BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c37927_g1_i1 len=970 path=[948:0-969]

Length=970
                                                                      Score     E

ref|XP_011092027.1|  PREDICTED: uncharacterized GPI-anchored prot...    196   8e-58   
ref|XP_009791750.1|  PREDICTED: uncharacterized GPI-anchored prot...    193   2e-56   
ref|XP_009592359.1|  PREDICTED: uncharacterized GPI-anchored prot...    192   2e-56   
ref|XP_004494624.1|  PREDICTED: uncharacterized GPI-anchored prot...    189   7e-55   
gb|EYU34849.1|  hypothetical protein MIMGU_mgv1a014351mg                181   4e-52   
ref|XP_008246485.1|  PREDICTED: uncharacterized GPI-anchored prot...    181   5e-52   
ref|XP_009349387.1|  PREDICTED: uncharacterized GPI-anchored prot...    181   9e-52   
ref|XP_010528873.1|  PREDICTED: uncharacterized GPI-anchored prot...    178   1e-50   
ref|XP_002512368.1|  conserved hypothetical protein                     176   4e-50   Ricinus communis
ref|XP_007205936.1|  hypothetical protein PRUPE_ppa011720mg             176   5e-50   
ref|XP_004302436.1|  PREDICTED: uncharacterized GPI-anchored prot...    175   1e-49   
ref|XP_008388580.1|  PREDICTED: uncharacterized GPI-anchored prot...    174   2e-49   
ref|XP_010105845.1|  hypothetical protein L484_002452                   170   9e-48   
ref|NP_001236105.1|  uncharacterized protein LOC100306255 precursor     169   3e-47   
ref|XP_006392478.1|  hypothetical protein EUTSA_v10023896mg             167   1e-46   
ref|XP_009123465.1|  PREDICTED: uncharacterized GPI-anchored prot...    166   3e-46   
ref|XP_006433302.1|  hypothetical protein CICLE_v10003231mg             165   1e-45   
ref|XP_006301039.1|  hypothetical protein CARUB_v10021431mg             164   2e-45   
ref|XP_004230183.1|  PREDICTED: uncharacterized GPI-anchored prot...    163   4e-45   
emb|CDY54670.1|  BnaAnng13320D                                          163   5e-45   
ref|NP_001238333.1|  uncharacterized protein LOC100499941 precursor     163   6e-45   
gb|KFK35608.1|  hypothetical protein AALP_AA4G013200                    162   8e-45   
gb|EPS61690.1|  hypothetical protein M569_13106                         162   8e-45   
ref|XP_003626300.1|  GPI-anchored protein, putative                     162   2e-44   
ref|XP_010046259.1|  PREDICTED: uncharacterized GPI-anchored prot...    162   3e-44   
ref|NP_564669.1|  Glycoprotein membrane precursor GPI-anchored          160   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472115.1|  PREDICTED: uncharacterized GPI-anchored prot...    159   6e-44   
ref|XP_010511226.1|  PREDICTED: uncharacterized GPI-anchored prot...    160   1e-43   
ref|XP_002894608.1|  predicted protein                                  160   1e-43   
gb|KDO59501.1|  hypothetical protein CISIN_1g031010mg                   158   2e-43   
gb|KDP23526.1|  hypothetical protein JCGZ_23359                         159   2e-43   
ref|XP_006361857.1|  PREDICTED: uncharacterized GPI-anchored prot...    157   5e-43   
ref|XP_010414928.1|  PREDICTED: uncharacterized GPI-anchored prot...    157   8e-43   
ref|XP_010480200.1|  PREDICTED: uncharacterized GPI-anchored prot...    157   9e-43   
ref|XP_008370632.1|  PREDICTED: uncharacterized protein LOC103434100    164   1e-42   
ref|XP_002284816.1|  PREDICTED: uncharacterized GPI-anchored prot...    156   2e-42   Vitis vinifera
ref|XP_009760084.1|  PREDICTED: uncharacterized GPI-anchored prot...    154   9e-42   
ref|XP_009603252.1|  PREDICTED: uncharacterized GPI-anchored prot...    154   2e-41   
gb|KHG08773.1|  hypothetical protein F383_36183                         154   2e-41   
ref|XP_006382609.1|  hypothetical protein POPTR_0005s03730g             153   4e-41   
gb|AFK45700.1|  unknown                                                 152   1e-40   
ref|XP_010674765.1|  PREDICTED: uncharacterized GPI-anchored prot...    149   9e-40   
gb|KGN60896.1|  hypothetical protein Csa_2G021670                       148   1e-39   
ref|XP_008454814.1|  PREDICTED: uncharacterized GPI-anchored prot...    149   2e-39   
ref|XP_007157162.1|  hypothetical protein PHAVU_002G047800g             148   2e-39   
ref|XP_004139359.1|  PREDICTED: uncharacterized GPI-anchored prot...    147   2e-39   
ref|XP_007206203.1|  hypothetical protein PRUPE_ppa014919mg             148   3e-39   
ref|XP_007147058.1|  hypothetical protein PHAVU_006G092700g             147   4e-39   
ref|XP_011036964.1|  PREDICTED: uncharacterized GPI-anchored prot...    150   4e-39   
ref|XP_009349386.1|  PREDICTED: uncharacterized GPI-anchored prot...    147   5e-39   
ref|XP_008388581.1|  PREDICTED: uncharacterized GPI-anchored prot...    147   7e-39   
gb|KHN35193.1|  Putative GPI-anchored protein                           147   9e-39   
ref|XP_010039910.1|  PREDICTED: uncharacterized GPI-anchored prot...    147   1e-38   
ref|XP_003610667.1|  GPI-anchored protein, putative                     146   1e-38   
gb|AFK40502.1|  unknown                                                 146   1e-38   
ref|NP_001238716.1|  uncharacterized protein LOC100306685 precursor     145   5e-38   
ref|XP_004305006.1|  PREDICTED: uncharacterized GPI-anchored prot...    144   8e-38   
ref|XP_007030861.1|  Glycoprotein membrane precursor GPI-anchored...    143   2e-37   
ref|NP_001236961.1|  uncharacterized protein LOC100306063 precursor     143   2e-37   
gb|KHN02689.1|  Putative GPI-anchored protein                           143   2e-37   
ref|XP_007034667.1|  Glycoprotein membrane precursor GPI-anchored       143   3e-37   
ref|XP_007143213.1|  hypothetical protein PHAVU_007G053500g             142   4e-37   
ref|XP_010035346.1|  PREDICTED: uncharacterized GPI-anchored prot...    142   8e-37   
ref|XP_008246484.1|  PREDICTED: uncharacterized GPI-anchored prot...    141   8e-37   
gb|KHG14473.1|  hypothetical protein F383_18736                         141   1e-36   
ref|NP_001238272.1|  uncharacterized protein LOC100499681 precursor     140   4e-36   
ref|XP_003536083.1|  PREDICTED: uncharacterized GPI-anchored prot...    140   4e-36   
gb|KHN16132.1|  Putative GPI-anchored protein                           139   5e-36   
ref|NP_001241609.1|  uncharacterized protein LOC100814074 precursor     139   6e-36   
emb|CAN77026.1|  hypothetical protein VITISV_015337                     140   1e-35   Vitis vinifera
ref|XP_008370496.1|  PREDICTED: uncharacterized GPI-anchored prot...    139   1e-35   
ref|XP_004511342.1|  PREDICTED: uncharacterized GPI-anchored prot...    139   1e-35   
gb|EYU45624.1|  hypothetical protein MIMGU_mgv1a014390mg                138   1e-35   
ref|XP_002281089.1|  PREDICTED: uncharacterized GPI-anchored prot...    138   1e-35   Vitis vinifera
ref|XP_004496769.1|  PREDICTED: uncharacterized GPI-anchored prot...    138   2e-35   
ref|XP_004229419.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   3e-35   
ref|XP_008449574.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   4e-35   
ref|XP_003591096.1|  GPI-anchored protein, putative                     137   4e-35   
ref|XP_008222969.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   4e-35   
ref|NP_001238118.1|  uncharacterized protein LOC100527063 precursor     137   4e-35   
ref|XP_011071553.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   4e-35   
ref|XP_008222968.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   5e-35   
gb|KHG10664.1|  hypothetical protein F383_12212                         136   1e-34   
gb|AFK45707.1|  unknown                                                 135   2e-34   
ref|XP_007223465.1|  hypothetical protein PRUPE_ppa011639mg             135   2e-34   
ref|XP_006489329.1|  PREDICTED: uncharacterized GPI-anchored prot...    135   3e-34   
gb|KEH43907.1|  glycoprotein membrane precursor GPI-anchored protein    134   7e-34   
ref|XP_009364203.1|  PREDICTED: uncharacterized GPI-anchored prot...    134   8e-34   
ref|XP_010255930.1|  PREDICTED: uncharacterized GPI-anchored prot...    133   1e-33   
ref|XP_006349221.1|  PREDICTED: uncharacterized GPI-anchored prot...    133   1e-33   
ref|XP_010486087.1|  PREDICTED: uncharacterized GPI-anchored prot...    133   1e-33   
ref|XP_010435264.1|  PREDICTED: uncharacterized GPI-anchored prot...    133   1e-33   
ref|XP_003562564.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   3e-33   
gb|KDO74741.1|  hypothetical protein CISIN_1g029481mg                   132   3e-33   
ref|XP_008353251.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   4e-33   
ref|XP_006850720.1|  hypothetical protein AMTR_s00025p00038290          132   4e-33   
ref|XP_004140158.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   5e-33   
ref|XP_004156068.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   6e-33   
ref|XP_002884553.1|  hypothetical protein ARALYDRAFT_477902             131   9e-33   
ref|XP_010464168.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   9e-33   
ref|XP_006378153.1|  hypothetical protein POPTR_0010s04230g             130   1e-32   
gb|AAM65942.1|  unknown                                                 130   1e-32   
ref|NP_566267.1|  glycoprotein membrane precursor GPI-anchored pr...    130   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004296918.1|  PREDICTED: uncharacterized GPI-anchored prot...    130   2e-32   
ref|XP_002871873.1|  hypothetical protein ARALYDRAFT_488808             129   3e-32   
ref|NP_197426.1|  GPI-anchored glycoprotein membrane precursor          129   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010102037.1|  hypothetical protein L484_000169                   129   4e-32   
ref|XP_008390848.1|  PREDICTED: uncharacterized GPI-anchored prot...    129   6e-32   
ref|XP_002871874.1|  hypothetical protein ARALYDRAFT_909958             128   7e-32   
ref|NP_001060451.2|  Os07g0645000                                       128   8e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002512367.1|  conserved hypothetical protein                     128   9e-32   Ricinus communis
ref|XP_006658043.1|  PREDICTED: uncharacterized GPI-anchored prot...    128   9e-32   
gb|KDP40135.1|  hypothetical protein JCGZ_02133                         128   1e-31   
emb|CDO99015.1|  unnamed protein product                                127   2e-31   
gb|EAZ04901.1|  hypothetical protein OsI_27083                          128   2e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_004495734.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   2e-31   
ref|XP_009338464.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   2e-31   
ref|XP_006288709.1|  hypothetical protein CARUB_v10002019mg             127   2e-31   
ref|XP_004517228.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   2e-31   
ref|XP_008795128.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   2e-31   
ref|XP_010492980.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   3e-31   
emb|CDY27716.1|  BnaA05g31250D                                          127   3e-31   
ref|XP_009129633.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   4e-31   
ref|XP_010666770.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   5e-31   
emb|CDY05224.1|  BnaC05g45790D                                          126   5e-31   
ref|XP_007144739.1|  hypothetical protein PHAVU_007G180700g             126   5e-31   
ref|XP_006298596.1|  hypothetical protein CARUB_v10014680mg             126   5e-31   
ref|XP_002312709.2|  hypothetical protein POPTR_0008s19950g             126   6e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011034215.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   6e-31   
ref|XP_010524805.1|  PREDICTED: uncharacterized GPI-anchored prot...    125   1e-30   
ref|XP_008450653.1|  PREDICTED: uncharacterized GPI-anchored prot...    125   1e-30   
ref|XP_009126313.1|  PREDICTED: uncharacterized GPI-anchored prot...    125   2e-30   
ref|XP_006407992.1|  hypothetical protein EUTSA_v10021555mg             125   2e-30   
ref|XP_002517197.1|  conserved hypothetical protein                     124   2e-30   Ricinus communis
gb|KDP23527.1|  hypothetical protein JCGZ_23360                         124   4e-30   
ref|XP_011010797.1|  PREDICTED: uncharacterized GPI-anchored prot...    124   4e-30   
gb|EMT17592.1|  hypothetical protein F775_44025                         125   5e-30   
ref|XP_004166034.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   9e-30   
ref|XP_008795129.1|  PREDICTED: uncharacterized GPI-anchored prot...    122   9e-30   
ref|XP_004135621.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   1e-29   
ref|XP_010454194.1|  PREDICTED: uncharacterized GPI-anchored prot...    122   1e-29   
ref|XP_009124942.1|  PREDICTED: uncharacterized GPI-anchored prot...    122   2e-29   
ref|NP_001149922.1|  LOC100283550 precursor                             122   2e-29   Zea mays [maize]
ref|XP_002463282.1|  hypothetical protein SORBIDRAFT_02g041150          122   2e-29   Sorghum bicolor [broomcorn]
ref|XP_010424180.1|  PREDICTED: uncharacterized GPI-anchored prot...    121   2e-29   
emb|CDY49994.1|  BnaC03g34510D                                          121   4e-29   
emb|CDY47208.1|  BnaAnng08780D                                          121   4e-29   
ref|XP_004958511.1|  PREDICTED: uncharacterized GPI-anchored prot...    121   4e-29   
ref|XP_010093991.1|  hypothetical protein L484_007337                   124   7e-29   
gb|EMS50332.1|  hypothetical protein TRIUR3_23618                       122   9e-29   
gb|ACF85600.1|  unknown                                                 119   2e-28   Zea mays [maize]
emb|CDY58332.1|  BnaA03g57350D                                          119   4e-28   
emb|CDY47207.1|  BnaAnng08770D                                          118   4e-28   
emb|CDY02572.1|  BnaC02g08630D                                          122   6e-28   
ref|XP_010278076.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   9e-28   
ref|XP_010938856.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   1e-27   
ref|XP_006400481.1|  hypothetical protein EUTSA_v10014774mg             117   1e-27   
ref|XP_009134868.1|  PREDICTED: uncharacterized GPI-anchored prot...    116   2e-27   
ref|XP_010938855.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   2e-27   
ref|XP_009126312.1|  PREDICTED: uncharacterized GPI-anchored prot...    115   4e-27   
ref|XP_009404701.1|  PREDICTED: uncharacterized GPI-anchored prot...    115   4e-27   
ref|XP_008777289.1|  PREDICTED: uncharacterized GPI-anchored prot...    113   2e-26   
ref|XP_008777288.1|  PREDICTED: uncharacterized GPI-anchored prot...    113   2e-26   
ref|XP_008777287.1|  PREDICTED: uncharacterized GPI-anchored prot...    113   4e-26   
ref|XP_009403830.1|  PREDICTED: uncharacterized GPI-anchored prot...    112   9e-26   
ref|XP_003591101.1|  GPI-anchored protein, putative                     112   1e-25   
ref|XP_010418920.1|  PREDICTED: uncharacterized GPI-anchored prot...    109   1e-25   
ref|XP_010454193.1|  PREDICTED: uncharacterized GPI-anchored prot...    110   3e-25   
gb|KFK38039.1|  hypothetical protein AALP_AA3G062300                    108   2e-24   
ref|XP_010492978.1|  PREDICTED: uncharacterized GPI-anchored prot...    107   5e-24   
ref|XP_006286569.1|  hypothetical protein CARUB_v10002011mg             107   7e-24   
ref|XP_010420720.1|  PREDICTED: uncharacterized GPI-anchored prot...    105   2e-23   
ref|XP_010420723.1|  PREDICTED: uncharacterized GPI-anchored prot...    105   3e-23   
ref|XP_010454192.1|  PREDICTED: uncharacterized GPI-anchored prot...    104   6e-23   
ref|XP_006375767.1|  hypothetical protein POPTR_0013s02470g             101   9e-23   
ref|XP_010492979.1|  PREDICTED: uncharacterized GPI-anchored prot...    101   6e-22   
ref|XP_011023590.1|  PREDICTED: uncharacterized GPI-anchored prot...  93.2    8e-20   
ref|XP_008454803.1|  PREDICTED: uncharacterized GPI-anchored prot...  94.0    5e-19   
gb|AAO42835.1|  At5g19240                                             92.4    9e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60328.1|  unknown                                               92.0    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197425.1|  GPI-anchored glycoprotein membrane precursor        92.0    1e-18   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43828.1|  unknown protein                                      90.1    1e-18   
gb|ABR67420.1|  GPI-anchored protein-like protein                     94.0    3e-18   Cucumis melo [Oriental melon]
ref|XP_006382607.1|  hypothetical protein POPTR_0005s03710g           90.5    3e-18   
ref|NP_197424.1|  GPI-anchored glycoprotein membrane precursor        89.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036773.1|  PREDICTED: uncharacterized GPI-anchored prot...  86.7    7e-17   
ref|XP_003591097.1|  GPI-anchored protein, putative                   85.5    1e-16   
ref|XP_006382608.1|  hypothetical protein POPTR_0005s03720g           83.6    9e-16   
ref|XP_011036774.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.0    3e-15   
gb|ABK94613.1|  unknown                                               81.6    4e-15   Populus trichocarpa [western balsam poplar]
gb|KGN60894.1|  hypothetical protein Csa_2G021650                     81.3    4e-15   
gb|KGN60893.1|  hypothetical protein Csa_2G021640                     80.1    2e-14   
ref|XP_008454795.1|  PREDICTED: uncharacterized GPI-anchored prot...  78.6    8e-14   
ref|XP_002981119.1|  hypothetical protein SELMODRAFT_37468            71.2    1e-11   
ref|XP_002982590.1|  hypothetical protein SELMODRAFT_37466            71.2    1e-11   
ref|XP_002319547.1|  hypothetical protein POPTR_0013s02460g           69.7    8e-11   Populus trichocarpa [western balsam poplar]
ref|XP_006419855.1|  hypothetical protein CICLE_v10007213mg           66.2    3e-10   
ref|XP_001775611.1|  predicted protein                                65.5    1e-09   
gb|AFK48797.1|  unknown                                               64.3    2e-09   
gb|AAN60255.1|  unknown                                               63.9    3e-09   
gb|EPS60021.1|  hypothetical protein M569_14784                       47.4    8e-04   



>ref|XP_011092027.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Sesamum 
indicum]
Length=186

 Score =   196 bits (498),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +1

Query  175  VFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG  354
            + LL S+ V+ D+EEDHLLQGINS+RQS ++PALAKHDKANC+A +IAD++ED+ C    
Sbjct  11   IILLLSVPVQSDEEEDHLLQGINSFRQSSNVPALAKHDKANCVADEIADQLEDKHCASNT  70

Query  355  APSSPPR-VANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLND  531
            AP +  + ++N    L KC ID NTT+DGM++PVCV  RV TLVLTNYTQS  N++YLND
Sbjct  71   APPAQSQLISNYPSVLKKCDIDVNTTRDGMILPVCVPHRVATLVLTNYTQS-HNSRYLND  129

Query  532  SKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAG  630
            S++TG GIGTEDDWTVLVLTTNT  G FA  AG
Sbjct  130  SRFTGAGIGTEDDWTVLVLTTNTPGGSFASGAG  162



>ref|XP_009791750.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Nicotiana sylvestris]
Length=194

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG-APSSPPR  375
            V CDDEE H+L GINSYRQS +LPAL KHDKA+CLA +IADE++++ CPR G  P   P+
Sbjct  24   VNCDDEEGHVLSGINSYRQSHNLPALTKHDKADCLADEIADEMQNQPCPRGGITPGPAPQ  83

Query  376  VANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGI  555
             A   K LDKC ID NTT DG+++PVCV  RV TLVLTNYTQS Q+A++LN+SKY+G GI
Sbjct  84   FAQYPKLLDKCDIDINTTADGIILPVCVHDRVATLVLTNYTQS-QHARFLNNSKYSGAGI  142

Query  556  GTEDDWTVLVLTTNTQTGMFAPPA  627
            G EDDWTVLVLTTNT  G FA  A
Sbjct  143  GAEDDWTVLVLTTNTAGGSFASGA  166



>ref|XP_009592359.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Nicotiana 
tomentosiformis]
Length=193

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 127/174 (73%), Gaps = 9/174 (5%)
 Frame = +1

Query  145  SSLRLSAAICVFLLASL----SVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGK  312
            +SLR+  A  +FL A L     V CDDE  H+L GINSYRQS +LPAL KHDKA+CLA +
Sbjct  2    ASLRVPPAAFLFLFAPLLIWAPVNCDDE-GHVLSGINSYRQSHNLPALTKHDKADCLADE  60

Query  313  IADEIEDEACPRPG-APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            IADE++++ CPR G  PS  P+     K LDKC ID NTT DG+++PVCV  RV TLVLT
Sbjct  61   IADEMQNQPCPRGGITPSPAPQFTQYPKLLDKCDIDINTTTDGIILPVCVHDRVATLVLT  120

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVRN  651
            NYTQS Q+ ++LN+SKY+G GIGTEDDWTVLVLTTNT  G FA  +GA + + +
Sbjct  121  NYTQS-QHVRFLNNSKYSGAGIGTEDDWTVLVLTTNTVGGSFA--SGATSLISH  171



>ref|XP_004494624.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Cicer arietinum]
Length=194

 Score =   189 bits (479),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 117/160 (73%), Gaps = 6/160 (4%)
 Frame = +1

Query  157  LSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDE  336
            L A++  F+L S  V C D+ED +L+GINSYRQ+K+LP L ++DKA+CLA ++ADEIED 
Sbjct  10   LLASVFTFILLSNPVHCSDKEDSVLKGINSYRQTKNLPPLYQNDKAHCLADEVADEIEDT  69

Query  337  ACPRPG------APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYT  498
             C +         P    R+ NLQKH+DKCGI+ NTT DG+++PVCV K  PT+VL+NYT
Sbjct  70   PCEKVSQYYPVSGPGGNQRIPNLQKHIDKCGININTTADGVILPVCVSKLEPTIVLSNYT  129

Query  499  QSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
             S   AK+LN+SKYTG G+G+EDDW VLVLTTNT  G F+
Sbjct  130  HSDIYAKFLNNSKYTGAGLGSEDDWMVLVLTTNTTAGTFS  169



>gb|EYU34849.1| hypothetical protein MIMGU_mgv1a014351mg [Erythranthe guttata]
Length=192

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 111/145 (77%), Gaps = 2/145 (1%)
 Frame = +1

Query  196  SVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPPR  375
            SV CDDEE++LLQGINS+RQS   PALAKHDKA C+A +IA+++E ++C     P +  +
Sbjct  30   SVYCDDEENNLLQGINSFRQSSRAPALAKHDKAECVADQIANQLEHQSCASNTLPPTQSQ  89

Query  376  V-ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVG  552
            + +N    L KC ID NTTKDGM++PVCV  RV TLVLTNYTQS QN+KYLNDS++TG G
Sbjct  90   LMSNYPNVLKKCKIDVNTTKDGMILPVCVPHRVSTLVLTNYTQS-QNSKYLNDSRFTGAG  148

Query  553  IGTEDDWTVLVLTTNTQTGMFAPPA  627
            IG EDDWTVLVLTT+T  G FA  A
Sbjct  149  IGKEDDWTVLVLTTSTPGGSFASGA  173



>ref|XP_008246485.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250 [Prunus 
mume]
Length=199

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 116/151 (77%), Gaps = 5/151 (3%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP--GA---PSSPP  372
            D++ED+LLQGINSYR+S +LP L K+D A CLA +IADEIED  C  P  GA   PSS  
Sbjct  29   DEDEDNLLQGINSYRRSLNLPVLVKNDNAGCLADRIADEIEDLPCSSPTNGANILPSSQS  88

Query  373  RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVG  552
             +ANL KHL KC ID N+T+DG+++PVCV K VPTLVLTNYT SP+ AKYLNDS+++GVG
Sbjct  89   PLANLPKHLRKCKIDANSTQDGVILPVCVPKLVPTLVLTNYTHSPKYAKYLNDSRFSGVG  148

Query  553  IGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            +G+ED+W V+VL ++  +G FA  AG+  ++
Sbjct  149  VGSEDNWAVVVLASSNPSGNFANAAGSLVSM  179



>ref|XP_009349387.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Pyrus x bretschneideri]
Length=199

 Score =   181 bits (459),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 117/173 (68%), Gaps = 5/173 (3%)
 Frame = +1

Query  130  SMAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAG  309
            S+   S      A  + LLA L    D +ED LLQGINSYR S +LPAL K+  A CLA 
Sbjct  3    SLIKLSFFFFVIAHSLVLLAPLVQSSDKDEDSLLQGINSYRTSLNLPALVKNGNAGCLAD  62

Query  310  KIADEIEDEACPRP--GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVP  474
            KIAD++ED+ C  P  GA    +S   +ANL KHL KC ID N+  DG+++PVCV K VP
Sbjct  63   KIADDMEDQPCSSPTNGANILATSQTPLANLPKHLGKCKIDANSASDGVILPVCVPKLVP  122

Query  475  TLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGA  633
            TLVLTNYT  PQ AKYLND+K+TGVG+G+EDDW V+VL +NT TG FA  A +
Sbjct  123  TLVLTNYTHQPQFAKYLNDTKFTGVGLGSEDDWMVVVLASNTPTGSFANAASS  175



>ref|XP_010528873.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Tarenaya 
hassleriana]
Length=197

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 118/167 (71%), Gaps = 11/167 (7%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            + V L AS S  C++EED+LLQG+NSYR ++ L   +K+DKA+CLA +IAD++EDE C  
Sbjct  16   LSVLLFASSSGLCNEEEDNLLQGLNSYRTAQRLAPFSKNDKADCLADEIADKLEDEPCTN  75

Query  349  --------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQS  504
                    PG  S PPR++N Q  L KC ID N T+DG+++PVCV KRVPTLVLTNYT +
Sbjct  76   HTALNDVVPG--SVPPRISNYQDLLSKCKIDPNKTRDGLILPVCVPKRVPTLVLTNYTHT  133

Query  505  PQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
               ++YLNDS+Y G G+G+ED+W V+VLTTNT  G FA  A   ATV
Sbjct  134  AY-SQYLNDSRYVGAGVGSEDEWMVVVLTTNTPAGSFASGASPVATV  179



>ref|XP_002512368.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49820.1| conserved hypothetical protein [Ricinus communis]
Length=190

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 114/148 (77%), Gaps = 3/148 (2%)
 Frame = +1

Query  175  VFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG  354
            +FL +S  V  DD+E+ +LQGINSYR S  LPAL K+DKA CLA ++AD+++D+ C   G
Sbjct  17   IFLFSSPLVLADDKENSVLQGINSYRTSLQLPALTKNDKAGCLADEVADKLQDQPCSSAG  76

Query  355  APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDS  534
            A S   +++N  + L KCGID N T+DG V+PVCV K VPTLVLTNYT + Q+AKY+NDS
Sbjct  77   ASSV--QLSNYPELLSKCGIDINHTRDGAVLPVCVPKLVPTLVLTNYTHT-QHAKYINDS  133

Query  535  KYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            +YTGVGIG+EDDW V+VL+TNT +G FA
Sbjct  134  RYTGVGIGSEDDWMVVVLSTNTPSGSFA  161



>ref|XP_007205936.1| hypothetical protein PRUPE_ppa011720mg [Prunus persica]
 gb|EMJ07135.1| hypothetical protein PRUPE_ppa011720mg [Prunus persica]
Length=199

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 115/151 (76%), Gaps = 5/151 (3%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP--GA---PSSPP  372
            D+++D+LLQGINSYR+S +LP L K+D A CLA +IAD+IED  C  P  GA   PSS  
Sbjct  29   DEDDDNLLQGINSYRRSLNLPVLIKNDNAGCLADRIADDIEDLPCSSPTNGANILPSSQS  88

Query  373  RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVG  552
             +ANL KHL KC ID N+T+DG+++PVCV K VPTLVLTNYT SP+  KYLNDS+++GVG
Sbjct  89   PLANLPKHLRKCKIDANSTQDGVILPVCVPKLVPTLVLTNYTHSPKYVKYLNDSRFSGVG  148

Query  553  IGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            +G+ED+W V+VL ++  +G FA  AG+  ++
Sbjct  149  VGSEDNWAVVVLASSNPSGNFANAAGSLVSM  179



>ref|XP_004302436.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Fragaria vesca subsp. vesca]
Length=200

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 12/171 (7%)
 Frame = +1

Query  142  SSSLRLSAAICVFLLASLS----VRCDDE--EDHLLQGINSYRQSKSLPALAKHDKANCL  303
            +S ++L     +F+ A+L     V  D E  ED +LQGINSYR+S SLPAL KHDKA+CL
Sbjct  2    ASLIKLCFFFLLFIQATLLLSPLVHSDREANEDDVLQGINSYRRSLSLPALIKHDKADCL  61

Query  304  AGKIADEIEDEACPRP--GAPSSPPRVA----NLQKHLDKCGIDGNTTKDGMVVPVCVRK  465
            AG+IAD+I D+ C     GA  SP  V+    +L  +L KC ID N+T DG+++PVCV K
Sbjct  62   AGEIADDINDQPCSSRTNGANISPASVSTDLPSLPSNLIKCKIDVNSTVDGVIMPVCVPK  121

Query  466  RVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
             V TLVLTNYT SP  AK+LNDS++TGVG+GTEDDWTV+VL T+T+TG FA
Sbjct  122  AVATLVLTNYTSSPHYAKFLNDSRFTGVGVGTEDDWTVVVLATSTRTGSFA  172



>ref|XP_008388580.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Malus domestica]
Length=201

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 111/156 (71%), Gaps = 5/156 (3%)
 Frame = +1

Query  181  LLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP--G  354
            LL+ L    D +ED LLQGINSYR S +LPAL K+  A CLA +IAD++ED+ C  P  G
Sbjct  22   LLSPLVQSSDKDEDXLLQGINSYRTSLNLPALVKNGNAGCLADEIADDMEDQPCSSPTNG  81

Query  355  A---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYL  525
            A    +S   +ANL KHL KC ID N+  DG+++PVCV K VPTLVLTNYT  PQ AKYL
Sbjct  82   ANILATSQTPLANLPKHLGKCKIDANSASDGVILPVCVPKLVPTLVLTNYTHQPQFAKYL  141

Query  526  NDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGA  633
            ND+K+TGVG+G+EDDW V+VL +NT TG  A  A +
Sbjct  142  NDTKFTGVGLGSEDDWMVVVLASNTPTGSLANAASS  177



>ref|XP_010105845.1| hypothetical protein L484_002452 [Morus notabilis]
 gb|EXC06579.1| hypothetical protein L484_002452 [Morus notabilis]
Length=193

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 113/162 (70%), Gaps = 6/162 (4%)
 Frame = +1

Query  148  SLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEI  327
            SL     +  FLL   SV  +D+ED+LLQG+NSYRQS+ LP L K+ KA CLA +IADE+
Sbjct  7    SLLFFVLLHAFLLLPNSVLSNDDEDNLLQGLNSYRQSQRLPPLVKNGKAECLADEIADEM  66

Query  328  EDEACPRPG-----APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTN  492
            ED+ C         APS+  ++ N  K L KC ID NTT DG+++PVCV   VPTL+LTN
Sbjct  67   EDQPCTTFAAGANIAPSTQTQLTNYPKLLKKCKIDANTTSDGVILPVCVSNLVPTLLLTN  126

Query  493  YTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            YT +   AKYLN++KYTG G+G+EDDW V+VL+T+T TG F+
Sbjct  127  YTHTSY-AKYLNNTKYTGAGLGSEDDWMVVVLSTSTPTGSFS  167



>ref|NP_001236105.1| uncharacterized protein LOC100306255 precursor [Glycine max]
 gb|ACU14351.1| unknown [Glycine max]
 gb|KHN04001.1| Putative GPI-anchored protein [Glycine soja]
Length=200

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 122/173 (71%), Gaps = 10/173 (6%)
 Frame = +1

Query  151  LRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIE  330
            + L A+IC FL+ S  V C D+ED + +GINSYRQ++SL  L++  KA CLA ++A+EIE
Sbjct  9    IFLLASICAFLVFSNPVLCSDKEDSVFKGINSYRQTRSLVPLSQVSKATCLADEVAEEIE  68

Query  331  DEACPRPGA--PSSPP-----RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
               C       PSS P     ++ NLQKH++KC I+ NTT DG+++PVCV K  PT+VL+
Sbjct  69   KMPCENVNQYYPSSVPGSGNLKIPNLQKHINKCDINFNTTTDGVILPVCVSKLEPTIVLS  128

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            NYT S + A++LN+SKYTG G+G+EDDW VLVLTTNT TG F   + AA +VR
Sbjct  129  NYTHSDRYAQFLNNSKYTGAGLGSEDDWMVLVLTTNTTTGSF---SAAATSVR  178



>ref|XP_006392478.1| hypothetical protein EUTSA_v10023896mg [Eutrema salsugineum]
 gb|ESQ29764.1| hypothetical protein EUTSA_v10023896mg [Eutrema salsugineum]
Length=197

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 117/168 (70%), Gaps = 13/168 (8%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            + +F L S  V C+ EED+LLQG+NSYR ++ +P  AK+DKA+C+A +IAD++EDE C  
Sbjct  17   LLIFFLISTYVICNQEEDNLLQGLNSYRTAQRVPPFAKNDKADCVADEIADKLEDEPCTN  76

Query  349  --------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQS  504
                    PG  S PPR++N Q+ L +C +D N+T+D +++PVC+  RVPTL LTNYT +
Sbjct  77   HTTASTVTPG--SVPPRLSNYQEILSECKVDANSTRDALILPVCIPNRVPTLALTNYTHT  134

Query  505  PQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
               A+YLNDS+Y G G+G+E +W V+VLTT+T  G FA  +G A + R
Sbjct  135  GY-AQYLNDSRYVGAGVGSEKEWMVVVLTTSTPGGSFA--SGEAISAR  179



>ref|XP_009123465.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Brassica 
rapa]
Length=194

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 119/168 (71%), Gaps = 13/168 (8%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            + +F L S  V  + EED+LLQG+NSYR ++S+P  AK+DKA+C+A +IAD++EDE C  
Sbjct  14   LLIFSLISTYVISNQEEDNLLQGLNSYRTAQSVPPFAKNDKADCVADEIADKLEDEPCTN  73

Query  349  --------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQS  504
                    PG  S PPR++N Q  L +C +D N+T+DG+++PVC+  RVPTLVLTNYT +
Sbjct  74   HTTVSTITPG--SVPPRLSNYQDILSECKVDPNSTRDGLILPVCIPNRVPTLVLTNYTHT  131

Query  505  PQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
               A+YLNDS+Y G G+G+E +W V+VLTT+T  G F+  +G A ++R
Sbjct  132  -SYAQYLNDSRYVGAGVGSEKEWMVVVLTTSTPGGSFS--SGEATSLR  176



>ref|XP_006433302.1| hypothetical protein CICLE_v10003231mg [Citrus clementina]
 gb|ESR46542.1| hypothetical protein CICLE_v10003231mg [Citrus clementina]
Length=193

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 114/175 (65%), Gaps = 16/175 (9%)
 Frame = +1

Query  106  FPFLSIYLSMAPSSSLRLSAAICVFLLASLSVRC-DDEEDHLLQGINSYRQSKSLPALAK  282
            F FLS++   A             FLL  L V C +D+ED+LLQGINS+R S  +P L K
Sbjct  8    FVFLSVFFHAA-------------FLLPHL-VNCKNDDEDNLLQGINSFRTSLGIPVLTK  53

Query  283  HDKANCLAGKIADEIEDEACPRPGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVR  462
            H KA CLA ++A+++E++ C         P ++N  + + KC ID NTT+DG+V+PVCV 
Sbjct  54   HKKAACLADEVAEDLENQPCTSINIGVKSPPLSNFNRLVKKCDIDINTTRDGVVLPVCVH  113

Query  463  KRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPA  627
              VPTLVLTNYT S   A+YLN+SK+ G G+G+EDDW V+VLTTNT  G+FA  A
Sbjct  114  DLVPTLVLTNYTHSSY-AQYLNNSKFAGAGVGSEDDWMVVVLTTNTAAGIFASGA  167



>ref|XP_006301039.1| hypothetical protein CARUB_v10021431mg [Capsella rubella]
 gb|EOA33937.1| hypothetical protein CARUB_v10021431mg [Capsella rubella]
Length=197

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 117/169 (69%), Gaps = 14/169 (8%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            + +F L S SV  +  ED+LLQG+NSYR ++ +P  AK+DKA+C+A +IAD++ED+ C  
Sbjct  16   LLIFSLISTSVISNQAEDNLLQGLNSYRTAQKVPPFAKNDKADCVADEIADKLEDQPCTN  75

Query  349  ---------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQ  501
                     PG  S PP++ N Q+ L +C ID NTT+DG+++P+C+  R+PTL LTNYTQ
Sbjct  76   HTTASTTVVPG--SVPPQLTNFQEILSECKIDPNTTRDGLILPICIPNRIPTLALTNYTQ  133

Query  502  SPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            +   A+YLNDSKY G G+G+E +W V+VLTT++  G F   AG A +VR
Sbjct  134  TGY-ARYLNDSKYVGAGVGSEKEWMVVVLTTSSPGGSFV--AGEATSVR  179



>ref|XP_004230183.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Solanum 
lycopersicum]
Length=193

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  196  SVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG-APSSPP  372
            +V CDDEE H+L GINSYRQS SLPAL K DKA+CLA +IADE+E++ CP  G  P+   
Sbjct  23   TVNCDDEEGHVLSGINSYRQSHSLPALTKQDKADCLADEIADELENQPCPSGGITPAPAS  82

Query  373  RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVG  552
            + A   K LDKC I+ NTT +G+++PVCV  RV TLVLTNYTQS ++A YLN+SKYTG G
Sbjct  83   QFAQYPKPLDKCNININTTAEGVILPVCVHDRVATLVLTNYTQS-RHAGYLNNSKYTGAG  141

Query  553  IGTEDDWTVLVLTTNTQTGMF  615
            IGTE DWTV+VLTTNT  G F
Sbjct  142  IGTEKDWTVVVLTTNTVGGSF  162



>emb|CDY54670.1| BnaAnng13320D [Brassica napus]
Length=204

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 118/168 (70%), Gaps = 13/168 (8%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            + +F L S  V  + EED+LLQG+NSYR ++S+P  AK+DKA+C+A +IAD++EDE C  
Sbjct  10   LLIFSLISTYVISNQEEDNLLQGLNSYRTAQSVPPFAKNDKADCVADEIADKLEDEPCTN  69

Query  349  --------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQS  504
                    PG  S PPR++  Q  L +C +D N+T+DG+++PVC+  RVPTLVLTNYT +
Sbjct  70   HTTVSTITPG--SVPPRLSTYQDILSECKVDPNSTRDGLILPVCIPNRVPTLVLTNYTHT  127

Query  505  PQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
               A+YLNDS+Y G G+G+E +W V+VLTT+T  G F+  +G A ++R
Sbjct  128  SY-AQYLNDSRYVGAGVGSEKEWMVVVLTTSTPGGSFS--SGEATSLR  172



>ref|NP_001238333.1| uncharacterized protein LOC100499941 precursor [Glycine max]
 gb|ACU14289.1| unknown [Glycine max]
 gb|KHN43276.1| Putative GPI-anchored protein [Glycine soja]
Length=200

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 119/173 (69%), Gaps = 10/173 (6%)
 Frame = +1

Query  151  LRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIE  330
            + L A  C FL+ S  V C D+ED + +GINSYRQ+++L  L +  KA CLA ++A+EI+
Sbjct  9    IFLLALFCAFLVFSNPVLCSDKEDSVFKGINSYRQTRNLAPLNQVSKATCLADEVAEEID  68

Query  331  DEACPRPGA--PSSPP-----RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            +  C       PSS P     ++ NLQKH+DKC I+ N+T DG+++PVCV K  PT+VL+
Sbjct  69   NMPCENVNQYYPSSVPGSGNLKIPNLQKHIDKCDINFNSTTDGVILPVCVSKLEPTIVLS  128

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            NYT S   A++LN+SKYTG G+G+EDDW VLVLTTNT TG F   + AA +VR
Sbjct  129  NYTHSGSYAQFLNNSKYTGAGLGSEDDWMVLVLTTNTTTGSF---SAAATSVR  178



>gb|KFK35608.1| hypothetical protein AALP_AA4G013200 [Arabis alpina]
Length=190

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 121/180 (67%), Gaps = 16/180 (9%)
 Frame = +1

Query  133  MAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGK  312
            M+PS  +     + +  + S  V C+ EED+LLQG+NSYR ++ +P  AK+DKA+C+A +
Sbjct  1    MSPSFYI---IHLLILSMVSTYVICNQEEDNLLQGLNSYRTAQRVPPFAKNDKADCVADE  57

Query  313  IADEIEDEAC--------PRPGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKR  468
            IAD++E E C          PGA   PPR++N Q  L +C +D N T+DG+++PVC+  R
Sbjct  58   IADKLEGEPCTNHTTVNTVTPGA--VPPRLSNYQDILSECKVDPNNTRDGLILPVCIPNR  115

Query  469  VPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            VPTL LTNYTQ+   A+YLNDS+Y G G+G+E +W V+VLTT+T  G FA  +G A ++R
Sbjct  116  VPTLALTNYTQT-GYARYLNDSRYVGAGVGSEKEWMVVVLTTSTPGGSFA--SGEATSLR  172



>gb|EPS61690.1| hypothetical protein M569_13106 [Genlisea aurea]
Length=186

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPPRVANLQ  390
            D+EDHLLQGIN+YRQS  LP L+KHD A C+A +IADE E   C    +P+ P  +AN  
Sbjct  27   DDEDHLLQGINAYRQSLKLPPLSKHDAAGCIADEIADEFEHTKCNASLSPARPEPLANHA  86

Query  391  KHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDD  570
              L+KC ++ +TT D +V+PVCV  RV TLVLTNYT S  N +YLNDS++TG GIGT+DD
Sbjct  87   DALNKCKVNADTTGDAVVLPVCVPHRVATLVLTNYTTS-FNTRYLNDSRFTGAGIGTDDD  145

Query  571  WTVLVLTTNTQTG  609
            WTVLVLTT+T  G
Sbjct  146  WTVLVLTTSTVAG  158



>ref|XP_003626300.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|ABD32399.1| hypothetical protein MtrDRAFT_AC150244g26v2 [Medicago truncatula]
 gb|AES82518.1| glycoprotein membrane precursor GPI-anchored protein [Medicago 
truncatula]
Length=195

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 110/153 (72%), Gaps = 6/153 (4%)
 Frame = +1

Query  178  FLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG-  354
            FL  S      D+ED +L+GINS+RQ+K+L  L K+DKA+CLA ++A+EIED  C +   
Sbjct  17   FLFLSNPAHSSDKEDSVLKGINSFRQTKNLAPLNKNDKAHCLADEVAEEIEDTPCEKVNQ  76

Query  355  -----APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAK  519
                  P    R+ NLQKH+DKC I+ NTT DG+++PVCV K  PT+VL+NYT S   AK
Sbjct  77   YYPVSGPGGNQRIPNLQKHIDKCDININTTTDGVILPVCVSKLEPTVVLSNYTHSDIYAK  136

Query  520  YLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            +LN+SKYTGVG+G+EDDW VLVLTTNT TG F+
Sbjct  137  FLNNSKYTGVGLGSEDDWMVLVLTTNTTTGTFS  169



>ref|XP_010046259.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250 [Eucalyptus 
grandis]
Length=218

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 109/154 (71%), Gaps = 7/154 (5%)
 Frame = +1

Query  157  LSAAICV--FLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIE  330
            LS  + V    L S  V C+D+ED+LLQGINSYR S++LP LAK+DKANC A ++AD+I+
Sbjct  8    LSGFVLVHAIFLQSYPVVCNDDEDNLLQGINSYRTSQNLPQLAKNDKANCFADELADKID  67

Query  331  DEACPRPGAPSSPPRV----ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYT  498
            D+ C      ++ P V    ++ Q  L KC I  N T DG+++PVCV K VPTLVLTNYT
Sbjct  68   DQPCSATYGANTLPGVGLQSSSYQDALSKCKIHPNYTTDGVILPVCVAKLVPTLVLTNYT  127

Query  499  QSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNT  600
             SP   KYLNDS++TG G+G+EDDW V+VLTT+T
Sbjct  128  HSPYQ-KYLNDSRFTGAGVGSEDDWMVVVLTTST  160



>ref|NP_564669.1| Glycoprotein membrane precursor GPI-anchored [Arabidopsis thaliana]
 gb|AAG51126.1|AC069144_23 unknown protein [Arabidopsis thaliana]
 gb|AAC64895.1| ESTs gb|F13915 and gb|F13916 come from this gene [Arabidopsis 
thaliana]
 gb|AAM62696.1| unknown [Arabidopsis thaliana]
 gb|AAO41876.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50480.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33157.1| Glycoprotein membrane precursor GPI-anchored [Arabidopsis thaliana]
Length=200

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 115/170 (68%), Gaps = 13/170 (8%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            + +F L S  V  +  ED+LLQG+NSYR ++ +P  AK++KA+C+A +IAD++ED+ C  
Sbjct  16   LLIFSLISTCVVSNQAEDNLLQGLNSYRTAQRVPPFAKNEKADCVADEIADKLEDQPCTN  75

Query  349  --------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQS  504
                    PG  S PPR+ N Q  L +C ID NTT+DG+++PVC+  R+PTL LTNYTQ+
Sbjct  76   HTTASTVTPG--SVPPRLTNYQDILSECKIDPNTTRDGLILPVCIPNRIPTLALTNYTQT  133

Query  505  PQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP--PAGAAATVR  648
               A+YLNDS+Y G G+G+E +W V+VLTT+T  G F     AG A +VR
Sbjct  134  GY-ARYLNDSRYVGAGVGSEKEWMVVVLTTSTPGGSFTAGVAAGKATSVR  182



>ref|XP_006472115.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Citrus sinensis]
Length=167

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPPRVANLQ  390
            D+ED+LLQGINS+R S  +P L KH KA CLA ++A+++E++ C         P ++N  
Sbjct  4    DDEDNLLQGINSFRTSLGIPVLTKHKKAACLADEVAEDLENQPCTSINIGVKSPPLSNFN  63

Query  391  KHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDD  570
            + + KC ID NTT+DG+V+PVCV   VPTLVLTNYT S   A+YLN+SK+ G G+G+EDD
Sbjct  64   RLVKKCDIDINTTRDGVVLPVCVHDLVPTLVLTNYTHSSY-AQYLNNSKFAGAGVGSEDD  122

Query  571  WTVLVLTTNTQTGMFAPPA  627
            W V+VLTTNT  G+FA  A
Sbjct  123  WMVVVLTTNTAAGIFASGA  141



>ref|XP_010511226.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Camelina sativa]
Length=202

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 117/172 (68%), Gaps = 15/172 (9%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            + +F L S  V C+  ED+LLQG+NS+R ++ +P   K++KA+C+A +IAD++ED+ C  
Sbjct  16   LLIFSLISTCVICNQAEDNLLQGLNSHRTAQKVPPFTKNEKADCVADEIADKLEDQPCTN  75

Query  349  --------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQS  504
                    PG  S PP++ N Q  L +C ID +TT+DG+++PVC+  R+PTL LTNYTQ+
Sbjct  76   HSTAGTVTPG--SVPPQLTNYQDILSECKIDPSTTRDGLILPVCIPNRIPTLALTNYTQT  133

Query  505  PQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMF----APPAGAAATVR  648
               AKYLNDS+Y G G+G+E +W V+VLTT+T +G F    A  AG A +VR
Sbjct  134  GY-AKYLNDSRYVGAGVGSEKEWMVVVLTTSTPSGSFTAGKASSAGKATSVR  184



>ref|XP_002894608.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70867.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 120/185 (65%), Gaps = 16/185 (9%)
 Frame = +1

Query  133  MAPSSSLRLSAAICVFLLASL---SVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCL  303
            M   + + LS  I   L+ SL    V C+  ED+LLQG+NSYR ++ +P  AK++KA+C+
Sbjct  1    MVLITKMSLSFYIIHLLIFSLIPTCVICNQAEDNLLQGLNSYRTAQRVPPFAKNEKADCV  60

Query  304  AGKIADEIEDEACPR--------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCV  459
            A +IAD++ED+ C          PG  S PPR+ N Q  L +C ID NTT+D +++PVC+
Sbjct  61   ADEIADKLEDQPCTNHTTASTVTPG--SVPPRLTNYQDILSECKIDPNTTRDALILPVCI  118

Query  460  RKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP--PAGA  633
              R+PTL LTNYTQ+   A+YLNDS+Y G G+G+E +W V+VLTT+T  G F     AG 
Sbjct  119  PNRIPTLALTNYTQTGY-ARYLNDSRYVGAGVGSEKEWMVVVLTTSTPGGSFTAGVAAGE  177

Query  634  AATVR  648
            A +VR
Sbjct  178  ATSVR  182



>gb|KDO59501.1| hypothetical protein CISIN_1g031010mg [Citrus sinensis]
Length=167

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPPRVANLQ  390
            D+ED+LLQGINS+R S  +P L KH KA CLA ++A+++ED+ C         P ++N  
Sbjct  4    DDEDNLLQGINSFRTSLGIPVLTKHKKAACLADEVAEDLEDQPCTSINIGVKSPPLSNYN  63

Query  391  KHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDD  570
            + + KC ID NT +DG+V+PVCV   VPTLVLTNYT S   A+YLN+SK+ G G+G+EDD
Sbjct  64   RLVKKCDIDINTNRDGVVLPVCVHDLVPTLVLTNYTHSSY-AQYLNNSKFAGAGVGSEDD  122

Query  571  WTVLVLTTNTQTGMFAPPA  627
            W V+VLTTNT  G+FA  A
Sbjct  123  WMVVVLTTNTAAGIFASGA  141



>gb|KDP23526.1| hypothetical protein JCGZ_23359 [Jatropha curcas]
Length=188

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 117/166 (70%), Gaps = 15/166 (9%)
 Frame = +1

Query  145  SSLRLSAAICVFLLA----SLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAG  309
            +SL+L  ++ + LLA    S  V  D  +ED +LQGINSYR S  LP+LA++DKA+CLA 
Sbjct  2    ASLKLRISLFLMLLATALLSSPVLSDGTDEDKILQGINSYRTSLRLPSLAQNDKASCLAD  61

Query  310  KIADEIEDEACPRPGAPSSPPRVANLQKH---LDKCGIDGNTTKDGMVVPVCVRKRVPTL  480
            KIAD++ED  CP    P+  P     Q +   L+KCGID N T DG+V+PVCV K V TL
Sbjct  62   KIADKLEDRPCP----PT--PTTVQQQDYPELLEKCGIDSNHTTDGVVLPVCVPKLVQTL  115

Query  481  VLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            VLTNYT++  +AKYLNDS++TG G+G+EDDW V+VLTTNT  G FA
Sbjct  116  VLTNYTRT-DHAKYLNDSRFTGAGLGSEDDWMVVVLTTNTPGGNFA  160



>ref|XP_006361857.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Solanum tuberosum]
Length=166

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 104/136 (76%), Gaps = 2/136 (1%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG-APSSPPRVANL  387
            DEE H+L GINSYRQS +LPAL K DKA+CLA +IADE+E++ CP  G  P+   + A  
Sbjct  3    DEEGHVLSGINSYRQSHNLPALTKQDKADCLADEIADELENQPCPSGGITPAPASQFAQY  62

Query  388  QKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTED  567
             K LDKC ID NTT +G+++PVCV  RV TLVLTNYTQS ++A YLN+SKYTG GIGTE 
Sbjct  63   PKLLDKCDIDINTTAEGVILPVCVHNRVATLVLTNYTQS-RHAGYLNNSKYTGAGIGTEK  121

Query  568  DWTVLVLTTNTQTGMF  615
            DWTV+VLTTNT  G F
Sbjct  122  DWTVVVLTTNTVAGSF  137



>ref|XP_010414928.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Camelina sativa]
 ref|XP_010480202.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250 [Camelina 
sativa]
Length=196

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 115/172 (67%), Gaps = 15/172 (9%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            + +F L S  V C+  ED+LLQG+NS+R ++ +    K++KA+C+A +IAD++ED+ C  
Sbjct  10   LLIFSLISTCVICNQAEDNLLQGLNSHRTAQKVAPFTKNEKADCVADEIADKLEDQPCTN  69

Query  349  --------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQS  504
                    PG  S PP++ N Q  L +C ID NTT+DG+++PVC+  R+PTL LTNYTQ+
Sbjct  70   HSTAGTVTPG--SVPPQLTNYQDILSECKIDPNTTRDGLILPVCIPNRIPTLALTNYTQT  127

Query  505  PQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMF----APPAGAAATVR  648
               AKYLNDS+Y G G+G+E +W V+VLTT+T  G F    A  AG A +VR
Sbjct  128  GY-AKYLNDSRYVGAGVGSEKEWMVVVLTTSTPGGSFTAGKASSAGKATSVR  178



>ref|XP_010480200.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Camelina sativa]
Length=196

 Score =   157 bits (397),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 114/168 (68%), Gaps = 13/168 (8%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            + +F L S  V C+  ED+LLQG+NS+R ++ +    K++KA+C+A +IAD++ED+ C  
Sbjct  16   LLIFSLISTCVICNQAEDNLLQGLNSHRTAQKVAPFTKNEKADCVADEIADKLEDQPCTN  75

Query  349  --------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQS  504
                    PG  S PP++ N Q  L +C ID NTT+DG+++PVC+  R+PTL LTNYTQ+
Sbjct  76   HSTAGTVTPG--SVPPQLTNYQDILSECKIDPNTTRDGLILPVCIPNRIPTLALTNYTQT  133

Query  505  PQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
               AKYLNDS+Y G G+G+E +W V+VLTT+T  G F   AG A +VR
Sbjct  134  GY-AKYLNDSRYVGAGVGSEKEWMVVVLTTSTPGGSFT--AGKATSVR  178



>ref|XP_008370632.1| PREDICTED: uncharacterized protein LOC103434100 [Malus domestica]
Length=512

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 114/173 (66%), Gaps = 5/173 (3%)
 Frame = +1

Query  130  SMAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAG  309
            S+   S      A  + LL+ L    D +ED+LLQGINSYR S +LPAL K+  A CLA 
Sbjct  316  SLIELSCFFFVIAHSLLLLSPLVQGADKDEDNLLQGINSYRTSLNLPALVKNGNAGCLAE  375

Query  310  KIADEIEDEACPRP--GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVP  474
            +IAD++ED+ C  P  GA    ++P  +ANL KHL K  ID N+T  G+++P+CV   VP
Sbjct  376  QIADDMEDQPCSSPTNGANILATTPTPLANLPKHLSKXKIDANSTSAGVILPICVPHLVP  435

Query  475  TLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGA  633
            TLVLTNYT  PQ A+ LNDSK+TGVG+G+EDDW V+VL TN   G FA  A +
Sbjct  436  TLVLTNYTHRPQFAECLNDSKFTGVGLGSEDDWMVVVLATNNPAGSFANAASS  488



>ref|XP_002284816.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Vitis 
vinifera]
 emb|CBI36760.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 10/161 (6%)
 Frame = +1

Query  178  FLLASLS-------VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDE  336
            F L +LS       V CD E+D LLQG+NSYR +++L  L K+DKA CLA ++A E+E +
Sbjct  12   FFLVALSIHFTSTPVHCDAEDDDLLQGLNSYRTARNLSTLVKNDKAECLAEELAGELEHQ  71

Query  337  ACPRPGAPSSPP-RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQN  513
             C     P++P  ++AN    L KC ID N T+DG+++ VCV  RVPTLVLTN+TQS   
Sbjct  72   PCT-AAVPATPQLQLANYPSILKKCKIDINYTRDGVIMQVCVPHRVPTLVLTNFTQS-HY  129

Query  514  AKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAA  636
            ++YLNDSK+TGVG+G+EDDW V VL+TN   G F+  + AA
Sbjct  130  SRYLNDSKFTGVGVGSEDDWVVAVLSTNGIEGSFSGASRAA  170



>ref|XP_009760084.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009760085.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
isoform X2 [Nicotiana sylvestris]
Length=194

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 108/153 (71%), Gaps = 5/153 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA---PSS  366
            V+CDDEED+LL+GINSYR S +L AL ++DKA CLA ++AD+ +D+ C    GA   P +
Sbjct  23   VKCDDEEDNLLRGINSYRASLNLTALRENDKAKCLADEMADQFKDQPCTNTTGANTVPGT  82

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P+ ++  K L KC ++  TT+DGM++P C+   V  LVL+NYT+S Q + YLND+K++G
Sbjct  83   EPQFSDYPKLLSKCDLNATTTRDGMIMPACIPNLVSDLVLSNYTKS-QYSNYLNDTKFSG  141

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            VGIG++D+W V+VLTTN   G F P   +A  +
Sbjct  142  VGIGSDDNWVVVVLTTNNPEGSFTPDTSSANLI  174



>ref|XP_009603252.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Nicotiana tomentosiformis]
Length=194

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 107/150 (71%), Gaps = 5/150 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA---PSS  366
            V+CDDEED+LL+GINSYR S +L AL ++DKA CLA ++AD+ +D+ C    GA   P +
Sbjct  23   VKCDDEEDNLLRGINSYRASLNLTALRENDKAKCLADEMADQFKDQPCTNTTGANTVPGT  82

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P+ ++  K L KC ++  TT+DGM++P CV   V  LVL+NYT+S Q + YLND+K++G
Sbjct  83   EPQFSDYPKLLSKCDLNATTTRDGMIMPACVPNLVSDLVLSNYTKS-QYSNYLNDTKFSG  141

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAA  636
            VGIG++D+W V+VLTTN   G F P   +A
Sbjct  142  VGIGSDDNWIVVVLTTNNPEGSFTPDTSSA  171



>gb|KHG08773.1| hypothetical protein F383_36183 [Gossypium arboreum]
Length=200

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 113/172 (66%), Gaps = 11/172 (6%)
 Frame = +1

Query  133  MAPSSSLRLSAAICVFLLASLS----VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANC  300
            MA +S  + S    VF+LA  S    V  DDEEDHLLQG+NSYR S +LPA AK+  A C
Sbjct  1    MAAASLRQPSLTTFVFVLAIFSLSHRVYSDDEEDHLLQGLNSYRTSANLPAFAKNKNAEC  60

Query  301  LAGKIADEI-EDEACPRPGAPSSPP-----RVANLQKHLDKCGIDGNTTKDGMVVPVCVR  462
            +A +IAD++ +D+  P    PS+ P      ++   K + KC ID NTT D MV+PVCV 
Sbjct  61   VAKRIADDVSDDDNNPHCTNPSNSPGNNATGLSAYPKAISKCDIDANTTSDVMVLPVCVS  120

Query  463  KRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
              VPTLVLTN+T++   +KY+NDS +TG+G+ +EDDW V+VL++N  TG  A
Sbjct  121  NLVPTLVLTNFTRT-HYSKYINDSTFTGIGLSSEDDWMVVVLSSNKPTGSLA  171



>ref|XP_006382609.1| hypothetical protein POPTR_0005s03730g [Populus trichocarpa]
 gb|ERP60406.1| hypothetical protein POPTR_0005s03730g [Populus trichocarpa]
Length=213

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 110/167 (66%), Gaps = 2/167 (1%)
 Frame = +1

Query  118  SIYLSMAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKAN  297
            +I+L  +P     + A + + +     + C  EED LLQG+NSYR S +LPAL KH  A 
Sbjct  16   AIFLLSSPVHCGTVIAYLFLLMAFLFMISCLYEEDDLLQGLNSYRHSLNLPALVKHTNAG  75

Query  298  CLAGKIADEIEDEACPRPGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPT  477
            CLA KIA ++EDE C    A +SP ++ +    L KCGID N T +G+ +PVCV   VPT
Sbjct  76   CLADKIAGKLEDEPCTSARA-ASPVQIDDYPDLLSKCGIDVNHTNEGVALPVCVPHLVPT  134

Query  478  LVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            L+LTNYT++P  A+Y+N S+++G G+G EDDW V+VLTT+T  G FA
Sbjct  135  LLLTNYTRTPY-ARYINASRFSGAGLGHEDDWMVVVLTTSTPRGDFA  180



>gb|AFK45700.1| unknown [Lotus japonicus]
Length=202

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 111/170 (65%), Gaps = 6/170 (4%)
 Frame = +1

Query  148  SLRLSAAICVFLLASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADE  324
            SL     +C  LL S  V+CD DEED L QGIN YR+S +L +L K++ ANC A KIAD+
Sbjct  7    SLVFGLVLCSILLLSPPVKCDHDEEDDLYQGINKYRESLNLTSLTKNENANCFADKIADQ  66

Query  325  IEDEACPRP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTN  492
             + + C    GA   P + P+  N  K L KC ++ + T+DG V+P CV   V T+VLTN
Sbjct  67   FKKQPCTNTTGANTVPGTEPQFDNYPKLLTKCKLNISNTRDGSVMPACVPGLVSTVVLTN  126

Query  493  YTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAAT  642
            +TQS   ++ LNDSKY G+GIG+ED+W V+VLTT+T  G F P AG+ ++
Sbjct  127  FTQSLY-SQNLNDSKYAGIGIGSEDNWIVVVLTTDTSGGSFVPEAGSGSS  175



>ref|XP_010674765.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Beta 
vulgaris subsp. vulgaris]
Length=197

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 115/174 (66%), Gaps = 13/174 (7%)
 Frame = +1

Query  133  MAPSSSLRLSAAICVFLLAS------LSVRC-DDEEDHLLQGINSYRQSKSLPALAKHDK  291
            MAP+ S RL+ ++   LL        + V C DDEE+ LLQG+NSYR S  LP L K+ +
Sbjct  1    MAPTKSCRLACSLLFVLLLHAFLLLPVPVLCGDDEENSLLQGLNSYRNSLQLPPLTKNKQ  60

Query  292  ANCLAGKIADEIEDEACPRPGAPSSPP-----RVANLQKHLDKCGIDGNTTKDGMVVPVC  456
            A CLA ++ADEI+D  C    A ++ P     +  N  K L KC ID NTT +G+++PVC
Sbjct  61   AGCLADELADEIKDRPCVPTVAANAIPGGSATQFLNYPKLLKKCNIDPNTTGNGIILPVC  120

Query  457  VRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            VRK  PTLVLTNYT++   A+Y+NDS++TG G+G+EDDW V+VL T+T  G FA
Sbjct  121  VRKLEPTLVLTNYTRTGY-ARYVNDSRFTGAGLGSEDDWMVVVLATSTAGGSFA  173



>gb|KGN60896.1| hypothetical protein Csa_2G021670 [Cucumis sativus]
Length=176

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 102/146 (70%), Gaps = 6/146 (4%)
 Frame = +1

Query  193  LSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSS--  366
            +++  D+EED+LLQG+NSYRQ+++LP L K+ KA+C+A ++AD+ ED+ C      S+  
Sbjct  1    MNLIIDNEEDNLLQGLNSYRQAQNLPPLVKNAKADCVANEMADDAEDQPCAVTTTKSNVV  60

Query  367  ---PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSK  537
               P ++     + +KC +D NTT D +V+PVCV K V TL+LTNYT S Q AKYLNDS+
Sbjct  61   ASRPSQITKFPDYAEKCKVDINTTADAVVMPVCVPKLVQTLLLTNYTHS-QYAKYLNDSR  119

Query  538  YTGVGIGTEDDWTVLVLTTNTQTGMF  615
            + G G+G EDDW V+VLTT T  G F
Sbjct  120  FVGAGLGKEDDWMVVVLTTGTNAGSF  145



>ref|XP_008454814.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Cucumis 
melo]
 gb|ABR67421.1| GPI-anchored protein-like protein II [Cucumis melo subsp. melo]
Length=196

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 102/152 (67%), Gaps = 6/152 (4%)
 Frame = +1

Query  175  VFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG  354
            + LL    V   DEED+LLQG+NSYRQ+++LP L K+ KA+C+A ++AD+ ED+ C    
Sbjct  15   IALLFFSPVLSKDEEDNLLQGLNSYRQAQNLPPLVKNAKADCIANEMADDAEDQPCAVTT  74

Query  355  APSS-----PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAK  519
              S+     P ++     + +KC +D NTT D +V+PVCV K V TL+LTNYT S Q AK
Sbjct  75   TKSNVVASRPSQITKFPDYAEKCKVDINTTADAVVMPVCVPKLVQTLLLTNYTHS-QYAK  133

Query  520  YLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMF  615
            YLNDS++ G G+G EDDW V+VLTT T  G F
Sbjct  134  YLNDSRFVGAGLGKEDDWMVVVLTTGTNAGSF  165



>ref|XP_007157162.1| hypothetical protein PHAVU_002G047800g [Phaseolus vulgaris]
 gb|ESW29156.1| hypothetical protein PHAVU_002G047800g [Phaseolus vulgaris]
Length=197

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 110/170 (65%), Gaps = 6/170 (4%)
 Frame = +1

Query  151  LRLSAAICVFLLASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEI  327
            L  +  I   + +  SV+CD DEED L QGIN+YR+S  L +L K++ ANC A +IAD+ 
Sbjct  8    LLFTLLISSIIFSHHSVKCDHDEEDDLYQGINNYRKSLHLTSLIKNENANCFADEIADQF  67

Query  328  EDEACPRP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNY  495
            +++ C    GA   P + PR +N    L+KC ++ + T+DG V+PVCV   VP++VL N+
Sbjct  68   KNQPCTNTTGANTVPGTEPRFSNYPDLLNKCHLNISNTRDGSVMPVCVPGLVPSVVLANF  127

Query  496  TQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            TQS  +   LNDSK+TG+GIG+ED+W V+VLTTNT  G F P     A +
Sbjct  128  TQSLYSGN-LNDSKFTGIGIGSEDNWIVVVLTTNTPEGSFVPETSNGANL  176



>ref|XP_004139359.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Cucumis sativus]
 ref|XP_004156479.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Cucumis sativus]
Length=172

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 98/140 (70%), Gaps = 6/140 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSS-----PPR  375
            DEED+LLQG+NSYRQ+++LP L K+ KA+C+A ++AD+ ED+ C      S+     P +
Sbjct  3    DEEDNLLQGLNSYRQAQNLPPLVKNAKADCVANEMADDAEDQPCAVTTTKSNVVASRPSQ  62

Query  376  VANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGI  555
            +     + +KC +D NTT D +V+PVCV K V TL+LTNYT S Q AKYLNDS++ G G+
Sbjct  63   ITKFPDYAEKCKVDINTTADAVVMPVCVPKLVQTLLLTNYTHS-QYAKYLNDSRFVGAGL  121

Query  556  GTEDDWTVLVLTTNTQTGMF  615
            G EDDW V+VLTT T  G F
Sbjct  122  GKEDDWMVVVLTTGTNAGSF  141



>ref|XP_007206203.1| hypothetical protein PRUPE_ppa014919mg [Prunus persica]
 gb|EMJ07402.1| hypothetical protein PRUPE_ppa014919mg [Prunus persica]
Length=188

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 105/173 (61%), Gaps = 12/173 (7%)
 Frame = +1

Query  148  SLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEI  327
            SL L A I   L  S    C++EED + QG+NS++QS     L K+  A CLA +IADE+
Sbjct  7    SLFLLALINCLLFLSHPASCNEEEDKIFQGLNSFKQS-----LKKNSNAECLADEIADEL  61

Query  328  EDEACPRPG----APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNY  495
            ED+ C         P + P+     K + KC ID NTT DG+++PVCV    P LV+ NY
Sbjct  62   EDQPCSSADDYAIEPGNGPKFPKFDKLIKKCHIDINTTTDGIILPVCVPNWDPDLVIKNY  121

Query  496  TQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMF--APPAGAAATVR  648
            T + Q AKYLN SKYTG G+GTEDDW V+VL+T+T++G F  AP   A   V 
Sbjct  122  THT-QYAKYLNGSKYTGAGVGTEDDWVVVVLSTDTESGSFSGAPSLAAIGMVH  173



>ref|XP_007147058.1| hypothetical protein PHAVU_006G092700g [Phaseolus vulgaris]
 gb|ESW19052.1| hypothetical protein PHAVU_006G092700g [Phaseolus vulgaris]
Length=193

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 102/146 (70%), Gaps = 7/146 (5%)
 Frame = +1

Query  184  LASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEAC-------  342
            + S+ V C+D+ED + +GINSYRQ+++L  L +  KA CLA ++A++IE   C       
Sbjct  14   VFSIPVLCNDKEDSVFKGINSYRQTQTLSPLTEVSKAKCLADEVAEDIEKTPCESVNKYY  73

Query  343  PRPGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKY  522
            P   +      + NL KH++KC I+ +TT DG+++PVCV K  PT+VL+NYT S + A++
Sbjct  74   PSTVSGGGNVNIPNLSKHIEKCHINISTTSDGVILPVCVAKLEPTIVLSNYTHSDRYAQF  133

Query  523  LNDSKYTGVGIGTEDDWTVLVLTTNT  600
            LN+SKYTG G+G+EDDW VLVLTTNT
Sbjct  134  LNNSKYTGAGLGSEDDWMVLVLTTNT  159



>ref|XP_011036964.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Populus euphratica]
Length=276

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = +1

Query  178  FLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA  357
            F L S  V CD+E D LLQG+NSYR S +LPAL KH  A CLA KIA ++EDE C    A
Sbjct  17   FFLLSSPVHCDEEND-LLQGLNSYRHSLNLPALVKHTNAGCLADKIAGKLEDEPCTSARA  75

Query  358  PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSK  537
             +SP ++ +    L KCG+D N T +G+ +PVCV   VPTL+LTNYT++   A+Y+N S+
Sbjct  76   -ASPVQIDDYPDLLSKCGVDVNHTNEGVALPVCVPHLVPTLLLTNYTRTAY-ARYINASR  133

Query  538  YTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            ++G G+G EDDW V+VLTT+T  G FA
Sbjct  134  FSGAGLGHEDDWLVVVLTTSTPRGDFA  160



>ref|XP_009349386.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Pyrus x bretschneideri]
Length=193

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 100/152 (66%), Gaps = 4/152 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG---APSSP  369
            V  +DEED L QG+NS+R+S +LP   K+D A CLA ++ADE+ED+ C        P + 
Sbjct  24   VFSNDEEDDLFQGLNSFRKSANLPEFKKNDDAACLADELADELEDQPCSSAHYIIEPGNL  83

Query  370  PRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGV  549
            PR  + +K + KC ID NTT   ++ PVCV      LVL NYT S  ++KYLNDSKY+GV
Sbjct  84   PRFPSFEKLVKKCHIDINTTTAAIIWPVCVPDLDEDLVLNNYTHS-HSSKYLNDSKYSGV  142

Query  550  GIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            GIG+EDDW V VLTT+ ++G F+  A +  T+
Sbjct  143  GIGSEDDWIVAVLTTDAESGSFSGGAASLGTI  174



>ref|XP_008388581.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Malus domestica]
Length=193

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 101/152 (66%), Gaps = 7/152 (5%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG---APSSP  369
            V  +DEED L QG+NS+R+S +LP   K+D A CLA ++ADE+ED+ C        P + 
Sbjct  24   VFSNDEEDDLFQGLNSFRKSANLPEFKKNDNAACLADELADELEDQPCSSAHYIIEPGNL  83

Query  370  PRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGV  549
            PR  + +K + KC ID NTT   ++ PVCV      LVL NYT S  ++KYLNDSKY+GV
Sbjct  84   PRFPSFEKLVKKCHIDINTTTAAIIWPVCVPDLDEDLVLNNYTHS-HSSKYLNDSKYSGV  142

Query  550  GIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            GIG+EDDW V VLTT+ ++G F   +G AAT+
Sbjct  143  GIGSEDDWIVAVLTTDAESGSF---SGGAATL  171



>gb|KHN35193.1| Putative GPI-anchored protein [Glycine soja]
Length=203

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = +1

Query  148  SLRLSAAICVFLLASLSVRCDD--EEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIAD  321
            SL  +  +   LL++ SV+CDD  EED L QGIN YR+S +L +L K++ ANC A +IA 
Sbjct  8    SLLFTVLLSSILLSNHSVKCDDHDEEDDLYQGINKYRESLNLTSLTKNENANCFADEIAG  67

Query  322  EIEDEACPRP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            + +++ C    GA   P + P+ +N    L+KC ++ + T+DG+V+P CV   V ++VLT
Sbjct  68   QFKNQPCTNTTGANTVPGTEPQFSNYPDLLNKCQLNISNTRDGIVMPACVPGLVSSVVLT  127

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP  621
            N+TQS  +   LNDSKYTG+GIG+ED+W V+VLTTNT  G F P
Sbjct  128  NFTQSLYSGN-LNDSKYTGIGIGSEDNWIVVVLTTNTPEGSFVP  170



>ref|XP_010039910.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Eucalyptus grandis]
 gb|KCW45646.1| hypothetical protein EUGRSUZ_L00601 [Eucalyptus grandis]
Length=206

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 104/156 (67%), Gaps = 5/156 (3%)
 Frame = +1

Query  193  LSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA---P  360
            L V+CD EED+LLQGINSYR S +L AL K+D A CLA ++AD+ + + C    GA   P
Sbjct  34   LLVKCDSEEDNLLQGINSYRTSLNLTALTKNDNAECLAKEMADQYKTQPCTNTTGANTVP  93

Query  361  SSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKY  540
             + P+ +N    L  C ++   T+DG+++P CV   VP+LVLTN+TQS Q +  LNDSKY
Sbjct  94   GTEPQFSNYPTLLANCHLNVTVTRDGVIMPACVPNLVPSLVLTNFTQS-QYSVSLNDSKY  152

Query  541  TGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            TG+GI +EDDW V++LTTNT  G +     A+  ++
Sbjct  153  TGIGISSEDDWMVVILTTNTPEGSYMSVKSASLILK  188



>ref|XP_003610667.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|ACJ83913.1| unknown [Medicago truncatula]
 gb|AES93625.1| glycoprotein membrane precursor GPI-anchored protein [Medicago 
truncatula]
 gb|AFK38764.1| unknown [Medicago truncatula]
Length=201

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 110/174 (63%), Gaps = 8/174 (5%)
 Frame = +1

Query  151  LRLSAAICV--FLLASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIAD  321
            LR S        LL S SV CD DEED L QG+N YR S +L +L K++ ANC A K+AD
Sbjct  4    LRFSVLFFFSSILLFSHSVHCDHDEEDDLYQGVNMYRTSLNLTSLTKNENANCFAEKLAD  63

Query  322  EIEDEACPRP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            + +++ C    GA   P + P+  N +  L KC ++ + T+DG V+P CV   VP++VL+
Sbjct  64   QFKNKPCTNTTGANTIPGTEPQFPNYEDLLTKCHLNISNTRDGSVMPACVPGLVPSIVLS  123

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVRN  651
            N+TQS   ++ LNDSK+TG+GIG+ED+W V+VLTTNT  G F P + +     N
Sbjct  124  NFTQSLY-SQNLNDSKFTGIGIGSEDNWIVVVLTTNTSDGSFVPESSSGDETSN  176



>gb|AFK40502.1| unknown [Medicago truncatula]
Length=201

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 109/174 (63%), Gaps = 8/174 (5%)
 Frame = +1

Query  151  LRLSAAICV--FLLASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIAD  321
            LR S        LL S SV CD DEED L QG+N YR S +L +L K++ ANC A K+AD
Sbjct  4    LRFSVLFFFSSILLFSHSVHCDHDEEDDLYQGVNMYRTSLNLTSLTKNENANCFAEKLAD  63

Query  322  EIEDEACPRP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            + +++ C    GA   P + P+  N +  L KC ++ + T+DG V+P CV   VP+ VL+
Sbjct  64   QFKNKPCTNTTGANTIPGTEPQFPNYEDLLTKCHLNISNTRDGSVMPACVPGLVPSFVLS  123

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVRN  651
            N+TQS   ++ LNDSK+TG+GIG+ED+W V+VLTTNT  G F P + +     N
Sbjct  124  NFTQSLY-SQNLNDSKFTGIGIGSEDNWIVVVLTTNTSDGSFVPESSSGDETSN  176



>ref|NP_001238716.1| uncharacterized protein LOC100306685 precursor [Glycine max]
 gb|ACU14980.1| unknown [Glycine max]
Length=203

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 109/164 (66%), Gaps = 7/164 (4%)
 Frame = +1

Query  148  SLRLSAAICVFLLASLSVRCDD--EEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIAD  321
            SL  +  +   LL++ SV+CDD  EED L QGIN YR+S +L +L K++ ANC A +IA 
Sbjct  8    SLLFTVLLSSILLSNHSVKCDDHDEEDDLYQGINKYRESLNLTSLTKNENANCFADEIAG  67

Query  322  EIEDEACPRP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            + +++ C    GA   P + P+ +N    L+KC ++ + T+DG+ +P CV   V ++VLT
Sbjct  68   QFKNQPCTNTTGANTVPGTEPQFSNYPDLLNKCQLNISNTRDGIAMPACVPGLVSSVVLT  127

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP  621
            N+TQS  +   LNDSKYTG+GIG+ED+W V+VLTTNT  G F P
Sbjct  128  NFTQSLYSGN-LNDSKYTGIGIGSEDNWIVVVLTTNTPEGSFVP  170



>ref|XP_004305006.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Fragaria vesca subsp. vesca]
Length=193

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 111/174 (64%), Gaps = 7/174 (4%)
 Frame = +1

Query  142  SSSLRLSAAICV--FLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKI  315
            SS L L A + V  FLL S  V C+DEED L  G+N++RQ+ +L  L K++KA C+A +I
Sbjct  3    SSRLSLFAFVLVHAFLLHSSLVCCNDEEDDLFVGLNNFRQTLNLSELVKNEKAGCIADEI  62

Query  316  ADEIEDEACPRPG----APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLV  483
            +DE++   C         P + P      K + KC ID +TT DG+++PVCV    P LV
Sbjct  63   SDELQGLPCSHAADYEIKPGNGPVFPYFSKLITKCNIDNSTTTDGIILPVCVPDLDPDLV  122

Query  484  LTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            L NYT++ + A++LN+SKYTG G+G+EDDW ++VLTT++ +G F   A + A +
Sbjct  123  LNNYTKT-KFAQFLNNSKYTGAGVGSEDDWMIVVLTTDSPSGSFTGGAASLAAI  175



>ref|XP_007030861.1| Glycoprotein membrane precursor GPI-anchored, putative [Theobroma 
cacao]
 gb|EOY11363.1| Glycoprotein membrane precursor GPI-anchored, putative [Theobroma 
cacao]
Length=189

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 106/163 (65%), Gaps = 5/163 (3%)
 Frame = +1

Query  130  SMAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAG  309
            S+ PS        + +FLL S  V  DD ED LLQG+NS+R S ++P+ +K+  A+C A 
Sbjct  3    SIKPSHHFFFVVVLAIFLL-SPPVLSDDVEDQLLQGLNSFRTSMNIPSFSKNKNAHCAAE  61

Query  310  KIADEIEDEACPRPGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            +IAD++ED+ C      +   R+++    + KC ID NTT D +V+PVCV   VPTLVLT
Sbjct  62   QIADDLEDQPCSNSNNET---RLSDHPNAISKCHIDPNTTSDAIVLPVCVPDLVPTLVLT  118

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            N+T++   +KY+NDS  TG+G+ ++DDW V+VL TNT +G  A
Sbjct  119  NFTRT-HFSKYMNDSSLTGIGVSSQDDWMVVVLATNTPSGSLA  160



>ref|NP_001236961.1| uncharacterized protein LOC100306063 precursor [Glycine max]
 gb|ACU14056.1| unknown [Glycine max]
Length=198

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 105/154 (68%), Gaps = 6/154 (4%)
 Frame = +1

Query  199  VRCDD-EEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA---PS  363
            V+CDD EED+L QGIN YR S +L AL ++D A+CLA KIAD+ + + C    GA   P 
Sbjct  26   VKCDDDEEDNLYQGINKYRASLNLKALTRNDNADCLAEKIADQFKKQPCTNTTGANTVPG  85

Query  364  SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYT  543
            + P+ +N    L KC +  + T+DG V+P CV   VP+LVLTN+T+S   +  LND+KYT
Sbjct  86   TEPQFSNYPDLLSKCDLAISNTRDGNVMPACVPDLVPSLVLTNFTKS-LYSDSLNDTKYT  144

Query  544  GVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            G+GIG+ED+W V+VLTTNT +G FAP +   A +
Sbjct  145  GIGIGSEDNWIVVVLTTNTPSGTFAPYSSDGANL  178



>gb|KHN02689.1| Putative GPI-anchored protein [Glycine soja]
Length=198

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 105/154 (68%), Gaps = 6/154 (4%)
 Frame = +1

Query  199  VRCDD-EEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA---PS  363
            V+CDD EED+L QGIN YR S +L AL ++D A+CLA KIAD+ + + C    GA   P 
Sbjct  26   VKCDDDEEDNLYQGINKYRASLNLKALTRNDNADCLAEKIADQFKKQPCTNTTGANTVPG  85

Query  364  SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYT  543
            + P+ +N    L KC +  + T+DG V+P CV   VP+LVLTN+T+S  +   LND+KYT
Sbjct  86   TEPQFSNYPDLLSKCDLAISNTRDGNVMPACVPGLVPSLVLTNFTKSLYSDS-LNDTKYT  144

Query  544  GVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            G+GIG+ED+W V+VLTTNT +G FAP +   A +
Sbjct  145  GIGIGSEDNWIVVVLTTNTPSGTFAPYSSDGANL  178



>ref|XP_007034667.1| Glycoprotein membrane precursor GPI-anchored [Theobroma cacao]
 gb|EOY05593.1| Glycoprotein membrane precursor GPI-anchored [Theobroma cacao]
Length=199

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 102/153 (67%), Gaps = 6/153 (4%)
 Frame = +1

Query  199  VRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP-GA---PS  363
            + CD DEE+ LL+GINSYR S +L  L K+D A C A ++ADE +++ C    GA   P 
Sbjct  26   IFCDTDEEEDLLKGINSYRASLNLTILTKNDNAECFADELADEFKNQPCTNSTGANTVPG  85

Query  364  SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYT  543
            + P+ AN  K L KC ++ + T+DG V+P CV   VP+LVLTN+TQS Q +   ND+KYT
Sbjct  86   TEPQFANYPKLLAKCHLNVSNTRDGAVMPACVPNLVPSLVLTNFTQS-QYSDNFNDTKYT  144

Query  544  GVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAAT  642
            GVGIG++ DW V+VLTT T  G F P   +AA+
Sbjct  145  GVGIGSDGDWIVVVLTTGTPEGSFVPATTSAAS  177



>ref|XP_007143213.1| hypothetical protein PHAVU_007G053500g [Phaseolus vulgaris]
 gb|ESW15207.1| hypothetical protein PHAVU_007G053500g [Phaseolus vulgaris]
Length=199

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 104/154 (68%), Gaps = 6/154 (4%)
 Frame = +1

Query  199  VRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA---PS  363
            V+CD DEED+L QGIN YR S +L AL ++D A+CLA KIAD+ + + C    GA   P 
Sbjct  26   VKCDSDEEDNLYQGINKYRASINLKALTRNDNADCLANKIADQFKKQPCTNTTGANTVPG  85

Query  364  SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYT  543
            + P+ +N    L KC +  + T+DG ++PVCV   VP+LVLTN+T+S   +  LND+ YT
Sbjct  86   TEPQFSNYPDLLSKCDLAISNTRDGNIMPVCVPGLVPSLVLTNFTKSLY-SDSLNDTTYT  144

Query  544  GVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            G+GIG+ED+W V+VLTTNT  G F+P +   A +
Sbjct  145  GIGIGSEDNWIVVVLTTNTPAGTFSPYSSNGANL  178



>ref|XP_010035346.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Eucalyptus 
grandis]
 gb|KCW84249.1| hypothetical protein EUGRSUZ_B01107 [Eucalyptus grandis]
Length=205

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 103/156 (66%), Gaps = 5/156 (3%)
 Frame = +1

Query  193  LSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA---P  360
            L V+CD EED+LLQGINSYR + +L  L K+D A CLA ++AD+ +++ C    GA   P
Sbjct  33   LLVKCDSEEDNLLQGINSYRTTLNLTVLTKNDNAECLAKEMADQYKNQPCTNTTGADTVP  92

Query  361  SSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKY  540
             + P+ +N    L  C ++ +  +DG+++P CV   VP+LVLTN+TQS Q +  LNDSKY
Sbjct  93   GTEPQFSNYPTLLANCHLNVSVIRDGVIMPACVPNLVPSLVLTNFTQS-QYSSSLNDSKY  151

Query  541  TGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            TG+GI +E+DW V++LTTNT  G F     A   ++
Sbjct  152  TGIGINSENDWMVVILTTNTPEGSFMSVESANLILK  187



>ref|XP_008246484.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Prunus mume]
Length=188

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 98/154 (64%), Gaps = 12/154 (8%)
 Frame = +1

Query  205  CDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG----APSSPP  372
            C++EED + QG+NS++QS     L K+  A CLA +IADE+ED+ C         P + P
Sbjct  26   CNEEEDKIFQGLNSFKQS-----LKKNSNAECLADEIADELEDQPCSSADDYAIEPGNGP  80

Query  373  RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVG  552
            +     K + KC ID NTT DG+++PVCV    P LV+ NYT + Q AKYLN SKYTG G
Sbjct  81   KFPKFNKLIKKCHIDINTTTDGIILPVCVPNWDPDLVIKNYTHT-QYAKYLNGSKYTGAG  139

Query  553  IGTEDDWTVLVLTTNTQTGMF--APPAGAAATVR  648
            +GTEDDW V+VL+T+T++G F  AP   A   V 
Sbjct  140  VGTEDDWVVVVLSTDTESGSFSGAPSLAAIGMVH  173



>gb|KHG14473.1| hypothetical protein F383_18736 [Gossypium arboreum]
Length=196

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 101/150 (67%), Gaps = 6/150 (4%)
 Frame = +1

Query  205  CD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP-GA---PSSP  369
            CD DEED+LL+GIN YR S +L  L K+D A CLA ++AD+ +++ C    GA   P + 
Sbjct  26   CDTDEEDNLLKGINDYRASLNLTILKKNDNAECLADELADQFKNQPCTNSTGANTVPGTE  85

Query  370  PRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGV  549
            P+ AN    L KC ++ + T+DG V+P CV   VP LVLTN+TQS  N   LND+KYTGV
Sbjct  86   PQFANYPNLLAKCHLNVSNTRDGAVMPACVPNLVPNLVLTNFTQSQYNDN-LNDTKYTGV  144

Query  550  GIGTEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            GIG++ DW V+VLTT T  G ++P  GAA+
Sbjct  145  GIGSDGDWIVVVLTTGTPEGSYSPATGAAS  174



>ref|NP_001238272.1| uncharacterized protein LOC100499681 precursor [Glycine max]
 gb|ACU13219.1| unknown [Glycine max]
 gb|KHN15798.1| Putative GPI-anchored protein [Glycine soja]
Length=199

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 101/146 (69%), Gaps = 6/146 (4%)
 Frame = +1

Query  199  VRCDD-EEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA---PS  363
            V+CDD EED+L QGIN YR S +L AL ++D ANCLA K+A++ + + C    GA   P 
Sbjct  26   VKCDDDEEDNLYQGINKYRASLNLKALTRNDNANCLAEKLANQFKKQPCTNTTGANTVPG  85

Query  364  SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYT  543
            + P+ +N    L KC +  + T+DG V+P CV   VP+LVL N+T+S   +  LND+KYT
Sbjct  86   TEPQFSNYPDLLSKCDLAISNTRDGNVMPACVPGLVPSLVLANFTKSLY-SDSLNDTKYT  144

Query  544  GVGIGTEDDWTVLVLTTNTQTGMFAP  621
            G+GIG+ED+W V+VLTTNT +G FAP
Sbjct  145  GIGIGSEDNWIVVVLTTNTPSGTFAP  170



>ref|XP_003536083.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Glycine max]
Length=196

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 111/172 (65%), Gaps = 14/172 (8%)
 Frame = +1

Query  115  LSIYLSMAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKA  294
            LS+YL         L A++ VF L    V C+DEED LL  IN YR+  +L  L +++KA
Sbjct  6    LSLYL---------LIASVFVFQLLPSPVVCNDEED-LLHDINVYRKVLNLAVLDENEKA  55

Query  295  NCLAGKIADEIEDEACPRPG----APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVR  462
            +CLA +IA+++E+  C         PS   R+ + QK ++KC I+ NTTKDG+++PVCV 
Sbjct  56   SCLAEEIAEDLENTKCEDFRDYYPLPSYTSRIPSFQKSVNKCKININTTKDGVIMPVCVP  115

Query  463  KRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            K     + +NYT+S + +KYLN+SKY   GIG+EDDW VL+++TNT +G F+
Sbjct  116  KLDSDALFSNYTKSNRFSKYLNNSKYKIAGIGSEDDWMVLIISTNTSSGDFS  167



>gb|KHN16132.1| Putative GPI-anchored protein [Glycine soja]
Length=196

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 111/172 (65%), Gaps = 14/172 (8%)
 Frame = +1

Query  115  LSIYLSMAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKA  294
            LS+YL         L A++ VF L    V C+DEED LL  IN YR+  +L  L +++KA
Sbjct  6    LSLYL---------LIASVFVFQLLPSPVVCNDEED-LLHDINVYRKVLNLAVLDENEKA  55

Query  295  NCLAGKIADEIEDEACPRPG----APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVR  462
            +CLA +IA+++E+  C         PS   R+ + QK ++KC I+ NTTKDG+++PVCV 
Sbjct  56   SCLAEEIAEDLENTKCEDFRDYYPLPSYTSRIPSFQKSVNKCKININTTKDGVIMPVCVP  115

Query  463  KRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            K     + +NYT+S + +KYLN+SKY   GIG+EDDW VL+++TNT +G F+
Sbjct  116  KLDSDALFSNYTKSNRFSKYLNNSKYKIAGIGSEDDWMVLIISTNTSSGDFS  167



>ref|NP_001241609.1| uncharacterized protein LOC100814074 precursor [Glycine max]
 gb|ACU20620.1| unknown [Glycine max]
 gb|KHN30457.1| Putative GPI-anchored protein [Glycine soja]
Length=198

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 105/156 (67%), Gaps = 7/156 (4%)
 Frame = +1

Query  196  SVRCDD--EEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP-GA---  357
            SV+C D  EED L QGIN YR+S +L +L K++ ANC A ++AD+ +++ C    GA   
Sbjct  23   SVKCGDRDEEDDLYQGINKYRESLNLTSLTKNENANCFADEMADQFKNQPCTNTTGANTV  82

Query  358  PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSK  537
            P + PR +N    L+KC ++ + T+DG+V+P CV   V ++VLTN+TQS  +   LNDSK
Sbjct  83   PGTEPRFSNYPDLLNKCHLNISNTRDGIVMPACVPGLVSSVVLTNFTQSLYSGN-LNDSK  141

Query  538  YTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            +TG+GIG+ED+W V+VL+TNT  G F P   + A +
Sbjct  142  FTGIGIGSEDNWIVVVLSTNTPEGSFVPETDSGANL  177



>emb|CAN77026.1| hypothetical protein VITISV_015337 [Vitis vinifera]
Length=252

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 106/163 (65%), Gaps = 12/163 (7%)
 Frame = +1

Query  178  FLLASLSVRCDDEEDH---------LLQGINSYRQSKSLPALAKHDKANCLAGKIADEIE  330
            F L +LS+       H         LLQG+NSYR +++L  L K+DKA CLA ++A E+E
Sbjct  12   FFLVALSILFTSTPVHCDDAAEDDDLLQGLNSYRTARNLSTLVKNDKAECLAEELAGELE  71

Query  331  DEACPRPGAPSSPP-RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSP  507
             + C     P++P  ++AN    L KC ID N T+DG+++ VCV  RVPTLVLTN+TQS 
Sbjct  72   HQPCT-AAVPATPQLQLANYPSILKKCKIDINYTRDGVIMQVCVPHRVPTLVLTNFTQS-  129

Query  508  QNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAA  636
              ++YLNDSK+TGVG+G+EDDW V VL+TN   G F+  + AA
Sbjct  130  HYSRYLNDSKFTGVGVGSEDDWVVAVLSTNGIEGSFSGASRAA  172



>ref|XP_008370496.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Malus domestica]
Length=193

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 99/175 (57%), Gaps = 5/175 (3%)
 Frame = +1

Query  133  MAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGK  312
            MA S        +   L  S  V  +DEED L Q +N++RQS+ LP   K+D A CLA K
Sbjct  1    MASSKLSYFLFYVLGLLFLSHPVFSNDEEDKLFQSLNNFRQSQKLPEFKKNDNAACLADK  60

Query  313  IADEIEDEACPRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTL  480
            +AD++E   C         P + P+     K   +C I+ N+T  G++ PVCV      L
Sbjct  61   LADKLEHRQCSSSQKYSIEPGNGPKFPKFDKLRRRCHIETNSTTAGIIWPVCVPDLDEDL  120

Query  481  VLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            VL NYT+S   AKYL DSKY GVGIG+EDDW ++VLTT+ Q+G FA  A +   +
Sbjct  121  VLNNYTRS-HYAKYLKDSKYAGVGIGSEDDWVIVVLTTDAQSGSFASGAASLGAI  174



>ref|XP_004511342.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Cicer arietinum]
Length=197

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 107/171 (63%), Gaps = 6/171 (4%)
 Frame = +1

Query  148  SLRLSAAICVFLLASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADE  324
            SL  S  I   +  + SV+CD DEED L QG+N YR S +L +L K++ ANC A + AD+
Sbjct  7    SLIFSLFISSIIFFNHSVKCDHDEEDDLYQGVNKYRTSLNLTSLTKNENANCFAEEFADQ  66

Query  325  IEDEACPRP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTN  492
             +++ C    GA   P + P+ +N  + L KC ++ + T+DG V+P CV   VP+LVL N
Sbjct  67   FKNQPCTNTTGANTIPGTEPQFSNYPELLSKCHLNISDTRDGSVMPACVPGLVPSLVLAN  126

Query  493  YTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            +T S   ++ LNDSK+TG+GIG++D+W ++VLTTN+  G F P     A  
Sbjct  127  FTGSLY-SQNLNDSKFTGIGIGSKDNWIIVVLTTNSSDGSFLPDTSNGANF  176



>gb|EYU45624.1| hypothetical protein MIMGU_mgv1a014390mg [Erythranthe guttata]
Length=191

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 99/144 (69%), Gaps = 5/144 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSS  366
            ++CDDEED+LLQGIN YR S +L AL K+D+A CLAG++AD+ + + C         P +
Sbjct  20   IKCDDEEDNLLQGINQYRASLNLTALIKNDRAECLAGEVADQFKGQPCTNTTGSATIPGT  79

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P+  N  + L KC ++  TT+DG ++P CV    P+LV++N+T+S Q ++YLN + ++G
Sbjct  80   EPQYPNFPQFLSKCHLNVTTTRDGQIMPACVPNLDPSLVISNFTKS-QYSEYLNSTNFSG  138

Query  547  VGIGTEDDWTVLVLTTNTQTGMFA  618
            +G+ +E +W V+VLTTNT  G ++
Sbjct  139  IGVNSEGNWIVVVLTTNTPEGSYS  162



>ref|XP_002281089.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Vitis 
vinifera]
 emb|CBI26205.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 101/150 (67%), Gaps = 5/150 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA---PSS  366
            V+CDDEED LL+GIN YR + +L AL K++ A C A ++AD+  D+ C    GA   P +
Sbjct  24   VQCDDEEDSLLKGINDYRATLNLTALVKNENAECFAEEMADQFNDQQCTNTTGANTVPGT  83

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P      K L KC ++ + T++GM++P CV   V + +L+N+TQS Q ++YLND+KYTG
Sbjct  84   EPTFDTYPKLLAKCHLNISDTREGMIMPACVPDLVASQLLSNFTQS-QYSEYLNDTKYTG  142

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAA  636
            +GIGTED+W V+VLTT+T  G FA    A+
Sbjct  143  IGIGTEDNWMVVVLTTSTPGGSFATYNAAS  172



>ref|XP_004496769.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Cicer arietinum]
Length=199

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 107/161 (66%), Gaps = 6/161 (4%)
 Frame = +1

Query  178  FLLASLSVRCDDEE-DHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP-  351
             LL +  V+CDD+E D+L QGIN YR S +L AL K+  A+CLA KIAD+ +++ C    
Sbjct  19   ILLINSPVKCDDDEKDNLYQGINKYRSSLNLKALTKNKNADCLADKIADQFKNQLCTNTT  78

Query  352  GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKY  522
            GA   P + P+ +N    L KC +  + T+DG V+P CV     +LVL N+T+S   ++ 
Sbjct  79   GANTVPGTEPQFSNYPNLLAKCQLAISDTRDGTVMPACVPGLASSLVLANFTKSLY-SEN  137

Query  523  LNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            LND+KYTG+GIG+ED+W V+VLTT+T TG FAP +  AA +
Sbjct  138  LNDTKYTGIGIGSEDNWIVVVLTTDTPTGNFAPYSSNAANL  178



>ref|XP_004229419.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Solanum lycopersicum]
Length=194

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 99/150 (66%), Gaps = 5/150 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA---PSS  366
            V+ DDEED+L + INSYR + +L  L ++DKA CLA +IAD+ +D+ C    GA   P +
Sbjct  23   VKSDDEEDNLFRSINSYRTTLNLTTLRENDKAKCLADEIADQFKDQPCTNTTGANTVPGT  82

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P+ ++    L KC ++  TT+D  ++P CV   VP LVL+NYT S Q A  LND+K+TG
Sbjct  83   EPQFSDYPNLLSKCKLNVTTTRDAAIMPACVPNLVPDLVLSNYTMS-QYATSLNDTKFTG  141

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAA  636
            VGIG++D+W V++LTTN   G F P   +A
Sbjct  142  VGIGSDDNWIVVILTTNNLEGSFTPDNSSA  171



>ref|XP_008449574.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Cucumis melo]
Length=196

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 101/152 (66%), Gaps = 7/152 (5%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSS----  366
            V+CDD++ H  +GINSYR S +L AL ++D A+CLA +IA++ +++ C      ++    
Sbjct  24   VKCDDDDLH--RGINSYRASLNLTALVENDNADCLAEEIAEKFKNQPCTNTTGSNTVSGT  81

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P+ ++    L KC ++ + T+DG ++P CV  RV  LVL N+T+S  + K LND+KY+G
Sbjct  82   EPQFSDFPNLLTKCNLNVSNTRDGAIMPACVPNRVADLVLANFTKSQYSGK-LNDTKYSG  140

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAAAT  642
            +GIGTEDDW V+VLTTNT  G F P  G+  T
Sbjct  141  IGIGTEDDWVVVVLTTNTAEGSFVPAVGSNNT  172



>ref|XP_003591096.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|AES61347.1| glycoprotein membrane precursor GPI-anchored protein [Medicago 
truncatula]
Length=201

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 100/153 (65%), Gaps = 5/153 (3%)
 Frame = +1

Query  175  VFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR--  348
            + L + ++  C ++E  LL  IN+YR+  +LP L K DK +CLA KIA+++E + C    
Sbjct  20   ILLTSPVTCACGEKEKDLLHDINTYRKVLNLPILEKTDKPSCLANKIANDLEHKHCEEFH  79

Query  349  ---PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAK  519
               P  P   P++ N +K ++KC I+ NTTKDG+++P+CV K     + +NYT++    K
Sbjct  80   NYYPNIPGKNPKIPNFEKSVEKCKININTTKDGVIMPMCVPKLDQDDLFSNYTKNSHFTK  139

Query  520  YLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            YLN+SKY   G+G+EDDW VL+++TNT +G F+
Sbjct  140  YLNNSKYIIAGVGSEDDWMVLIISTNTTSGDFS  172



>ref|XP_008222969.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
isoform X2 [Prunus mume]
Length=202

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 109/160 (68%), Gaps = 8/160 (5%)
 Frame = +1

Query  172  CVFLLASLSVRCD-DEEDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEACP  345
            CV L  S  V+CD DEED LL+GIN YR S  +L  L K+  A CLA +IAD+++++ C 
Sbjct  15   CVVLF-SHQVKCDGDEEDTLLRGINGYRASTLNLATLTKNANAECLADEIADQLKNKPCT  73

Query  346  RP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQN  513
               GA   P + P+ +   K L KC ++ + T+DG+++P CV   VP+LVLTN+T+S Q 
Sbjct  74   NTTGANTVPGTEPQFSGYPKLLAKCHLNVSNTRDGVIMPACVPSLVPSLVLTNFTKS-QY  132

Query  514  AKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGA  633
            ++ LND+KYTG+GIG+ED+W V+VLTTNT  G F+   G+
Sbjct  133  SESLNDTKYTGIGIGSEDNWIVVVLTTNTPYGSFSNAQGS  172



>ref|NP_001238118.1| uncharacterized protein LOC100527063 precursor [Glycine max]
 gb|ACU16103.1| unknown [Glycine max]
 gb|KHN20213.1| Putative GPI-anchored protein [Glycine soja]
Length=196

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 109/182 (60%), Gaps = 20/182 (11%)
 Frame = +1

Query  115  LSIYLSMAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKA  294
            LS+YL         L A++  F L    V C+DEED LL  IN YR+  +LP L +  KA
Sbjct  6    LSLYL---------LIASVFFFHLLPSPVLCNDEED-LLHDINVYRKVLNLPVLDESGKA  55

Query  295  NCLAGKIADEIEDEAC-------PRPGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPV  453
            +CLA +IA+ +E   C       P P   S  P+    QK ++KC I+ NTTKDG+++P+
Sbjct  56   SCLAEEIAENLEHTKCEDFRDYYPLPSYTSKIPK---FQKSINKCKININTTKDGVIMPL  112

Query  454  CVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGA  633
            CV K  P  + +NYT+S + +KYLN+SKY   G+G+EDDW VL+++TNT +G F+     
Sbjct  113  CVPKLDPDALFSNYTKSNRFSKYLNNSKYKIAGLGSEDDWMVLIISTNTSSGDFSSATSL  172

Query  634  AA  639
             A
Sbjct  173  LA  174



>ref|XP_011071553.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Sesamum indicum]
Length=191

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 101/145 (70%), Gaps = 5/145 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSS  366
            ++CDD+ED+LLQGIN YR S +L AL K+D+A CLA +IA++ +++ C         P +
Sbjct  20   IKCDDDEDNLLQGINQYRSSLNLTALTKNDRAECLADEIAEQFKNQPCTNTTGSNTVPGT  79

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P+ ++  K L KC ++  TT+DG ++P CV      LVL+N+T+S Q + YLN ++YTG
Sbjct  80   EPQYSDYPKLLAKCHLNVTTTRDGQIMPACVPNLDSGLVLSNFTKS-QYSGYLNGTQYTG  138

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAP  621
            +GIG+ED+W V+VLTT+T  G ++P
Sbjct  139  IGIGSEDNWIVVVLTTSTPEGNYSP  163



>ref|XP_008222968.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
isoform X1 [Prunus mume]
Length=203

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 109/161 (68%), Gaps = 9/161 (6%)
 Frame = +1

Query  172  CVFLLASLSVRCD--DEEDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEAC  342
            CV L  S  V+CD  DEED LL+GIN YR S  +L  L K+  A CLA +IAD+++++ C
Sbjct  15   CVVLF-SHQVKCDGVDEEDTLLRGINGYRASTLNLATLTKNANAECLADEIADQLKNKPC  73

Query  343  PRP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQ  510
                GA   P + P+ +   K L KC ++ + T+DG+++P CV   VP+LVLTN+T+S Q
Sbjct  74   TNTTGANTVPGTEPQFSGYPKLLAKCHLNVSNTRDGVIMPACVPSLVPSLVLTNFTKS-Q  132

Query  511  NAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGA  633
             ++ LND+KYTG+GIG+ED+W V+VLTTNT  G F+   G+
Sbjct  133  YSESLNDTKYTGIGIGSEDNWIVVVLTTNTPYGSFSNAQGS  173



>gb|KHG10664.1| hypothetical protein F383_12212 [Gossypium arboreum]
Length=200

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 99/144 (69%), Gaps = 6/144 (4%)
 Frame = +1

Query  199  VRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP-GA---PS  363
            V CD DEED LL+GINSYR S +L +L  ++ A CLA ++A+E +++ C    GA   P 
Sbjct  23   VFCDNDEEDDLLKGINSYRASLNLTSLTTNENAECLADELAEEFKNQPCTNSTGANTVPG  82

Query  364  SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYT  543
            + P+ AN    L KC ++ + T+DG V+P CV    P+LVLTN+TQS Q ++ LN++KYT
Sbjct  83   TEPQFANYPNILAKCHLNVSVTRDGAVMPACVPNLAPSLVLTNFTQS-QYSENLNETKYT  141

Query  544  GVGIGTEDDWTVLVLTTNTQTGMF  615
            G+GIG+E DW V+VLTTNT  G +
Sbjct  142  GIGIGSEGDWIVVVLTTNTAEGNY  165



>gb|AFK45707.1| unknown [Lotus japonicus]
Length=199

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = +1

Query  175  VFLLASLSVRC-DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP  351
            V LL +    C DDE+D+L QGIN YR S +L ALAK++ A+CLA +IA++ +++ C   
Sbjct  18   VILLINYPTECADDEKDNLYQGINKYRASINLKALAKNENADCLADQIAEQFKNQPCTNT  77

Query  352  -GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAK  519
             GA   P + P+ +N    L KC +  + T+D  V+P CV   VP+LVL+N+T S   + 
Sbjct  78   TGANTVPGTEPQFSNYPNLLAKCHLAISDTQDRTVMPACVPNLVPSLVLSNFTGSLY-SD  136

Query  520  YLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
             LND+KYTG+GIG+ED+W V+VLTTNT  G FAP +   A +
Sbjct  137  SLNDTKYTGIGIGSEDNWIVVVLTTNTPAGNFAPYSSNGANL  178



>ref|XP_007223465.1| hypothetical protein PRUPE_ppa011639mg [Prunus persica]
 gb|EMJ24664.1| hypothetical protein PRUPE_ppa011639mg [Prunus persica]
Length=202

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 109/160 (68%), Gaps = 8/160 (5%)
 Frame = +1

Query  172  CVFLLASLSVRCD-DEEDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEACP  345
            CV L  S  V+CD DEED LL+GIN YR S  +L  L K+  A CLA +IA++++++ C 
Sbjct  15   CVVLF-SHQVKCDGDEEDSLLRGINGYRASTLNLTILTKNANAECLADEIAEQLKNQPCT  73

Query  346  RP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQN  513
               GA   P + P+ ++  K L KC ++ + T+DG+++P CV   VP+LVLTN+T+S Q 
Sbjct  74   NTTGANTVPGTEPQFSDYPKLLAKCHLNVSNTRDGVIMPACVPSLVPSLVLTNFTES-QY  132

Query  514  AKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGA  633
            ++ LND+K+TG+GIG+ED+W V+VLTTNT  G F    G+
Sbjct  133  SESLNDTKFTGIGIGSEDNWIVVVLTTNTPDGSFTNAQGS  172



>ref|XP_006489329.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Citrus sinensis]
Length=192

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 107/158 (68%), Gaps = 6/158 (4%)
 Frame = +1

Query  178  FLLASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP-  351
            FL  +L V+CD DEED LLQG+NSYR+S +L +L K+  A CLA ++AD+ +++ C    
Sbjct  14   FLSMNLLVKCDTDEEDTLLQGLNSYRESLNLTSLTKNKNAECLADELADQFKNQPCTNST  73

Query  352  GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKY  522
            GA   P +  +++N    L KC ++ + T+DG+V+P CV    P+LVL+N+T+S Q +  
Sbjct  74   GANTVPGTEKQLSNYPDLLAKCHLNVSNTRDGIVMPACVPNLEPSLVLSNFTKS-QYSDS  132

Query  523  LNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAA  636
            LND+KY G GIG+ED+W V++LTT+T  G + P   A+
Sbjct  133  LNDTKYKGAGIGSEDNWIVVILTTSTPEGSYVPYNAAS  170



>gb|KEH43907.1| glycoprotein membrane precursor GPI-anchored protein [Medicago 
truncatula]
Length=199

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = +1

Query  175  VFLLASLSVRCDDEE-DHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP  351
            V  L +  V+CDD+E D+L QGIN YR S +L +L K+  A+CLA KIAD+ +++ C   
Sbjct  18   VIFLMNYPVKCDDDEKDNLYQGINKYRASLNLKSLTKNKNADCLADKIADQFKNQPCTNT  77

Query  352  -GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAK  519
             GA   P + P+ +N    L KC +  + T+DG V+P CV      LVL N+T+S   ++
Sbjct  78   TGANTVPGTEPQFSNYPNLLAKCQLAISDTRDGAVMPACVPGLASGLVLANFTKSLY-SQ  136

Query  520  YLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
             LND++YTG+GIG+ED+W V+VLTT+T TG FAP +  +A +
Sbjct  137  NLNDTQYTGIGIGSEDNWIVVVLTTDTPTGNFAPYSSNSANL  178



>ref|XP_009364203.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Pyrus x bretschneideri]
Length=204

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 102/155 (66%), Gaps = 9/155 (6%)
 Frame = +1

Query  172  CVFLLASLSVRCD--DEEDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEAC  342
            C+ LL S  V+CD  DEED LLQGINSYR S  +L AL K+  A CLA +IA++ + + C
Sbjct  16   CIVLL-SHQVKCDGVDEEDSLLQGINSYRASTLNLTALTKNANAECLAKEIAEQFKSQPC  74

Query  343  PRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQ  510
                     P + P   +  K L KC ++ + T+DG+++P CV   VP+LVLTN+TQS Q
Sbjct  75   TNTTGSNTVPGTEPNFPDYPKLLAKCHLNISNTRDGVIMPACVPSLVPSLVLTNFTQS-Q  133

Query  511  NAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMF  615
             +  LND+K+TG+GIG+E++W V VLTT+T  G F
Sbjct  134  YSDNLNDTKFTGIGIGSEENWIVAVLTTSTPEGSF  168



>ref|XP_010255930.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Nelumbo nucifera]
Length=196

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 98/144 (68%), Gaps = 5/144 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPP--  372
            V+ DDE+  LLQ INSYR + +L AL ++D A+CLAG++AD+ +++ C      ++ P  
Sbjct  24   VKSDDEDKRLLQDINSYRATLNLSALTENDNADCLAGEMADQFKNQPCTNSTGANTVPGT  83

Query  373  --RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
              ++AN    L+ C ++ + T+DG+++P CV   VP+LVL N+T S Q + YLNDSKYTG
Sbjct  84   EMQLANYPDLLNHCHLNVSNTRDGVIMPACVPDLVPSLVLANFTGS-QYSSYLNDSKYTG  142

Query  547  VGIGTEDDWTVLVLTTNTQTGMFA  618
             GI +E DW V++LTTNT  G +A
Sbjct  143  AGISSEGDWIVVILTTNTPEGSYA  166



>ref|XP_006349221.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Solanum tuberosum]
Length=194

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 100/150 (67%), Gaps = 5/150 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGAPS---S  366
            V+ DDEED+L + INSYR S +L  L ++DKA CLA ++AD+ +++ C    GA +   +
Sbjct  23   VKSDDEEDNLFRSINSYRASLNLTILRENDKAKCLADEMADQFKNQPCTNTTGANTVLGT  82

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P+ ++    L KC ++  TT+D +++P CV   VP LVL+NYT S Q +  LND+K+TG
Sbjct  83   EPQFSDYPNLLSKCKLNVTTTRDAVIMPACVPNLVPDLVLSNYTMS-QYSNSLNDTKFTG  141

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAA  636
            VGIG++D+W V++LTTN   G F P   +A
Sbjct  142  VGIGSDDNWIVVILTTNNLEGSFTPDNSSA  171



>ref|XP_010486087.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Camelina sativa]
Length=202

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            DEED LL GINSYR +++L   +K++ A CLA +IAD+ +++ C         P + P+ 
Sbjct  27   DEEDILLTGINSYRTTQNLTVFSKNENAECLADEIADQFKNKPCTNDTGSFTVPGTEPQF  86

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            AN  K L KC ++   T+DGMV+P CV +   +LVLTN+T++ Q +  LNDSKYTG+GIG
Sbjct  87   ANYPKMLSKCHLNVTDTRDGMVMPACVPRLESSLVLTNFTKT-QYSLGLNDSKYTGIGIG  145

Query  559  TEDDWTVLVLTTNTQTGMFA  618
             ED+W V+VLTTNT  G ++
Sbjct  146  KEDNWIVVVLTTNTPEGSYS  165



>ref|XP_010435264.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Camelina sativa]
Length=203

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            DEED LL GINSYR +++L   +K++ A CLA +IAD+ +++ C         P + P+ 
Sbjct  27   DEEDILLTGINSYRTTQNLTVFSKNENAECLADEIADQFKNKPCTNDTGSFTVPGTEPQF  86

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            AN  K L KC ++   T+DGMV+P CV +   +LVLTN+T++ Q +  LNDSKYTG+GIG
Sbjct  87   ANYPKMLSKCHLNVTDTRDGMVMPACVPRLESSLVLTNFTKT-QYSLGLNDSKYTGIGIG  145

Query  559  TEDDWTVLVLTTNTQTGMFA  618
             ED+W V+VLTTNT  G ++
Sbjct  146  KEDNWIVVVLTTNTPEGSYS  165



>ref|XP_003562564.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Brachypodium distachyon]
Length=195

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 107/173 (62%), Gaps = 17/173 (10%)
 Frame = +1

Query  178  FLLASLSV---------RCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIE  330
            F L +L++         R D  +D LL+GINSYR S  +PAL ++  A+CLA ++A + +
Sbjct  6    FFLCALAIVASSLLHCARSDGSDDQLLKGINSYRGSLKVPALTENKNADCLAEQLAKQFK  65

Query  331  DEACPRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYT  498
            D+ C         P +  +  +  K+LD+C ++ + T+DG V+P CV   V  +VLTNYT
Sbjct  66   DQQCTNTTGSNTVPGTEQQFPDYPKYLDRCHLNASVTEDGQVMPACVPGLVANVVLTNYT  125

Query  499  QSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP-PAGA--AATVR  648
            +S  N  YLNDSKY+GVGI  E DW V+VL+TNT +G ++P P G+  A +VR
Sbjct  126  KSQYNL-YLNDSKYSGVGIANEGDWVVVVLSTNTDSGDYSPAPPGSNWAPSVR  177



>gb|KDO74741.1| hypothetical protein CISIN_1g029481mg [Citrus sinensis]
Length=192

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 109/163 (67%), Gaps = 7/163 (4%)
 Frame = +1

Query  178  FLLASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP-  351
            FL  +L V+CD DEED LLQG+NSYR+S +L +L K+  A CLA ++AD+ +++ C    
Sbjct  14   FLSMNLLVKCDTDEEDTLLQGLNSYRESLNLTSLTKNKNAECLADELADQFKNQPCTNST  73

Query  352  GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKY  522
            GA   P +  +++N    L KC ++ + T+DG+V+P CV     +LVL+N+T+S Q +  
Sbjct  74   GANTVPGTEKQLSNYPDLLAKCHLNVSNTRDGIVMPACVPNLEHSLVLSNFTKS-QYSDS  132

Query  523  LNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVRN  651
            LND+KY G GIG+ED+W V++LTT+T  G +  P  AA+ + N
Sbjct  133  LNDTKYKGAGIGSEDNWIVVILTTSTPAGSYV-PYNAASLISN  174



>ref|XP_008353251.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Malus domestica]
Length=204

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 103/156 (66%), Gaps = 9/156 (6%)
 Frame = +1

Query  172  CVFLLASLSVRCD--DEEDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEAC  342
            C+ LL S  V+CD  DEED LLQGIN YR +  +L AL K+  A CLA +IA++ +++ C
Sbjct  16   CIVLL-SHQVKCDGVDEEDSLLQGINXYRTATLNLXALTKNANAECLADEIAEQFKNQPC  74

Query  343  PRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQ  510
                     P + P   +  K L KC ++ + T+DG+++P CV   VP+LVLTN+T+S Q
Sbjct  75   TNTTGSNTVPGTEPNFPDYPKLLAKCHLNVSNTRDGVIMPACVPSLVPSLVLTNFTKS-Q  133

Query  511  NAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
             +  LND+K+TG+GIG+ED+W V+VLTT+T  G F 
Sbjct  134  YSDKLNDTKFTGIGIGSEDNWIVVVLTTSTPEGSFV  169



>ref|XP_006850720.1| hypothetical protein AMTR_s00025p00038290 [Amborella trichopoda]
 gb|ERN12301.1| hypothetical protein AMTR_s00025p00038290 [Amborella trichopoda]
Length=204

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 94/147 (64%), Gaps = 4/147 (3%)
 Frame = +1

Query  214  EEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP-GA---PSSPPRVA  381
            E+  L   +NSYR S +LPAL+ ++ A CLA KIA + ED+ C    GA   P +  + +
Sbjct  40   EDKQLFNSLNSYRSSSNLPALSSNENAACLADKIAGKYEDQPCTNTTGANTVPGTETQFS  99

Query  382  NLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGT  561
            +    L  C ++ + T+DG+++ VCV K VP LVL+N+T S Q ++YLND+KY G GI +
Sbjct  100  DYPDFLADCHLNVSNTRDGVIMLVCVPKLVPALVLSNFTHSQQYSRYLNDTKYVGAGIAS  159

Query  562  EDDWTVLVLTTNTQTGMFAPPAGAAAT  642
            ED+W V VLTTNT TG F P   A ++
Sbjct  160  EDNWIVAVLTTNTSTGSFQPYNAATSS  186



>ref|XP_004140158.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Cucumis sativus]
 gb|KGN48028.1| hypothetical protein Csa_6G425160 [Cucumis sativus]
Length=196

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSS----  366
            V+CDD++ H  +GINSYR S +L AL ++D A+CLA +IA++ +++ C      ++    
Sbjct  24   VKCDDDDLH--RGINSYRASLNLTALVENDNADCLAEEIAEKFKNQPCTNTTGSNTISGT  81

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P+ ++    L KC ++ + T+DG ++P CV  RV  LVL N+T+S  + K LND+KYTG
Sbjct  82   EPQFSDFPNLLAKCNLNVSNTRDGAIMPACVPNRVADLVLANFTKSQYSGK-LNDTKYTG  140

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAAAT  642
            +GIG E DW V+VLTT+T  G F P  G+  T
Sbjct  141  IGIGNEHDWVVVVLTTSTAEGSFVPAVGSNNT  172



>ref|XP_004156068.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Cucumis sativus]
Length=193

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSS----  366
            V+CDD++ H  +GINSYR S +L AL ++D A+CLA +IA++ +++ C      ++    
Sbjct  24   VKCDDDDLH--RGINSYRASLNLTALVENDNADCLAEEIAEKFKNQPCTNTTGSNTISGT  81

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P+ ++    L KC ++ + T+DG ++P CV  RV  LVL N+T+S  + K LND+KYTG
Sbjct  82   EPQFSDFPNLLAKCNLNVSNTRDGAIMPACVPNRVADLVLANFTKSQYSGK-LNDTKYTG  140

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAAAT  642
            +GIG E DW V+VLTT+T  G F P  G+  T
Sbjct  141  IGIGNEHDWVVVVLTTSTAEGSFVPAVGSNNT  172



>ref|XP_002884553.1| hypothetical protein ARALYDRAFT_477902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60812.1| hypothetical protein ARALYDRAFT_477902 [Arabidopsis lyrata subsp. 
lyrata]
Length=199

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 96/140 (69%), Gaps = 5/140 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEED LL GINSYR +++L  L+K++ A CLA +IAD+ +++ C         P + P+ 
Sbjct  27   DEEDILLTGINSYRTTQNLTTLSKNENAECLADEIADQFKNKPCTNDTGSATVPGTEPQF  86

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            AN  + L KC ++ + T+DG ++P CV +   +LVLTN+T+S Q +  LNDSK+TG+GIG
Sbjct  87   ANYPQILAKCHLNVSDTRDGSIMPACVPRLESSLVLTNFTKS-QYSMSLNDSKFTGIGIG  145

Query  559  TEDDWTVLVLTTNTQTGMFA  618
             EDDW V+VLTTNT  G ++
Sbjct  146  KEDDWIVVVLTTNTPEGSYS  165



>ref|XP_010464168.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Camelina 
sativa]
Length=201

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            DEED LL GINSYR +++L   +K++ A CLA +IAD+ +++ C         P + P+ 
Sbjct  27   DEEDILLTGINSYRTTQNLTVFSKNENAECLADEIADQFKNKPCTNDTGSFTVPGTEPQF  86

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            AN  + L KC ++   T+DGMV+P CV +   +LVLTN+T++ Q +  LNDSKYTG+GIG
Sbjct  87   ANYPQMLAKCHLNVTDTRDGMVMPACVPRLESSLVLTNFTKT-QYSLGLNDSKYTGIGIG  145

Query  559  TEDDWTVLVLTTNTQTGMFA  618
             ED+W V+VLTTNT  G ++
Sbjct  146  KEDNWIVVVLTTNTPEGSYS  165



>ref|XP_006378153.1| hypothetical protein POPTR_0010s04230g [Populus trichocarpa]
 gb|ERP55950.1| hypothetical protein POPTR_0010s04230g [Populus trichocarpa]
Length=202

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 104/168 (62%), Gaps = 7/168 (4%)
 Frame = +1

Query  133  MAPSSSLRLSAAICVFLLASLS--VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLA  306
            MA S    L      FLL  +S  V CDD+ED LLQ IN+YR S +L AL K+D A CLA
Sbjct  1    MASSRFSLLFPFFVSFLLCIISHPVLCDDQEDGLLQSINNYRTSLNLTALTKNDNAECLA  60

Query  307  GKIADEIEDEACPRPGAPSSPP----RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVP  474
            G++AD+ +D+ C      ++ P    +  N    L KC ++ + T+DG ++P CV    P
Sbjct  61   GELADQFKDQPCTYATGSNTVPGTETQFPNYPSLLAKCHLNVSNTRDGALMPACVPNLDP  120

Query  475  TLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            +LVLTN+TQ+ Q +  L+D+K+TG GIG++ +W V+VLTT+T  G F 
Sbjct  121  SLVLTNFTQT-QYSGSLDDAKFTGAGIGSDGNWIVVVLTTSTPEGSFV  167



>gb|AAM65942.1| unknown [Arabidopsis thaliana]
Length=200

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEED LL GINSYR +++L  L+K++ A CLA +IAD+ +++ C         P + P+ 
Sbjct  27   DEEDILLTGINSYRTTQNLTILSKNENAECLADEIADQFKNKPCTNDTGSATVPGTEPQF  86

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            AN  + L KC ++ + T+DG ++P CV +    LVLTN+T+S Q +  LNDSK+TG+GIG
Sbjct  87   ANYPQILAKCHLNVSDTRDGSIMPACVPRLESNLVLTNFTKS-QYSMSLNDSKFTGIGIG  145

Query  559  TEDDWTVLVLTTNTQTGMFA  618
             EDDW V+VLTTNT  G ++
Sbjct  146  KEDDWIVVVLTTNTPEGSYS  165



>ref|NP_566267.1| glycoprotein membrane precursor GPI-anchored protein [Arabidopsis 
thaliana]
 sp|Q84MC0.1|UGPI4_ARATH RecName: Full=Uncharacterized GPI-anchored protein At3g06035; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAP21222.1| At3g06035 [Arabidopsis thaliana]
 dbj|BAE99958.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74333.1| glycoprotein membrane precursor GPI-anchored protein [Arabidopsis 
thaliana]
Length=200

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEED LL GINSYR +++L  L+K++ A CLA +IAD+ +++ C         P + P+ 
Sbjct  27   DEEDILLTGINSYRTTQNLTILSKNENAECLADEIADQFKNKPCTNDTGSATVPGTEPQF  86

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            AN  + L KC ++ + T+DG ++P CV +    LVLTN+T+S Q +  LNDSK+TG+GIG
Sbjct  87   ANYPQILAKCHLNVSDTRDGSIMPACVPRLESNLVLTNFTKS-QYSMSLNDSKFTGIGIG  145

Query  559  TEDDWTVLVLTTNTQTGMFA  618
             EDDW V+VLTTNT  G ++
Sbjct  146  KEDDWIVVVLTTNTPEGSYS  165



>ref|XP_004296918.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Fragaria vesca subsp. vesca]
Length=208

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +1

Query  172  CVFLLASLSVRCD--DEEDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEAC  342
            C+ LL    V+CD  DEED+LLQGINSYR +  +L AL K+D A CLA +IAD+ + + C
Sbjct  16   CIVLLNH-QVKCDEADEEDNLLQGINSYRATALNLTALTKNDNAECLADEIADQFKKQPC  74

Query  343  PRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQ  510
                     P +  + AN    L KC ++ + T+DG+++P CV    PTLVL N+T+S Q
Sbjct  75   TNTTGSFTVPGTETQFANFPDLLAKCHLNVSNTRDGVIMPACVPNLDPTLVLNNFTKS-Q  133

Query  511  NAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP  621
             +  LN + +TG+GIG+ED+W V++LTT+T  G + P
Sbjct  134  YSSSLNQTNFTGIGIGSEDNWIVVILTTSTPEGSYVP  170



>ref|XP_002871873.1| hypothetical protein ARALYDRAFT_488808 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48132.1| hypothetical protein ARALYDRAFT_488808 [Arabidopsis lyrata subsp. 
lyrata]
Length=199

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 98/153 (64%), Gaps = 5/153 (3%)
 Frame = +1

Query  193  LSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP----GAP  360
            LS   +DEED L  GIN+YR   +L  L  ++ A CLA +IAD+ +++ C         P
Sbjct  23   LSNTGNDEEDVLRTGINNYRAGLNLTTLIHNENAECLADEIADQFKNQPCTNTTGSFSVP  82

Query  361  SSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKY  540
             + P   NL K L KC ++   T+DG ++P CV    P+LVLTN+TQS Q +K LNDSK+
Sbjct  83   GTQPGFPNLPKLLSKCRLNPTVTRDGAILPACVPNLDPSLVLTNFTQS-QYSKDLNDSKF  141

Query  541  TGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            TG+GIG++D+W V+VLTT+T  G ++P + + A
Sbjct  142  TGIGIGSDDNWIVVVLTTSTPEGSYSPASNSGA  174



>ref|NP_197426.1| GPI-anchored glycoprotein membrane precursor [Arabidopsis thaliana]
 sp|P59833.1|UGPI3_ARATH RecName: Full=Uncharacterized GPI-anchored protein At5g19250; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAT41767.1| At5g19250 [Arabidopsis thaliana]
 gb|AAT70462.1| At5g19250 [Arabidopsis thaliana]
 gb|AED92675.1| GPI-anchored glycoprotein membrane precursor [Arabidopsis thaliana]
Length=196

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 94/147 (64%), Gaps = 5/147 (3%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEED LL GINSYR S +L  L  +  A CLA +IAD+ +++ C         P + P  
Sbjct  28   DEEDVLLTGINSYRASLNLTTLIHNHNAECLADEIADQFKNQPCTNTTGSASVPGTTPGF  87

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             NL   L KC ++   T+DG ++P CV    P+LVLTN+T S Q +K LNDSK+TG+GIG
Sbjct  88   PNLPNLLSKCRLNPTVTRDGAILPACVPNLDPSLVLTNFTMS-QYSKDLNDSKFTGIGIG  146

Query  559  TEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            ++D+W V+VLTT+T  G ++P + + A
Sbjct  147  SDDNWIVVVLTTSTPEGSYSPASNSGA  173



>ref|XP_010102037.1| hypothetical protein L484_000169 [Morus notabilis]
 gb|EXC45743.1| hypothetical protein L484_000169 [Morus notabilis]
Length=177

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 95/148 (64%), Gaps = 6/148 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPP-----R  375
            ++ED +L+GIN YR+S ++  LA++DKA+CLA +IAD++ED+ C      +  P      
Sbjct  11   EKEDLILKGINKYRKSVNVSELAENDKASCLADEIADDLEDQPCSGADKFADDPTRTVTE  70

Query  376  VANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGI  555
            + N  K  +KC I+  TT DG+++PVCV   V  LVL NYT SP   K+L DSKY+G G+
Sbjct  71   LVNFPKLANKCDINITTTTDGVILPVCVPDLVSELVLGNYTHSPYK-KFLKDSKYSGTGV  129

Query  556  GTEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            G+E  W V+VLTT+  TG F+     AA
Sbjct  130  GSEGAWIVVVLTTDKPTGSFSAATSLAA  157



>ref|XP_008390848.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Malus domestica]
 ref|XP_008351231.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Malus domestica]
Length=204

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 100/155 (65%), Gaps = 9/155 (6%)
 Frame = +1

Query  172  CVFLLASLSVRCD--DEEDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEAC  342
            C+ LL S  V+CD  DEED LLQGIN YR S  +L AL K+  A CLA  IA++ +++ C
Sbjct  16   CIVLL-SHQVKCDGVDEEDSLLQGINGYRASTLNLMALTKNANAECLAKXIAEQFKNQPC  74

Query  343  PRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQ  510
                     P + P   +  K L KC ++ + T+ G+++P CV   VP+LVLTN+TQS Q
Sbjct  75   TNTTGSNTVPGTEPNFPDYPKLLAKCHLNVSNTRXGVIMPACVPSLVPSLVLTNFTQS-Q  133

Query  511  NAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMF  615
             +  LND+K+TG+GIG+E++W V VLTT+T  G F
Sbjct  134  YSGNLNDTKFTGIGIGSEENWIVAVLTTSTPEGSF  168



>ref|XP_002871874.1| hypothetical protein ARALYDRAFT_909958 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48133.1| hypothetical protein ARALYDRAFT_909958 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 95/147 (65%), Gaps = 5/147 (3%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP----GAPSSPPRV  378
            DEED L  GIN+YR   +L  L  ++ A CLA +IAD+ +++ C         P + P  
Sbjct  28   DEEDVLRTGINNYRAGLNLTTLIHNENAECLADEIADQFKNQPCTNTTGSFSVPGTQPGF  87

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             NL K L KC ++   T+DG ++P CV    P+LVLTN+TQS Q +K LNDSK+TG+GIG
Sbjct  88   PNLPKLLSKCRLNPTVTRDGAILPACVPNLDPSLVLTNFTQS-QYSKDLNDSKFTGIGIG  146

Query  559  TEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            ++D+W V+VLTT+T  G ++P + + A
Sbjct  147  SDDNWIVVVLTTSTPEGSYSPASNSGA  173



>ref|NP_001060451.2| Os07g0645000 [Oryza sativa Japonica Group]
 dbj|BAC07018.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ40865.1| hypothetical protein OsJ_25346 [Oryza sativa Japonica Group]
 dbj|BAH01239.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF22365.2| Os07g0645000 [Oryza sativa Japonica Group]
Length=194

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 105/163 (64%), Gaps = 9/163 (6%)
 Frame = +1

Query  169  ICVFLLASLSVRC---DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEA  339
            +C  +LAS  + C   D  +  LL+GINSYR S  +PAL+++  A CLA ++A + +D+ 
Sbjct  8    VCFLVLASSLLHCARSDGSDSQLLKGINSYRASLKVPALSENKNAACLAEQLAQQFKDQP  67

Query  340  CPR-PGA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSP  507
            C    GA   P +  +  +  K+LD C ++ + T DG V+P CV   VP +VLTNYT+S 
Sbjct  68   CTNTTGANTVPGTEQQFPDYPKYLDHCHLNASVTGDGQVMPACVPGLVPDVVLTNYTKSQ  127

Query  508  QNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP-PAGA  633
             N +YLND+K++GVGI  E DW V+VL+T++ +G ++P P G+
Sbjct  128  YN-QYLNDTKFSGVGIANEGDWVVVVLSTSSGSGDYSPAPPGS  169



>ref|XP_002512367.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49819.1| conserved hypothetical protein [Ricinus communis]
Length=196

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 93/149 (62%), Gaps = 1/149 (1%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPPRV  378
            V CDDEED L+  +NS+R   +LP   K++ A+CLA ++A E+ DE C +    +     
Sbjct  27   VHCDDEEDILITCLNSHRAYLNLPVFVKNEGADCLADEVARELGDEPCNKTNTNNPFQVD  86

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N+   + KC I+   TKDG V+PVCV +  P  V TNYT++   AKY+NDS++  VGIG
Sbjct  87   HNITDLISKCDINITHTKDGAVLPVCVPELEPIAVFTNYTRT-HFAKYINDSRFAQVGIG  145

Query  559  TEDDWTVLVLTTNTQTGMFAPPAGAAATV  645
            +E +W V+VL+TNT  G FA  AG  + V
Sbjct  146  SEGEWMVIVLSTNTSRGDFAAFAGTNSLV  174



>ref|XP_006658043.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Oryza brachyantha]
Length=194

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 106/163 (65%), Gaps = 9/163 (6%)
 Frame = +1

Query  169  ICVFLLASLSVRC---DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEA  339
            +C  +LAS  + C   D  +  LL+GINSYR S  +PAL++++ A CLA ++A + + + 
Sbjct  8    LCFLVLASSLLHCARSDGSDSRLLKGINSYRASLKVPALSENNNAACLAEQLAKQFKGQP  67

Query  340  CPRP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSP  507
            C    GA   P +  +  +  K+LD C ++ + T+DG V+P CV   VP +VLTNYT+S 
Sbjct  68   CTNTTGANTVPGTEQQFPDYPKYLDHCHLNASVTEDGQVMPACVPGLVPDVVLTNYTKSQ  127

Query  508  QNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP-PAGA  633
             N +YLND+K++GVGI  E DW V+VL+T+T +G ++P P G+
Sbjct  128  YN-QYLNDTKFSGVGIANEGDWVVVVLSTSTGSGGYSPAPPGS  169



>gb|KDP40135.1| hypothetical protein JCGZ_02133 [Jatropha curcas]
Length=198

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 104/156 (67%), Gaps = 9/156 (6%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPS----S  366
            V+CD EED LL+GINSYR+S +L  L K+D A CLA ++AD+ +D+ C      +    +
Sbjct  24   VKCD-EEDTLLEGINSYRKSLNLTTLTKNDNAECLADELADQFKDQPCTNTTGSNTVSGT  82

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             P+  N +  L KC ++ + T+DG+ +P CV    P+LVLTN+T++ Q +  LND+KYTG
Sbjct  83   EPQFPNYESILAKCHLNISNTRDGVSMPACVPNLDPSLVLTNFTRT-QYSGNLNDTKYTG  141

Query  547  VGIGTEDDWTVLVLTTNTQTGMF---APPAGAAATV  645
            VGIG++ +W V+VLTT+T  G F   AP + +A ++
Sbjct  142  VGIGSDGNWIVVVLTTSTPEGNFENAAPNSDSAGSL  177



>emb|CDO99015.1| unnamed protein product [Coffea canephora]
Length=196

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 97/148 (66%), Gaps = 5/148 (3%)
 Frame = +1

Query  184  LASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR-PGA-  357
              S +V+C DEE +LLQ INSYR S +L AL ++DKA CLA  +AD  +D+ C    GA 
Sbjct  19   FISHTVKCADEEQNLLQQINSYRASLNLTALKENDKAKCLADGMADNFKDQPCTNTTGAN  78

Query  358  --PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLND  531
              P +  + ++    L KC ++  TT+DG ++P CV    PT+VL N+T + Q A  LND
Sbjct  79   TVPGTESQFSDYPNILAKCHLNVTTTRDGAIMPACVPNLNPTIVLANFTDT-QYANNLND  137

Query  532  SKYTGVGIGTEDDWTVLVLTTNTQTGMF  615
            +K+TGVGIG+++DW V+VLTT+T  G +
Sbjct  138  TKFTGVGIGSKNDWIVVVLTTDTPEGSY  165



>gb|EAZ04901.1| hypothetical protein OsI_27083 [Oryza sativa Indica Group]
Length=212

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 105/163 (64%), Gaps = 9/163 (6%)
 Frame = +1

Query  169  ICVFLLASLSVRC---DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEA  339
            +C  +LAS  + C   D  +  LL+GINSYR S  +PAL+++  A CLA ++A + +D+ 
Sbjct  8    VCFLVLASSLLHCARSDGSDSQLLKGINSYRASLKVPALSENKNAACLAEQLAQQFKDQP  67

Query  340  CPR-PGA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSP  507
            C    GA   P +  +  +  K+LD C ++ + T DG V+P CV   VP +VLTNYT+S 
Sbjct  68   CTNTTGANTVPGTEQQFPDYPKYLDHCHLNASVTGDGQVMPACVPGLVPDVVLTNYTKSQ  127

Query  508  QNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP-PAGA  633
             N +YLND+K++GVGI  E DW V+VL+T++ +G ++P P G+
Sbjct  128  YN-QYLNDTKFSGVGIANEGDWVVVVLSTSSGSGDYSPAPPGS  169



>ref|XP_004495734.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Cicer arietinum]
Length=201

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 107/174 (61%), Gaps = 19/174 (11%)
 Frame = +1

Query  145  SSLRLSAAICVFLL------ASLSVRC-DDEEDHLLQGINSYRQSKSLPALAKHDKANCL  303
            S+ +L   + +F+       + ++  C + ++  LL  IN+YR+  +LP   K DK +CL
Sbjct  2    STFKLGLYLLLFVFTHHLLPSQVAAACREKKQKDLLHDINTYRKVLNLPIFKKSDKPSCL  61

Query  304  AGKIADEIEDEAC-------PRPGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVR  462
            A KIA+++ED+ C       P PG   S P++ N QK ++KC I  NTTKDG+++PVCV 
Sbjct  62   ANKIANDLEDKHCEDYFHYYPLPG---SNPKIPNFQKSVEKCKISINTTKDGVIMPVCVP  118

Query  463  KRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDD--WTVLVLTTNTQTGMFA  618
            K  P  + +NYT+S +  KYL +SKY   G+G++ D  W VL+++TNT +G F+
Sbjct  119  KLDPDNLFSNYTKSNRYIKYLKNSKYVIAGVGSDSDNEWMVLIISTNTTSGDFS  172



>ref|XP_009338464.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Pyrus x bretschneideri]
Length=204

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 9/156 (6%)
 Frame = +1

Query  172  CVFLLASLSVRCD--DEEDHLLQGINSYRQSKSLPALA-KHDKANCLAGKIADEIEDEAC  342
            C+ LL S  V+CD  DEED LLQGINSYR +        K+  A CLA +IA++ +++ C
Sbjct  16   CIVLL-SHQVKCDGVDEEDSLLQGINSYRTATLNLTTLTKNANAECLADEIAEQFKNQPC  74

Query  343  PRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQ  510
                     P + P  ++  K L KC ++ + T+DG+V+P CV   VP+LVLTN+T++ Q
Sbjct  75   TNTTGSNTVPGTEPNFSDYPKLLAKCHLNVSNTRDGVVMPACVPSLVPSLVLTNFTKT-Q  133

Query  511  NAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
             +  LND+K+TG+GIG+ED+W V+VLTT+T  G F 
Sbjct  134  YSNNLNDTKFTGIGIGSEDNWIVVVLTTSTPEGSFV  169



>ref|XP_006288709.1| hypothetical protein CARUB_v10002019mg [Capsella rubella]
 gb|EOA21607.1| hypothetical protein CARUB_v10002019mg [Capsella rubella]
Length=194

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 5/147 (3%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEE+ L+  +N+YR S +L AL K++ A CLA ++AD+ ++  C         P + P  
Sbjct  26   DEEEVLITVLNNYRTSINLTALVKNENAECLADELADQFKNRPCTNTTGSAAVPGTEPGF  85

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            +N  K L KC ++   T+DG+++P CV     TLVL NYT+S Q ++ LNDSK+TG+GIG
Sbjct  86   SNFPKLLSKCRLNITVTRDGVILPSCVPHLDQTLVLNNYTKS-QYSRSLNDSKFTGIGIG  144

Query  559  TEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            ++D+W V+VLTTNT  G ++P   + A
Sbjct  145  SDDNWVVVVLTTNTPEGSYSPATNSGA  171



>ref|XP_004517228.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Cicer arietinum]
Length=173

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 6/104 (6%)
 Frame = +1

Query  325  IEDEACPRPG------APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVL  486
            IED  C +         P    R++N+QKH+DKCGI+ NTT DG+++PVCV K  PT+VL
Sbjct  45   IEDTPCEKVSQYYPVSGPGGNQRISNMQKHIDKCGININTTTDGVILPVCVSKLEPTIVL  104

Query  487  TNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            +NYT S   AK+LN+SKYTGVG+G+EDDW VLVLTTNT  G F+
Sbjct  105  SNYTHSDIYAKFLNNSKYTGVGLGSEDDWMVLVLTTNTTAGTFS  148



>ref|XP_008795128.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
isoform X1 [Phoenix dactylifera]
Length=192

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 91/153 (59%), Gaps = 5/153 (3%)
 Frame = +1

Query  202  RCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPP---  372
            RCDD    LL+GINSYR S +L AL  +  A CLA ++A + + + C      ++ P   
Sbjct  21   RCDDTSSELLKGINSYRASLNLSALTGNQNAECLAEQLAKQFKGQQCSNTTGSNTVPGTE  80

Query  373  -RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGV  549
             +  N    L+ C ++   T+D  V+P C+    P LVL+N+T+S Q ++ LNDS + G 
Sbjct  81   QQFPNYPDFLNHCHLNATVTQDAAVMPACIPGLTPDLVLSNFTKS-QYSQNLNDSHFVGA  139

Query  550  GIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            GI  EDDW V+VL+TNT +G FAP  G A+ V+
Sbjct  140  GIADEDDWVVVVLSTNTPSGSFAPATGVASVVK  172



>ref|XP_010492980.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
isoform X1 [Camelina sativa]
 ref|XP_010492981.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
isoform X2 [Camelina sativa]
Length=195

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 102/170 (60%), Gaps = 6/170 (4%)
 Frame = +1

Query  145  SSLRLSAAICVFL-LASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIAD  321
            S L L     VFL L    +  +DEED L   IN+YR S +L  L K++ A CLA ++AD
Sbjct  4    SKLHLLFLFSVFLSLHRPVLSENDEEDVLFTVINNYRTSINLTTLIKNENAECLADELAD  63

Query  322  EIEDEACPR----PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            + ++  C         P + P  ++  K L KC ++   T+DG+++P CV     TL++ 
Sbjct  64   QFKNRPCTNTSGSAAVPGTEPGFSDFPKLLTKCRLNITITRDGVILPTCVPHLDQTLLMN  123

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            NYT+S Q ++ LNDSK+TG+GIG+ED+W V+VLTTNT  G ++P   + A
Sbjct  124  NYTKS-QYSRSLNDSKFTGIGIGSEDNWVVVVLTTNTPEGSYSPATNSGA  172



>emb|CDY27716.1| BnaA05g31250D [Brassica napus]
Length=199

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 93/141 (66%), Gaps = 5/141 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            DEED L  GINSYR S++L  L K+  A CLA ++AD+ +++ C         P + P+ 
Sbjct  29   DEEDVLFTGINSYRTSQNLTTLNKNKNAECLADELADQFKNKPCTNETGSATVPGTEPQF  88

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            ++    L KC ++ + T+DG ++P CV +   +LVLTN+T+S Q +  LNDSK+TG+GIG
Sbjct  89   SDYPNILAKCHLNVSDTRDGSIMPACVPRLESSLVLTNFTKS-QYSMSLNDSKFTGMGIG  147

Query  559  TEDDWTVLVLTTNTQTGMFAP  621
             EDDW V+VLTTNT  G ++P
Sbjct  148  KEDDWIVVVLTTNTPEGNYSP  168



>ref|XP_009129633.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Brassica 
rapa]
Length=199

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 93/141 (66%), Gaps = 5/141 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            DEED L  GINSYR S++L  L K+  A CLA ++AD+ +++ C         P + P+ 
Sbjct  29   DEEDVLFTGINSYRTSQNLTTLNKNKNAECLADELADQFKNKPCTNETGSATVPGTEPQF  88

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            ++    L KC ++ + T+DG ++P CV +   +LVLTN+T+S Q +  LNDSK+TG+GIG
Sbjct  89   SDYPNILAKCHLNVSDTRDGSIMPACVPRLESSLVLTNFTKS-QYSMSLNDSKFTGMGIG  147

Query  559  TEDDWTVLVLTTNTQTGMFAP  621
             EDDW V+VLTTNT  G ++P
Sbjct  148  KEDDWIVVVLTTNTPEGNYSP  168



>ref|XP_010666770.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Beta vulgaris subsp. vulgaris]
Length=194

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 102/174 (59%), Gaps = 6/174 (3%)
 Frame = +1

Query  145  SSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADE  324
            SS  L       +L +  VR DDE D+LLQG+N YR S +L AL K+D A CLA +IAD+
Sbjct  6    SSTFLFLLFQAIILINHQVRSDDE-DNLLQGMNKYRASLNLTALTKNDNAACLAEQIADQ  64

Query  325  IEDEACPRPGAPSSPP----RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTN  492
             +D+ C      ++ P      A+  + L  C ++   T+DG ++P CV    P+LVL N
Sbjct  65   YKDQPCTNTTGSNTVPGTENNFASYPEFLSHCHLNITNTRDGQIMPACVPDLDPSLVLMN  124

Query  493  YTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVRNP  654
            +T+S Q +  LNDS Y+G GI +E +W V+VLTTN+ +G F    G+   + +P
Sbjct  125  FTKS-QYSGNLNDSTYSGAGIASEGNWIVVVLTTNSSSGSFETYEGSTGFIYSP  177



>emb|CDY05224.1| BnaC05g45790D [Brassica napus]
Length=199

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 93/141 (66%), Gaps = 5/141 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEED L  GINSYR S++L  L K+  A CLA ++AD+ +++ C         P + P+ 
Sbjct  29   DEEDVLFTGINSYRTSQNLTTLNKNKNAECLADELADQFKNKPCTNDTGSATVPGAEPQF  88

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            ++    L KC ++ + T+DG ++P CV +   +LVLTN+T+S Q +  LNDSK+TG+GIG
Sbjct  89   SDYPNILAKCHLNVSDTRDGSIMPACVPRLESSLVLTNFTKS-QYSMSLNDSKFTGMGIG  147

Query  559  TEDDWTVLVLTTNTQTGMFAP  621
             EDDW V+VLTTNT  G ++P
Sbjct  148  KEDDWIVVVLTTNTPEGNYSP  168



>ref|XP_007144739.1| hypothetical protein PHAVU_007G180700g [Phaseolus vulgaris]
 gb|ESW16733.1| hypothetical protein PHAVU_007G180700g [Phaseolus vulgaris]
Length=197

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 94/153 (61%), Gaps = 10/153 (7%)
 Frame = +1

Query  157  LSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDE  336
            L A++  F L    V CDDE  +LL  +N YR+  +LP L +  KA+CLA +IA+++ D 
Sbjct  11   LIASLVAFHLLPSPVACDDEGKNLLHDVNIYRKVMNLPVLDESAKASCLAEEIAEDLADM  70

Query  337  AC-------PRPGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNY  495
             C       P PG  S  P   N QK+L KC I+ NTT DG+++P+CV K    ++ +NY
Sbjct  71   HCETFRDYYPTPGNNSKIP---NFQKNLAKCSIEINTTTDGVIMPLCVPKLNHDVLFSNY  127

Query  496  TQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTT  594
            T+S +  KYLN+SKY   G+GTEDDW V ++ T
Sbjct  128  TKSNRFTKYLNNSKYNIAGVGTEDDWMVFIVGT  160



>ref|XP_006298596.1| hypothetical protein CARUB_v10014680mg [Capsella rubella]
 gb|EOA31494.1| hypothetical protein CARUB_v10014680mg [Capsella rubella]
Length=199

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            D ED LL GINSYR +++L  L+K++ A CLA +IAD+ +++ C         P + P+ 
Sbjct  25   DTEDILLTGINSYRATQNLTNLSKNENAECLADEIADQFKNKPCTNDTGSATVPGTEPQF  84

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N  + L KC ++ + T+DGM++P CV +  P LVLTN+T+S Q +  LNDSKYTG+GIG
Sbjct  85   PNYPQMLAKCHLNVSDTRDGMIMPACVPRLEPNLVLTNFTKS-QYSMGLNDSKYTGIGIG  143

Query  559  TEDDWTVLVLTTNTQTGMFA  618
             E+DW V+VL+T+T  G ++
Sbjct  144  KENDWIVVVLSTSTPEGSYS  163



>ref|XP_002312709.2| hypothetical protein POPTR_0008s19950g [Populus trichocarpa]
 gb|ABK94712.1| unknown [Populus trichocarpa]
 gb|EEE90076.2| hypothetical protein POPTR_0008s19950g [Populus trichocarpa]
Length=205

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 101/168 (60%), Gaps = 10/168 (6%)
 Frame = +1

Query  142  SSSLRLSAAICVFL----LASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLA  306
            SS   L     VF     L S  V CD D+ED LLQGIN+YR S +L  L K+D A CLA
Sbjct  3    SSRFSLLFPFFVFFIILCLISHPVICDGDQEDALLQGINNYRTSFNLTTLTKNDNAECLA  62

Query  307  GKIADEIEDEACPRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVP  474
             +IAD+ +++ C         P + P+  N    L KC ++ + T+DG V+P CV    P
Sbjct  63   EEIADQFKNQPCTNTTGSNTVPGTEPQFPNYPSLLAKCHLNVSNTRDGAVMPACVPHLDP  122

Query  475  TLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            +LVLTN+T++P +   LND+K+TG GIG++ +W V+VLTT+T  G + 
Sbjct  123  SLVLTNFTRTPYSDN-LNDTKFTGAGIGSDGNWIVVVLTTSTPEGSYV  169



>ref|XP_011034215.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Populus euphratica]
Length=205

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 101/168 (60%), Gaps = 10/168 (6%)
 Frame = +1

Query  142  SSSLRLSAAICVFL----LASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLA  306
            SS   L     VF     L S  V CD D+ED LLQGIN+YR S +L  L K+D A CLA
Sbjct  3    SSRFSLLFPFFVFFIILCLTSQPVICDGDQEDALLQGINNYRTSFNLTTLTKNDNAECLA  62

Query  307  GKIADEIEDEACPRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVP  474
             +IA++ +++ C         P + P+  N    L KC ++ + T+DG V+P CV    P
Sbjct  63   EEIAEQFKNQPCTNTTGSNTVPGTEPQFPNYPSLLAKCHLNISNTRDGAVMPACVPHLDP  122

Query  475  TLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            +LVLTN+T++P +   LND+K+TG GIG++ +W V+VLTT+T  G + 
Sbjct  123  SLVLTNFTRTPYSGN-LNDTKFTGAGIGSDGNWIVVVLTTSTPEGSYV  169



>ref|XP_010524805.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010524806.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 isoform 
X2 [Tarenaya hassleriana]
Length=197

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 96/146 (66%), Gaps = 6/146 (4%)
 Frame = +1

Query  199  VRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PS  363
            V CD DEED LL  +NSYR S++L  L K+  A CLA +IA++ +++ C         P 
Sbjct  22   VLCDNDEEDSLLTVVNSYRTSQNLTTLTKNKNAECLADEIAEQFKNQPCTNTTGSNTVPG  81

Query  364  SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYT  543
            + P+  N  + L KC ++ + T+DG ++P CV +   ++VL+N+T+S Q +  LNDSK+T
Sbjct  82   TEPQFPNFPELLSKCHLNVSATRDGAIMPACVHRLDQSVVLSNFTKS-QYSMNLNDSKFT  140

Query  544  GVGIGTEDDWTVLVLTTNTQTGMFAP  621
            G+GIG++ DW V+VLTTNT  G ++P
Sbjct  141  GIGIGSDHDWVVVVLTTNTPEGSYSP  166



>ref|XP_008450653.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Cucumis melo]
Length=208

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 6/154 (4%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            I +FLL    V CD ++D++L  IN YRQSK+L   + +  A CLAGK+  ++ DE C  
Sbjct  17   ISIFLLHPNVVLCDVKDDNILSAINKYRQSKNLSEFSYNKNAACLAGKLVYKLRDEPCSS  76

Query  349  P----GAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNA  516
                    SS  ++A+  K L KC I  N++ DG+++P CV    PT V +NYT S  +A
Sbjct  77   AENFNKEISSETKLADFPKLLRKCHIAYNSSIDGIILPSCVPGLDPTSVTSNYTHS-HDA  135

Query  517  KYLNDSKYTGVGIGT-EDDWTVLVLTTNTQTGMF  615
            +Y+ND  YTG G+GT ED W VL+L+TNT TG +
Sbjct  136  EYINDQNYTGAGVGTIEDAWVVLILSTNTSTGNY  169



>ref|XP_009126313.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Brassica rapa]
Length=199

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 94/142 (66%), Gaps = 5/142 (4%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEAC---PRPGA-PSSPPR  375
            +DEED LL+GIN YR S +L +LA ++ A CLA ++AD+ +++ C   P P + P S P 
Sbjct  27   NDEEDILLKGINDYRTSLNLTSLAHNNNAECLADELADQFKNQPCTNMPGPASVPGSQPG  86

Query  376  VANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGI  555
                 K L KC ++   T+DG ++P CV     +LVL+N+T+S  N + LNDSK+TG+GI
Sbjct  87   FTEFPKFLTKCRLNITATRDGEIMPACVPNLDASLVLSNFTKSRYN-QNLNDSKFTGIGI  145

Query  556  GTEDDWTVLVLTTNTQTGMFAP  621
             ++D+W V++LTTNT  G + P
Sbjct  146  ASDDNWIVVILTTNTTEGGYTP  167



>ref|XP_006407992.1| hypothetical protein EUTSA_v10021555mg [Eutrema salsugineum]
 gb|ESQ49445.1| hypothetical protein EUTSA_v10021555mg [Eutrema salsugineum]
Length=198

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 92/140 (66%), Gaps = 5/140 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            DEED L  GINSYR  ++L  L K++ A CLA +IAD+ +++ C         P + P+ 
Sbjct  28   DEEDVLFTGINSYRTLQNLTILNKNENAECLADEIADQFKNKPCTNDTGSATVPGTEPQF  87

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            AN  + L KC ++ + T+DG ++P CV +    LVLTN+T+S Q +  LNDSK+TG+GIG
Sbjct  88   ANYPQILAKCHLNVSDTRDGSIMPACVPRLDSNLVLTNFTKS-QYSMNLNDSKFTGMGIG  146

Query  559  TEDDWTVLVLTTNTQTGMFA  618
             EDDW V+VLTTNT  G ++
Sbjct  147  KEDDWIVVVLTTNTPEGSYS  166



>ref|XP_002517197.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45360.1| conserved hypothetical protein [Ricinus communis]
Length=172

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 94/150 (63%), Gaps = 5/150 (3%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            +EED LL+GINSYR+S +L  L K++ A CLA ++AD+ +++ C         P +  + 
Sbjct  5    NEEDTLLEGINSYRKSLNLTTLTKNENAECLAEELADQFKNQPCTNTTGSNTVPGTEQQF  64

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N +  L KC ++ + T+DG  +P CV    PTLVL N+T S Q + YLND+KYTG GIG
Sbjct  65   HNYESLLAKCHLNVSNTRDGQAMPACVPNLDPTLVLANFTGS-QYSSYLNDTKYTGAGIG  123

Query  559  TEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            ++ +W V+VLTT+   G F     A+ T++
Sbjct  124  SDGNWIVIVLTTSDPEGSFVTYNAASLTIK  153



>gb|KDP23527.1| hypothetical protein JCGZ_23360 [Jatropha curcas]
Length=186

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 91/143 (64%), Gaps = 5/143 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPPRV  378
            V CDD+ED L + +NS+R    LP L  ++ A CLAG++A E+ED+ C      S P ++
Sbjct  24   VHCDDDEDDLFKCLNSHRAYLDLPTLVNNEDAECLAGEVAKELEDQPCNG----SHPLQL  79

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
                  L KC I+ +  K+G+V+PVCV   VPT+V TNYT++   AKY+NDSK+   G+G
Sbjct  80   DEHTDLLSKCDINISHAKEGVVLPVCVPDLVPTVVFTNYTRT-HYAKYINDSKFAQAGVG  138

Query  559  TEDDWTVLVLTTNTQTGMFAPPA  627
            ++ DW V+VL TN+  G FA  A
Sbjct  139  SKGDWMVVVLGTNSTGGDFAAAA  161



>ref|XP_011010797.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Populus euphratica]
Length=202

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 98/153 (64%), Gaps = 7/153 (5%)
 Frame = +1

Query  178  FLLASLS--VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP  351
            FLL  +S  V CDD+ D LLQ IN+YR S +L AL K+D A CLA ++AD+ +D+ C   
Sbjct  16   FLLCIISHPVLCDDQVDGLLQSINNYRTSLNLTALTKNDNAECLAEELADQFKDQPCTNA  75

Query  352  GAPSSPP----RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAK  519
               ++ P    +  N    L KC ++ + T+DG ++P CV    P+LVLTN+TQ+ Q + 
Sbjct  76   TGSNTVPGTETQFPNYPSLLAKCHLNVSNTRDGALMPACVPNLDPSLVLTNFTQT-QYSG  134

Query  520  YLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
             L+D+K+TG GIG++ +W V+VLTT+T  G F 
Sbjct  135  SLDDAKFTGAGIGSDGNWIVVVLTTSTPEGSFV  167



>gb|EMT17592.1| hypothetical protein F775_44025 [Aegilops tauschii]
Length=286

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 105/161 (65%), Gaps = 9/161 (6%)
 Frame = +1

Query  163  AAICVFLLASLSV----RCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIE  330
            AA+  FL  + S+    R D +++ LL+GINSYR S  +PAL ++  A+CLA ++A + +
Sbjct  97   AALFCFLAVASSLLHPARSDGDDNQLLKGINSYRASLKVPALTENSNADCLAEQLAKKFK  156

Query  331  DEACPRP-GA---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYT  498
             + C    GA   P + P+  +  + LD+C ++ + T+DG V+P CV   V  +VLTNYT
Sbjct  157  GQECTNTTGANTVPGTEPQFPDYPQFLDRCHLNASVTEDGQVMPACVPGLVADIVLTNYT  216

Query  499  QSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP  621
            +S  N ++LND+KY+G+GI  E DW V+VL+T+T +G ++P
Sbjct  217  KSQYN-RFLNDTKYSGIGIANEGDWVVVVLSTSTDSGDYSP  256



>ref|XP_004166034.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Cucumis sativus]
Length=201

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 98/164 (60%), Gaps = 6/164 (4%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            I +FLL    V CD ++D++L  IN YR+SK+L  L+ +  A CLAGK+  ++ DE C  
Sbjct  17   ISIFLLHPNVVLCDVKDDNILNAINEYRESKNLSRLSYNRNAACLAGKLVYKLRDEPCSS  76

Query  349  P----GAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNA  516
                    SS  ++A+  K L KC I  N++ DG+++P CVR      V +NYT+S  + 
Sbjct  77   AENFNKEISSETKLADFPKLLRKCHIAYNSSVDGIILPSCVRGLDAISVTSNYTRS-HDG  135

Query  517  KYLNDSKYTGVGIGTEDD-WTVLVLTTNTQTGMFAPPAGAAATV  645
            +Y+ND  YTG G+GT DD W VL+L+TNT TG +     ++  V
Sbjct  136  EYINDQNYTGAGVGTIDDAWVVLILSTNTSTGNYDNSGSSSLVV  179



>ref|XP_008795129.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
isoform X2 [Phoenix dactylifera]
Length=192

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 89/153 (58%), Gaps = 5/153 (3%)
 Frame = +1

Query  202  RCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSP  369
            R DD    LL+GINSYR S +L AL  +  A CLA ++A + + + C         P + 
Sbjct  21   RSDDTSSELLKGINSYRASLNLSALTGNQNAECLAEQLAKQFKGQQCSNTTGSNTVPGTE  80

Query  370  PRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGV  549
             +  N    L+ C ++   T+D  V+P C+    P LVL+N+T+S Q ++ LNDS + G 
Sbjct  81   QQFPNYPDFLNHCHLNATVTQDAAVMPACIPGLTPDLVLSNFTKS-QYSQNLNDSHFVGA  139

Query  550  GIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            GI  EDDW V+VL+TNT +G FAP  G A+ V+
Sbjct  140  GIADEDDWVVVVLSTNTPSGSFAPATGVASVVK  172



>ref|XP_004135621.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Cucumis sativus]
Length=201

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 98/164 (60%), Gaps = 6/164 (4%)
 Frame = +1

Query  169  ICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR  348
            I +FLL    V CD ++D++L  IN YR+SK+L  L+ +  A CLAGK+  ++ DE C  
Sbjct  17   ISIFLLHPNVVLCDVKDDNILNAINEYRESKNLSRLSYNRNAACLAGKLVYKLRDEPCSS  76

Query  349  P----GAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNA  516
                    SS  ++A+  K L KC I  N++ DG+++P CVR      V +NYT+S  + 
Sbjct  77   AENFNKEISSETKLADFPKLLRKCHIAYNSSVDGIILPSCVRGLDAISVTSNYTRS-HDG  135

Query  517  KYLNDSKYTGVGIGTEDD-WTVLVLTTNTQTGMFAPPAGAAATV  645
            +Y+ND  YTG G+GT DD W VL+L+TNT TG +     ++  V
Sbjct  136  EYINDQNYTGAGVGTIDDAWVVLILSTNTSTGNYDNSGSSSLVV  179



>ref|XP_010454194.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Camelina sativa]
Length=195

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPR  375
            +DEED LL  IN+YR S ++  L K++ A CLA ++AD+ ++  C         P + P 
Sbjct  26   NDEEDVLLTVINNYRTSINITTLIKNENAECLADELADQFKNRPCTNNSGSAAVPGTEPG  85

Query  376  VANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGI  555
             ++  K L KC ++   T+DG+++P CV     TL++ NYT+S Q ++ LNDSK+TG+GI
Sbjct  86   FSDFPKLLTKCRLNITVTRDGVILPTCVPHLDQTLLMNNYTKS-QYSRSLNDSKFTGIGI  144

Query  556  GTEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            G+ED+W V+VLTT+T  G ++P   + A
Sbjct  145  GSEDNWVVVVLTTSTPEGSYSPATNSGA  172



>ref|XP_009124942.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Brassica rapa]
 emb|CDY18841.1| BnaAnng03060D [Brassica napus]
Length=207

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 91/139 (65%), Gaps = 5/139 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEED L  GINSYR S++L  L K++ A CLA ++A++ ++  C         P + P+ 
Sbjct  29   DEEDVLFTGINSYRTSQNLTILNKNENAECLADELAEQFKNRPCTNNTGSATVPGTEPQF  88

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            A   K L KC ++ + T+DG ++P CV +   +LVLTN+T+S Q +  LNDSK+TG+GIG
Sbjct  89   AEYPKILTKCHLNVSDTRDGSIMPACVPRLESSLVLTNFTKS-QYSMSLNDSKFTGMGIG  147

Query  559  TEDDWTVLVLTTNTQTGMF  615
             E+DW V+VLTTNT  G +
Sbjct  148  KENDWIVVVLTTNTPGGSY  166



>ref|NP_001149922.1| LOC100283550 precursor [Zea mays]
 gb|ACG37206.1| GPI-anchored protein At5g19240 precursor [Zea mays]
Length=197

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 102/158 (65%), Gaps = 8/158 (5%)
 Frame = +1

Query  169  ICVFLLASLSVRC---DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEA  339
            +C  +LAS  + C   D  +  LL+GINSYR S  +PALA++  A CLA ++A + + + 
Sbjct  8    LCALVLASSLLHCARSDGNDAQLLKGINSYRSSLKVPALAENKNAACLAEQLARQFKGQE  67

Query  340  CPRP-GAPS---SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSP  507
            C    GA +   +  +  +  ++LD+C ++ + T+DG V+P CV   VP +VL NYT+S 
Sbjct  68   CTNTTGANTVIGTEQQFPDYPRYLDRCHLNASVTEDGQVMPACVPGLVPAVVLANYTKSQ  127

Query  508  QNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP  621
             N ++LNDS+++G GI +E DW V+VL+T+T +G ++P
Sbjct  128  YN-RFLNDSQFSGAGIASEGDWVVVVLSTSTGSGDYSP  164



>ref|XP_002463282.1| hypothetical protein SORBIDRAFT_02g041150 [Sorghum bicolor]
 gb|EER99803.1| hypothetical protein SORBIDRAFT_02g041150 [Sorghum bicolor]
Length=194

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 102/160 (64%), Gaps = 8/160 (5%)
 Frame = +1

Query  163  AAICVFLLASLSVRC---DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIED  333
            + +C  +LAS  + C   D  +  LL+GINSYR S  +PAL ++  A CLA ++A + + 
Sbjct  6    SVLCSLVLASSLLHCARSDGNDAQLLKGINSYRSSLKVPALTENTNAACLAEQLAKQFKG  65

Query  334  EACPRP-GAPS---SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQ  501
            + C    GA +   +  +  +  K+LD C ++ + T+DG V+P CV   VP +VLTNYT+
Sbjct  66   QQCTNTTGANTVIGTEQQFPDYPKYLDHCHLNASVTEDGQVMPACVPGLVPAVVLTNYTK  125

Query  502  SPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP  621
            S  N ++LND++++GVGI  E DW V+VL+T+T +G ++P
Sbjct  126  SQYN-RFLNDTQFSGVGIANEGDWVVVVLSTSTGSGDYSP  164



>ref|XP_010424180.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like, 
partial [Camelina sativa]
Length=189

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPR  375
            +DE+D LL  IN+YR S +L  L K++ A CLA ++AD+ ++  C         P + P 
Sbjct  26   NDEDDVLLTVINNYRTSINLTTLIKNENAECLADELADQFKNRPCTNNSGSAAVPGTEPG  85

Query  376  VANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGI  555
             ++  K L KC ++   T+DG+++P CV     TL++ NYT+S Q ++ LNDSK+TG+GI
Sbjct  86   FSDFPKLLTKCRLNITVTRDGVILPTCVPHLDQTLLMNNYTKS-QYSRSLNDSKFTGIGI  144

Query  556  GTEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            G+ED+W V+VLTT+T  G ++P   + A
Sbjct  145  GSEDNWVVVVLTTSTPEGSYSPATNSGA  172



>emb|CDY49994.1| BnaC03g34510D [Brassica napus]
Length=197

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 104/163 (64%), Gaps = 10/163 (6%)
 Frame = +1

Query  151  LRLSAAICVFLLASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEI  327
            L L + I +FL  S  V  D DEED L  GINSYR S++L  L  ++ A CLA +IAD++
Sbjct  6    LLLISFILIFL--SRHVLSDIDEEDVLFIGINSYRASQNLTTLNNNENAECLADEIADQL  63

Query  328  EDEACPR----PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCV--RKRVPTLVLT  489
            +++ C         P + P+ A+    L KC +  + T+DG+++P CV   +  P+LVLT
Sbjct  64   KNKPCTNDTGSATVPGTEPQFADYPNILAKCHLSVSDTRDGLIMPACVPFLESSPSLVLT  123

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            N+T+S Q +  LNDSK+TG+GIG EDDW V+VLTTNT  G F+
Sbjct  124  NFTKS-QYSLSLNDSKFTGMGIGKEDDWIVVVLTTNTPQGSFS  165



>emb|CDY47208.1| BnaAnng08780D [Brassica napus]
 emb|CDY47211.1| BnaAnng08810D [Brassica napus]
Length=199

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 89/142 (63%), Gaps = 5/142 (4%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPR  375
            +DEED LL+GIN YR S +L  L  ++ A CLA ++AD+ +++ C         P S P 
Sbjct  27   NDEEDILLKGINDYRTSLNLTTLTHNNNAECLADELADQFKNQPCTNMTGPASVPGSQPG  86

Query  376  VANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGI  555
                 K L KC ++   T+DG ++P CV     +LVL+N+T+S  N + LNDSK+TG+GI
Sbjct  87   FTEFPKFLTKCRLNITATRDGEIMPACVPNLDASLVLSNFTKSRYN-QNLNDSKFTGIGI  145

Query  556  GTEDDWTVLVLTTNTQTGMFAP  621
             ++D+W V++LTTNT  G + P
Sbjct  146  ASDDNWIVVILTTNTTEGGYTP  167



>ref|XP_004958511.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Setaria italica]
Length=194

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 100/158 (63%), Gaps = 8/158 (5%)
 Frame = +1

Query  169  ICVFLLASLSVRC---DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEA  339
            +C  +LA   + C   D  +  LL+GINSYR S  +PAL ++  A CLA ++A + + + 
Sbjct  8    LCFLVLAFSLLHCARSDGNDAQLLKGINSYRSSLKVPALTENKNAACLAEQLAKQFKGQQ  67

Query  340  CPRP-GAPS---SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSP  507
            C    GA +   +  +  +  K+LD C ++ + T+DG V+P CV   VP +VLTNYT+S 
Sbjct  68   CTNTTGANTVIGTEQQFPDYPKYLDHCHLNASVTEDGQVMPACVPGLVPGVVLTNYTKSQ  127

Query  508  QNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP  621
             N ++LNDS+++GVGI  E DW V+VL+T+T +G ++P
Sbjct  128  YN-RFLNDSQFSGVGIANEGDWVVVVLSTSTGSGDYSP  164



>ref|XP_010093991.1| hypothetical protein L484_007337 [Morus notabilis]
 gb|EXB55006.1| hypothetical protein L484_007337 [Morus notabilis]
Length=396

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 96/146 (66%), Gaps = 6/146 (4%)
 Frame = +1

Query  199  VRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSS---  366
            V+CD D ED LLQ IN+YR S +L AL K+  A CLA +++++ +++ C      ++   
Sbjct  25   VKCDHDVEDSLLQSINAYRASLNLTALQKNKNAECLADEVSEQFQNQPCTNTTGSNTVTG  84

Query  367  -PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYT  543
              P+ A+    L KC ++ + T+DG V+P CV     TLV++N+T+S Q + YLND+KY+
Sbjct  85   TEPQFADYPNLLTKCHLNISNTRDGAVLPACVPNLESTLVVSNFTKS-QYSDYLNDTKYS  143

Query  544  GVGIGTEDDWTVLVLTTNTQTGMFAP  621
            G+GIG ED+W V+VLTT+T  G F P
Sbjct  144  GIGIGHEDNWIVVVLTTSTPEGSFVP  169


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 87/151 (58%), Gaps = 8/151 (5%)
 Frame = +1

Query  214  EEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP-GAPSSP---PRVA  381
            EED LL+ IN+ R +  L AL K+  A C A + AD  +D+ C    GA ++P    +++
Sbjct  202  EEDVLLRSINAERATLKLAALTKNVNAECFADEFADRFQDQPCANTTGAITTPGTTTQLS  261

Query  382  NLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGT  561
            N  + L KC ++     +G+V+PVCV   VP   L++  +S Q +  LND K+TGVGIG 
Sbjct  262  NYPELLAKCNLN---VSNGLVLPVCVPNSVPNSALSDLKRS-QYSNSLNDPKFTGVGIGF  317

Query  562  EDDWTVLVLTTNTQTGMFAPPAGAAATVRNP  654
            EDDW V+VLT+N+      P A ++     P
Sbjct  318  EDDWIVVVLTSNSTAAGVVPSANSSNPANTP  348



>gb|EMS50332.1| hypothetical protein TRIUR3_23618 [Triticum urartu]
Length=302

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = +1

Query  181  LLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRP-GA  357
            ++ ++ ++ + E++ LL+GINSYR S  +PAL ++  A+CLA ++A + + + C    GA
Sbjct  115  IINAMCMQLEGEDNQLLKGINSYRASLKVPALTENSNADCLAEQLAKKFKGQECTNTTGA  174

Query  358  ---PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLN  528
               P + P+  +  + L++C ++ + T+DG V+P CV   V  +VLTNYT+S  N ++LN
Sbjct  175  NTVPGTEPQFPDYPQFLNRCHLNASVTEDGQVMPACVPGLVADVVLTNYTKSQYN-RFLN  233

Query  529  DSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP-PAGA  633
            D+KY+GVGI  E DW V+VL+T+T +G ++P P G+
Sbjct  234  DTKYSGVGIANEGDWVVVVLSTSTDSGDYSPAPPGS  269



>gb|ACF85600.1| unknown [Zea mays]
 tpg|DAA41605.1| TPA: GPI-anchored protein At5g19240 [Zea mays]
Length=197

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 101/158 (64%), Gaps = 8/158 (5%)
 Frame = +1

Query  169  ICVFLLASLSVRC---DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEA  339
            +C  +LAS  + C   D  +  LL+GINSYR S  +PAL+++  A CLA ++A + + + 
Sbjct  8    LCALVLASSLLHCARSDGNDAQLLKGINSYRSSLKVPALSENKNAACLAEQLARQFKGQE  67

Query  340  CPRP-GAPS---SPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSP  507
            C    GA +   +  +  +  ++LD+C ++ + T+DG V+P CV    P +VL NYT+S 
Sbjct  68   CTNTTGANTVIGTEQQFPDYPRYLDRCHLNASVTEDGQVMPACVPGLAPAVVLANYTKSQ  127

Query  508  QNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAP  621
             N ++LNDS+++G GI +E DW V+VL+T+T +G ++P
Sbjct  128  YN-RFLNDSQFSGAGIASEGDWVVVVLSTSTGSGDYSP  164



>emb|CDY58332.1| BnaA03g57350D [Brassica napus]
Length=230

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 94/142 (66%), Gaps = 7/142 (5%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            DEED L +GINSYR S++L  L  ++ A CLA +IAD++++  C         P + P+ 
Sbjct  58   DEEDVLFKGINSYRASQNLTTLNNNENAECLADEIADQLKNNPCTNDTGSVTVPGTEPQF  117

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCV--RKRVPTLVLTNYTQSPQNAKYLNDSKYTGVG  552
            A+    L KC +  + T+DG+++P CV   +  P+LVLTN+T+S Q +  LNDSK+TG+G
Sbjct  118  ADYPNILAKCHLSVSDTRDGLIMPACVPFLESSPSLVLTNFTKS-QYSLSLNDSKFTGMG  176

Query  553  IGTEDDWTVLVLTTNTQTGMFA  618
            IG EDDW V+VLTTNT  G F+
Sbjct  177  IGKEDDWIVVVLTTNTPQGSFS  198



>emb|CDY47207.1| BnaAnng08770D [Brassica napus]
Length=198

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 86/142 (61%), Gaps = 6/142 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEED LL  IN YR S +L  L  +D A+CLA +IAD+ ++  C         P S P+ 
Sbjct  25   DEEDLLLTTINKYRTSLNLTTLTPNDNADCLAEEIADQFKNRPCTNTTTSASVPGSEPQF  84

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N    L KC ++    +D +++P CV     +LVLTN+T S    K LNDSK+TG+GIG
Sbjct  85   PNYPNLLKKCHLNVTAMRDSVILPACVSNHDQSLVLTNFTNSDY-LKNLNDSKFTGIGIG  143

Query  559  TEDDWTVLV-LTTNTQTGMFAP  621
            ++D+W V+V LTTNT  G F+P
Sbjct  144  SDDNWIVVVLLTTNTSEGSFSP  165



>emb|CDY02572.1| BnaC02g08630D [Brassica napus]
Length=439

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 90/142 (63%), Gaps = 5/142 (4%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPR  375
            +DEED LL+GIN YR S +L  L  ++ A CLA ++AD+ +++ C         P S P 
Sbjct  267  NDEEDILLKGINDYRTSLNLTTLTHNNNAECLADELADQFKNQPCTNTTGPASVPGSQPG  326

Query  376  VANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGI  555
             +   K L KC ++   T+DG ++P CV     +LVL+N+T+S  N K LNDSK+TG+GI
Sbjct  327  FSEFPKFLTKCRLNITATRDGEIMPACVPNLDASLVLSNFTKSRYN-KNLNDSKFTGIGI  385

Query  556  GTEDDWTVLVLTTNTQTGMFAP  621
             ++D+W V++LTTNT  G + P
Sbjct  386  ASDDNWIVVILTTNTTEGGYTP  407


 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 87/141 (62%), Gaps = 5/141 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEED LL  IN YR S +L  L  +D A+CLAG+I D+ ++  C         P S P+ 
Sbjct  25   DEEDLLLTIINKYRTSLNLTTLTPNDNADCLAGEIVDQFKNRPCTNTTTSASVPGSEPQF  84

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N    L KC ++    +D +++P CV     +LVLTN+T+S +  K LNDSK+TG+GIG
Sbjct  85   PNYPNLLKKCHLNVTAMRDSVILPACVSNHDQSLVLTNFTKS-EYLKNLNDSKFTGIGIG  143

Query  559  TEDDWTVLVLTTNTQTGMFAP  621
            ++D+W V+VLTT T  G F+P
Sbjct  144  SDDNWIVVVLTTKTSEGSFSP  164



>ref|XP_010278076.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035 [Nelumbo 
nucifera]
Length=204

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 90/156 (58%), Gaps = 5/156 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPP--  372
            V+  DEE+ LL+ IN YR S +L  L ++  A+C+A ++AD+ E + C      +S P  
Sbjct  24   VKSHDEEETLLRDINKYRASLNLSPLTENKDADCIAEQVADQFEKQPCSNTTGANSAPGA  83

Query  373  --RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
              ++AN    L +C ++   TKD  ++P CV   VPTLVL+N+T S   ++YL DSKYT 
Sbjct  84   EIQLANYPAILHQCHLNTINTKDVAIIPACVPNLVPTLVLSNFTGS-HYSRYLKDSKYTE  142

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVRNP  654
             GI  EDDW V+VLTTN          G  +  RNP
Sbjct  143  AGISAEDDWIVVVLTTNAPVAAAGTAVGGNSVPRNP  178



>ref|XP_010938856.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
isoform X2 [Elaeis guineensis]
Length=192

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 89/154 (58%), Gaps = 5/154 (3%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPP--  372
            VR DD    LL+GINSYR S +L AL ++  A+CLA ++A + + + C      ++ P  
Sbjct  20   VRSDDTSSELLKGINSYRTSLNLSALTENQNADCLAEQLAKQFKGQDCSNTTGSNTVPGT  79

Query  373  --RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
              +  N    L+ C ++   T+D  ++P CV      LVLTN+T+S Q ++ LNDS + G
Sbjct  80   EQQFPNYPDFLNHCHLNATVTQDAAIMPACVPGLAADLVLTNFTKS-QYSQNLNDSHFVG  138

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
             GI  E DW V+VL+TNT  G FAP    A+ V+
Sbjct  139  AGIADEGDWVVVVLSTNTPGGSFAPATAVASAVK  172



>ref|XP_006400481.1| hypothetical protein EUTSA_v10014774mg [Eutrema salsugineum]
 gb|ESQ41934.1| hypothetical protein EUTSA_v10014774mg [Eutrema salsugineum]
Length=187

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 96/173 (55%), Gaps = 5/173 (3%)
 Frame = +1

Query  133  MAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGK  312
            MA S    LS  I       LS   ++EE+ LL+ IN YR S +L  L ++D A CLA +
Sbjct  1    MAISKLFLLSVVILSLHRPVLSD--NEEEEFLLKTINIYRTSINLTTLTQNDNAECLADE  58

Query  313  IADEIEDEAC-PRPGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            IADE ++  C    G+   P       K L KC ++ N T+DG+++P C      + VLT
Sbjct  59   IADEFKNRPCTSNTGSALDPGSEPGFPKLLTKCRLNINATRDGVIMPACAHNHDASHVLT  118

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            NYT S    K LNDSK+TG+GIG++ +W V++LTTNT  G ++   G    V 
Sbjct  119  NYTNSL--IKNLNDSKFTGIGIGSDVNWVVIILTTNTTEGGYSKSGGFTFGVN  169



>ref|XP_009134868.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Brassica rapa]
Length=200

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 93/142 (65%), Gaps = 7/142 (5%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEED L +GINSYR S++L  L  ++ A CLA +IAD++++  C         P + P+ 
Sbjct  28   DEEDVLFKGINSYRASQNLTTLNNNENAECLADEIADQLKNNPCTNDTGSATVPGTEPQF  87

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCV--RKRVPTLVLTNYTQSPQNAKYLNDSKYTGVG  552
            A+    L KC +  + T+DG+++P CV   +  P+LVLTN+T+S Q +  LND K+TG+G
Sbjct  88   ADYPNILAKCHLSVSDTRDGLIMPACVPFLESSPSLVLTNFTKS-QYSLSLNDFKFTGMG  146

Query  553  IGTEDDWTVLVLTTNTQTGMFA  618
            IG EDDW V+VLTTN+  G F+
Sbjct  147  IGKEDDWIVVVLTTNSPQGSFS  168



>ref|XP_010938855.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
isoform X1 [Elaeis guineensis]
Length=205

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 91/157 (58%), Gaps = 5/157 (3%)
 Frame = +1

Query  190  SLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSP  369
            SLS+R  +    LL+GINSYR S +L AL ++  A+CLA ++A + + + C      ++ 
Sbjct  30   SLSIRLGNTSSELLKGINSYRTSLNLSALTENQNADCLAEQLAKQFKGQDCSNTTGSNTV  89

Query  370  P----RVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSK  537
            P    +  N    L+ C ++   T+D  ++P CV      LVLTN+T+S Q ++ LNDS 
Sbjct  90   PGTEQQFPNYPDFLNHCHLNATVTQDAAIMPACVPGLAADLVLTNFTKS-QYSQNLNDSH  148

Query  538  YTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
            + G GI  E DW V+VL+TNT  G FAP    A+ V+
Sbjct  149  FVGAGIADEGDWVVVVLSTNTPGGSFAPATAVASAVK  185



>ref|XP_009126312.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Brassica rapa]
Length=198

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 85/142 (60%), Gaps = 6/142 (4%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            DEED LL  IN YR S +L  L  +D A+CLA +I D+ ++  C         P S P+ 
Sbjct  25   DEEDLLLTIINKYRTSLNLTTLTPNDNADCLAEEITDQFKNRPCTNTTTSASVPGSEPQF  84

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N  K L KC ++    +D +++P CV     +LVLTN+T S    K LNDSK+TG+GIG
Sbjct  85   PNYPKLLKKCHLNVTAMRDSVILPACVSNHDQSLVLTNFTNSDY-LKNLNDSKFTGIGIG  143

Query  559  TEDDWTVLV-LTTNTQTGMFAP  621
            ++D+W V+V LT NT  G F+P
Sbjct  144  SDDNWIVVVLLTINTSEGSFSP  165



>ref|XP_009404701.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Musa acuminata subsp. malaccensis]
Length=194

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 87/155 (56%), Gaps = 7/155 (5%)
 Frame = +1

Query  169  ICVFLLASL--SVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEAC  342
            +  F LA L  S R  D    LL+GIN YR S +L +L +++ A+CLA ++A   + + C
Sbjct  8    LSFFFLAVLLDSARSGDTTGQLLRGINDYRVSLNLSSLTENENADCLAAQLASAFKGQDC  67

Query  343  PRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQ  510
                     P +  +  +   +L  C ++   T+DG ++P CV    P LVL NYT+S  
Sbjct  68   SNTTGSDTVPGTEEQFPDFPDYLTACHLNATVTRDGFIMPACVPDLAPDLVLANYTKSQY  127

Query  511  NAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMF  615
            N K LNDS Y G+GI  E +W V+VLTTNT TG +
Sbjct  128  NQK-LNDSSYAGIGIAEEGNWVVVVLTTNTATGNY  161



>ref|XP_008777289.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
isoform X3 [Phoenix dactylifera]
Length=165

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 85/150 (57%), Gaps = 5/150 (3%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            D    LL+GINSYR S +L AL ++  A CL+ ++A + + + C         P +  + 
Sbjct  11   DTSSELLKGINSYRASLNLSALTENQNAECLSEQLAKQFKGQDCSNTTGSNTVPGTEQQF  70

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N    L+ C ++   T+D  V+P CV      LVLTN+T+S Q ++ LNDS + G GI 
Sbjct  71   PNYPDFLNHCHLNATVTQDAAVMPACVPGLARDLVLTNFTKS-QYSQNLNDSHFVGAGIA  129

Query  559  TEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
             E DW V+VL+TNT TG FAP  G A+ V 
Sbjct  130  DEGDWVVVVLSTNTPTGSFAPATGVASVVE  159



>ref|XP_008777288.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
isoform X2 [Phoenix dactylifera]
Length=172

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 85/150 (57%), Gaps = 5/150 (3%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            D    LL+GINSYR S +L AL ++  A CL+ ++A + + + C         P +  + 
Sbjct  11   DTSSELLKGINSYRASLNLSALTENQNAECLSEQLAKQFKGQDCSNTTGSNTVPGTEQQF  70

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N    L+ C ++   T+D  V+P CV      LVLTN+T+S Q ++ LNDS + G GI 
Sbjct  71   PNYPDFLNHCHLNATVTQDAAVMPACVPGLARDLVLTNFTKS-QYSQNLNDSHFVGAGIA  129

Query  559  TEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
             E DW V+VL+TNT TG FAP  G A+ V 
Sbjct  130  DEGDWVVVVLSTNTPTGSFAPATGVASVVE  159



>ref|XP_008777287.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
isoform X1 [Phoenix dactylifera]
Length=201

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPP----RV  378
            D    LL+GINSYR S +L AL ++  A CL+ ++A + + + C      ++ P    + 
Sbjct  11   DTSSELLKGINSYRASLNLSALTENQNAECLSEQLAKQFKGQDCSNTTGSNTVPGTEQQF  70

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N    L+ C ++   T+D  V+P CV      LVLTN+T+S Q ++ LNDS + G GI 
Sbjct  71   PNYPDFLNHCHLNATVTQDAAVMPACVPGLARDLVLTNFTKS-QYSQNLNDSHFVGAGIA  129

Query  559  TEDDWTVLVLTTNTQTGMFAPPAGAAATVR  648
             E DW V+VL+TNT TG FAP  G A+ V 
Sbjct  130  DEGDWVVVVLSTNTPTGSFAPATGVASVVE  159



>ref|XP_009403830.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Musa acuminata subsp. malaccensis]
Length=194

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 90/172 (52%), Gaps = 8/172 (5%)
 Frame = +1

Query  151  LRLSAAICVFLLASL-SVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEI  327
            LR+S   C  L+  L S R DD    LL+GIN YR S +L  L  +  A+CLA ++A   
Sbjct  3    LRISLFSCFLLIVLLHSARSDDTSSQLLKGINDYRVSLNLSQLTANQNADCLAEQLASAY  62

Query  328  EDEACPRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNY  495
            + + C         P +  + +N    L  C ++    +DG ++P CV    P LVL N+
Sbjct  63   KGQDCTNTTGSDTVPGTEQQFSNFPDFLSNCHLNATVIRDGSIMPACVPGLDPQLVLANF  122

Query  496  TQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPP--AGAAATV  645
            T+S  N + LNDS Y G+G+  E +W V VLTTNT  G + P    GA + V
Sbjct  123  TESQYN-QNLNDSSYVGIGLADEGNWVVAVLTTNTPAGNYGPATDTGAGSVV  173



>ref|XP_003591101.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|AES61352.1| glycoprotein membrane precursor GPI-anchored protein [Medicago 
truncatula]
Length=218

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 94/147 (64%), Gaps = 11/147 (7%)
 Frame = +1

Query  202  RCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEAC-------PRPGAP  360
            R  D +D LL  IN+YR++ +LP L K+ KA+CLA +IA ++ED+ C       P PG  
Sbjct  44   RRYDPDDDLLHDINTYRKALNLPILEKNYKASCLANRIAYDLEDKHCEYFHDFHPLPGI-  102

Query  361  SSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRV-PTLVLTNYTQSPQNAKYLNDSK  537
               P + N Q+ + KC I+ NTT+DG+V+PVCV + +    + +NYT++ +   YLN+SK
Sbjct  103  --NPEIPNFQRSVKKCDININTTRDGVVMPVCVPEIMHENDLFSNYTKNSRFTPYLNNSK  160

Query  538  YTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            YT  G+G + D  VL++ TNT +G F+
Sbjct  161  YTLAGVGHDLDKMVLIIGTNTASGDFS  187



>ref|XP_010418920.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like, 
partial [Camelina sativa]
Length=125

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 10/116 (9%)
 Frame = +1

Query  175  VFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR--  348
            +F L S  V C+  ED+LLQG+NS+R ++ +    K++KA+C+A +IAD++ED+ C    
Sbjct  12   IFSLISTCVICNQAEDNLLQGLNSHRTAQKVAPFTKNEKADCVADEIADKLEDQPCTNHS  71

Query  349  ------PGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYT  498
                  PG  S PP++ N Q  L +C ID NTT+DG+++PVC+  R+PTL LTNYT
Sbjct  72   TAGTVTPG--SVPPQLTNYQDILSECKIDPNTTRDGLILPVCIPNRIPTLALTNYT  125



>ref|XP_010454193.1| PREDICTED: uncharacterized GPI-anchored protein At5g19230-like 
[Camelina sativa]
Length=194

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = +1

Query  145  SSLRLSAAICVFLLASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIAD  321
            S L L   + VFL     V  D DEED LL+  N YR+S  L  L K++ A C A ++A 
Sbjct  4    SRLHLLFLLAVFLSLHRPVLSDNDEEDLLLELFNVYRKSIKLKTLTKNENAECFADEVAG  63

Query  322  EIEDEACPRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            + +++ C         P + PR+ NL K L KC ++    +DG V+ VCV K      LT
Sbjct  64   QFKNQRCKNVTGSALVPETDPRIQNLPKLLTKCRLNTTVIRDGAVMQVCVPKHDQNPNLT  123

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTEDD--WTVLVLTTNTQTGMFAPPAGAAATV  645
            +++ +    K LNDSK+TGVGIG+E D  W V+VLTTNT  G +A     A  V
Sbjct  124  DFSLAV--LKNLNDSKFTGVGIGSESDGEWVVVVLTTNTLEGGYAISGAFAFGV  175



>gb|KFK38039.1| hypothetical protein AALP_AA3G062300 [Arabis alpina]
Length=206

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 93/148 (63%), Gaps = 14/148 (9%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSS----PPRV  378
            DEED L   +N+YR +++L  L K+  A CLA +IAD+  ++ C      ++     P+ 
Sbjct  27   DEEDILFTDLNNYRTTQNLTTLIKNKNAECLADEIADQFRNKPCTNDTGSATVSGTEPQF  86

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
            AN  + + KC ++ + T++  ++P CV +    LVLTN+T+S  + K LNDSKYTG+GIG
Sbjct  87   ANFPQLVAKCHLNVSDTRE--IMPACVPRLESALVLTNFTKSQYSLK-LNDSKYTGIGIG  143

Query  559  TEDDWTVLVLTTNTQTGMFAPPAGAAAT  642
            TED+W V++LTT+T       P G+++T
Sbjct  144  TEDNWIVVILTTST-------PGGSSST  164



>ref|XP_010492978.1| PREDICTED: uncharacterized GPI-anchored protein At5g19230-like 
[Camelina sativa]
Length=195

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 87/162 (54%), Gaps = 6/162 (4%)
 Frame = +1

Query  145  SSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADE  324
            S L L   + VF      V  D +E++LL+  N YR S +L  L K++ A+CLA ++AD+
Sbjct  4    SKLHLLFLLSVFFSLHRIVLSDSDEENLLKVFNEYRTSLNLKTLTKNNNADCLADEVADQ  63

Query  325  IEDEACPRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTN  492
             +++ C         P + PR+ N    L KC +     KDG +V  C     P  VL N
Sbjct  64   FKNQTCSNTNGFALVPGTDPRIPNFPNLLAKCRLSTTVIKDGEIVKACAPNYDPIPVLRN  123

Query  493  YTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            +T      K LNDSK+TG+GI    +W V++LTTNT+ G ++
Sbjct  124  FTLVV--IKNLNDSKFTGIGIAKGGNWIVVILTTNTREGGYS  163



>ref|XP_006286569.1| hypothetical protein CARUB_v10002011mg [Capsella rubella]
 gb|EOA19467.1| hypothetical protein CARUB_v10002011mg [Capsella rubella]
Length=196

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 88/166 (53%), Gaps = 6/166 (4%)
 Frame = +1

Query  133  MAPSSSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGK  312
            MA S  L L   + VF      V  D  E+ LL+  N  R S  L  L K+  A+CLA +
Sbjct  1    MAISKQLHLLFLLSVFFALHRLVLSDTGEEDLLKVFNDVRTSLKLKTLTKNKNADCLADE  60

Query  313  IADEIEDEACPRPG----APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTL  480
            +AD+++ + C         P   PR+ N    L KC ++ +  +DG ++ VC     P  
Sbjct  61   VADQLKSQTCTNTTDFTLVPEKDPRIPNFPNLLAKCSLNTSVIRDGEIMKVCAPNHDPIP  120

Query  481  VLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            VL N+  S    K LNDSK+TG+GIG++ +W V+VLTTNT  G ++
Sbjct  121  VLKNF--SLVLTKNLNDSKFTGIGIGSDKNWVVVVLTTNTPEGSYS  164



>ref|XP_010420720.1| PREDICTED: uncharacterized GPI-anchored protein At5g19230-like 
[Camelina sativa]
Length=195

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 90/169 (53%), Gaps = 6/169 (4%)
 Frame = +1

Query  145  SSLRLSAAICVFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADE  324
            S L L   + VF      V  D +E++LL+  N YR S +L  L K++ A+CLA ++AD+
Sbjct  4    SKLHLLFLLSVFFSLHRLVLSDSDEENLLKVFNEYRTSLNLKTLTKNNNADCLADEVADQ  63

Query  325  IEDEACPRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTN  492
             +++ C         P + PR+ N    L KC +     +DG ++  C     P  VL N
Sbjct  64   FKNQTCSNTNGFALVPGTDPRIPNFPNLLAKCRLRTTVIRDGEIMKACAPDYDPIPVLRN  123

Query  493  YTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            +T      K LNDSK+TG+GI    +W V++LTTNT+ G ++  A ++ 
Sbjct  124  FTLVV--IKNLNDSKFTGIGIAKGGNWIVVILTTNTREGGYSLAANSSG  170



>ref|XP_010420723.1| PREDICTED: uncharacterized GPI-anchored protein At5g19230-like 
[Camelina sativa]
Length=194

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 92/165 (56%), Gaps = 9/165 (5%)
 Frame = +1

Query  145  SSLRLSAAICVFLLASLSVRCD-DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIAD  321
            S L L   + VFL     V  D DEED LL+  N YR+S  L  L K++ A C A ++A 
Sbjct  4    SKLHLLFLLAVFLSLHRPVLSDNDEEDLLLELFNVYRKSIKLTTLRKNENAECFADEVAG  63

Query  322  EIEDEACPRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLT  489
            + +++ C         P + PR+ NL   L KC ++    +DG V+ VCV K      LT
Sbjct  64   QFKNQPCTNVTGSALVPETDPRIQNLPNLLAKCHLNTTVIRDGAVMQVCVPKHDQNPNLT  123

Query  490  NYTQSPQNAKYLNDSKYTGVGIGTED--DWTVLVLTTNTQTGMFA  618
            +++ +    K LNDSK+TGVGIG+E   +W V+VLTTNT  G +A
Sbjct  124  DFSVAV--FKNLNDSKFTGVGIGSESGGEWVVVVLTTNTFEGGYA  166



>ref|XP_010454192.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Camelina sativa]
Length=195

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 85/151 (56%), Gaps = 6/151 (4%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSS  366
            V  D +E++LL+  N YR S +L  L K++ A+CLA ++AD+ +++ C         P +
Sbjct  22   VLSDSDEENLLKVFNEYRTSLNLKTLTKNNNADCLADEVADQFKNQTCSNTNGFALVPGT  81

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
             PR+ N    L KC +     +DG +V  C     P  VL N+T      K LNDSK+TG
Sbjct  82   DPRIPNFPNLLAKCRLSTTVIRDGEIVKACAPNYDPIPVLRNFTLVV--IKNLNDSKFTG  139

Query  547  VGIGTEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            +GI  + +W V++LTTNT+ G ++  A ++ 
Sbjct  140  IGIAKDGNWIVVILTTNTREGDYSLAANSSG  170



>ref|XP_006375767.1| hypothetical protein POPTR_0013s02470g, partial [Populus trichocarpa]
 gb|ERP53564.1| hypothetical protein POPTR_0013s02470g, partial [Populus trichocarpa]
Length=113

 Score =   101 bits (251),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +1

Query  214  EEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPPRVANLQK  393
            EED  LQG+NS+R S +LPALAK+  A CLA KIAD++ED+ C    A +SP ++ +   
Sbjct  1    EEDDFLQGLNSHRLSLTLPALAKNKNAGCLADKIADKLEDQPCTAASA-ASPVQIESYPD  59

Query  394  HLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLND  531
             L +CGID N T +G+V+P C    VPTL+LTNYT++   +KY+ND
Sbjct  60   LLSECGIDVNHTTEGVVLPACGPHLVPTLLLTNYTRTTY-SKYIND  104



>ref|XP_010492979.1| PREDICTED: uncharacterized GPI-anchored protein At5g19230-like 
[Camelina sativa]
Length=198

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 92/173 (53%), Gaps = 10/173 (6%)
 Frame = +1

Query  145  SSLRLSAAICVFLLASLSVRCDD--EEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIA  318
            S L L   + VFL     V  D+  +E+ L+ G N YR+S ++  LAK++ A C A +IA
Sbjct  4    SKLHLLFLLAVFLSLHRPVLSDNSAKEEGLVSGFNIYRKSINITTLAKNENAECFAEEIA  63

Query  319  DEIEDEACPRPGA----PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVL  486
             +  +  C         P + PR+ NL K L KC ++    +DG V+  C  K      L
Sbjct  64   GQFNNPPCTNVTGSTLVPETDPRIQNLPKLLAKCRLNTTVIRDGAVMQFCFPKHDQNPDL  123

Query  487  TNYTQSPQNAKYLNDSKYTGVGIGTEDD--WTVLVLTTNTQTGMFAPPAGAAA  639
            T +  SP   + LNDSK+TG+G+G+E D  W V+VLTTNT  G +A    + A
Sbjct  124  TKF--SPAVDQNLNDSKFTGIGMGSESDGEWLVVVLTTNTLEGGYASTTNSGA  174



>ref|XP_011023590.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250 [Populus 
euphratica]
Length=119

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 11/110 (10%)
 Frame = +1

Query  175  VFLLASLSVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG  354
            +FLL+S  V CD EED LLQG+NSYR S +LPA        CLA KIAD++ED+ C    
Sbjct  17   IFLLSS-PVHCD-EEDDLLQGLNSYRLSLTLPA--------CLADKIADKLEDQPCTAAR  66

Query  355  APSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQS  504
            A +SP ++ +    L +CGID N T +G+V+P C    VPTL+LTNYT++
Sbjct  67   A-ASPVQIESYPDILSECGIDVNHTTEGVVLPACGPHLVPTLLLTNYTRT  115



>ref|XP_008454803.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Cucumis melo]
Length=239

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 82/145 (57%), Gaps = 7/145 (5%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDE---ACPRPGA---P  360
            V CD  ED L + +N YR SK L  + ++ KA+C   +IA + +D+   +    G+   P
Sbjct  67   VHCDVNEDTLFKAMNIYRSSKELTPMNRNSKADCFVKQIAWDFDDQLPLSIFTSGSNITP  126

Query  361  SSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKY  540
            S+  ++ NL  +L +C I+ N TK+G+++P+ +   V  LVL   T S Q A YL+  ++
Sbjct  127  SNLTQLPNLPDYLTRCNIELNNTKNGLILPLHIPTLVSNLVLHGCTHS-QMANYLSKPEF  185

Query  541  TGVGIGTEDDWTVLVLTTNTQTGMF  615
            T +GIG  + W V    T++ TG F
Sbjct  186  TSIGIGCYEQWAVFAFATDSPTGSF  210



>gb|AAO42835.1| At5g19240 [Arabidopsis thaliana]
 dbj|BAE99487.1| hypothetical protein [Arabidopsis thaliana]
Length=199

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 80/152 (53%), Gaps = 8/152 (5%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            D E+ L    N YR+S +L  L K+  A CLA ++ D+++++ C         P + P +
Sbjct  28   DGENLLFTVFNQYRESVNLTNLKKNKNAECLADEVVDQLQNQPCTNTTGSASVPGTDPGI  87

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N    L KC ++ N T+DG+++ VC  K   T  L+++       K LNDSK+TG G+G
Sbjct  88   PNFPNLLAKCRLNTNVTRDGLILQVCAPKHHSTPDLSSFANVL--TKNLNDSKFTGAGVG  145

Query  559  TEDD--WTVLVLTTNTQTGMFAPPAGAAATVR  648
             + D  W V VLTTNT  G ++     A  V 
Sbjct  146  IDSDGIWLVTVLTTNTPGGSYSNSGAFAFGVN  177



>gb|AAN60328.1| unknown [Arabidopsis thaliana]
Length=194

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 80/152 (53%), Gaps = 8/152 (5%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            D E+ L    N YR+S +L  L K+  A CLA ++ D+++++ C         P + P +
Sbjct  28   DGENLLFTVFNQYRESVNLTNLKKNKNAECLADEVVDQLQNQPCTNTTGSASVPGTDPGI  87

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N    L KC ++ N T+DG+++ VC  K   T  L+++       K LNDSK+TG G+G
Sbjct  88   PNFPNLLAKCRLNTNVTRDGLILQVCAPKHHSTPDLSSFANVL--TKNLNDSKFTGAGVG  145

Query  559  TEDD--WTVLVLTTNTQTGMFAPPAGAAATVR  648
             + D  W V VLTTNT  G ++     A  V 
Sbjct  146  IDSDGIWLVTVLTTNTPGGSYSNSGAFAFGVN  177



>ref|NP_197425.1| GPI-anchored glycoprotein membrane precursor [Arabidopsis thaliana]
 sp|Q84VZ5.2|UGPI2_ARATH RecName: Full=Uncharacterized GPI-anchored protein At5g19240; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AED92674.1| GPI-anchored glycoprotein membrane precursor [Arabidopsis thaliana]
Length=199

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 80/152 (53%), Gaps = 8/152 (5%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPRV  378
            D E+ L    N YR+S +L  L K+  A CLA ++ D+++++ C         P + P +
Sbjct  28   DGENLLFTVFNQYRESVNLTNLKKNKNAECLADEVVDQLQNQPCTNTTGSASVPGTDPGI  87

Query  379  ANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIG  558
             N    L KC ++ N T+DG+++ VC  K   T  L+++       K LNDSK+TG G+G
Sbjct  88   PNFPNLLAKCRLNTNVTRDGLILQVCAPKHHSTPDLSSFANVL--TKNLNDSKFTGAGVG  145

Query  559  TEDD--WTVLVLTTNTQTGMFAPPAGAAATVR  648
             + D  W V VLTTNT  G ++     A  V 
Sbjct  146  IDSDGIWLVTVLTTNTPGGSYSNSGAFAFGVN  177



>dbj|BAD43828.1| unknown protein [Arabidopsis thaliana]
Length=130

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = +1

Query  358  PSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSK  537
            P + P   NL   L KC ++   T+DG ++P CV    P+LVLTN+T S Q +K LNDSK
Sbjct  15   PGTTPGFPNLPNLLSKCRLNPTVTRDGAILPACVPNLDPSLVLTNFTMS-QYSKDLNDSK  73

Query  538  YTGVGIGTEDDWTVLVLTTNTQTGMFAPPAGAAA  639
            +TG+GIG++D+W V+VLTT+T  G ++P + + A
Sbjct  74   FTGIGIGSDDNWIVVVLTTSTPEGSYSPASNSGA  107



>gb|ABR67420.1| GPI-anchored protein-like protein [Cucumis melo subsp. melo]
Length=406

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 82/145 (57%), Gaps = 7/145 (5%)
 Frame = +1

Query  199  VRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDE---ACPRPGA---P  360
            V CD  ED L + +N YR SK L  + ++ KA+C   +IA + +D+   +    G+   P
Sbjct  234  VHCDVNEDTLFKAMNIYRSSKELTPMNRNSKADCFVKQIAWDFDDQLPLSIFTSGSNITP  293

Query  361  SSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKY  540
            S+  ++ NL  +L +C I+ N TK+G+++P+ +   V  LVL   T S Q A YL+  ++
Sbjct  294  SNLTQLPNLPDYLTRCNIELNNTKNGLILPLHIPTLVSNLVLHGCTHS-QMANYLSKPEF  352

Query  541  TGVGIGTEDDWTVLVLTTNTQTGMF  615
            T +GIG  + W V    T++ TG F
Sbjct  353  TSIGIGCYEQWAVFAFATDSPTGSF  377


 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 79/144 (55%), Gaps = 9/144 (6%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA-------PSS  366
            D + + L +G N YR SK   ALA++ KA C+A +IA     +  P   A       PS+
Sbjct  27   DVDLEELFKGFNIYRNSKDRSALAQNSKAKCIAEQIAKNWYSQL-PCSAAIEGDVLLPSN  85

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
              ++    ++  KC ++ N T DG+++PV V      L+LTN T S Q  KYL+++ YT 
Sbjct  86   QSQLPLFTEYSRKCEVNLNHTVDGVILPVHVPNSADKLMLTNCTHS-QAPKYLDNATYTS  144

Query  547  VGIGTEDDWTVLVLTTNTQTGMFA  618
            VG+ T +D  V+ L T+  +G ++
Sbjct  145  VGLATNEDCLVIALGTDAISGSYS  168



>ref|XP_006382607.1| hypothetical protein POPTR_0005s03710g [Populus trichocarpa]
 gb|ABK93420.1| unknown [Populus trichocarpa]
 gb|ERP60404.1| hypothetical protein POPTR_0005s03710g [Populus trichocarpa]
Length=188

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 82/149 (55%), Gaps = 11/149 (7%)
 Frame = +1

Query  175  VFLLASLSVRCDDEEDHLLQGINSYRQ-SKSLPALAKHDKANCLAGKIADEIEDEACPRP  351
            +FL +S  + C DE+  L + IN+YR     +PAL K+ KA CLA +IAD + D+ C   
Sbjct  17   IFLFSSAVLSCGDEKHELFKNINAYRTLFLDIPALTKNKKAKCLANEIADRL-DQPCNET  75

Query  352  GAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCV----RKRVPTLVLTNYTQSPQNAK  519
                   ++ +    L  C +  N   D +V+PVC      + VP  +L NYT++ Q  K
Sbjct  76   -THVDQVKLDSYADQLKDC-VGTNHATDAVVMPVCAPADEVEAVP--LLHNYTRT-QYKK  130

Query  520  YLNDSKYTGVGIGTEDDWTVLVLTTNTQT  606
            Y+ DS YTG G+G+ D W V+VL  NT T
Sbjct  131  YIKDSSYTGAGVGSNDYWMVVVLNRNTST  159



>ref|NP_197424.1| GPI-anchored glycoprotein membrane precursor [Arabidopsis thaliana]
 sp|Q8GUL8.1|UGPI1_ARATH RecName: Full=Uncharacterized GPI-anchored protein At5g19230; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAO00758.1| putative protein [Arabidopsis thaliana]
 gb|AAP37802.1| At5g19230 [Arabidopsis thaliana]
 gb|AED92673.1| GPI-anchored glycoprotein membrane precursor [Arabidopsis thaliana]
Length=189

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 87/160 (54%), Gaps = 8/160 (5%)
 Frame = +1

Query  145  SSLRLSAAICVFL-LASLSVR-CDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIA  318
            S L L   + VFL L  L +   D E+D LL   N YR   +L  L K++ A CLA ++ 
Sbjct  4    SKLHLLCLLSVFLSLHRLVLSGTDGEDDLLLTVFNKYRTGLNLKTLTKNENAECLADEVV  63

Query  319  DEIEDEACPRPGAPSSPPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYT  498
            D+++++ C      S+P    NL   L KC ++    +DG+++ VC  K      L+N+ 
Sbjct  64   DQLKNQPCTNTNN-SAPVPGNNL---LAKCSLNTTVVRDGVIMQVCFPKHDKNPDLSNFN  119

Query  499  QSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
                  K LNDSK TG+GIG+ D W V++LTTNT  G ++
Sbjct  120  SVV--LKNLNDSKITGIGIGSGDIWVVVILTTNTPEGGYS  157



>ref|XP_011036773.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Populus euphratica]
Length=192

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 84/143 (59%), Gaps = 11/143 (8%)
 Frame = +1

Query  175  VFLLASLSVRCDDEEDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEACPRP  351
            +FLL+S  +    EE  LL+ IN+YR S   +PAL K+ KA C+A  IA  +E     +P
Sbjct  17   IFLLSSEVLGYGGEELKLLENINTYRTSYWDIPALTKNKKARCVAKNIAATLE-----QP  71

Query  352  GAPSSPPRVANLQKHLDKCG--IDGNTTKDGMVVPVCVRKRVPTLV--LTNYTQSPQNAK  519
               ++      L K+ D+    ID N T DG+V+PVC+ +   T V  L NYT++ + A 
Sbjct  72   CNETTDVYKVKLDKYPDQLANCIDTNHTTDGVVLPVCLPEDGLTEVSLLHNYTRT-RYAH  130

Query  520  YLNDSKYTGVGIGTEDDWTVLVL  588
            Y+ DS +TG+GIG+ D W V+VL
Sbjct  131  YIKDSNFTGIGIGSNDYWMVVVL  153



>ref|XP_003591097.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|AES61348.1| glycoprotein membrane precursor GPI-anchored protein [Medicago 
truncatula]
Length=168

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 69/118 (58%), Gaps = 4/118 (3%)
 Frame = +1

Query  202  RCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPG----APSSP  369
            R  D+E+ LL  IN YR+ ++LP L ++  A+CLA K A +++D+ C         PS  
Sbjct  43   RWGDKENDLLHDINIYRKVQNLPILEENYDASCLAIKFAYDLKDKHCEDFHDFHPLPSRN  102

Query  370  PRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYT  543
            P + N QK + KC I  NTTKD +++ VCV       + +NYT+     +YLN+SKYT
Sbjct  103  PSIPNFQKSVWKCNITINTTKDWVLMRVCVPGLDEDDLFSNYTRDSHFTEYLNNSKYT  160



>ref|XP_006382608.1| hypothetical protein POPTR_0005s03720g [Populus trichocarpa]
 gb|ERP60405.1| hypothetical protein POPTR_0005s03720g [Populus trichocarpa]
Length=192

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 82/143 (57%), Gaps = 11/143 (8%)
 Frame = +1

Query  175  VFLLASLSVRCDDEEDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEACPRP  351
            +FLL+S  +    EE  LL+ IN+YR S   +PAL K+ KA C+A  IA  +E     +P
Sbjct  17   IFLLSSEVLGYGGEELKLLENINAYRTSYWDIPALTKNKKARCVAKNIAATLE-----QP  71

Query  352  GAPSSPPRVANLQKHLDKCG--IDGNTTKDGMVVPVCVRK--RVPTLVLTNYTQSPQNAK  519
               ++ P    L K+ D+    I  N T DG+V+PVC+ +       +L NYT++ +   
Sbjct  72   CNETTRPFKVILDKYPDQLANCIGTNHTTDGVVLPVCLPEDGLAEVSLLHNYTRT-RYVN  130

Query  520  YLNDSKYTGVGIGTEDDWTVLVL  588
            Y+ DS +TG+GIG+ D W V+VL
Sbjct  131  YIKDSNFTGIGIGSNDYWMVVVL  153



>ref|XP_011036774.1| PREDICTED: uncharacterized GPI-anchored protein At3g06035-like 
[Populus euphratica]
Length=188

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 84/164 (51%), Gaps = 22/164 (13%)
 Frame = +1

Query  157  LSAAICVF-------LLASLSVRCDDEEDHLLQGINSYRQ-SKSLPALAKHDKANCLAGK  312
            L   IC+F       L +S  + C DE+  L + IN+YR     +PAL K+ KA CLA K
Sbjct  4    LQVNICLFVLFQAIVLFSSAVLSCGDEKHELFKNINAYRTLFLDIPALTKNKKAKCLANK  63

Query  313  IADEIEDEACPRPGAPSSPPRVANLQKHLDKCGIDGNTTK--DGMVVPVCV----RKRVP  474
            +AD ++     +P   ++      L  + D+      TT   D +++PVC      + VP
Sbjct  64   VADSLD-----QPCNETTHVEEVKLDSYPDQLKDCVGTTHATDAVLMPVCAPADEVEAVP  118

Query  475  TLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQT  606
              +L NYT+ P   KY+ D  YTG G+G+ D W V+V+  NT T
Sbjct  119  --LLHNYTRPPYK-KYIKDPSYTGAGVGSNDYWMVVVMNRNTST  159



>gb|ABK94613.1| unknown [Populus trichocarpa]
Length=192

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 82/143 (57%), Gaps = 11/143 (8%)
 Frame = +1

Query  175  VFLLASLSVRCDDEEDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEACPRP  351
            +FLL+S  +    +E  LL+ IN+YR S   +PAL K+ KA C+A  IA  +E     +P
Sbjct  17   IFLLSSEVLGYGGDELKLLENINTYRTSYWDIPALTKNKKARCVAKNIAATLE-----QP  71

Query  352  GAPSSPPRVANLQKHLDKCG--IDGNTTKDGMVVPVCVRK--RVPTLVLTNYTQSPQNAK  519
               ++ P    L K+ D+    I  N T DG+V+PVC+ +       +L NYT++ +   
Sbjct  72   CNETTRPFKVILDKYPDQLANCIGTNHTTDGVVLPVCLPEDGLAEVSLLHNYTRT-RYVN  130

Query  520  YLNDSKYTGVGIGTEDDWTVLVL  588
            Y+ DS +TG+GIG+ D W V+VL
Sbjct  131  YIKDSNFTGIGIGSNDYWMVVVL  153



>gb|KGN60894.1| hypothetical protein Csa_2G021650 [Cucumis sativus]
Length=161

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%), Gaps = 7/132 (5%)
 Frame = +1

Query  238  INSYRQSKSLPALAKHDKANCLAGKIADEIEDEA------CPRPGAPSSPPRVANLQKHL  399
            +N YR SK L  + ++ KA+CL  +IA +++D++         P  PS+  ++ NL  +L
Sbjct  1    MNKYRSSKELTPMHRNSKADCLVKQIAWDLDDQSPLSIFTSGSPIIPSNLTQLPNLPDYL  60

Query  400  DKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTV  579
             KC I+ N T+ G+++P+ +      LVL   T S Q   YL+  ++T +GIG  ++W V
Sbjct  61   TKCKIELNNTRKGLILPLHIPTLALKLVLHGCTHS-QMDNYLSKPEFTSIGIGCYEEWAV  119

Query  580  LVLTTNTQTGMF  615
                T++ TG F
Sbjct  120  FAFATDSPTGSF  131



>gb|KGN60893.1| hypothetical protein Csa_2G021640 [Cucumis sativus]
Length=204

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 79/147 (54%), Gaps = 8/147 (5%)
 Frame = +1

Query  196  SVRCDDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPPR  375
            SV CD + + L +G N YR SK   ALA++ KA C+A +IA    ++  P   A      
Sbjct  23   SVHCDVDLEELFKGFNIYRNSKDRSALAQNSKAKCIAEQIAKNWYNKL-PCSAAIEGDVL  81

Query  376  VANLQKHL------DKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSK  537
            +   Q  L       KC ++ N T DG+++PV V      L+LTN T S Q  KYL+++ 
Sbjct  82   LPFNQSQLPMSHYSRKCEVNLNHTVDGVILPVYVPNSADKLMLTNCTHS-QAPKYLDNAT  140

Query  538  YTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            YT VG+ T +D  V+ L T+  +G ++
Sbjct  141  YTRVGLATNEDCLVIALGTDAISGSYS  167



>ref|XP_008454795.1| PREDICTED: uncharacterized GPI-anchored protein At5g19250-like 
[Cucumis melo]
Length=205

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 79/144 (55%), Gaps = 9/144 (6%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA-------PSS  366
            D + + L +G N YR SK   ALA++ KA C+A +IA     +  P   A       PS+
Sbjct  27   DVDLEELFKGFNIYRNSKDRSALAQNSKAKCIAEQIAKNWYSQL-PCSAAIEGDVLLPSN  85

Query  367  PPRVANLQKHLDKCGIDGNTTKDGMVVPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTG  546
              ++    ++  KC ++ N T DG+++PV V      L+LTN T S Q  KYL+++ YT 
Sbjct  86   QSQLPLFTEYSRKCEVNLNHTVDGVILPVHVPNSADKLMLTNCTHS-QAPKYLDNATYTS  144

Query  547  VGIGTEDDWTVLVLTTNTQTGMFA  618
            VG+ T +D  V+ L T+  +G ++
Sbjct  145  VGLATNEDCLVIALGTDAISGSYS  168



>ref|XP_002981119.1| hypothetical protein SELMODRAFT_37468, partial [Selaginella moellendorffii]
 gb|EFJ17820.1| hypothetical protein SELMODRAFT_37468, partial [Selaginella moellendorffii]
Length=144

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 64/142 (45%), Gaps = 6/142 (4%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPR  375
            D  E  LL  IN YR +   P L+ +  A+CLA K+AD  +   C        +P   P 
Sbjct  2    DAVESQLLNDINMYRSNLGAPLLSPNPGASCLADKLADHFQHTPCDNVTEAQTSPGLTPD  61

Query  376  VANLQKHLDKCGIDGNTTKDGMVVPVCV--RKRVPTLVLTNYTQSPQNAKYLNDSKYTGV  549
              +    L  C +D   T  G V+  C+            N+T+S +  +++N S+++ +
Sbjct  62   FPDYPSMLADCRLDLANTTGGQVLVDCIPASSDAAGTAFQNFTRSQEYQRFINSSEFSSI  121

Query  550  GIGTEDDWTVLVLTTNTQTGMF  615
            GI  ED W VLVL T      F
Sbjct  122  GIANEDAWFVLVLGTKASNANF  143



>ref|XP_002982590.1| hypothetical protein SELMODRAFT_37466, partial [Selaginella moellendorffii]
 gb|EFJ16343.1| hypothetical protein SELMODRAFT_37466, partial [Selaginella moellendorffii]
Length=144

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 64/142 (45%), Gaps = 6/142 (4%)
 Frame = +1

Query  208  DDEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPR----PGAPSSPPR  375
            D  E  LL  IN YR +   P L+ +  A+CLA K+AD  +   C        +P   P 
Sbjct  2    DAVESQLLNDINMYRSNLGAPLLSPNPGASCLADKLADHFQHMPCDNVTEAQTSPGLTPD  61

Query  376  VANLQKHLDKCGIDGNTTKDGMVVPVCV--RKRVPTLVLTNYTQSPQNAKYLNDSKYTGV  549
              +    L +C +D   T  G V+  C+            N T+S +  +++N S ++ +
Sbjct  62   FPDYPSMLAECRLDLANTTGGQVLVDCIPASSDAAGTAFQNLTRSQEYQRFINSSDFSSI  121

Query  550  GIGTEDDWTVLVLTTNTQTGMF  615
            GIG ED W VLVL T      F
Sbjct  122  GIGNEDAWFVLVLGTKASNANF  143



>ref|XP_002319547.1| hypothetical protein POPTR_0013s02460g [Populus trichocarpa]
 gb|EEE95470.1| hypothetical protein POPTR_0013s02460g [Populus trichocarpa]
Length=181

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 73/140 (52%), Gaps = 21/140 (15%)
 Frame = +1

Query  217  EDHLLQGINSYRQSK-SLPALAKHDKANCLAGKIADEIEDEACPRPGAPSSPPRVANLQK  393
            ED+LL+ IN+YR S   LPAL K+ KA+CLA +I  +++D        P+          
Sbjct  32   EDNLLESINAYRTSLLGLPALTKNKKASCLAREIVVQLDD-------YPT----------  74

Query  394  HLDKCGIDGNTTKDGMVVPVCV-RKRVPTLV-LTNYTQSPQNAKYLNDSKYTGVGIGTED  567
             L  C    + T D  ++P+C+      TL    NY++S Q  KY+N+S Y G G+G  +
Sbjct  75   QLKHCYGSSSHTTDVAILPICIPGNDEQTLTNFQNYSRS-QYEKYVNESGYRGAGVGGNE  133

Query  568  DWTVLVLTTNTQTGMFAPPA  627
            +W V+V   NT +   A  A
Sbjct  134  NWMVVVFVENTTSWTSAGGA  153



>ref|XP_006419855.1| hypothetical protein CICLE_v10007213mg [Citrus clementina]
 gb|ESR33095.1| hypothetical protein CICLE_v10007213mg [Citrus clementina]
Length=85

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +1

Query  445  VPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFAPP  624
            +P CV    P+LVL+N+T+S Q +  LND+KY G GIG+ED+W V++LTT+T  G +  P
Sbjct  1    MPACVPNLEPSLVLSNFTKS-QYSDSLNDTKYKGAGIGSEDNWIVVILTTSTPEGSYV-P  58

Query  625  AGAAATVRN  651
              AA+ + N
Sbjct  59   YNAASLISN  67



>ref|XP_001775611.1| predicted protein [Physcomitrella patens]
 gb|EDQ59558.1| predicted protein [Physcomitrella patens]
Length=135

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 68/139 (49%), Gaps = 14/139 (10%)
 Frame = +1

Query  229  LQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGAPSS----PPRVANLQKH  396
            L  IN YR S+ LPA   +  A+C+A ++A++    +C       +     P+  +    
Sbjct  1    LSNINEYRLSQGLPAFGTNAGASCVARQVAEKFRGTSCTNSTGTDTVDGQEPQFDD--AL  58

Query  397  LDKCGIDGNTTKDGMVVPVCVRKRV-----PTLVLTNYTQSPQNAKYLNDSKYTGVGIGT  561
            L KC +     KDG + P CV   +     P +   N T+S Q A+ LND+KY   G G+
Sbjct  59   LKKCNLQLVNVKDGFIGPSCVPAGISAADAPKVAAINITKS-QYAE-LNDTKYVSAGAGS  116

Query  562  EDD-WTVLVLTTNTQTGMF  615
             D+ W V+VL TN   G F
Sbjct  117  VDNAWFVMVLATNASEGNF  135



>gb|AFK48797.1| unknown [Medicago truncatula]
Length=89

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  445  VPVCVRKRVPTLVLTNYTQSPQNAKYLNDSKYTGVGIGTEDDWTVLVLTTNTQTGMFA  618
            +P+CV K     + +NYT++    KYLN+SKY   G+G+EDDW VL+++TNT +G F+
Sbjct  1    MPMCVPKLDQDDLFSNYTKNSHFTKYLNNSKYIIAGVGSEDDWMVLIISTNTTSGDFS  58



>gb|AAN60255.1| unknown [Arabidopsis thaliana]
Length=106

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEACPRPGA----PSSPPRV  378
            DEED LL GINSYR +++L  L+K++ A CLA +IAD+ +++ C         P + P+ 
Sbjct  27   DEEDILLTGINSYRTTQNLTILSKNENAECLADEIADQFKNKPCTNDTGSATVPGTEPQF  86

Query  379  ANLQKHLDKCGIDGNTTKDG  438
            AN  + L KC ++ + T+DG
Sbjct  87   ANYPQILAKCHLNVSDTRDG  106



>gb|EPS60021.1| hypothetical protein M569_14784, partial [Genlisea aurea]
Length=57

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  211  DEEDHLLQGINSYRQSKSLPALAKHDKANCLAGKIADEIEDEAC  342
            DE+ +LLQGIN YR S +L +L ++  A+CLAG++A +++ + C
Sbjct  1    DEDGNLLQGINRYRTSLNLTSLTRNSNADCLAGEVAVQLKPQPC  44



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2108914979916