAHANLPSYSAVERLIQQITVV  489
             L +  +L+AY +P  SP+  LL    R ++ + LN A+L + + P+   +E++++Q  V 
Sbjct  385   LNEIFSLIAYSDPYTSPVSFLLEKSKRDQIINDLNCALLVYCHKPATPVLEKIVKQAKVA  444

Query  488   RQSLSQEPGKEGNLPFSLKDFL  423
                +  +         ++KDF+
Sbjct  445   IDQVVYQNASPAAAFINVKDFI  466



>ref|XP_011043244.1| PREDICTED: glucose-induced degradation protein 8 homolog [Populus 
euphratica]
Length=243

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 92/166 (55%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             ++   + +   D++ +V+++LV   + D  E F   +G  +PD  L  +  R  +     
Sbjct  32    KKLNDVKIRKEDMNKLVMNFLVTEGYVDAAEKFQMESGT-EPDIDLATITDRMAVKKAVQ  90

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV  AIE+   L P++L+ N  L F L    F+EL+   K  EALEFAQ +LAP G+ 
Sbjct  91    CGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRFIELIRNGKVEEALEFAQEELAPRGEE  150

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              QS++E+LE  +ALLA+E+    P+  LL +  R K A  +N AIL
Sbjct  151   NQSFLEELERTVALLAFEDVSNCPVGGLLDISQRLKTASEVNAAIL  196



>ref|XP_002316637.2| hypothetical protein POPTR_0011s04610g [Populus trichocarpa]
 ref|XP_006377312.1| hypothetical protein POPTR_0011s04610g [Populus trichocarpa]
 gb|EEE97249.2| hypothetical protein POPTR_0011s04610g [Populus trichocarpa]
 gb|ERP55109.1| hypothetical protein POPTR_0011s04610g [Populus trichocarpa]
Length=243

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 92/166 (55%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             ++   + +   D++ +V+++LV   + D  E F   +G  +PD  L  +  R  +     
Sbjct  32    KKLNDVKIRKEDMNKLVMNFLVTEGYVDAAEKFQMESGT-EPDIDLATITDRMAVKKAVQ  90

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV  AIE+   L P++L+ N  L F L    F+EL+   K  EALEFAQ +LAP G+ 
Sbjct  91    CGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRFIELIRNGKVEEALEFAQEELAPRGEE  150

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              QS++E+LE  +ALLA+E+    P+  LL +  R K A  +N AIL
Sbjct  151   NQSFLEELERTVALLAFEDVSNCPVGGLLDISQRLKTASEVNAAIL  196



>ref|XP_010057465.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X3 [Eucalyptus grandis]
Length=233

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             ++   + +   D++ +V+++LV   F D  E F   +G  +PD  L  +  R  +     
Sbjct  21    KRLNDVKIKKEDMNKLVMNFLVTEGFVDAAEKFRKESGT-EPDIDLSTITDRMAVKKAVQ  79

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV  AIE+   L P++L+ N  L F L     +EL+   K  EALEFAQ +LAP G+ 
Sbjct  80    CGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKVEEALEFAQEELAPRGEE  139

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              QS++E+LE  +ALLA+E+    P+  LL +  R K A  +N AIL
Sbjct  140   NQSFLEELERTVALLAFEDVSNCPVGDLLDMSQRLKTASEVNAAIL  185



>ref|XP_010041272.1| PREDICTED: glucose-induced degradation protein 8 homolog isoform 
X4 [Eucalyptus grandis]
Length=231

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 2/166 (1%)
 Frame = -3

Query  1046  RQYETIDVSDSDVHNIVLSYLVHNCFKDTVESFIASTGMKQPDYCLEDMEKRKRIFNFTL  867
             ++   + +   D++ +V+++LV   F D  E F   +G  +PD  L  +  R  +     
Sbjct  19    KRLNDVKIRKEDMNKLVMNFLVTEGFVDAAEKFRKESGT-EPDIDLSTITDRMAVKKAVQ  77

Query  866   EGNVLKAIEQTEQLAPDLLEKNKDLHFDLLSLHFVELVCTRKCTEALEFAQTKLAPFGKV  687
              GNV  AIE+   L P++L+ N  L F L     +EL+   K  EALEFAQ +LAP G+ 
Sbjct  78    CGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKVEEALEFAQEELAPRGEE  137

Query  686   -QSYVEKLEDFMALLAYEEPEKSPMFHLLSLEYRQKVADSLNRAIL  552
              QS++E+LE  +ALLA+E+    P+  LL +  R K A  +N AIL
Sbjct  138   NQSFLEELERTVALLAFEDVSNCPVGDLLDMSQRLKTASEVNAAIL  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3189754985028