BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c37893_g1_i1 len=970 path=[1:0-969]

Length=970
                                                                      Score     E

ref|XP_011101398.1|  PREDICTED: transcription factor TGA5-like          241   1e-74   
ref|XP_009613589.1|  PREDICTED: transcription factor TGA6               236   8e-73   
ref|XP_009764515.1|  PREDICTED: transcription factor TGA6               232   3e-71   
gb|EYU43338.1|  hypothetical protein MIMGU_mgv1a023322mg                233   3e-71   
ref|XP_010316825.1|  PREDICTED: transcription factor TGA6               231   5e-71   
ref|XP_006362387.1|  PREDICTED: transcription factor TGA4-like          229   2e-70   
emb|CDO96810.1|  unnamed protein product                                228   1e-69   
ref|XP_011085984.1|  PREDICTED: transcription factor TGA5-like          229   1e-68   
ref|XP_010089699.1|  hypothetical protein L484_006321                   224   8e-68   
ref|XP_002266016.2|  PREDICTED: transcription factor TGA2               218   1e-65   Vitis vinifera
ref|XP_010439827.1|  PREDICTED: transcription factor TGA6-like          214   2e-64   
ref|XP_006384064.1|  hypothetical protein POPTR_0004s05690g             213   1e-63   
gb|KDO77874.1|  hypothetical protein CISIN_1g046619mg                   213   1e-63   
ref|XP_006467638.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    213   2e-63   
ref|XP_007025357.1|  Transcription factor-related, putative             212   4e-63   
ref|XP_010999748.1|  PREDICTED: transcription factor TGA6               209   6e-62   
ref|XP_006449514.1|  hypothetical protein CICLE_v10017869mg             207   1e-61   
ref|XP_010052186.1|  PREDICTED: transcription factor HBP-1b(c38)        207   3e-61   
ref|NP_193600.2|  transcription factor-related protein                  206   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225304.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    206   8e-61   
emb|CAB37450.1|  putative protein                                       204   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010277052.1|  PREDICTED: transcription factor HBP-1b(c38)-...    204   3e-60   
ref|XP_010434503.1|  PREDICTED: transcription factor TGA6-like is...    203   6e-60   
gb|ACD56655.1|  predicted protein                                       203   1e-59   Gossypioides kirkii
gb|AAT64037.1|  predicted protein                                       202   2e-59   Gossypium hirsutum [American cotton]
ref|XP_004486274.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    201   5e-59   
ref|XP_003541699.1|  PREDICTED: transcription factor HBP-1b(c38)-...    201   6e-59   
emb|CDX99446.1|  BnaC01g11060D                                          201   6e-59   
ref|XP_009350852.1|  PREDICTED: transcription factor TGA6               201   7e-59   
ref|XP_009132069.1|  PREDICTED: uncharacterized protein LOC103856700    201   8e-59   
ref|XP_006414073.1|  hypothetical protein EUTSA_v10027388mg             200   1e-58   
ref|XP_008371485.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    200   1e-58   
ref|XP_003547173.2|  PREDICTED: transcription factor TGA5-like          200   3e-58   
ref|XP_002867982.1|  hypothetical protein ARALYDRAFT_354881             197   6e-58   
emb|CBI30697.3|  unnamed protein product                                195   4e-57   
ref|XP_010686461.1|  PREDICTED: transcription factor HBP-1b(c38)        196   7e-57   
ref|XP_004293958.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    193   7e-56   
ref|XP_006285198.1|  hypothetical protein CARUB_v10006552mg             190   7e-55   
ref|XP_003636790.1|  Transcription factor TGA5                          180   6e-51   
gb|KDP21106.1|  hypothetical protein JCGZ_21577                         178   2e-50   
ref|XP_007148035.1|  hypothetical protein PHAVU_006G175000g             180   3e-50   
ref|XP_002534284.1|  conserved hypothetical protein                     177   1e-49   Ricinus communis
gb|KFK28536.1|  hypothetical protein AALP_AA7G009500                    174   3e-49   
ref|XP_010274491.1|  PREDICTED: uncharacterized protein LOC104609805    179   2e-47   
ref|XP_010434504.1|  PREDICTED: transcription factor HBP-1b(c38)-...    165   1e-45   
ref|XP_007212128.1|  hypothetical protein PRUPE_ppa012113mg             142   2e-37   
gb|KHN08426.1|  TGACG-sequence-specific DNA-binding protein TGA-2.1     139   5e-36   
ref|XP_009773805.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    120   4e-29   
ref|XP_002528014.1|  conserved hypothetical protein                     123   4e-29   Ricinus communis
ref|XP_011022856.1|  PREDICTED: transcription factor TGA2-like          120   5e-28   
ref|XP_002273632.1|  PREDICTED: transcription factor TGA2               119   5e-28   Vitis vinifera
ref|XP_002310543.2|  hypothetical protein POPTR_0007s04840g             119   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006380400.1|  hypothetical protein POPTR_0007s04840g             116   1e-26   
ref|XP_009402767.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    113   2e-25   
ref|XP_007214751.1|  hypothetical protein PRUPE_ppa024940mg             113   2e-25   
ref|XP_008793320.1|  PREDICTED: transcription factor HBP-1b(c38)-...    112   2e-25   
ref|XP_002272259.1|  PREDICTED: transcription factor TGA3-like          110   7e-25   Vitis vinifera
ref|XP_010025725.1|  PREDICTED: transcription factor TGA2-like          110   1e-24   
gb|KHN28618.1|  hypothetical protein glysoja_040486                     107   2e-24   
ref|XP_007159878.1|  hypothetical protein PHAVU_002G275400g             110   2e-24   
emb|CDM81542.1|  unnamed protein product                                109   3e-24   
ref|XP_002984747.1|  hypothetical protein SELMODRAFT_181239             109   3e-24   
ref|XP_008227573.1|  PREDICTED: transcription factor TGA2-like          109   3e-24   
ref|XP_010104546.1|  hypothetical protein L484_025521                   108   3e-24   
ref|XP_002985809.1|  hypothetical protein SELMODRAFT_123200             108   3e-24   
ref|XP_008807787.1|  PREDICTED: transcription factor HBP-1b(c38)-...    107   5e-24   
gb|KDP41541.1|  hypothetical protein JCGZ_15948                         107   6e-24   
dbj|BAJ05339.1|  hypothetical protein                                   108   7e-24   
ref|XP_006830264.1|  hypothetical protein AMTR_s00130p00113960          108   7e-24   
dbj|BAJ05340.1|  hypothetical protein                                   107   1e-23   
ref|XP_003524316.1|  PREDICTED: transcription factor TGA4-like          108   1e-23   
ref|XP_003630355.1|  Transcription factor HBP-1b(c1)                    107   1e-23   
ref|XP_010104255.1|  hypothetical protein L484_016398                   106   2e-23   
gb|EYU45430.1|  hypothetical protein MIMGU_mgv1a012463mg                107   2e-23   
gb|EYU20609.1|  hypothetical protein MIMGU_mgv1a010868mg                107   2e-23   
ref|XP_004503896.1|  PREDICTED: transcription factor HBP-1b(c38)-...    107   2e-23   
gb|KHN17404.1|  Transcription factor TGA4                               108   3e-23   
gb|EYU23355.1|  hypothetical protein MIMGU_mgv1a023684mg                106   3e-23   
ref|XP_002510006.1|  Transcription factor HBP-1b, putative              104   6e-23   Ricinus communis
ref|XP_009757325.1|  PREDICTED: transcription factor TGA5-like          105   9e-23   
ref|XP_010674364.1|  PREDICTED: transcription factor TGA6-like          105   1e-22   
gb|EPS72055.1|  hypothetical protein M569_02704                         102   1e-22   
ref|XP_009623095.1|  PREDICTED: transcription factor HBP-1b(c38)-...    104   1e-22   
ref|XP_010920869.1|  PREDICTED: transcription factor TGA3-like          104   2e-22   
ref|XP_009802153.1|  PREDICTED: transcription factor HBP-1b(c38)-...    103   2e-22   
ref|XP_002532112.1|  Transcription factor HBP-1b, putative              103   2e-22   Ricinus communis
ref|XP_009799260.1|  PREDICTED: transcription factor TGA6-like          103   4e-22   
ref|XP_010093103.1|  hypothetical protein L484_007912                   103   6e-22   
ref|XP_002272336.1|  PREDICTED: transcription factor TGA5-like          102   6e-22   Vitis vinifera
ref|XP_011097086.1|  PREDICTED: transcription factor TGA2-like          103   6e-22   
ref|XP_009617985.1|  PREDICTED: transcription factor TGA5-like          102   8e-22   
gb|EYU23876.1|  hypothetical protein MIMGU_mgv11b017687mg               102   1e-21   
gb|EYU35712.1|  hypothetical protein MIMGU_mgv1a011847mg                102   1e-21   
ref|XP_004289493.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    102   1e-21   
ref|XP_008337157.1|  PREDICTED: transcription factor HBP-1b(c38)-...    102   1e-21   
ref|XP_010922993.1|  PREDICTED: uncharacterized protein LOC105046169    104   2e-21   
ref|XP_004288481.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    101   2e-21   
ref|XP_009594445.1|  PREDICTED: transcription factor TGA6-like          101   3e-21   
gb|KDP24433.1|  hypothetical protein JCGZ_24997                         100   3e-21   
gb|EYU26796.1|  hypothetical protein MIMGU_mgv1a026861mg                100   4e-21   
ref|XP_009798761.1|  PREDICTED: transcription factor TGA5             99.8    4e-21   
gb|EYU23363.1|  hypothetical protein MIMGU_mgv1a023034mg                100   4e-21   
gb|KDO56688.1|  hypothetical protein CISIN_1g047612mg                 99.8    5e-21   
ref|XP_004156023.1|  PREDICTED: transcription factor TGA6-like        99.8    6e-21   
dbj|BAA05470.1|  tumor-related protein                                  100   7e-21   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_006432080.1|  hypothetical protein CICLE_v10002078mg             100   7e-21   
ref|NP_001042081.1|  Os01g0159000                                     99.8    8e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009606302.1|  PREDICTED: transcription factor TGA7-like        99.4    8e-21   
ref|XP_006429421.1|  hypothetical protein CICLE_v10012620mg           99.0    8e-21   
ref|XP_011079057.1|  PREDICTED: transcription factor TGA5-like        99.4    9e-21   
ref|XP_010497879.1|  PREDICTED: uncharacterized protein LOC104775604  94.7    1e-20   
ref|XP_006338981.1|  PREDICTED: transcription factor TGA6-like        99.0    1e-20   
ref|XP_002263705.1|  PREDICTED: transcription factor TGA2-like        98.2    1e-20   Vitis vinifera
ref|XP_008442175.1|  PREDICTED: transcription factor TGA2-like is...  99.0    1e-20   
ref|XP_008806140.1|  PREDICTED: transcription factor TGA7-like        99.0    1e-20   
ref|XP_009379553.1|  PREDICTED: transcription factor TGA6-like        99.0    2e-20   
ref|XP_007026666.1|  Response to aba and salt 1, putative             97.8    2e-20   
ref|XP_011100139.1|  PREDICTED: transcription factor TGA1-like        98.6    2e-20   
ref|XP_010497886.1|  PREDICTED: transcription factor HBP-1b(c38)-...  93.6    3e-20   
ref|XP_010277360.1|  PREDICTED: transcription factor HBP-1b(c38)-...  98.2    3e-20   
ref|XP_004239641.1|  PREDICTED: transcription factor TGA6-like        97.8    3e-20   
ref|XP_007048544.1|  TGACG-sequence-specific DNA-binding protein ...  97.4    3e-20   
ref|XP_006643777.1|  PREDICTED: transcription factor TGA6-like        97.8    4e-20   
gb|EAY72627.1|  hypothetical protein OsI_00493                        97.8    4e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_011082768.1|  PREDICTED: transcription factor TGA1             97.1    4e-20   
ref|XP_004137901.1|  PREDICTED: transcription factor TGA7-like        96.7    5e-20   
ref|XP_009769468.1|  PREDICTED: transcription factor TGA6-like        97.1    6e-20   
gb|EYU23360.1|  hypothetical protein MIMGU_mgv1a019261mg              97.4    7e-20   
ref|XP_002272378.1|  PREDICTED: transcription factor TGA5-like        96.7    7e-20   Vitis vinifera
ref|XP_006356862.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  96.3    8e-20   
ref|XP_006472990.1|  PREDICTED: transcription factor TGA5-like        97.4    8e-20   
ref|XP_007206845.1|  hypothetical protein PRUPE_ppa027068mg           96.3    8e-20   
ref|XP_008442399.1|  PREDICTED: transcription factor HBP-1b(c38)      95.9    1e-19   
ref|XP_010277361.1|  PREDICTED: transcription factor HBP-1b(c38)-...  96.3    1e-19   
ref|XP_009768149.1|  PREDICTED: transcription factor TGA7-like        95.5    2e-19   
ref|XP_008219160.1|  PREDICTED: transcription factor HBP-1b(c38)      95.1    2e-19   
ref|XP_008442174.1|  PREDICTED: transcription factor TGA2-like is...  95.9    2e-19   
gb|KGN62783.1|  Transcription factor HBP-1b                           95.1    2e-19   
ref|XP_004249821.1|  PREDICTED: transcription factor HBP-1b(c38)-...  94.7    3e-19   
ref|XP_009618663.1|  PREDICTED: transcription factor TGA1-like        94.4    3e-19   
ref|XP_006366944.1|  PREDICTED: transcription factor HBP-1b(c38)-...  94.4    4e-19   
ref|XP_007021794.1|  Uncharacterized protein TCM_031867               94.4    5e-19   
emb|CDP06468.1|  unnamed protein product                              94.0    6e-19   
ref|XP_004244373.1|  PREDICTED: transcription factor TGA5             93.2    8e-19   
ref|XP_010086637.1|  hypothetical protein L484_004349                 92.8    1e-18   
ref|XP_004514219.1|  PREDICTED: uncharacterized protein LOC101514340  92.8    1e-18   
ref|XP_008345524.1|  PREDICTED: transcription factor TGA4-like        93.2    1e-18   
ref|XP_008386261.1|  PREDICTED: transcription factor TGA5-like        92.8    1e-18   
ref|NP_001237999.1|  bZIP transcription factor bZIP132                92.4    2e-18   
ref|XP_003530288.1|  PREDICTED: transcription factor HBP-1b(c38)-...  92.4    2e-18   
ref|XP_004148432.1|  PREDICTED: transcription factor TGA4-like        92.4    2e-18   
ref|XP_006348396.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  92.0    2e-18   
ref|XP_010905699.1|  PREDICTED: transcription factor HBP-1b(c38)-...  90.9    2e-18   
ref|XP_003596341.1|  Transcription factor TGA5                        92.0    2e-18   
ref|XP_009789761.1|  PREDICTED: transcription factor TGA2-like        91.7    2e-18   
ref|XP_007137287.1|  hypothetical protein PHAVU_009G114600g           90.5    3e-18   
ref|XP_010037696.1|  PREDICTED: transcription factor HBP-1b(c38)-...  91.7    3e-18   
ref|XP_006593493.1|  PREDICTED: bZIP transcription factor bZIP132...  92.0    3e-18   
ref|XP_008444975.1|  PREDICTED: transcription factor TGA4             91.3    4e-18   
ref|XP_011075022.1|  PREDICTED: transcription factor TGA5-like        91.7    4e-18   
ref|XP_008243515.1|  PREDICTED: transcription factor TGA4-like        91.3    4e-18   
ref|XP_010276977.1|  PREDICTED: transcription factor TGA2             90.9    4e-18   
ref|XP_009339278.1|  PREDICTED: transcription factor TGA5             90.9    4e-18   
ref|XP_007212919.1|  hypothetical protein PRUPE_ppa022280mg           90.9    4e-18   
ref|XP_009629955.1|  PREDICTED: transcription factor TGA1-like        90.9    5e-18   
ref|XP_009377744.1|  PREDICTED: transcription factor TGA4-like        90.9    6e-18   
ref|XP_004489078.1|  PREDICTED: transcription factor HBP-1b(c38)-...  90.1    8e-18   
ref|XP_010064245.1|  PREDICTED: transcription factor TGA1-like        90.9    8e-18   
ref|XP_004238547.1|  PREDICTED: transcription factor HBP-1b(c38)      90.1    1e-17   
ref|XP_008366197.1|  PREDICTED: transcription factor TGA5-like        89.7    1e-17   
ref|XP_007140269.1|  hypothetical protein PHAVU_008G097900g           89.4    2e-17   
gb|EYU45030.1|  hypothetical protein MIMGU_mgv1a018123mg              92.0    2e-17   
ref|XP_006477767.1|  PREDICTED: transcription factor TGA1-like        89.0    2e-17   
gb|KDP34795.1|  hypothetical protein JCGZ_10575                       88.6    3e-17   
ref|XP_004246934.1|  PREDICTED: transcription factor TGA2-like        88.6    4e-17   
gb|KEH23189.1|  transcription factor TGA5-like protein                88.2    4e-17   
ref|XP_011085128.1|  PREDICTED: transcription factor TGA5-like        88.2    5e-17   
ref|XP_006602670.1|  PREDICTED: transcription factor HBP-1b(c38)-...  87.8    5e-17   
ref|XP_007149576.1|  hypothetical protein PHAVU_005G081900g           87.4    6e-17   
ref|XP_011074300.1|  PREDICTED: transcription factor TGA1             88.2    7e-17   
ref|XP_004305124.1|  PREDICTED: transcription factor TGA4-like        87.4    8e-17   
gb|KHG25856.1|  Transcription factor TGA1 -like protein               87.4    8e-17   
ref|XP_006442481.1|  hypothetical protein CICLE_v10022056mg           87.4    8e-17   
emb|CAN72574.1|  hypothetical protein VITISV_036367                   86.7    1e-16   Vitis vinifera
ref|XP_002283108.1|  PREDICTED: transcription factor HBP-1b(c1)-like  86.7    1e-16   Vitis vinifera
ref|XP_004968271.1|  PREDICTED: transcription factor TGA6-like        87.4    2e-16   
dbj|BAH30346.1|  hypothetical protein                                 86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010313918.1|  PREDICTED: transcription factor TGA5-like        86.3    2e-16   
ref|NP_564730.1|  protein ZW2                                         86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003634633.1|  PREDICTED: transcription factor TGA4-like        86.3    2e-16   
ref|XP_011101404.1|  PREDICTED: transcription factor TGA6-like        85.9    4e-16   
ref|XP_004146086.1|  PREDICTED: transcription factor TGA5-like        85.1    4e-16   
ref|XP_008351209.1|  PREDICTED: transcription factor TGA7-like        86.3    5e-16   
ref|XP_003565204.1|  PREDICTED: transcription factor TGA2-like        85.1    7e-16   
ref|XP_006433711.1|  hypothetical protein CICLE_v10003662mg           83.6    1e-15   
ref|XP_006345765.1|  PREDICTED: transcription factor TGA1-like        84.7    1e-15   
ref|XP_008463763.1|  PREDICTED: transcription factor TGA5             84.3    1e-15   
ref|XP_003634664.1|  PREDICTED: transcription factor HBP-1b(c38)      84.0    1e-15   
ref|XP_010274492.1|  PREDICTED: transcription factor TGA5-like        84.0    1e-15   
ref|XP_010062825.1|  PREDICTED: transcription factor HBP-1b(c38)-...  83.6    2e-15   
gb|EYU36422.1|  hypothetical protein MIMGU_mgv1a025661mg              83.2    2e-15   
ref|XP_010089698.1|  hypothetical protein L484_006320                 82.8    4e-15   
ref|XP_010490486.1|  PREDICTED: transcription factor TGA4-like        82.4    5e-15   
ref|XP_007213175.1|  hypothetical protein PRUPE_ppa027008mg           82.0    6e-15   
emb|CDP10926.1|  unnamed protein product                              82.4    1e-14   
ref|XP_010511109.1|  PREDICTED: transcription factor TGA4-like        80.9    2e-14   
ref|XP_006370140.1|  DNA-binding family protein                       80.9    2e-14   
ref|XP_010695960.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  80.5    2e-14   
ref|XP_010667750.1|  PREDICTED: transcription factor HBP-1b(c38)-...  80.5    3e-14   
ref|XP_010317335.1|  PREDICTED: transcription factor HBP-1b(c38)-...  80.5    3e-14   
ref|XP_008351887.1|  PREDICTED: transcription factor TGA4-like        79.3    3e-14   
ref|XP_009762839.1|  PREDICTED: transcription factor HBP-1b(c38)-...  80.5    3e-14   
gb|EPS59924.1|  hypothetical protein M569_14883                       78.6    4e-14   
ref|XP_009118288.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  79.3    5e-14   
gb|KHN36891.1|  Transcription factor TGA1                             78.2    1e-13   
ref|XP_004234088.1|  PREDICTED: transcription factor TGA6-like        78.6    1e-13   
ref|XP_010414743.1|  PREDICTED: transcription factor TGA4-like        78.2    1e-13   
ref|XP_003567594.2|  PREDICTED: uncharacterized protein LOC100833996  78.6    1e-13   
ref|XP_002455164.1|  hypothetical protein SORBIDRAFT_03g005300        79.3    2e-13   Sorghum bicolor [broomcorn]
ref|XP_008349608.1|  PREDICTED: transcription factor TGA5-like        76.6    2e-13   
ref|XP_010458320.1|  PREDICTED: transcription factor TGA4-like        77.4    2e-13   
ref|XP_011085982.1|  PREDICTED: transcription factor HBP-1b(c38)-...  77.8    2e-13   
ref|XP_004293959.1|  PREDICTED: uncharacterized protein LOC101299272  77.8    3e-13   
ref|XP_011007917.1|  PREDICTED: transcription factor HBP-1b(c38)      77.0    3e-13   
ref|XP_004134926.1|  PREDICTED: transcription factor TGA1-like        77.4    4e-13   
ref|XP_009383925.1|  PREDICTED: transcription factor HBP-1b(c38)-...  76.3    4e-13   
ref|XP_011101452.1|  PREDICTED: transcription factor TGA5-like        77.0    5e-13   
ref|NP_001042845.2|  Os01g0306400                                     76.6    5e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002888220.1|  hypothetical protein ARALYDRAFT_893661           76.3    5e-13   
dbj|BAK01043.1|  predicted protein                                    75.5    6e-13   
dbj|BAB64034.1|  hypothetical protein                                 76.6    8e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009758860.1|  PREDICTED: transcription factor TGA3-like        76.3    1e-12   
ref|XP_007025355.1|  Delay of germination 1, putative                 77.8    1e-12   
ref|XP_010920258.1|  PREDICTED: transcription factor TGA2             75.9    1e-12   
gb|EYU43340.1|  hypothetical protein MIMGU_mgv1a020768mg              75.5    2e-12   
ref|XP_009338174.1|  PREDICTED: transcription factor TGA2-like        74.7    2e-12   
ref|XP_002537773.1|  conserved hypothetical protein                   75.1    2e-12   Ricinus communis
ref|XP_002524536.1|  conserved hypothetical protein                   72.8    3e-12   Ricinus communis
ref|NP_001145406.1|  uncharacterized protein LOC100278763             73.6    5e-12   Zea mays [maize]
ref|XP_004967541.1|  PREDICTED: transcription factor PERIANTHIA-like  73.6    6e-12   
ref|NP_001118628.1|  uncharacterized protein                          73.6    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008655844.1|  PREDICTED: transcription factor TGA5-like        73.2    7e-12   
ref|XP_010543213.1|  PREDICTED: transcription factor TGA2-like        73.2    7e-12   
ref|XP_007159877.1|  hypothetical protein PHAVU_002G275400g           72.8    8e-12   
gb|EYU20277.1|  hypothetical protein MIMGU_mgv1a018018mg              73.6    8e-12   
ref|XP_008673985.1|  PREDICTED: transcription factor PERIANTHIA-like  72.8    9e-12   
ref|XP_006582492.1|  PREDICTED: transcription factor HBP-1b(c38)-...  71.2    9e-12   
gb|EYU28097.1|  hypothetical protein MIMGU_mgv1a017794mg              73.2    1e-11   
ref|NP_188106.2|  uncharacterized protein                             72.8    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301016.1|  hypothetical protein CARUB_v10021407mg           72.8    1e-11   
ref|XP_008439732.1|  PREDICTED: transcription factor TGA5             73.2    1e-11   
gb|EYU31233.1|  hypothetical protein MIMGU_mgv1a023634mg              72.0    2e-11   
emb|CDX93460.1|  BnaA06g05880D                                        72.0    2e-11   
ref|XP_009405145.1|  PREDICTED: transcription factor HBP-1b(c38)-...  71.6    2e-11   
ref|XP_009148314.1|  PREDICTED: transcription factor TGA1-like        71.6    2e-11   
ref|XP_010253822.1|  PREDICTED: uncharacterized protein LOC104594963  73.2    4e-11   
ref|XP_006303181.1|  hypothetical protein CARUB_v10010176mg           71.2    4e-11   
ref|XP_008344751.1|  PREDICTED: transcription factor TGA5-like        70.1    5e-11   
ref|XP_011082771.1|  PREDICTED: transcription factor HBP-1b(c38)-...  72.4    5e-11   
ref|XP_009405272.1|  PREDICTED: transcription factor HBP-1b(c1)-like  70.9    6e-11   
ref|XP_009589153.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  70.9    7e-11   
ref|XP_009607760.1|  PREDICTED: transcription factor TGA6-like        70.5    9e-11   
ref|XP_009792490.1|  PREDICTED: uncharacterized protein LOC104239538  70.1    1e-10   
ref|XP_009792613.1|  PREDICTED: transcription factor TGA6-like        70.5    1e-10   
ref|XP_010064898.1|  PREDICTED: transcription factor HBP-1b(c38)-...  70.5    1e-10   
gb|KDP21107.1|  hypothetical protein JCGZ_21578                       69.7    2e-10   
gb|EYU26795.1|  hypothetical protein MIMGU_mgv1a0233481mg             67.8    2e-10   
ref|XP_010487302.1|  PREDICTED: transcription factor HBP-1b(c38)-...  69.3    2e-10   
ref|XP_011082770.1|  PREDICTED: transcription factor HBP-1b(c38)-...  70.9    2e-10   
ref|XP_008443347.1|  PREDICTED: uncharacterized protein LOC103486954  70.1    2e-10   
ref|XP_010487301.1|  PREDICTED: transcription factor HBP-1b(c38)-...  69.3    2e-10   
gb|AGG09199.1|  delay of germination 1c                               69.3    4e-10   
ref|XP_002882899.1|  hypothetical protein ARALYDRAFT_341612           68.6    4e-10   
ref|XP_011081582.1|  PREDICTED: transcription factor HBP-1b(c38)-...  68.6    4e-10   
emb|CDY22613.1|  BnaC08g42470D                                        67.8    6e-10   
ref|XP_008673687.1|  PREDICTED: transcription factor TGA6-like        68.6    7e-10   
ref|XP_010465409.1|  PREDICTED: transcription factor HBP-1b(c38)-...  67.8    7e-10   
ref|XP_009395216.1|  PREDICTED: transcription factor TGA2-like        68.2    8e-10   
ref|XP_010552125.1|  PREDICTED: transcription factor TGA7             67.8    8e-10   
ref|XP_010465408.1|  PREDICTED: transcription factor HBP-1b(c38)-...  67.8    9e-10   
ref|XP_010502248.1|  PREDICTED: transcription factor HBP-1b(c38)-...  67.4    9e-10   
ref|XP_010502264.1|  PREDICTED: transcription factor HBP-1b(c38)-...  67.4    1e-09   
ref|XP_010502256.1|  PREDICTED: transcription factor HBP-1b(c38)-...  67.4    1e-09   
dbj|BAG91889.1|  unnamed protein product                              66.6    1e-09   
ref|XP_004161213.1|  PREDICTED: uncharacterized LOC101207776          68.2    1e-09   
ref|XP_004150221.1|  PREDICTED: uncharacterized protein LOC101207776  67.8    1e-09   
ref|XP_004289492.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  65.5    1e-09   
ref|XP_006358130.1|  PREDICTED: transcription factor TGA1-like        67.4    2e-09   
ref|XP_010316826.1|  PREDICTED: transcription factor TGA5-like        66.6    3e-09   
emb|CDO96811.1|  unnamed protein product                              65.9    4e-09   
ref|XP_009599896.1|  PREDICTED: transcription factor TGA3-like        65.9    5e-09   
gb|AHA62826.1|  delay of germination 1 B                              65.5    5e-09   
gb|ABI84260.1|  tumor-related protein-like                            64.7    6e-09   
ref|XP_006300241.1|  hypothetical protein CARUB_v10016481mg           65.1    8e-09   
ref|XP_006407035.1|  hypothetical protein EUTSA_v10022387mg           64.7    8e-09   
ref|XP_006417512.1|  hypothetical protein EUTSA_v10008665mg           64.7    9e-09   
ref|XP_010242649.1|  PREDICTED: transcription factor TGA1-like        63.5    1e-08   
ref|NP_172466.1|  response to ABA and salt 1                          64.3    1e-08   
ref|XP_009619619.1|  PREDICTED: transcription factor TGA2-like        64.7    1e-08   
ref|XP_006659885.1|  PREDICTED: transcription factor TGA4-like        65.5    1e-08   
ref|XP_006281774.1|  hypothetical protein CARUB_v10027949mg           65.1    1e-08   
gb|ABK81209.1|  DOG1 alpha splice variant                             64.7    2e-08   
gb|ABK81206.1|  DOG1 alpha splice variant                             64.7    2e-08   
ref|NP_199395.2|  protein DELAY OF GERMINATION 1                      64.7    2e-08   
dbj|BAB09311.1|  tumor-related protein-like                           64.3    2e-08   
ref|XP_010676762.1|  PREDICTED: transcription factor TGA4-like        63.9    2e-08   
ref|XP_003560850.1|  PREDICTED: transcription factor HBP-1b(c38)-...  64.3    2e-08   
ref|XP_002863451.1|  hypothetical protein ARALYDRAFT_330831           63.9    2e-08   
emb|CDX94928.1|  BnaC05g07430D                                        63.2    3e-08   
ref|XP_009789465.1|  PREDICTED: uncharacterized protein LOC104237085  63.5    4e-08   
ref|XP_006655440.1|  PREDICTED: transcription factor HBP-1b(c1)-like  63.5    5e-08   
emb|CDY66844.1|  BnaC07g50150D                                        63.2    6e-08   
gb|AGG09198.1|  delay of germination 1a                               62.8    7e-08   
gb|ABK81211.1|  DOG1 alpha splice variant                             62.8    8e-08   
gb|KCW69957.1|  hypothetical protein EUGRSUZ_F03275                   61.6    1e-07   
gb|ACV41800.1|  delay of germination 1                                61.6    2e-07   
ref|XP_002892539.1|  hypothetical protein ARALYDRAFT_471106           60.5    3e-07   
gb|EYU43339.1|  hypothetical protein MIMGU_mgv1a024141mg              59.7    3e-07   
ref|XP_010695448.1|  PREDICTED: transcription factor HBP-1b(c38)      59.3    3e-07   
ref|XP_011098215.1|  PREDICTED: transcription factor TGA6-like        60.5    3e-07   
ref|XP_010316820.1|  PREDICTED: transcription factor HBP-1b(c38)-...  60.1    4e-07   
gb|EEC71515.1|  hypothetical protein OsI_03809                        60.1    6e-07   
ref|XP_009120767.1|  PREDICTED: transcription factor TGA6-like is...  59.7    8e-07   
ref|XP_010230791.1|  PREDICTED: transcription factor HBP-1b(c38)      59.7    9e-07   
ref|NP_974293.1|  transcription factor TGA6                           59.7    1e-06   
gb|EMT22752.1|  hypothetical protein F775_12222                       59.7    1e-06   
ref|XP_009146508.1|  PREDICTED: uncharacterized protein LOC103870151  58.9    1e-06   
emb|CDY70896.1|  BnaCnng70220D                                        58.5    1e-06   
ref|NP_001078141.1|  transcription factor TGA6                        59.3    1e-06   
emb|CDX97614.1|  BnaA05g24650D                                        58.5    1e-06   
dbj|BAB03134.1|  leucine zipper transcription factor HBP-1b           59.3    1e-06   
ref|XP_008651323.1|  PREDICTED: uncharacterized protein LOC100279...  59.3    1e-06   
ref|XP_008651313.1|  PREDICTED: uncharacterized protein LOC100279...  59.7    1e-06   
tpg|DAA57191.1|  TPA: putative bZIP transcription factor superfam...  58.2    1e-06   
emb|CDX76507.1|  BnaA08g08930D                                        58.5    1e-06   
ref|XP_009120759.1|  PREDICTED: transcription factor TGA6-like is...  59.3    1e-06   
ref|XP_008651324.1|  PREDICTED: uncharacterized protein LOC100279...  58.9    2e-06   
ref|XP_008651325.1|  PREDICTED: uncharacterized protein LOC100279...  58.9    2e-06   
dbj|BAD44579.1|  bZip transcription factor TGA6 / AtbZip45            58.9    2e-06   
ref|XP_006367574.1|  PREDICTED: uncharacterized protein LOC102590415  57.8    2e-06   
ref|XP_008651314.1|  PREDICTED: uncharacterized protein LOC100279...  58.9    2e-06   
ref|XP_008651321.1|  PREDICTED: uncharacterized protein LOC100279...  58.9    2e-06   
ref|NP_566415.3|  transcription factor TGA6                           58.9    2e-06   
ref|XP_006407352.1|  hypothetical protein EUTSA_v10021187mg           58.9    2e-06   
ref|NP_001030678.1|  transcription factor TGA6                        58.9    2e-06   
ref|XP_006407351.1|  hypothetical protein EUTSA_v10021187mg           58.5    2e-06   
ref|XP_008651318.1|  PREDICTED: uncharacterized protein LOC100279...  58.5    2e-06   
gb|ACG36725.1|  tumor-related protein                                 58.5    2e-06   
ref|XP_010924633.1|  PREDICTED: uncharacterized protein LOC105047415  56.6    2e-06   
ref|XP_010498795.1|  PREDICTED: transcription factor TGA6-like is...  58.2    3e-06   
ref|XP_002456383.1|  hypothetical protein SORBIDRAFT_03g035150        58.2    3e-06   
ref|XP_010464986.1|  PREDICTED: transcription factor TGA6 isoform X4  58.2    3e-06   
ref|XP_006299748.1|  hypothetical protein CARUB_v10015943mg           58.2    3e-06   
gb|EAY98526.1|  hypothetical protein OsI_20438                        58.2    3e-06   
ref|XP_009135220.1|  PREDICTED: transcription factor TGA6-like        58.2    3e-06   
emb|CDM84316.1|  unnamed protein product                              57.8    3e-06   
dbj|BAO79416.1|  wheat delay of dormancy 1                            57.8    3e-06   
ref|XP_002882771.1|  hypothetical protein ARALYDRAFT_478587           58.2    4e-06   
tpg|DAA57542.1|  TPA: hypothetical protein ZEAMMB73_325815            56.6    4e-06   
gb|KFK28541.1|  hypothetical protein AALP_AA7G010100                  57.4    4e-06   
ref|XP_009405143.1|  PREDICTED: uncharacterized protein LOC103988325  56.6    4e-06   
ref|XP_010498764.1|  PREDICTED: transcription factor TGA6-like is...  57.8    5e-06   
ref|XP_010464983.1|  PREDICTED: transcription factor TGA6 isoform X2  57.8    5e-06   
gb|AEF30410.1|  putative TGA2-like protein 2                          57.4    5e-06   
ref|XP_010464987.1|  PREDICTED: transcription factor TGA6 isoform X5  57.8    5e-06   
ref|XP_010486922.1|  PREDICTED: transcription factor TGA6 isoform X3  57.4    5e-06   
emb|CDY00762.1|  BnaC03g37460D                                        57.4    6e-06   
ref|XP_010498804.1|  PREDICTED: transcription factor TGA6-like is...  57.4    6e-06   
tpg|DAA57190.1|  TPA: putative bZIP transcription factor superfam...  57.4    6e-06   
tpg|DAA57189.1|  TPA: LOW QUALITY PROTEIN: putative bZIP transcri...  57.0    7e-06   
ref|NP_001105735.1|  LOC542756                                        57.0    7e-06   
emb|CDY58051.1|  BnaA06g40200D                                        56.6    8e-06   
ref|XP_006282688.1|  hypothetical protein CARUB_v10005444mg           56.6    8e-06   
ref|XP_010105854.1|  Transcription factor TGA7                        57.0    8e-06   
gb|ACF80806.1|  unknown                                               57.0    9e-06   
ref|XP_004237865.1|  PREDICTED: transcription factor TGA1-like is...  57.0    9e-06   
ref|XP_010320138.1|  PREDICTED: transcription factor TGA4-like is...  56.6    1e-05   
emb|CDY52616.1|  BnaCnng22950D                                        56.6    1e-05   
gb|ACF79461.1|  unknown                                               57.0    1e-05   
ref|NP_001132337.1|  putative bZIP transcription factor superfami...  56.6    1e-05   
gb|AAC37470.1|  leucine zipper                                        56.2    1e-05   
ref|XP_002457410.1|  hypothetical protein SORBIDRAFT_03g006790        56.2    1e-05   
ref|XP_006644874.1|  PREDICTED: transcription factor HBP-1b(c1)-like  56.2    1e-05   
emb|CDX78883.1|  BnaA01g09500D                                        53.5    2e-05   
ref|XP_004967673.1|  PREDICTED: transcription factor HBP-1b(c38)-...  55.8    2e-05   
ref|XP_009146628.1|  PREDICTED: transcription factor TGA6 isoform X2  55.8    2e-05   
gb|EPS65159.1|  hypothetical protein M569_09619                       55.8    2e-05   
ref|XP_006644064.1|  PREDICTED: transcription factor HBP-1b(c38)-...  55.8    2e-05   
ref|XP_009384968.1|  PREDICTED: transcription factor HBP-1b(c38)-...  55.8    2e-05   
gb|AFW84811.1|  putative bZIP transcription factor superfamily pr...  55.1    2e-05   
dbj|BAB72064.1|  bZIP transcription factor                            55.5    2e-05   
gb|EEC82717.1|  hypothetical protein OsI_27401                        55.5    2e-05   
gb|ADX23485.1|  DOG1                                                  53.1    2e-05   
ref|XP_002455522.1|  hypothetical protein SORBIDRAFT_03g012570        54.3    3e-05   
ref|XP_008655435.1|  PREDICTED: octopine synthase binding factor3...  55.8    3e-05   
ref|XP_006360289.1|  PREDICTED: transcription factor TGA7-like is...  55.5    3e-05   
ref|XP_009594430.1|  PREDICTED: transcription factor TGA1-like        55.5    3e-05   
gb|ADX23463.1|  DOG1                                                  52.8    3e-05   
ref|XP_009146627.1|  PREDICTED: transcription factor TGA6 isoform X1  55.1    3e-05   
ref|XP_010439826.1|  PREDICTED: uncharacterized protein LOC104723193  54.7    3e-05   
gb|EEC71673.1|  hypothetical protein OsI_04142                        55.5    3e-05   
ref|XP_003564436.1|  PREDICTED: transcription factor HBP-1b(c1)       55.5    3e-05   
gb|ADX23355.1|  DOG1                                                  52.8    3e-05   
gb|AAT28675.1|  bZIP transcription factor                             55.1    4e-05   
ref|XP_004958746.1|  PREDICTED: transcription factor HBP-1b(c38)-...  55.1    4e-05   
gb|ADX23392.1|  DOG1                                                  52.4    4e-05   
ref|XP_004958747.1|  PREDICTED: transcription factor HBP-1b(c38)-...  54.7    4e-05   
ref|XP_004252551.1|  PREDICTED: transcription factor TGA1             54.7    4e-05   
ref|NP_196312.1|  transcription factor TGA2                           54.7    4e-05   
gb|ADX23273.1|  DOG1                                                  52.4    4e-05   
ref|XP_006399172.1|  hypothetical protein EUTSA_v10014082mg           54.7    4e-05   
ref|NP_001060695.1|  Os07g0687700                                     54.7    4e-05   
ref|XP_002871242.1|  bZIP transcription factor TGA2                   54.7    4e-05   
gb|ABR46137.1|  bZIP transcription factor TGA2                        54.7    4e-05   
gb|EEC82988.1|  hypothetical protein OsI_28023                        54.7    5e-05   
gb|ABK92477.1|  unknown                                               53.5    5e-05   
ref|XP_006658160.1|  PREDICTED: transcription factor HBP-1b(c38)-...  54.3    5e-05   
dbj|BAD03039.1|  putative transcription factor STGA1                  54.7    5e-05   
gb|ABR46126.1|  bZIP transcription factor TGA2                        54.3    5e-05   
gb|EEC70410.1|  hypothetical protein OsI_01405                        54.3    5e-05   
gb|EEE54337.1|  hypothetical protein OsJ_01313                        54.3    6e-05   
emb|CDY08443.1|  BnaA05g26790D                                        54.3    6e-05   
ref|XP_009588814.1|  PREDICTED: transcription factor TGA1             54.3    6e-05   
ref|XP_009776929.1|  PREDICTED: transcription factor TGA1-like        54.3    6e-05   
ref|XP_006646344.1|  PREDICTED: transcription factor TGA5-like        52.4    6e-05   
ref|XP_010423270.1|  PREDICTED: transcription factor TGA2             54.3    6e-05   
gb|EAZ41703.1|  hypothetical protein OsJ_26239                        53.9    6e-05   
ref|XP_006288172.1|  hypothetical protein CARUB_v10001409mg           54.3    6e-05   
ref|NP_001042751.1|  Os01g0279900                                     54.3    6e-05   
gb|EMT32868.1|  putative Transcription factor HBP-1b(c1)              54.3    6e-05   
dbj|BAD81089.1|  putative HBP-1b                                      53.5    7e-05   
gb|AHF20184.1|  bzip transcription factor                             54.3    7e-05   
ref|XP_011075425.1|  PREDICTED: transcription factor HBP-1b(c38)-...  54.3    7e-05   
ref|XP_004970302.1|  PREDICTED: transcription factor HBP-1b(c1)-l...  54.3    7e-05   
emb|CDX99444.1|  BnaC01g11080D                                        51.6    8e-05   
ref|XP_006354049.1|  PREDICTED: transcription factor TGA1-like is...  53.9    8e-05   
gb|EMS58753.1|  Transcription factor HBP-1b(c1)                       53.9    8e-05   
ref|XP_006354048.1|  PREDICTED: transcription factor TGA1-like is...  53.9    9e-05   
ref|XP_004958749.1|  PREDICTED: transcription factor HBP-1b(c38)-...  53.5    9e-05   
ref|XP_003576364.1|  PREDICTED: transcription factor TGA6-like        54.3    9e-05   
dbj|BAB17733.1|  putative transcription factor HBP-1b - wheat         53.1    9e-05   
emb|CDM84630.1|  unnamed protein product                              53.9    9e-05   
ref|XP_004958748.1|  PREDICTED: transcription factor HBP-1b(c38)-...  53.5    9e-05   
sp|Q41558.2|HBP1C_WHEAT  RecName: Full=Transcription factor HBP-1...  53.9    9e-05   
gb|ADX23328.1|  DOG1                                                  51.2    9e-05   
gb|ADX23444.1|  DOG1                                                  51.2    1e-04   
ref|XP_008655434.1|  PREDICTED: octopine synthase binding factor3...  53.9    1e-04   
ref|NP_001105448.1|  octopine synthase binding factor3                53.9    1e-04   
ref|XP_010932613.1|  PREDICTED: transcription factor TGA2-like        53.9    1e-04   
ref|XP_002871243.1|  ocs-element binding factor 5                     53.5    1e-04   
ref|XP_010063316.1|  PREDICTED: transcription factor TGA1-like is...  53.5    1e-04   
ref|XP_010063319.1|  PREDICTED: transcription factor TGA1-like is...  53.5    1e-04   
gb|ACN31945.1|  unknown                                               53.5    1e-04   
gb|EPS63781.1|  hypothetical protein M569_11002                       53.5    1e-04   
dbj|BAJ94197.1|  predicted protein                                    53.5    1e-04   
ref|XP_011027648.1|  PREDICTED: transcription factor TGA7             53.1    1e-04   
gb|ADX23275.1|  DOG1                                                  50.8    1e-04   
ref|XP_002306598.1|  Transcription factor TGA7 family protein         53.1    2e-04   
ref|XP_004961243.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...  52.0    2e-04   
ref|XP_003562427.1|  PREDICTED: transcription factor HBP-1b(c38)      52.8    2e-04   
ref|XP_010491292.1|  PREDICTED: transcription factor TGA5             52.4    2e-04   
dbj|BAJ98375.1|  predicted protein                                    52.4    2e-04   
gb|KHN01678.1|  hypothetical protein glysoja_012989                   51.2    2e-04   
gb|AAD34570.1|AF143442_1  NPR1-interactor protein 1                   52.0    2e-04   
ref|XP_002458658.1|  hypothetical protein SORBIDRAFT_03g037560        52.8    2e-04   
gb|ADX23439.1|  DOG1                                                  50.1    2e-04   
gb|AGH18702.1|  TGA-type basic leucine zipper protein                 52.4    2e-04   
gb|EAY99001.1|  hypothetical protein OsI_20960                        51.6    2e-04   
gb|ADX23284.1|  DOG1                                                  50.1    2e-04   
ref|XP_002970901.1|  hypothetical protein SELMODRAFT_231689           52.4    2e-04   
ref|XP_011097899.1|  PREDICTED: transcription factor TGA4 isoform X2  52.4    2e-04   
ref|XP_002980439.1|  hypothetical protein SELMODRAFT_112221           51.6    2e-04   
gb|ADX23263.1|  DOG1                                                  50.1    2e-04   
gb|ADX23458.1|  DOG1                                                  50.1    3e-04   
ref|XP_011097893.1|  PREDICTED: transcription factor TGA4 isoform X1  52.4    3e-04   
gb|ADX23279.1|  DOG1                                                  50.1    3e-04   
ref|XP_010904691.1|  PREDICTED: transcription factor HBP-1b(c38)-...  52.4    3e-04   
ref|XP_006288178.1|  hypothetical protein CARUB_v10001413mg           52.0    3e-04   
emb|CAA49525.1|  ocs-element binding factor 5                         52.0    3e-04   
ref|XP_008786823.1|  PREDICTED: transcription factor TGA2-like is...  52.4    3e-04   
gb|ADX23323.1|  DOG1                                                  49.7    3e-04   
gb|EMS67944.1|  Transcription factor HBP-1b(c1)                       52.0    3e-04   
gb|EMT24705.1|  putative Transcription factor HBP-1b(c1)              52.0    3e-04   
ref|XP_011097907.1|  PREDICTED: transcription factor TGA1 isoform X3  52.0    3e-04   
ref|XP_004515651.1|  PREDICTED: transcription factor TGA3-like is...  52.0    3e-04   
ref|XP_008786824.1|  PREDICTED: transcription factor TGA2-like is...  52.4    3e-04   
gb|EMT26672.1|  putative Transcription factor HBP-1b(c1)              52.0    3e-04   
ref|XP_004515653.1|  PREDICTED: transcription factor TGA3-like is...  52.0    3e-04   
ref|XP_002969636.1|  hypothetical protein SELMODRAFT_231344           52.0    3e-04   
gb|ADX23274.1|  DOG1                                                  49.7    3e-04   
ref|NP_196313.1|  OCS-element binding factor 5                        52.0    3e-04   
ref|XP_008783086.1|  PREDICTED: transcription factor HBP-1b(c38)-...  52.0    3e-04   
ref|XP_009338179.1|  PREDICTED: transcription factor TGA1-like        49.3    3e-04   
ref|XP_009393095.1|  PREDICTED: transcription factor HBP-1b(c1)-like  52.0    3e-04   
gb|EMS62862.1|  hypothetical protein TRIUR3_32726                     50.4    3e-04   
ref|XP_010423275.1|  PREDICTED: transcription factor TGA5-like is...  52.0    3e-04   
ref|XP_010904690.1|  PREDICTED: transcription factor HBP-1b(c38)-...  52.0    4e-04   
emb|CDX68037.1|  BnaA07g20770D                                        52.0    4e-04   
emb|CAB37451.1|  putative protein                                     51.6    4e-04   
ref|XP_004972183.1|  PREDICTED: transcription factor HBP-1b(c38)-...  51.6    4e-04   



>ref|XP_011101398.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=238

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 166/223 (74%), Gaps = 15/223 (7%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDH----EFLVNKLTTHYKNYYTAKW  705
            M SKVEE F+DF+ KWM QLE+  QLLL+ +  E  H    E +VNKLT H+K YYT KW
Sbjct  10   MNSKVEEKFSDFYRKWMGQLEDFLQLLLVVS-REHSHSQAAEDMVNKLTAHHKQYYTFKW  68

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKA  525
            AAA EDVLAFF PVWL+ LE+A+LWVTGWKPS  FRLV    M+EEQ+KK+E LR KIK 
Sbjct  69   AAAHEDVLAFFTPVWLSRLENAHLWVTGWKPSLVFRLVESAAMTEEQVKKIEALRVKIKM  128

Query  524  eeekveremerqqVAMADRRMVELARL-------GGGDTVA---DVAVKNMLGGLEKVMK  375
            EEE+VEREMERQQVA+ADR+MVEL R        GG   V+   +VAV+ ML GLE+VMK
Sbjct  129  EEERVEREMERQQVAVADRKMVELVRQEQLAEKNGGAAEVSGLVEVAVRGMLAGLERVMK  188

Query  374  MADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            MADCVRLKTLKG+LDV+ P   +  LA+ SMLQIQMRK G+ +
Sbjct  189  MADCVRLKTLKGMLDVLTPIQCVDLLAAKSMLQIQMRKMGEKR  231



>ref|XP_009613589.1| PREDICTED: transcription factor TGA6 [Nicotiana tomentosiformis]
Length=237

 Score =   236 bits (603),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 175/235 (74%), Gaps = 23/235 (10%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE---NEKDHEFLVNKLTTHYKNYYTAKWA  702
            M ++VE++F+++FE WM+QLEE  +LLLI  +   + KDHE LVNK+T H+K+YYTAKWA
Sbjct  1    MTTQVEKNFSNYFENWMSQLEEFLRLLLIVPKEISHVKDHETLVNKMTAHHKDYYTAKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIK  528
            AA ED+L+FF PVWL+ LE+AYLWVTGWKPS AFRL+ G    +S+EQ+K ++ L+ KI+
Sbjct  61   AAHEDILSFFNPVWLSPLENAYLWVTGWKPSMAFRLLVGATSELSDEQVKSIDALKVKIR  120

Query  527  AeeekveremerqqVAMADRRMVELARLGGG------------------DTVADVAVKNM  402
            AEEE+VEREMERQQVA+ DR+MVELARL                     D + +VA+K +
Sbjct  121  AEEERVEREMERQQVALGDRKMVELARLNSSTRVRTSGCTSDSHLNNQLDGLVEVALKGL  180

Query  401  LGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNL  237
            +  LE+VMKMADCVRLKTLKGLLD++ PT  +  LA+ SMLQIQMRK G+ + NL
Sbjct  181  MISLERVMKMADCVRLKTLKGLLDILNPTQCVGLLAAISMLQIQMRKWGRKKENL  235



>ref|XP_009764515.1| PREDICTED: transcription factor TGA6 [Nicotiana sylvestris]
Length=235

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 172/233 (74%), Gaps = 21/233 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAENE---KDHEFLVNKLTTHYKNYYTAKWA  702
            M ++V+++F+++FE WM+QLEE  +LLL+  +     KDHE LVNK+TTH+K+YYT KWA
Sbjct  1    MTTQVQKNFSNYFENWMSQLEEFLRLLLMVPKETSYVKDHESLVNKMTTHHKDYYTVKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-AGEGMSEEQMKKVEVLRGKIKA  525
            AA ED+L+FF PVWL+ LE+AYLWVTGWKPS AFRLV A   +S+EQ+K ++ L+ KI+A
Sbjct  61   AAHEDILSFFNPVWLSPLENAYLWVTGWKPSMAFRLVGANSELSDEQVKSIDALKVKIRA  120

Query  524  eeekveremerqqVAMADRRMVELARLGGG-----------------DTVADVAVKNMLG  396
            EEE+VEREMERQQVA+ DR+MVELARL                    D + +VA+K ++ 
Sbjct  121  EEERVEREMERQQVALGDRKMVELARLNSSRVRTSGCSSDSDSNNQLDGLVEVALKGLMV  180

Query  395  GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNL  237
             LE+VMKMADC RLKTLKGLLD++ P   +  LA+ +MLQIQMRK G+ + NL
Sbjct  181  SLERVMKMADCARLKTLKGLLDILNPKQCVDLLAAITMLQIQMRKWGRKKENL  233



>gb|EYU43338.1| hypothetical protein MIMGU_mgv1a023322mg [Erythranthe guttata]
Length=256

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 177/253 (70%), Gaps = 39/253 (15%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDH-----EFLVNKLTTHYKNYYTAK  708
            M+++VEESF+DF EKW +++E+  QL+L  + ++  H     E + NKLT H+K YYT K
Sbjct  1    MKTQVEESFSDFHEKWTSRVEDLLQLVLAVSRDDHSHDPAVYEAVANKLTAHHKEYYTFK  60

Query  707  WAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG----------------EGM  576
            WAAA EDVLAFF PVWLT LE+A+LW TGWKPS AFRLV                   G+
Sbjct  61   WAAAHEDVLAFFTPVWLTPLENAFLWFTGWKPSAAFRLVESLRVATSGGGAAAASCLSGL  120

Query  575  SEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL--------GGGDTVAD  420
            +EEQ+KK+E LR KIKA+E++VEREMERQQV+MADR+MVELA L        GG  + AD
Sbjct  121  TEEQVKKIEALRVKIKADEDRVEREMERQQVSMADRKMVELAMLERRAGRSEGGSASAAD  180

Query  419  ---------VAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQM  267
                     VA+K +L GLEKVMKMADCVRLKTLKGLLD+  P   ++FLAS +ML++Q+
Sbjct  181  LARVDGLVEVALKGLLVGLEKVMKMADCVRLKTLKGLLDIFSPMQGVNFLASKAMLELQI  240

Query  266  RKCGKTQHNLSLI  228
            +KCG+ +HN +++
Sbjct  241  KKCGQ-KHNKNVL  252



>ref|XP_010316825.1| PREDICTED: transcription factor TGA6 [Solanum lycopersicum]
Length=219

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 167/219 (76%), Gaps = 6/219 (3%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEEC-AQLLLIAAENE--KDHEFLVNKLTTHYKNYYTAKWA  702
            M S+V E+FT +FE WM QLEE   QL+++  E     DHE LV+K+TTH+KNYYTAKWA
Sbjct  1    MTSQVAENFTKYFENWMIQLEELLKQLVIVPRETSYVNDHELLVSKMTTHHKNYYTAKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG--MSEEQMKKVEVLRGKIK  528
            AA ED+LAFF P+WL+ LE  Y W+TGWKPS AFRLV+G G   S+E++K ++ LR KI+
Sbjct  61   AAHEDILAFFTPMWLSPLEIVYSWITGWKPSMAFRLVSGGGGAFSDEELKNIDGLRVKIR  120

Query  527  AeeekveremerqqVAMADRRMVELARL-GGGDTVADVAVKNMLGGLEKVMKMADCVRLK  351
             EEEKVEREMERQQVA+ DR+MVELAR+    D + ++A+K +   LE+VMKMADCVRLK
Sbjct  121  GEEEKVEREMERQQVAIGDRKMVELARIRNDNDELVELALKGLRMSLERVMKMADCVRLK  180

Query  350  TLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
            TLKGLL+++ P  S+ FLA+ S +QIQMRK G+ + N+ 
Sbjct  181  TLKGLLEILSPLQSVDFLAAISTIQIQMRKRGRKRINVD  219



>ref|XP_006362387.1| PREDICTED: transcription factor TGA4-like [Solanum tuberosum]
Length=222

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 165/219 (75%), Gaps = 6/219 (3%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEEC-AQLLLIAAENE--KDHEFLVNKLTTHYKNYYTAKWA  702
            M S+V E+F  +FE WM QLEE   QL+++  E     DHE LV+K+TTH+K+YYTAKWA
Sbjct  1    MTSQVGENFRKYFENWMIQLEELLKQLVIVPRETSYVNDHESLVSKMTTHHKDYYTAKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAe  522
            AA ED+LAFF P+WL+ LE  Y W+TGWKPS AFRLV G   S+EQ+K ++ LR KI+ E
Sbjct  61   AAHEDILAFFTPMWLSPLEIVYSWITGWKPSMAFRLVGGGAFSDEQLKNIDGLRVKIRGE  120

Query  521  eekveremerqqVAMADRRMVELARLGGGDT---VADVAVKNMLGGLEKVMKMADCVRLK  351
            EEKVEREMERQQVA+ DR+MVELAR+   D    + ++A+K +   LE+VMKMADCVRLK
Sbjct  121  EEKVEREMERQQVAIGDRKMVELARIKNSDNNDELVELALKGLRMSLERVMKMADCVRLK  180

Query  350  TLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
            TLKGLL+++ P  S+ FLA+ S +QIQMRK G+ + N++
Sbjct  181  TLKGLLEILSPIQSVDFLAAISTIQIQMRKRGRKRMNVA  219



>emb|CDO96810.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 168/237 (71%), Gaps = 33/237 (14%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQL-LLIAAENEKDHEF-----LVNKLTTHYKNYYTA  711
            MR+K+EE F++FFE WM++LEE  Q  L +  EN+   E      LVNKLT H+K+YYTA
Sbjct  1    MRTKIEEKFSNFFEIWMSKLEEYVQHHLTLKKENKSSDEEVHYVPLVNKLTQHHKDYYTA  60

Query  710  KWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------------EGMSEE  567
            KWA A EDVLAFF PVWL+ LE+AYLW+TGWKPS  FRLV                +SEE
Sbjct  61   KWACASEDVLAFFTPVWLSPLENAYLWITGWKPSMIFRLVDSLRKGQVPGATSLADLSEE  120

Query  566  QMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL----GGGDTVA--------  423
            Q+KK+E LR +I+ +EEKVEREMERQQVAMADR+MVELARL      G+ +A        
Sbjct  121  QVKKIEGLRSRIRVDEEKVEREMERQQVAMADRKMVELARLVSLTKNGEHLAAASSSQIN  180

Query  422  ---DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
               ++A+K +L GLEKVMKMADCVRLKTLKG+LDV+ P  S  FLAS+S+LQIQMRK
Sbjct  181  GLVEMAIKELLAGLEKVMKMADCVRLKTLKGVLDVLNPMQSADFLASSSVLQIQMRK  237



>ref|XP_011085984.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=329

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 176/244 (72%), Gaps = 29/244 (12%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAEN----EKDHEFLVNKLTTHYKNYYTAKW  705
            M+++VEE F+DF+ KWM QLE   QLLL+ + +    E  ++ +VNKLT H+K YYT KW
Sbjct  80   MKTQVEEKFSDFYAKWMDQLEHLLQLLLVVSRDGHSQEAGYQSMVNKLTAHHKEYYTFKW  139

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------------EGMSEEQM  561
            A+A EDVLAFFAPVW++ LE+AYLWVTGWKPST FRLV               G++EEQ+
Sbjct  140  ASAHEDVLAFFAPVWMSPLENAYLWVTGWKPSTVFRLVESLRGVQPEGGMKLSGLTEEQV  199

Query  560  KKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL-------GGGDTVA------D  420
            KK+E LR KIK EEE+VEREMERQQV MADR+MVELA L       GG  TVA      +
Sbjct  200  KKIEALRVKIKVEEERVEREMERQQVGMADRKMVELATLERQAKKNGGAATVAQVDGLVE  259

Query  419  VAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
            VA+K +L GLEKVMKMADCVRLKTLKG+LD++ P   + FLA+ASMLQIQ+RK GK +  
Sbjct  260  VALKGLLAGLEKVMKMADCVRLKTLKGMLDILNPMQCVDFLAAASMLQIQIRKWGKKREE  319

Query  239  LSLI  228
             S++
Sbjct  320  KSVL  323



>ref|XP_010089699.1| hypothetical protein L484_006321 [Morus notabilis]
 gb|EXB38222.1| hypothetical protein L484_006321 [Morus notabilis]
Length=248

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 166/230 (72%), Gaps = 23/230 (10%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE---NEKDH-EFLVNKLTTHYKNYYTAKW  705
            M++KVEE+F+DFFEKW++QLEE  Q L+  ++   N+ D  + LV ++TTH K YYTAKW
Sbjct  1    MKTKVEETFSDFFEKWVSQLEELLQQLVQVSKTTNNDSDQLQALVARVTTHVKAYYTAKW  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG----------EGMSEEQMKK  555
            AAA EDVLAFF+PVWL+ LE+AY WVTGWKPST FRLV             G++E+Q+K 
Sbjct  61   AAAHEDVLAFFSPVWLSPLENAYQWVTGWKPSTVFRLVESLRKSGSATTLRGLTEQQVKT  120

Query  554  VEVLRGKIKAeeekveremerqqVAMADRRMVELARLGG---------GDTVADVAVKNM  402
            VE LR KI+ EEEKVEREMERQQVAMADRRMVELARL            + + + A+K M
Sbjct  121  VEKLRLKIRLEEEKVEREMERQQVAMADRRMVELARLASRGGGGGEAAEEVLVEAALKGM  180

Query  401  LGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
              GLE+VMK ADCVRLKTLKG+LD + P   + FLA+  MLQ+Q+R+ G+
Sbjct  181  FVGLERVMKAADCVRLKTLKGVLDELSPLQCVEFLAATCMLQLQLRQLGR  230



>ref|XP_002266016.2| PREDICTED: transcription factor TGA2 [Vitis vinifera]
Length=245

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 163/230 (71%), Gaps = 24/230 (10%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE---NEKDHEFLVNKLTTHYKNYYTAKWA  702
            M+S VEE F +F+EKWM QLEE  Q LL  +    +  + E LV+++TTH K YY AKWA
Sbjct  7    MKSPVEERFIEFYEKWMCQLEENLQRLLKVSREIPHRTEREALVSRVTTHLKEYYNAKWA  66

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL--------VAGEG---MSEEQMKK  555
            AA EDVLAFF+PVWL+ LE+AYLWVTGWKPSTAFRL        V GE    MSEEQMKK
Sbjct  67   AAHEDVLAFFSPVWLSPLENAYLWVTGWKPSTAFRLIESLRQTGVPGESLAEMSEEQMKK  126

Query  554  VEVLRGKIKAeeekveremerqqVAMADRRMVELARL-----GGG-----DTVADVAVKN  405
            VE LR +I+ EEEKVEREMERQQVA+ADR+MVELAR       GG     + + +VA+K 
Sbjct  127  VEELRVRIRLEEEKVEREMERQQVALADRKMVELARAASRVSNGGLASEENGLVEVALKG  186

Query  404  MLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +L GLE+VMK ADC RLKTLKG+L+V+ P   + FLA+  M  + +RK G
Sbjct  187  LLSGLERVMKAADCARLKTLKGILEVLSPLQCVDFLAATLMFHVNLRKWG  236



>ref|XP_010439827.1| PREDICTED: transcription factor TGA6-like [Camelina sativa]
 ref|XP_010449485.1| PREDICTED: transcription factor TGA6-like [Camelina sativa]
Length=231

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 162/226 (72%), Gaps = 13/226 (6%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE---NEKDHEFLVNKLTTHYKNYYTAKWA  702
            MR++VEE F +F+E W+ QLE+    LLIA     +E +   L++KLTTH+K YYTAKWA
Sbjct  1    MRNRVEEKFLEFYENWVIQLEQYLHQLLIAHNTTMSEIELRALISKLTTHHKAYYTAKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMS-----EEQMKKVEVLRG  537
            A  EDVLAFF PVWLT LE A  W+TGWKPST FR+V     S     E Q++K+E LR 
Sbjct  61   AIGEDVLAFFGPVWLTPLEKACFWLTGWKPSTVFRMVDRLRKSRLVLVEAQVRKLEELRA  120

Query  536  KIKAeeekveremerqqVAMADRRMVELARLG---GGDTVA--DVAVKNMLGGLEKVMKM  372
            K K EE+K+ERE+ER QVAM DR+MVELARLG   GG++V   + AVK +  GLEK++K 
Sbjct  121  KTKFEEQKIEREVERYQVAMGDRKMVELARLGCHVGGESVVVIEAAVKGLATGLEKMVKA  180

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
            ADCVRLKTLKG+LD++ P   + FLA+A+  Q+Q+R+ G  +HN++
Sbjct  181  ADCVRLKTLKGILDILAPPQCVEFLAAAAAFQVQLRRWGNQRHNVT  226



>ref|XP_006384064.1| hypothetical protein POPTR_0004s05690g [Populus trichocarpa]
 gb|ERP61861.1| hypothetical protein POPTR_0004s05690g [Populus trichocarpa]
Length=245

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 170/242 (70%), Gaps = 29/242 (12%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE--------NEKDHEFLVNKLTTHYKNYY  717
            M+ KV E F++FFEKW  QL+E  QLLL A++        ++++ + LV+K+T HYK+Y+
Sbjct  1    MKGKVGERFSEFFEKWACQLDEYLQLLLRASKQRVINTVCDQRELQTLVSKVTQHYKDYF  60

Query  716  TAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL--------VAGEGMSE---  570
            T KW+ A EDVLAFF P+W + LE+AY W TGWKPST F+L        V G  ++E   
Sbjct  61   TIKWSLAHEDVLAFFCPIWGSPLENAYSWFTGWKPSTIFKLIDSTRINRVPGSSLAELTQ  120

Query  569  EQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGG----------DTVAD  420
            EQ++K+E LR KI+ EEEKVEREMERQQVAMADR+M ELARL G           D + +
Sbjct  121  EQLRKIEELRVKIRLEEEKVEREMERQQVAMADRKMFELARLTGRVKDSETMDQFDGLVE  180

Query  419  VAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
            VA+K ++ GLEKVMK ADCVRL+TLKG+LDV+ P   + FLA+ +MLQIQ+R+ GK + +
Sbjct  181  VAMKGLMAGLEKVMKAADCVRLRTLKGVLDVLSPLQCVDFLAATTMLQIQLRQWGKRRDS  240

Query  239  LS  234
            +S
Sbjct  241  IS  242



>gb|KDO77874.1| hypothetical protein CISIN_1g046619mg [Citrus sinensis]
Length=239

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 163/223 (73%), Gaps = 21/223 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQ-LLLIAAEN--EKDHEFLVNKLTTHYKNYYTAKWA  702
            M+++VEE F +FFEKW+ QL++ +Q L+ I+ E+  E + + LV+KLT+HYK YYT KWA
Sbjct  1    MKNQVEEKFAEFFEKWVCQLDDYSQQLIRISKESSSEAEQQALVSKLTSHYKEYYTVKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL--------VAGEG----MSEEQMK  558
             A EDVL F+ PVW+++ E AY WVTGWKPS  FRL        V G G    ++E+Q++
Sbjct  61   LAHEDVLVFYCPVWVSTFEMAYSWVTGWKPSIIFRLVDSLRKTMVPGGGSLAELTEQQLR  120

Query  557  KVEVLRGKIKAeeekveremerqqVAMADRRMVELARL------GGGDTVADVAVKNMLG  396
            K+E LR KI+ EEEKVEREMERQQVA+ADR+MVELARL      G  D + +VA+K +L 
Sbjct  121  KIEELRLKIRLEEEKVEREMERQQVALADRKMVELARLTSRLSNGEVDGLVEVALKGLLS  180

Query  395  GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQM  267
            GLEKVMK ADCVRLKTLKG+LDV+    S+ FLA  S+LQIQM
Sbjct  181  GLEKVMKAADCVRLKTLKGILDVLSTKQSVDFLAGTSILQIQM  223



>ref|XP_006467638.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Citrus sinensis]
Length=239

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 163/223 (73%), Gaps = 21/223 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQ-LLLIAAEN--EKDHEFLVNKLTTHYKNYYTAKWA  702
            M+++VEE F +FFEKW+ QL++ +Q L+ I+ E+  E + + LV+KLT+HYK YYT KWA
Sbjct  1    MKNQVEEKFAEFFEKWVCQLDDYSQQLIRISKESSSEAEQQALVSKLTSHYKEYYTVKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL--------VAGEG----MSEEQMK  558
             A EDVL F+ PVW+++ E AY WVTGWKPS  FRL        V G G    ++E+Q++
Sbjct  61   LAHEDVLVFYCPVWVSTFEMAYSWVTGWKPSIIFRLVDSLRKTMVPGGGSLAELTEQQLR  120

Query  557  KVEVLRGKIKAeeekveremerqqVAMADRRMVELARL------GGGDTVADVAVKNMLG  396
            K+E LR KI+ EEEKVEREMERQQVA+ADR+MVELARL      G  D + +VA+K +L 
Sbjct  121  KIEELRLKIRLEEEKVEREMERQQVALADRKMVELARLTSRLSNGEVDGLVEVALKGLLS  180

Query  395  GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQM  267
            GLEKVMK ADCVRLKTLKG+LDV+    S+ FLA  S+LQIQM
Sbjct  181  GLEKVMKAADCVRLKTLKGILDVLSTKQSVDFLAGTSILQIQM  223



>ref|XP_007025357.1| Transcription factor-related, putative [Theobroma cacao]
 gb|EOY27979.1| Transcription factor-related, putative [Theobroma cacao]
Length=251

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 164/233 (70%), Gaps = 26/233 (11%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEE-CAQLLLIAAEN----EKDHEFLVNKLTTHYKNYYTAK  708
            M++ V E F+ FFEKW+ QL++   QLL ++ E+      + + LV+KLT HYK +YT K
Sbjct  1    MKTPVGERFSQFFEKWICQLDDYLQQLLRVSKESLSSEADEQQALVSKLTAHYKEFYTVK  60

Query  707  WAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL--------VAGEG---MSEEQM  561
            W AA EDVLAF+ PVWL+ LE+AY W+TGWKPS  FRL        V G G   ++EEQ+
Sbjct  61   WTAAHEDVLAFYCPVWLSKLENAYSWLTGWKPSMIFRLVESMRRTRVPGPGLAELTEEQL  120

Query  560  KKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL----------GGGDTVADVAV  411
            +K+E LR KIK EEEKVEREMERQQVA+ADR+MVEL R+          G  D + +VA+
Sbjct  121  RKIEQLRMKIKLEEEKVEREMERQQVALADRKMVELVRMASRIRKGELVGQVDGLVEVAI  180

Query  410  KNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            K +L GLE+VMK ADCVRLKTLKG+LDV+ P+ S+ FLA   MLQIQ+R+ G+
Sbjct  181  KGILAGLERVMKAADCVRLKTLKGVLDVLNPSQSVDFLAGTCMLQIQLRQWGQ  233



>ref|XP_010999748.1| PREDICTED: transcription factor TGA6 [Populus euphratica]
Length=245

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 167/242 (69%), Gaps = 29/242 (12%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE--------NEKDHEFLVNKLTTHYKNYY  717
            M+ KV E F++FFEKW  QL+E  QLLL A++        ++++ + LV+K+T HYK+Y+
Sbjct  1    MKGKVGERFSEFFEKWACQLDEYLQLLLRASKQRVIDTVCDQRELQTLVSKVTQHYKDYF  60

Query  716  TAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL--------VAGEGMSE---  570
            T KW+ A EDVLAFF P+W   LE+AY W TGWKPST F+L        V G  ++E   
Sbjct  61   TIKWSLAHEDVLAFFCPIWGNPLENAYSWFTGWKPSTIFKLIDSTRINRVPGSSLAELTQ  120

Query  569  EQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGG----------DTVAD  420
            EQ+ K+E LR KI+ EEEKVEREMERQQVAMADR+M ELARL G           D + +
Sbjct  121  EQLGKIEELRVKIRLEEEKVEREMERQQVAMADRKMFELARLTGRVKDSETIAQFDGLVE  180

Query  419  VAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
            VA+K ++ GLEKVMK ADCVRL+TLKG+LDV+ P   + FLA+ S LQIQ+R+ GK + +
Sbjct  181  VAMKGLMVGLEKVMKAADCVRLRTLKGVLDVLSPLQCVDFLAATSTLQIQLRQWGKRRDS  240

Query  239  LS  234
            +S
Sbjct  241  IS  242



>ref|XP_006449514.1| hypothetical protein CICLE_v10017869mg [Citrus clementina]
 gb|ESR62754.1| hypothetical protein CICLE_v10017869mg [Citrus clementina]
Length=239

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 161/223 (72%), Gaps = 21/223 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQ-LLLIAAEN--EKDHEFLVNKLTTHYKNYYTAKWA  702
            M+++VEE F +FFEKW+ QL++ +Q L+ I+ E+  E + + LV+KLT+HYK YYT KWA
Sbjct  1    MKNQVEEKFAEFFEKWVCQLDDYSQQLIRISKESSSEAEQQALVSKLTSHYKEYYTVKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL--------VAGEG----MSEEQMK  558
             A EDVL F+ PVW+++ E A  WVTGWKPS  FRL        V G G    ++E+Q++
Sbjct  61   LAHEDVLVFYCPVWVSTFEMACSWVTGWKPSIIFRLVDSLRKTMVPGAGSLAELTEQQLR  120

Query  557  KVEVLRGKIKAeeekveremerqqVAMADRRMVELARL------GGGDTVADVAVKNMLG  396
            K+E LR KI+ EEEKVEREMERQQVA+ADR+MVELARL      G  D + +VA+K +L 
Sbjct  121  KIEELRLKIRLEEEKVEREMERQQVALADRKMVELARLTSRLSNGEVDGLVEVALKGLLS  180

Query  395  GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQM  267
            GLEKVMK ADCVRLKTLKG+LDV+    S+ FLA  S+LQ QM
Sbjct  181  GLEKVMKAADCVRLKTLKGILDVLSTKQSVDFLAGTSILQTQM  223



>ref|XP_010052186.1| PREDICTED: transcription factor HBP-1b(c38) [Eucalyptus grandis]
Length=242

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 162/232 (70%), Gaps = 21/232 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE----NEKDHEFLVNKLTTHYKNYYTAKW  705
            MR++ EE F+D+FEKW+++LEE +  L  A+      E++   LV+KLT H+K YYTAKW
Sbjct  1    MRTQAEEKFSDYFEKWVSRLEEYSHQLHSASRETSTTEEELRALVSKLTAHHKEYYTAKW  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVA-----GEGMSEEQMKKVEVLR  540
            AAA  DV AFF+P W + LE+AY W+TGWKPSTAFR++      G  ++E+Q+ ++E LR
Sbjct  61   AAAGGDVFAFFSPPWSSPLENAYSWLTGWKPSTAFRVIEALRARGAVVAEDQLTRIEQLR  120

Query  539  GKIKAeeekveremerqqVAMADRRMVELARLGGG------------DTVADVAVKNMLG  396
             KI+ EEE+VEREMERQQV +ADRRMVELARL G             D + D A+K +  
Sbjct  121  AKIRLEEERVEREMERQQVGLADRRMVELARLAGRRVEAATAAGPQVDGLVDAALKGLAS  180

Query  395  GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
            GLE +MK ADCVRLKTLKG+LD + P+  + FLA+ S LQ+Q+R+ GK + +
Sbjct  181  GLEWIMKAADCVRLKTLKGVLDELSPSQCVEFLAALSALQVQLRRWGKKRQS  232



>ref|NP_193600.2| transcription factor-related protein [Arabidopsis thaliana]
 gb|AAO41945.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50710.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84072.1| transcription factor-related protein [Arabidopsis thaliana]
Length=232

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 161/229 (70%), Gaps = 14/229 (6%)
 Frame = -3

Query  878  SSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAEN----EKDHEFLVNKLTTHYKNYYTA  711
            S MR+ VEE F +F+E W+ QLE     LLIA  N    E +   L++KLTTH+K YYTA
Sbjct  2    SKMRNLVEEKFLEFYESWVIQLELYLHQLLIAHNNNTMSETELRHLISKLTTHHKAYYTA  61

Query  710  KWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-----AGEGMSEEQMKKVEV  546
            KWAA REDVLAFF  VWL  LE+A  W+TGWKPS  FR+V     +   + E Q+KK+E 
Sbjct  62   KWAAIREDVLAFFGSVWLNPLENACSWLTGWKPSMVFRMVDRLRKSRVVLVEAQVKKLEE  121

Query  545  LRGKIKAeeekveremerqqVAMADRRMVELARLG---GGDT--VADVAVKNMLGGLEKV  381
            LR K K +E+K+EREMER QVAMADR+MVELARLG   GG++  V + AV+ +  GLEK+
Sbjct  122  LRVKTKFDEQKIEREMERYQVAMADRKMVELARLGCHVGGESVMVVEAAVRGLSMGLEKM  181

Query  380  MKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
            +K ADCVRLKTLKG+LD++ P   + FLA+A+  Q+Q+R+ G  +H ++
Sbjct  182  VKAADCVRLKTLKGILDILTPPQCVEFLAAAATFQVQLRRWGNRRHYVT  230



>ref|XP_008225304.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-1A 
[Prunus mume]
Length=240

 Score =   206 bits (523),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 168/239 (70%), Gaps = 22/239 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE----NEKDHEFLVNKLTTHYKNYYTAKW  705
            MR++VEE F++FFEKW+ QLE+  Q LL  +E    NE + + LV+K+T  +K YYT KW
Sbjct  1    MRTQVEERFSEFFEKWVCQLEQLQQQLLKLSEETLQNEAELQALVSKVTYLHKEYYTVKW  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------EGMSEEQMKKVEVL  543
            AAAREDVLAFF PVW + LE+AY WVTGWKPS  F+L+          MSEEQ+KK+E L
Sbjct  61   AAAREDVLAFFCPVWSSPLENAYNWVTGWKPSMLFQLIGSLRKTRLVNMSEEQLKKIEEL  120

Query  542  RGKIKAeeekveremerqqVAMADRRMVELARLGG------------GDTVADVAVKNML  399
            R K++ EEEKVEREMERQQVAMADR+MVELARL               + + DVA+K ML
Sbjct  121  RLKMRCEEEKVEREMERQQVAMADRKMVELARLASRVRNGGEVVEVEVEGLVDVALKVML  180

Query  398  GGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLSLITN  222
             GLE+VMK ADCVRLKTLKG+LD + P   + FLA+  M+QI++R+ G+ + + + + N
Sbjct  181  SGLERVMKAADCVRLKTLKGVLDALSPLQCVEFLAATCMVQIRLRQWGRKKCDQNALLN  239



>emb|CAB37450.1| putative protein [Arabidopsis thaliana]
 emb|CAB78867.1| putative protein [Arabidopsis thaliana]
Length=229

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 160/227 (70%), Gaps = 14/227 (6%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAEN----EKDHEFLVNKLTTHYKNYYTAKW  705
            MR+ VEE F +F+E W+ QLE     LLIA  N    E +   L++KLTTH+K YYTAKW
Sbjct  1    MRNLVEEKFLEFYESWVIQLELYLHQLLIAHNNNTMSETELRHLISKLTTHHKAYYTAKW  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-----AGEGMSEEQMKKVEVLR  540
            AA REDVLAFF  VWL  LE+A  W+TGWKPS  FR+V     +   + E Q+KK+E LR
Sbjct  61   AAIREDVLAFFGSVWLNPLENACSWLTGWKPSMVFRMVDRLRKSRVVLVEAQVKKLEELR  120

Query  539  GKIKAeeekveremerqqVAMADRRMVELARLG---GGDT--VADVAVKNMLGGLEKVMK  375
             K K +E+K+EREMER QVAMADR+MVELARLG   GG++  V + AV+ +  GLEK++K
Sbjct  121  VKTKFDEQKIEREMERYQVAMADRKMVELARLGCHVGGESVMVVEAAVRGLSMGLEKMVK  180

Query  374  MADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
             ADCVRLKTLKG+LD++ P   + FLA+A+  Q+Q+R+ G  +H ++
Sbjct  181  AADCVRLKTLKGILDILTPPQCVEFLAAAATFQVQLRRWGNRRHYVT  227



>ref|XP_010277052.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nelumbo nucifera]
Length=243

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 155/233 (67%), Gaps = 24/233 (10%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAEN---EKDHEFLVNKLTTHYKNYYTAKWA  702
            M S+V+  F++F+EKW+ QLE   Q LL    +   E  H  LV K  THYK YYTAKWA
Sbjct  1    MNSQVQGRFSEFYEKWLHQLETNLQELLSVPRDQSHEAKHRALVIKAVTHYKEYYTAKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG-----------EGMSEEQMKK  555
            AA ED+L FF P WLT LE+AY+W+T W+PS AFRLV             E MSEEQ+K+
Sbjct  61   AAHEDILGFFCPPWLTPLENAYIWMTDWRPSVAFRLVHSLRHTHVPGPSLEHMSEEQLKR  120

Query  554  VEVLRGKIKAeeekveremerqqVAMADRRMVELARL----------GGGDTVADVAVKN  405
            +  LR +I++EE+KVE EMERQQV +ADRRMVELARL          G  D   D A+K 
Sbjct  121  MVELRTRIRSEEQKVEMEMERQQVGLADRRMVELARLATRVRNGEVVGELDGFVDAALKT  180

Query  404  MLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            +L GLE+VMK ADC+RLK LKG+LDV+ P   + F+A+  ML+IQMR+ G+ +
Sbjct  181  VLEGLERVMKTADCLRLKALKGVLDVLTPLQCVDFMAATLMLKIQMRRWGEKR  233



>ref|XP_010434503.1| PREDICTED: transcription factor TGA6-like isoform X1 [Camelina 
sativa]
Length=231

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 158/226 (70%), Gaps = 13/226 (6%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE---NEKDHEFLVNKLTTHYKNYYTAKWA  702
            MR++VEE F +F+E W+ QLE+    LLIA     +E +   L++KLTTH+K YYTAKWA
Sbjct  1    MRNRVEEKFLEFYENWVIQLEQYLHQLLIAHNTTMSEIELRALISKLTTHHKAYYTAKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMS-----EEQMKKVEVLRG  537
            A  EDVLAFF PVWLT LE A  W+TGWKPST FR+V     S     E Q++K+E LR 
Sbjct  61   AIGEDVLAFFGPVWLTPLEKACFWLTGWKPSTVFRMVDRLRKSRLVLVEAQVRKLEELRA  120

Query  536  KIKAeeekveremerqqVAMADRRMVELARLG-----GGDTVADVAVKNMLGGLEKVMKM  372
            K K EE+K+ERE+ER QVAM DR+MVELARLG         V + AVK +  GLEK++K 
Sbjct  121  KTKFEEQKIEREVERYQVAMGDRKMVELARLGCHVGGESVVVVEAAVKGLATGLEKMVKA  180

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
            ADCVRLKTLKG+LD++ P   + FLA+A+  Q+Q+R+ G  +HN++
Sbjct  181  ADCVRLKTLKGILDILAPPQCVEFLAAAAAFQVQLRRWGNQRHNVT  226



>gb|ACD56655.1| predicted protein [Gossypioides kirkii]
Length=253

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 161/235 (69%), Gaps = 24/235 (10%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLE-ECAQLLLIAAE--NEKDHEFLVNKLTTHYKNYYTAKWA  702
            M+S V E F++FF+KW+ QL+    QL+ + +E  +E + + LV+KLT HYK YYT KWA
Sbjct  1    MKSPVGERFSEFFDKWICQLDGYLQQLVRVPSEGLSESEQQALVSKLTAHYKEYYTVKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG------MSEEQMKKVEVLR  540
            AA EDVL F+ PVWL+ LE+AY W+TGWKPS  F +V          ++EEQ++K+E LR
Sbjct  61   AAHEDVLVFYCPVWLSKLENAYSWLTGWKPSMIFGVVESTRRKSVAELTEEQVRKIEQLR  120

Query  539  GKIKAeeekveremerqqVAMADRRMVELARLG------------GGDTV---ADVAVKN  405
             KIK EEEKVEREMERQQVAMADR++VEL R              G   V    +VA+K 
Sbjct  121  VKIKLEEEKVEREMERQQVAMADRKVVELVRTARRIRNEELVVVVGNHQVEGLVEVALKG  180

Query  404  MLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
            +L GLE+VMK ADCVRLK LKG+LD++ P+ S+ FLA   MLQIQ+RK G+ + N
Sbjct  181  VLAGLERVMKAADCVRLKALKGVLDILNPSQSLDFLAGTCMLQIQIRKWGQNRDN  235



>gb|AAT64037.1| predicted protein [Gossypium hirsutum]
Length=253

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 160/235 (68%), Gaps = 24/235 (10%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEE-CAQLLLIAAE--NEKDHEFLVNKLTTHYKNYYTAKWA  702
            M S V E F++FF+KW+ QL+    QL+ ++ E  +E +H+ LV+KLT HYK YYT KWA
Sbjct  1    MTSPVGERFSEFFDKWICQLDGYLQQLVRVSREGLSESEHQTLVSKLTAHYKEYYTVKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------EGMSEEQMKKVEVLR  540
            AA EDVL F+ PVWL+ LE+A  W+TGWKPS  F +V          ++EEQ++K+E LR
Sbjct  61   AAHEDVLVFYCPVWLSKLENACSWLTGWKPSMIFGVVESMRRKSVAELTEEQVRKIEQLR  120

Query  539  GKIKAeeekveremerqqVAMADRRMVELARLG------------GGDTV---ADVAVKN  405
             KIK EEEKVEREMERQQVAMADR+MVEL R              G   V    +VA+K 
Sbjct  121  VKIKLEEEKVEREMERQQVAMADRKMVELVRTARRIRNEELVVVVGNHQVEGLVEVALKG  180

Query  404  MLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
            +L GLE+VMK ADCVRLK LKG+LDV+ P+ S+ FLA   MLQIQ+RK G+ + N
Sbjct  181  VLAGLERVMKAADCVRLKALKGVLDVLNPSQSLDFLAGICMLQIQIRKWGQNRDN  235



>ref|XP_004486274.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Cicer arietinum]
Length=234

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 159/219 (73%), Gaps = 13/219 (6%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECA-QLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAA  696
            M++ V E F++F++KW+ +LEE   QLL ++   E++ + LV+K+TTH K YYT KW AA
Sbjct  1    MKNTVVEKFSEFYQKWIFKLEEILHQLLQVSKTEEQEIQSLVSKVTTHLKEYYTVKWGAA  60

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----MSEEQMKKVEVLRGKIK  528
             EDV+ FF P WL+ LE+A+LWVTGWKPST FR++ G      M+EEQ KK++ LR +++
Sbjct  61   HEDVVIFFTPTWLSPLENAHLWVTGWKPSTVFRILDGLNAAFDMTEEQKKKIDELRVRVR  120

Query  527  AeeekveremerqqVAMADRRMVELARLG----GGDTVAD----VAVKNMLGGLEKVMKM  372
             EEEKVEREMERQQVAMAD +MVELA+L      GD   D    VA+K + GGLEKVMK 
Sbjct  121  IEEEKVEREMERQQVAMADLKMVELAKLSCRARKGDARVDGLVGVALKAVFGGLEKVMKT  180

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +DCVRLKTLKG+LDV+ P   + FLA+   +Q+++RK G
Sbjct  181  SDCVRLKTLKGVLDVLTPIQCVEFLAANIGIQLRLRKFG  219



>ref|XP_003541699.1| PREDICTED: transcription factor HBP-1b(c38)-like [Glycine max]
Length=254

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 171/242 (71%), Gaps = 29/242 (12%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECA-QLLLIAAE------NEKDHEFLVNKLTTHYKNYYT  714
            M++ V ESFTDF++KW+ +LEE   QLL ++ +       E++ + LV+K+T+H K YYT
Sbjct  1    MKNPVAESFTDFYDKWVWKLEEILHQLLEVSKQRTEVVKTEQELQVLVSKVTSHLKEYYT  60

Query  713  AKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV------AGEG---MSEEQM  561
             KWA+A E+VL FF+P WL+ LE+AYLW+TGWKPS  F+L+      A  G   M+EEQ+
Sbjct  61   IKWASAHEEVLVFFSPAWLSPLENAYLWITGWKPSMVFKLLETLKKQASGGDFVMTEEQV  120

Query  560  KKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL---------GGG----DTVAD  420
            +K+E LR + + EEEKVEREMERQQVAMADR+MVEL +L         GGG    D V +
Sbjct  121  RKIEELRKRTRMEEEKVEREMERQQVAMADRKMVELVKLTGRARNNGSGGGGDAVDAVVE  180

Query  419  VAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
            VA+K +L GLE+VMK +DCVRLKTLKG+LDV+ P   + FLA+   +Q+++R+ GK + +
Sbjct  181  VALKGVLAGLERVMKASDCVRLKTLKGVLDVLSPMQCVDFLAANIAMQLRLRQWGKKKRD  240

Query  239  LS  234
            ++
Sbjct  241  IA  242



>emb|CDX99446.1| BnaC01g11060D [Brassica napus]
Length=239

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 158/234 (68%), Gaps = 21/234 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAK  708
            MR++VEE F +F+E W+ QLE+    LLIA  N     E +   L++KLT H+K YYTAK
Sbjct  1    MRNRVEEKFLEFYESWIFQLEQYLHQLLIAHNNINTMSEIELRGLISKLTAHHKAYYTAK  60

Query  707  WAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMS--------EEQMKKV  552
            WAA  ED+LAFF PVWL  LE +  W+TGWKPSTAFR++     S        E Q++++
Sbjct  61   WAAIGEDILAFFGPVWLNPLEKSCFWLTGWKPSTAFRMLDRLRKSWRPTVVLVEAQVRRL  120

Query  551  EVLRGKIKAeeekveremerqqVAMADRRMVELARLG-------GGDTV-ADVAVKNMLG  396
            E LR K + +EE++E EMER QVAMADR+MVELARLG       G  TV  + AVK +  
Sbjct  121  EELRVKTRFDEERIETEMERYQVAMADRKMVELARLGCRVGGVEGESTVLVEAAVKGLAT  180

Query  395  GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
             LEK++K ADCVRLKTLKG+LDV+ P   + FLA+A+  Q+Q+R+ G  +HN++
Sbjct  181  RLEKMVKAADCVRLKTLKGILDVLAPPQCVEFLAAAAAFQVQLRRWGNERHNVT  234



>ref|XP_009350852.1| PREDICTED: transcription factor TGA6 [Pyrus x bretschneideri]
Length=237

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 167/238 (70%), Gaps = 22/238 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE----NEKDHEFLVNKLTTHYKNYYTAKW  705
            MRS+VE+ F++FFE+W+ QLE+  Q LL  +E    NE +   LV+K T  +K YYT KW
Sbjct  1    MRSQVEQRFSEFFERWVFQLEQLQQQLLKLSEETRQNEAELRALVSKATNLHKEYYTVKW  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------EGMSEEQMKKVEVL  543
            AAAR+DVLAFF PVW + LE+AY WVTGWKPS  F+L+          MSEEQ++KVE L
Sbjct  61   AAARDDVLAFFCPVWSSPLENAYSWVTGWKPSMLFQLIESLKKTRLVSMSEEQVRKVEQL  120

Query  542  RGKIKAeeekveremerqqVAMADRRMVELARLG----GGDTVA------DVAVKNMLGG  393
            R K+K EE+KVEREMERQQVAMADRRMVELARL      G+  A      +VAVK ML G
Sbjct  121  RQKMKYEEDKVEREMERQQVAMADRRMVELARLATRARNGEAAAELEGLVNVAVKVMLSG  180

Query  392  LEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLSLITNS  219
            LE VMK ADCVRLKTLKGLLD++ P  S+ FLA+  M+QI++ + G+   N++ I  S
Sbjct  181  LEGVMKAADCVRLKTLKGLLDLLSPLQSVEFLAATCMVQIKLGEWGR--RNVTKIKCS  236



>ref|XP_009132069.1| PREDICTED: uncharacterized protein LOC103856700 [Brassica rapa]
 emb|CDX78882.1| BnaA01g09490D [Brassica napus]
Length=239

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 158/234 (68%), Gaps = 21/234 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAK  708
            MR++VEE F +F+E W+ QLE+    LLIA  N     E +   L++KLT H+K YYTAK
Sbjct  1    MRNRVEEKFLEFYEGWIFQLEQYLHQLLIAHNNINTMSEIELRGLISKLTAHHKAYYTAK  60

Query  707  WAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMS--------EEQMKKV  552
            WAA  EDVLAFF PVWL  LE +  W+TGWKPSTAFR++     S        E Q++++
Sbjct  61   WAAIGEDVLAFFGPVWLNPLEKSCFWLTGWKPSTAFRMLDRLRKSWRPTVVLVEAQVRRL  120

Query  551  EVLRGKIKAeeekveremerqqVAMADRRMVELARLG-------GGDTV-ADVAVKNMLG  396
            E LR K + +EE++E EMER QVAMADR+MVELARLG       G  TV  + AVK +  
Sbjct  121  EELRVKTRFDEERIETEMERYQVAMADRKMVELARLGCRVGGVEGESTVLVEAAVKGLAT  180

Query  395  GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
             LEK++K ADCVRLKTLKG+LDV+ P   + FLA+A+  Q+Q+R+ G  +HN++
Sbjct  181  RLEKMVKAADCVRLKTLKGILDVLAPPQCVEFLAAAAAFQVQLRRWGNERHNVT  234



>ref|XP_006414073.1| hypothetical protein EUTSA_v10027388mg [Eutrema salsugineum]
 gb|ESQ55526.1| hypothetical protein EUTSA_v10027388mg [Eutrema salsugineum]
Length=238

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 161/233 (69%), Gaps = 20/233 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAEN-------EKDHEFLVNKLTTHYKNYYT  714
            MR+++EE F +F+E W+ QLE+    L++A  N       E +   +++KLTTH+K YYT
Sbjct  1    MRNRIEEKFLEFYEGWIFQLEQYLHQLIVAHNNYTNNTMSEMELRGMISKLTTHHKAYYT  60

Query  713  AKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--------AGEGMSEEQMK  558
            AKWAA  EDVLAFF PVWL  LE +  W+TGWKPS AFR+V            + E Q+K
Sbjct  61   AKWAAIGEDVLAFFGPVWLNPLERSCFWLTGWKPSMAFRIVDRLRKSWRPTVVLEEAQVK  120

Query  557  KVEVLRGKIKAeeekveremerqqVAMADRRMVELARLG---GGDT--VADVAVKNMLGG  393
            K+E LR K + +EEK+EREMER QVAMADR+MVELA+LG   GG++  V + AVK +   
Sbjct  121  KLEELRVKTRFDEEKIEREMERYQVAMADRKMVELAKLGCHIGGESAVVVEAAVKGLAMA  180

Query  392  LEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
            LEK++K+ADC RLKTLKG+LD++ P   + FLA+A+  Q+Q+R+ G  +H+++
Sbjct  181  LEKMVKVADCARLKTLKGILDILSPPQCVEFLAAAAAFQVQLRRLGNARHHVT  233



>ref|XP_008371485.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-1A 
[Malus domestica]
Length=237

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 161/226 (71%), Gaps = 20/226 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE----NEKDHEFLVNKLTTHYKNYYTAKW  705
            MRS+VE+ F++FFE+W+ QLE+  Q LL  +E    NE +   LV+K T  +K YYT KW
Sbjct  1    MRSQVEQRFSEFFERWVFQLEQLQQQLLKLSEETRQNEAELRALVSKATNLHKEYYTVKW  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------EGMSEEQMKKVEVL  543
            AAAR+DVLAFF PVW + LE+AY WVTGWKPS  F+LV          MSEEQ++KVE L
Sbjct  61   AAARDDVLAFFCPVWSSPLENAYSWVTGWKPSMLFQLVESLKKTRLVSMSEEQVRKVEQL  120

Query  542  RGKIKAeeekveremerqqVAMADRRMVELARLG----GGDTVA------DVAVKNMLGG  393
            R K++ EE+KVEREMERQQVAMADRRMVELARL      G+  A      +VA+K ML G
Sbjct  121  RQKMRYEEDKVEREMERQQVAMADRRMVELARLATRARNGEAAAELEGLVNVAMKVMLSG  180

Query  392  LEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            LE VMK ADCVRLKTLKGLLD++ P  S+  LA+  MLQI++R+ G
Sbjct  181  LEGVMKAADCVRLKTLKGLLDLLSPLQSVELLAATCMLQIKLREWG  226



>ref|XP_003547173.2| PREDICTED: transcription factor TGA5-like [Glycine max]
Length=290

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 171/242 (71%), Gaps = 26/242 (11%)
 Frame = -3

Query  884  FSSSMRSKVEESFTDFFEKWMAQLEECA-QLLLIAAE------NEKDHEFLVNKLTTHYK  726
            F+S M++ V +SFT+F++KW+ +LEE   QLL ++ +       E++ + L++K+T+H K
Sbjct  36   FTSLMKNPVAQSFTEFYDKWVWKLEEILHQLLEVSKQRTQVVKTEQELQVLISKVTSHLK  95

Query  725  NYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV------AGEG----M  576
             YYT KWA+A EDVL FF+P WL+ LE+AYLW+TGWKPS   +L+      A  G    M
Sbjct  96   EYYTVKWASAHEDVLVFFSPTWLSPLENAYLWMTGWKPSMVLKLLETLKKQAASGGDFVM  155

Query  575  SEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGG---------GDTVA  423
            +EEQ +K+E LR + + EEEKVEREMERQQVAMADR+MVEL +L           GD VA
Sbjct  156  TEEQARKIEELRKRTRMEEEKVEREMERQQVAMADRKMVELVKLTTRARNGGGGGGDAVA  215

Query  422  DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQH  243
            +VA+K +L GLE+VMK +DCVRLKTLKG+LDV+ P   + FLA+ + +Q+++R+ GK + 
Sbjct  216  EVALKGVLAGLERVMKASDCVRLKTLKGVLDVLSPMQCVDFLAANTAMQLRLRQWGKKKR  275

Query  242  NL  237
            ++
Sbjct  276  DM  277



>ref|XP_002867982.1| hypothetical protein ARALYDRAFT_354881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44241.1| hypothetical protein ARALYDRAFT_354881 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 156/226 (69%), Gaps = 13/226 (6%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDHEF--LVNKLTTHYKNYYTAKWAA  699
            MR+ VEE F +F+E W+ QLE     LLIA     + E   L++KLTTH+K YYTAKWAA
Sbjct  1    MRNLVEEKFLEFYESWVIQLELYLHQLLIAHNTMSETELRALISKLTTHHKAYYTAKWAA  60

Query  698  AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV------AGEGMSEEQMKKVEVLRG  537
              EDVLAFF P+WL  LE A  W+TGWKPST FR+V      +   + E Q++K+E LR 
Sbjct  61   IGEDVLAFFGPIWLNPLEKACFWLTGWKPSTVFRMVDRLRKYSRVVLVEAQVRKLEELRV  120

Query  536  KIKAeeekveremerqqVAMADRRMVELARLG-----GGDTVADVAVKNMLGGLEKVMKM  372
            K K +E+K+EREMER QVAMADR+MVELARLG         V + AV+ +  GLEK++K 
Sbjct  121  KTKFDEQKIEREMERYQVAMADRKMVELARLGCHVGGESVVVVEAAVRGLATGLEKMVKA  180

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
            ADCVRLKTLKG+LD++ P   + FLA+A+  Q+Q+R+ G  +HN++
Sbjct  181  ADCVRLKTLKGILDILAPPQCVEFLAAAATFQVQLRRWGNRRHNVT  226



>emb|CBI30697.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 139/227 (61%), Gaps = 46/227 (20%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE---NEKDHEFLVNKLTTHYKNYYTAKWA  702
            M+S VEE F +F+EKWM QLEE  Q LL  +    +  + E LV+++TTH K YY AKWA
Sbjct  1    MKSPVEERFIEFYEKWMCQLEENLQRLLKVSREIPHRTEREALVSRVTTHLKEYYNAKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL--------VAGEGMSEEQMKKVEV  546
            AA EDVLAFF+PVWL+ LE+AYLWVTGWKPSTAFRL        V GE ++E Q      
Sbjct  61   AAHEDVLAFFSPVWLSPLENAYLWVTGWKPSTAFRLIESLRQTGVPGESLAEMQQ-----  115

Query  545  LRGKIKAeeekveremerqqVAMADRRMVELARL-----GGG-----DTVADVAVKNMLG  396
                                VA+ADR+MVELAR       GG     + + +VA+K +L 
Sbjct  116  --------------------VALADRKMVELARAASRVSNGGLASEENGLVEVALKGLLS  155

Query  395  GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            GLE+VMK ADC RLKTLKG+L+V+ P   + FLA+  M  + +RK G
Sbjct  156  GLERVMKAADCARLKTLKGILEVLSPLQCVDFLAATLMFHVNLRKWG  202



>ref|XP_010686461.1| PREDICTED: transcription factor HBP-1b(c38) [Beta vulgaris subsp. 
vulgaris]
Length=251

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 158/242 (65%), Gaps = 22/242 (9%)
 Frame = -3

Query  881  SSSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWA  702
            SS+  S VEE F  ++E+W+ QLE   Q L++   ++ D+E +V   TTH+K YYTAKWA
Sbjct  4    SSNNNSLVEEKFCSYYEEWLKQLELHLQQLVLG--HQLDYETMVTTFTTHHKEYYTAKWA  61

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG-----------EGMSEEQMKK  555
            AA +D+LAFF+P W + LESA+ W TGWKPST FR+V               +S+EQ +K
Sbjct  62   AAHDDILAFFSPQWASPLESAFTWATGWKPSTVFRVVDSLRKTRAPLTSLAQLSDEQAQK  121

Query  554  VEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGG---------DTVADVAVKNM  402
            +  L  KIK EE+KV+REMERQQVAM D +MVELAR+            D +  VAVK +
Sbjct  122  IGELGVKIKLEEQKVDREMERQQVAMGDLKMVELARVSSRVNANESSRVDKIVGVAVKGL  181

Query  401  LGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLSLITN  222
              GLEKVMKM D VRLK LKG+LDV+ P   + FLA  +MLQIQ+RK GK +  +++  +
Sbjct  182  FDGLEKVMKMGDYVRLKALKGVLDVLSPRQKVDFLAVFAMLQIQIRKWGKQRALINIAND  241

Query  221  SS  216
            SS
Sbjct  242  SS  243



>ref|XP_004293958.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-1A-like 
[Fragaria vesca subsp. vesca]
Length=239

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 166/239 (69%), Gaps = 22/239 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLL--------IAAENEKDHEFLVNKLTTHYKNYY  717
            M ++VEE FT+FFE W+ QLE+    LL        +   NE + + LV+++T  +K YY
Sbjct  1    MTTQVEERFTEFFETWVCQLEQLQHQLLKLSQEKSTLQPHNEAELQALVSRVTNLHKEYY  60

Query  716  TAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG---EGMSEEQMKKVEV  546
            TAKWAAA +DVLAFF PVW + LE+AY W+TGWKPS  F+L+     + +SE+Q++K+E 
Sbjct  61   TAKWAAAHQDVLAFFCPVWSSPLENAYSWLTGWKPSMLFKLMRKARLQNLSEQQLRKIEE  120

Query  545  LRGKIKAeeekveremerqqVAMADRRMVELARL------GGGDTV-----ADVAVKNML  399
            LR KI+ EEE+VEREMERQQVAMADR+MVELARL      GGG  V      D+A+K +L
Sbjct  121  LRLKIRYEEERVEREMERQQVAMADRKMVELARLATRVRNGGGAVVEVEGMVDMAMKVIL  180

Query  398  GGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLSLITN  222
             GLE+VMK ADCVRLK LKGLLD++ P   + FLA+  M+QI++ + G+ + N+ +  N
Sbjct  181  NGLERVMKAADCVRLKALKGLLDLLSPLQCVEFLAATGMVQIRLSQWGRKRSNVLIDLN  239



>ref|XP_006285198.1| hypothetical protein CARUB_v10006552mg [Capsella rubella]
 gb|EOA18096.1| hypothetical protein CARUB_v10006552mg [Capsella rubella]
Length=235

 Score =   190 bits (482),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 154/230 (67%), Gaps = 17/230 (7%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDHEF----LVNKLTTHYKNYYTAKW  705
            MR++VEE F +F++ W+ QLE+    LL A  N    E     L++KLTTH+K YY AKW
Sbjct  1    MRNRVEEKFLEFYDNWVIQLEQYLHQLLNARNNNTMTEIELRALISKLTTHHKAYYIAKW  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMS--------EEQMKKVE  549
            AA  EDVLAFF PVWL  LE A  W+TGWKPSTAFR++     S        E Q+ K+E
Sbjct  61   AAIGEDVLAFFGPVWLNPLEKACFWLTGWKPSTAFRMLERLRKSWSPTVVLLEAQVTKLE  120

Query  548  VLRGKIKAeeekveremerqqVAMADRRMVELARLG-----GGDTVADVAVKNMLGGLEK  384
             LR K K EE+K+EREMER QV+M DR+MVE+ARLG         V + AVK +  GLEK
Sbjct  121  ELRFKTKFEEQKIEREMERYQVSMGDRKMVEIARLGCHVGGESVVVVEAAVKGLATGLEK  180

Query  383  VMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
            ++K ADCVRLKTLKG+LD++ P   + FLA+A+  Q+Q+R+ G  +H+++
Sbjct  181  MVKAADCVRLKTLKGILDILAPPQCVEFLAAAAAFQVQLRRWGNQRHHVT  230



>ref|XP_003636790.1| Transcription factor TGA5 [Medicago truncatula]
 gb|KEH36610.1| seed dormancy control protein [Medicago truncatula]
 gb|KEH36614.1| seed dormancy control protein [Medicago truncatula]
Length=233

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 155/226 (69%), Gaps = 20/226 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECA-QLLLIAAE------NEKDHEFLVNKLTTHYKNYYT  714
            M++ V E F++F+EKW+ +LEE   QLL I+ +      NE++ + LV+K+T H K YYT
Sbjct  1    MKNLVVERFSEFYEKWVVKLEEIQRQLLEISKKKTEVTMNEQELKALVSKVTAHVKEYYT  60

Query  713  AKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV---AGE-GMSEEQMKKV-E  549
             KW AA EDVL FF P WLT LE+A+LWVTGWKPST F ++    GE  M+EEQ KK+  
Sbjct  61   VKWGAAHEDVLVFFTPTWLTPLENAHLWVTGWKPSTVFHILEDPKGEFNMTEEQKKKILG  120

Query  548  VLRGKIKAeeekveremerqqVAMADRRMVELARL--------GGGDTVADVAVKNMLGG  393
             LR +I+ EEEKVEREMERQQVAMAD +MVELA+L        G  D +  VA+  +  G
Sbjct  121  ELRVRIRMEEEKVEREMERQQVAMADLKMVELAKLSCRAKKDDGRVDGMVGVALNGVFAG  180

Query  392  LEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            LEKVMK +DC RLK+LKG+LD++ P   + FLA+   +Q+ +R+ G
Sbjct  181  LEKVMKTSDCARLKSLKGVLDILSPIQCVDFLAAHIGMQLWLRQLG  226



>gb|KDP21106.1| hypothetical protein JCGZ_21577 [Jatropha curcas]
Length=211

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 136/190 (72%), Gaps = 22/190 (12%)
 Frame = -3

Query  755  LVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL------  594
            LV+K+T HYK YYT KWA AREDVLAFF+P+W+T LE+AY W+TGWKPS  F+L      
Sbjct  21   LVSKVTQHYKEYYTIKWALAREDVLAFFSPIWVTPLENAYSWITGWKPSAVFKLVDSMRT  80

Query  593  --VAGEGMSE---EQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL----G  441
              V G  ++E   EQ+ +++ LR KI+ EEEKVEREMERQQVA+ADR+M+EL RL     
Sbjct  81   SRVPGPSLTELTQEQVGQIQELRVKIRLEEEKVEREMERQQVAIADRKMIELLRLVVRVK  140

Query  440  GGDTVA-------DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASM  282
             G+ V+        VA+K ++GGLEKVMK ADCVRL+TLKGLLD++ P   + FLA   M
Sbjct  141  NGEQVSLQVEGRVQVALKGVMGGLEKVMKAADCVRLRTLKGLLDLLNPFQCVEFLAGICM  200

Query  281  LQIQMRKCGK  252
            LQIQ+ + GK
Sbjct  201  LQIQISQSGK  210



>ref|XP_007148035.1| hypothetical protein PHAVU_006G175000g [Phaseolus vulgaris]
 gb|ESW20029.1| hypothetical protein PHAVU_006G175000g [Phaseolus vulgaris]
Length=305

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 157/234 (67%), Gaps = 21/234 (9%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAA-------ENEKDHEFLVNKLTTHYKNYYT  714
            M + V   F++F+E W  +LE+  Q LL  +       + E++ + LV+ +T+H K YYT
Sbjct  62   MANPVVVRFSEFYENWTGKLEDILQQLLQVSSQRTEVVKTEQELQALVSTVTSHLKEYYT  121

Query  713  AKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EG----MSEEQMKKV  552
             KW  A ++VL FF+P WL  LE+A LW+TGWKPST FR V    +G    M+EEQ KK+
Sbjct  122  TKWGIAHDNVLIFFSPPWLNPLENAQLWMTGWKPSTVFRQVENLKKGNVLVMTEEQEKKM  181

Query  551  EVLRGKIKAeeekveremerqqVAMADRRMVELARLGGG--------DTVADVAVKNMLG  396
            E L+ KIK EEEKVEREMERQQVAMADRRMV+L++L           D+VA+VAVK +L 
Sbjct  182  EELKMKIKMEEEKVEREMERQQVAMADRRMVQLSKLTSRARSAGSEMDSVAEVAVKEVLA  241

Query  395  GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
            GLE+VMK +DCVRLKTLKG+LD++ P  S+ FLA+     ++  + GK + +++
Sbjct  242  GLERVMKASDCVRLKTLKGVLDLLTPMQSVDFLAANITTLLRFNQWGKKKKDMA  295



>ref|XP_002534284.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28101.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/254 (44%), Positives = 158/254 (62%), Gaps = 38/254 (15%)
 Frame = -3

Query  875  SMRSKVEESFTDFFEKWMAQLE-ECAQLLLIAAENEK--------DHEF--LVNKLTTHY  729
             M++KVE+ F++F EKWM  L+    QL  + +  ++        D +   +V+K+  HY
Sbjct  2    DMKNKVEDRFSEFLEKWMRLLDGYLLQLRKVVSSKDRLNKHGTYCDEKLQAIVSKVAQHY  61

Query  728  KNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------------  585
            K YY  KWA A EDVLAFF+P W++ LE+A  W+T WKPS  F+LV              
Sbjct  62   KEYYIIKWALAHEDVLAFFSPTWISPLETASSWITDWKPSVVFKLVDSLRTNHRVPGPSS  121

Query  584  --EGMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELAR----------LG  441
                +++EQ++K+E L+ KI+ EE+KVEREMERQQVA+ADR+MVELAR          + 
Sbjct  122  TLAELTQEQVRKIEELKLKIRLEEQKVEREMERQQVAIADRKMVELARWVYRVKNDGKVS  181

Query  440  GGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
              + +   A+   L GLEKVMK ADCVRL+ LKG+LDV+ P   + FLA+ +ML IQ+R+
Sbjct  182  QVEGLVQAALNGALAGLEKVMKAADCVRLRALKGILDVLSPFQCVEFLAATAMLHIQLRQ  241

Query  260  CGKTQHNLSLITNS  219
             GK +HN   ITN+
Sbjct  242  WGKRRHN---ITNN  252



>gb|KFK28536.1| hypothetical protein AALP_AA7G009500 [Arabis alpina]
Length=195

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 129/186 (69%), Gaps = 14/186 (8%)
 Frame = -3

Query  755  LVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-----  591
            L++KLTTH+K YYTAKWAA  EDVLAFF PVWL  LE +  W+TGWKPSTAFR+V     
Sbjct  9    LISKLTTHHKAYYTAKWAAIGEDVLAFFGPVWLNPLEKSCFWLTGWKPSTAFRMVERLRK  68

Query  590  AGEGMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGG---------  438
            +   + E Q KK+E LR K + EEEK+EREMER QVAMADR+MVELARLG          
Sbjct  69   STVVLVEAQAKKLEELRVKTRFEEEKIEREMERYQVAMADRKMVELARLGCHVGGGGGGE  128

Query  437  GDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKC  258
               V + AVK +  GLEK++K ADCVRLKTL G+LD++ P   + FLA  +  Q+Q+R+ 
Sbjct  129  SMVVVEAAVKGLAMGLEKMVKAADCVRLKTLMGILDILAPPQCVEFLAETAAFQVQLRRW  188

Query  257  GKTQHN  240
            G  +HN
Sbjct  189  GNERHN  194



>ref|XP_010274491.1| PREDICTED: uncharacterized protein LOC104609805 [Nelumbo nucifera]
Length=625

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 153/248 (62%), Gaps = 24/248 (10%)
 Frame = -3

Query  899  KPSRQFSSSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAEN---EKDHEFLVNKLTTHY  729
            +P  + S  M+S V+E F++F+EKW+ Q E   + +L  A +   E +H  LV ++ T Y
Sbjct  61   RPRTRRSEDMKSLVQERFSEFYEKWLFQQETNLEEILSVARDQSHEPEHRALVIRVVTQY  120

Query  728  KNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--------AGEG--  579
            K YYT KWAAA ED+L FF P WL+ LE+A  W+T W+PS AFRLV         G    
Sbjct  121  KEYYTTKWAAAHEDILGFFCPSWLSPLENACTWMTDWRPSLAFRLVDSLRQTQIPGSSLV  180

Query  578  -MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL----------GGGD  432
             MSE Q+KK++ L  +IK EEEKVE EMERQQV +ADR MVELARL             D
Sbjct  181  EMSEAQLKKMKELCRRIKLEEEKVEMEMERQQVGLADRPMVELARLTTRVRNGEVASKFD  240

Query  431  TVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
               DVA+  +LGGLE+VMKMADC+RLK LKGLLDV+    S+  +A+  M +IQ     +
Sbjct  241  GYVDVALDTLLGGLERVMKMADCLRLKALKGLLDVLTVLQSMDLMAAMLMQKIQFLPILR  300

Query  251  TQHNLSLI  228
              H + L+
Sbjct  301  HHHLMDLV  308



>ref|XP_010434504.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Camelina 
sativa]
Length=208

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 133/192 (69%), Gaps = 13/192 (7%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE---NEKDHEFLVNKLTTHYKNYYTAKWA  702
            MR++VEE F +F+E W+ QLE+    LLIA     +E +   L++KLTTH+K YYTAKWA
Sbjct  1    MRNRVEEKFLEFYENWVIQLEQYLHQLLIAHNTTMSEIELRALISKLTTHHKAYYTAKWA  60

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMS-----EEQMKKVEVLRG  537
            A  EDVLAFF PVWLT LE A  W+TGWKPST FR+V     S     E Q++K+E LR 
Sbjct  61   AIGEDVLAFFGPVWLTPLEKACFWLTGWKPSTVFRMVDRLRKSRLVLVEAQVRKLEELRA  120

Query  536  KIKAeeekveremerqqVAMADRRMVELARLG-----GGDTVADVAVKNMLGGLEKVMKM  372
            K K EE+K+ERE+ER QVAM DR+MVELARLG         V + AVK +  GLEK++K 
Sbjct  121  KTKFEEQKIEREVERYQVAMGDRKMVELARLGCHVGGESVVVVEAAVKGLATGLEKMVKA  180

Query  371  ADCVRLKTLKGL  336
            ADCVRLKTLK +
Sbjct  181  ADCVRLKTLKAM  192



>ref|XP_007212128.1| hypothetical protein PRUPE_ppa012113mg [Prunus persica]
 gb|EMJ13327.1| hypothetical protein PRUPE_ppa012113mg [Prunus persica]
Length=183

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 124/176 (70%), Gaps = 17/176 (10%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAAE----NEKDHEFLVNKLTTHYKNYYTAKW  705
            MR++VEE F++FFEKW+ QLE+  Q LL  +E    NE + + LV+K+T  +K YYT KW
Sbjct  1    MRTQVEERFSEFFEKWVCQLEQLQQQLLKLSEETLQNEVELQALVSKVTYLHKEYYTVKW  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------EGMSEEQMKKVEVL  543
            AAAREDVLAFF PVW + LE+AY WVTGWKPS  F+L+          MSEEQ+KK+EVL
Sbjct  61   AAAREDVLAFFCPVWSSPLENAYNWVTGWKPSMLFQLIGSLRKTRLVNMSEEQLKKIEVL  120

Query  542  RGKIKAeeekveremerqqVAMADRRMVELARL-------GGGDTVADVAVKNMLG  396
            R K++ EEEKVEREMERQQVAMADRRMVELARL       G       +AV  +LG
Sbjct  121  RLKMRYEEEKVEREMERQQVAMADRRMVELARLCEAQDIEGCFGCAEPIAVCGVLG  176



>gb|KHN08426.1| TGACG-sequence-specific DNA-binding protein TGA-2.1 [Glycine 
soja]
Length=201

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 126/187 (67%), Gaps = 27/187 (14%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECA-QLLLIAAE------NEKDHEFLVNKLTTHYKNYYT  714
            M++ V ESFTDF++KW+ +LEE   QLL ++ +       E++ + LV+K+T+H K YYT
Sbjct  1    MKNPVAESFTDFYDKWVWKLEEILHQLLEVSKQRTEVVKTEQELQVLVSKVTSHLKEYYT  60

Query  713  AKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV------AGEG---MSEEQM  561
             KWA+A E+VL FF+P WL+ LE+AYLW+TGWKPS  F+L+      A  G   M+EEQ+
Sbjct  61   IKWASAHEEVLVFFSPAWLSPLENAYLWITGWKPSMVFKLLETLKKQASGGDFVMTEEQV  120

Query  560  KKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL----------GGGDTVADVAV  411
            +K+E LR + + E EKVEREMERQQVAMADR+MVEL +L          GGGD V D  V
Sbjct  121  RKIEELRKRTRMEAEKVEREMERQQVAMADRKMVELVKLTGRARNNGSGGGGDAV-DAVV  179

Query  410  KNMLGGL  390
            +  L G 
Sbjct  180  EVALEGF  186



>ref|XP_009773805.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Nicotiana sylvestris]
Length=149

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = -3

Query  824  MAQLEECAQLLLIAAENE---KDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLT  654
            M QLEE  +LLLI  +     KDHE LV K+TTH+K+YYT KWAAA ED+L+FF PVWL+
Sbjct  1    MTQLEESLRLLLIVPKETSYVKDHESLVIKMTTHHKDYYTVKWAAAHEDILSFFNPVWLS  60

Query  653  SLESAYLWVTGWKPSTAFRL-VAGEGMSEEQMKKV  552
             LE+AYLWVTGWKPS AFRL VA   +S+EQ  K+
Sbjct  61   PLENAYLWVTGWKPSMAFRLVVANSELSDEQCVKL  95



>ref|XP_002528014.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34370.1| conserved hypothetical protein [Ricinus communis]
Length=271

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 132/248 (53%), Gaps = 43/248 (17%)
 Frame = -3

Query  866  SKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDH--------EFLVNKLTTHYKNYYTA  711
            S    SF DFFE W+ + ++    L+ A++ + ++        + L+N++  HY+ YY+A
Sbjct  16   SSSHNSFHDFFEWWLVEQKQELDELISASKQKLNNKNNNHDSLQPLINRVLEHYEQYYSA  75

Query  710  KWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------------  579
            K   A+ DVLA F+P W + LE A+LW+ GW+PS AF L+  +                 
Sbjct  76   KSKWAKHDVLAMFSPSWTSPLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAQLHDVIRGLC  135

Query  578  ------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA------RLGGG  435
                  +S  Q+ +V+  + +I  EE+ +   M + Q  +AD  MVEL       R   G
Sbjct  136  TGDLGDLSPNQLVQVDEFQRRIIREEKNITENMAKHQATVADTSMVELTHAISKTRRDEG  195

Query  434  DTVAD-------VAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQ  276
             ++ +         +K  L GLEKV++ AD +RL+TLKG++D++ P  ++HFL +A+ L 
Sbjct  196  SSIGNEVQERVESTLKTKLEGLEKVLQKADDLRLRTLKGIIDILTPDQTVHFLIAAAELH  255

Query  275  IQMRKCGK  252
            +++ + GK
Sbjct  256  LRLHELGK  263



>ref|XP_011022856.1| PREDICTED: transcription factor TGA2-like [Populus euphratica]
Length=280

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 137/258 (53%), Gaps = 49/258 (19%)
 Frame = -3

Query  881  SSSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDH--------------EFLVNK  744
            +S+  S   ESF  FFE W+A+     + L I+   + DH              + L+N+
Sbjct  14   TSTNGSPSRESFRKFFECWLAEQSNYLEQL-ISTCKDYDHNKKNSPQSSSQAILQPLINR  72

Query  743  LTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFR-----------  597
            +  HY++YY AK   A++DVL+  +P W ++LE A+LW+ GW+PS AF            
Sbjct  73   VLEHYEHYYRAKSRWAKDDVLSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQLE  132

Query  596  -----LVAGEG------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA  450
                 L+ G G      +S  Q+ +V+ L+ K   EE ++  +  + Q A+AD  MVEL+
Sbjct  133  AQLHELICGLGTGDLGDLSASQLTRVDQLQRKTIREENELTEKHAKHQEAVADSSMVELS  192

Query  449  R--------LGGGDTVADVAVKNMLG----GLEKVMKMADCVRLKTLKGLLDVMGPTHSI  306
                        GD V +  V++ L     GL+++++MAD +RL+T+KG+++++ P  ++
Sbjct  193  HEVTELLRSESTGDEVDEERVESTLAPKKDGLQEILQMADDLRLRTIKGVIEILTPMQAV  252

Query  305  HFLASASMLQIQMRKCGK  252
            HFL +A+ L +++   GK
Sbjct  253  HFLIAAAELHLRLHDWGK  270



>ref|XP_002273632.1| PREDICTED: transcription factor TGA2 [Vitis vinifera]
 emb|CBI21619.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 125/240 (52%), Gaps = 37/240 (15%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKDHEF-------LVNKLTTHYKNYYTAKWAAA  696
            E F  FFE W+ +  +  Q L+ A+ N +  +        LV ++ +HY NYY AK  + 
Sbjct  9    EGFHKFFESWLTEQNQHLQELISASRNNQHTDDSDQILCPLVERVVSHYHNYYHAKSLST  68

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG---------------------  579
            R+++L+   P W + LE A+LWV GW+PS AF L+  +                      
Sbjct  69   RDNILSMLTPPWRSLLEDAFLWVGGWRPSVAFHLLYSKSGLQFESGLADLIRGLSTGDLG  128

Query  578  -MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTV--------  426
             MS EQ+ +V+ L+ K   EE ++   M R Q  +AD +MVEL+     +          
Sbjct  129  DMSHEQLCRVDELQRKTIREEREMTENMARIQETVADSKMVELSEAATEEGGGGDDLGER  188

Query  425  ADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
             + A+K+   GL +++  AD +RL+TLKG+LD++ P   +HFL +A+ L +++ K GK +
Sbjct  189  VESALKHKEEGLAEMLLKADDLRLRTLKGVLDILTPMQCVHFLIAAAELHLRLHKWGKNK  248



>ref|XP_002310543.2| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
 gb|EEE90993.2| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
Length=269

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 132/247 (53%), Gaps = 38/247 (15%)
 Frame = -3

Query  881  SSSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDH-------------EFLVNKL  741
            +S+  S   E+F  FFE W+A+     + L I++  + DH             + L+N++
Sbjct  14   TSTNSSPSRETFRKFFECWLAEQNNYLEQL-ISSCKDYDHNKKNSPQSSQATLQPLINRV  72

Query  740  TTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFR------------  597
              HY+ YY AK   A++DVL+  +P W ++LE A+LW+ GW+PS AF             
Sbjct  73   LEHYEYYYRAKSRWAKDDVLSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQLEA  132

Query  596  ----LVAGEG------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA-  450
                L+ G G      +S  Q+ +V+ L+ K   EE ++  +  + Q  +AD  MVELA 
Sbjct  133  QLHELICGLGTGDLGDLSGSQLTRVDQLQRKTIREENELTEKHVKHQETVADSSMVELAH  192

Query  449  -RLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQI  273
               G  +   +  +     GL+++++MAD +R++T+KG++D++ P  ++HFL +A+ L +
Sbjct  193  ENTGTDEERVESTLAPRKDGLQEILQMADDLRVRTIKGVIDILTPIQAVHFLIAAAELHL  252

Query  272  QMRKCGK  252
            ++   GK
Sbjct  253  RLHDWGK  259



>ref|XP_006380400.1| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
 gb|ERP58197.1| hypothetical protein POPTR_0007s04840g [Populus trichocarpa]
Length=277

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 132/255 (52%), Gaps = 46/255 (18%)
 Frame = -3

Query  881  SSSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDH-------------EFLVNKL  741
            +S+  S   E+F  FFE W+A+     + L I++  + DH             + L+N++
Sbjct  14   TSTNSSPSRETFRKFFECWLAEQNNYLEQL-ISSCKDYDHNKKNSPQSSQATLQPLINRV  72

Query  740  TTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFR------------  597
              HY+ YY AK   A++DVL+  +P W ++LE A+LW+ GW+PS AF             
Sbjct  73   LEHYEYYYRAKSRWAKDDVLSMLSPSWTSTLEHAFLWIGGWRPSVAFHLLYSKSGHQLEA  132

Query  596  ----LVAGEG------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA-  450
                L+ G G      +S  Q+ +V+ L+ K   EE ++  +  + Q  +AD  MVELA 
Sbjct  133  QLHELICGLGTGDLGDLSGSQLTRVDQLQRKTIREENELTEKHVKHQETVADSSMVELAH  192

Query  449  ---------RLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFL  297
                       G  +   +  +     GL+++++MAD +R++T+KG++D++ P  ++HFL
Sbjct  193  EVTELLRSENTGTDEERVESTLAPRKDGLQEILQMADDLRVRTIKGVIDILTPIQAVHFL  252

Query  296  ASASMLQIQMRKCGK  252
             +A+ L +++   GK
Sbjct  253  IAAAELHLRLHDWGK  267



>ref|XP_009402767.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-1A-like 
[Musa acuminata subsp. malaccensis]
Length=270

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 127/236 (54%), Gaps = 30/236 (13%)
 Frame = -3

Query  863  KVEESFTDFFEKWMAQLEECAQLLLIAAENEKDH---EFLVNKLTTHYKNYYTAKWAAAR  693
            +  E F  FFE W+A+ E   Q+L  AA +  +      LV+++  HY+ YY AK A+ R
Sbjct  22   RAPEHFAKFFECWLAEQERDLQVLRTAAASAGEELRLRPLVDRVLGHYEYYYCAKAASVR  81

Query  692  EDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------------------  579
             DVL  F P W +S E+ +LW  GW+P+ AF L+  +                       
Sbjct  82   RDVLPMFNPTWTSSTENLFLWAGGWRPTMAFHLLYSKSGLQFEPRLLELIVGNPTRDLAD  141

Query  578  MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELAR-LGGGDTV-ADVAVKN  405
            +S +Q+++++ L       E+++  E  + Q ++AD RMVEL   L   + V AD   + 
Sbjct  142  LSPDQLERIDGLHRLTVRLEKEISEEEAQVQESVADARMVELTHALAESEEVEADAMEQE  201

Query  404  M---LGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            M      + +V++ AD +RL+TLKGL++++ P  ++HFL +A+ L +++ + GK++
Sbjct  202  MKRKRDRMNEVLQRADQLRLETLKGLVEILKPVQAVHFLIAAAELHLKVHEFGKSK  257



>ref|XP_007214751.1| hypothetical protein PRUPE_ppa024940mg [Prunus persica]
 gb|EMJ15950.1| hypothetical protein PRUPE_ppa024940mg [Prunus persica]
Length=277

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/259 (31%), Positives = 130/259 (50%), Gaps = 56/259 (22%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKDHE---------------------FLVNKLT  738
            ESF +FFE W+++  +  Q L+IA+EN +                         LV ++ 
Sbjct  10   ESFHNFFECWLSEQNQHLQDLIIASENNQTTRNNLYNGNTTTTAAANTNTSLRTLVERVV  69

Query  737  THYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAF--------------  600
             HY+ YY AK    ++DVL   +P W TSLE A+LW+ GW+PS AF              
Sbjct  70   KHYEQYYEAKSRWVKQDVLRMLSPSWTTSLEDAFLWIGGWRPSMAFHLFYSKSGLQLEAR  129

Query  599  --RLVAGEG------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL  444
               L+ G G      +S+ Q+ +V+ L+ +   EE  +  +M +QQ ++AD  MVELA +
Sbjct  130  LTELIEGLGTGDLADISQHQLMQVDHLQRRTVKEERDITEKMAKQQESVADTSMVELAHM  189

Query  443  --------GGGDTVA-----DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIH  303
                    GG +  A     +  V +    LE++++ AD +RLKTLK +  ++ P  ++H
Sbjct  190  TTELMSTNGGHEHEAEEDRVECVVASKEQCLEEILQRADSLRLKTLKAITHILTPIQAVH  249

Query  302  FLASASMLQIQMRKCGKTQ  246
            FL +A+ L +++   GK +
Sbjct  250  FLIAAAELHLRLHDWGKKE  268



>ref|XP_008793320.1| PREDICTED: transcription factor HBP-1b(c38)-like [Phoenix dactylifera]
Length=274

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 127/241 (53%), Gaps = 41/241 (17%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKDHE------------FLVNKLTTHYKNYYTA  711
            E F + FE W+A+ +   Q L  AA   +                LV ++  H + YY A
Sbjct  21   EQFAELFECWLAERKLHLQALRAAASAPRPETPDEEAEEERRLTLLVRRVLGHCEYYYRA  80

Query  710  KWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------------  579
            K A+A+ DV   F+P W +S E+ +LWV GW+PS AF L+  +                 
Sbjct  81   KAASAKRDVTPMFSPTWTSSSENLFLWVGGWRPSVAFHLIYSKSGIQLESQLAEVIRGAS  140

Query  578  ------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMV-------ELARLGG  438
                  +S+ Q+K+++ L+ +    E+++  E  R Q  +AD++MV       E+ R G 
Sbjct  141  TRDLADLSQGQLKRIDELQRRTIRIEKEISEEEARTQEGVADKQMVLLSHVLREMGRDGK  200

Query  437  GDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKC  258
               + + A+++   G+E+V++ AD +R +TLKG+++++ P  +IHFL +A+ L++++R+ 
Sbjct  201  AAEMMEPAMQDKRAGMERVLERADALRQETLKGVVEILRPMQTIHFLITAAELRLRVREY  260

Query  257  G  255
            G
Sbjct  261  G  261



>ref|XP_002272259.1| PREDICTED: transcription factor TGA3-like [Vitis vinifera]
Length=237

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 108/207 (52%), Gaps = 11/207 (5%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAENEKDHEF----LVNKLTTHYKNYYTAKWAAAREDVL  681
            F  FF  W+ + EE  QLLL A E + D E     L+ +   HY  YY AK    REDVL
Sbjct  15   FERFFRGWLVRQEELRQLLLQATERDCDEEAGLQELIGRAVAHYAEYYKAKQRVVREDVL  74

Query  680  AFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeekve  507
                P WLT  E + LW+ G+KP  AFRLV      ++EEQ +++E LR +   +E K+ 
Sbjct  75   ILLGPPWLTPFERSLLWIGGFKPGFAFRLVTNYVTNLTEEQKQRMEQLRAETAEDERKLT  134

Query  506  remerqqVAMADRRMVELA-----RLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLK  342
             E+ R +       +VE+A     R+ G     D  ++ M    E +++ AD +R KT  
Sbjct  135  AELSRVRTRPTAISLVEMATMARERVNGERDTVDERIEMMKLAAEILVECADYLRCKTAL  194

Query  341  GLLDVMGPTHSIHFLASASMLQIQMRK  261
             ++ ++ P+ ++ FL + + LQ ++R 
Sbjct  195  KIMGILNPSQNVKFLLAVTQLQRRVRN  221



>ref|XP_010025725.1| PREDICTED: transcription factor TGA2-like [Eucalyptus grandis]
 gb|KCW62438.1| hypothetical protein EUGRSUZ_H05080 [Eucalyptus grandis]
Length=285

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/245 (30%), Positives = 129/245 (53%), Gaps = 44/245 (18%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKDHEF-----LVNKLTTHYKNYYTAKWAAARE  690
            ESF  FFE W+ +  +    L+ A+   +D +      L++++  HY+ YY AK  +A++
Sbjct  22   ESFHKFFECWLVEQNQHLHDLISASSPARDGDDQALRPLIDRVMLHYEQYYKAKSRSAKQ  81

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKA-----  525
            +VLA F+P W +S E A+LW+ GW+PS AF L+  +   + + +  E++RG   +     
Sbjct  82   NVLAMFSPTWRSSFEDAFLWIGGWRPSMAFHLLYSKSGLQLEAQLAELIRGLATSDLADL  141

Query  524  -----------------eeekveremerqqVAMADRRMVELA-------RLGGGDTVADV  417
                             +E+ +  +  + Q  +AD  MVEL+       R GGGD   + 
Sbjct  142  SPSQLALIDDRQRTTIHQEKAITEKFAKHQETVADASMVELSHTITEMMRAGGGDAAVEN  201

Query  416  ------AVKNMLG----GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQM  267
                   V++ L     GLE++++MAD +RL TLK +L+++    ++HFL +A+ L +++
Sbjct  202  EAAMEEEVESALAAKEEGLEEMLQMADDLRLSTLKEILNILTSMQAVHFLIAAAELHLRI  261

Query  266  RKCGK  252
             + GK
Sbjct  262  HEWGK  266



>gb|KHN28618.1| hypothetical protein glysoja_040486 [Glycine soja]
Length=163

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 106/150 (71%), Gaps = 19/150 (13%)
 Frame = -3

Query  629  VTGWKPSTAFRLV------AGEG----MSEEQMKKVEVLRGKIKAeeekveremerqqVA  480
            +TGWKPS   +L+      A  G    M+EEQ +K+E LR + + EEEKVEREMERQQVA
Sbjct  1    MTGWKPSMVLKLLETLKKQAASGGDFVMTEEQARKIEELRKRTRMEEEKVEREMERQQVA  60

Query  479  MADRRMVELARL---------GGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDV  327
            MADR+MVEL +L         GGGD VA+VA+K +L GLE+VMK +DCVRLKTLKG+LDV
Sbjct  61   MADRKMVELVKLTTRARNGGGGGGDAVAEVALKGVLAGLERVMKASDCVRLKTLKGVLDV  120

Query  326  MGPTHSIHFLASASMLQIQMRKCGKTQHNL  237
            + P   + FLA+ + +Q+++R+ GK + ++
Sbjct  121  LSPMQCVDFLAANTAMQLRLRQWGKKKRDM  150



>ref|XP_007159878.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
 gb|ESW31872.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
Length=278

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 124/240 (52%), Gaps = 43/240 (18%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAF  675
            ESF  FFE W+++  +  + LL+  E   + + + +K+  HY++YY  K   A++DVLA 
Sbjct  22   ESFHHFFEGWISEQNQHLKDLLVVGE---ELQSVKDKVVEHYESYYKTKSRCAKQDVLAM  78

Query  674  FAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------------------MSEEQM  561
             +P W +SLE A+LW+ GW+PS AF L+  +                       +S  Q+
Sbjct  79   LSPTWTSSLEDAFLWIGGWRPSMAFHLLYSKSGLQFEARLQELVQGLRTHDLGDLSASQI  138

Query  560  KKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGG-----------------D  432
             +++ ++ ++  EE ++   M   Q  +AD  MVEL+ +                    D
Sbjct  139  SQLDEMQKRVILEERQITDLMAGHQETVADASMVELSHVASEMIRANERGEVEESKEFED  198

Query  431  TVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
             V    V+    GLEK+++ AD +RL TLK +++V+ P  +IHFL +A+ L +++ + GK
Sbjct  199  KVESTLVQKE-EGLEKILQKADELRLGTLKAIVNVLTPKQAIHFLIAAAELHLRLHEWGK  257



>emb|CDM81542.1| unnamed protein product [Triticum aestivum]
 emb|CDM84782.1| unnamed protein product [Triticum aestivum]
Length=260

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/251 (30%), Positives = 130/251 (52%), Gaps = 35/251 (14%)
 Frame = -3

Query  911  SSPWKPSRQFSSSMRSKVEESFTDFFEKWMAQLEEC-----AQLLLIAAENEKDHEFLVN  747
            S P  P+   + +  S   ESF  FFE W+  LE+       +    A  ++ D   LV+
Sbjct  5    SRPQHPNGSLAPA--SDGGESFAKFFECWI--LEQSRDLAALRAAATARPDDSDLRRLVD  60

Query  746  KLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----  579
            ++  HY++YY AK AAA  DVL  FAP W+++ ES YLW  GW+P++A +L+  +     
Sbjct  61   RVLGHYEHYYRAKSAAASADVLPMFAPSWISATESLYLWCGGWRPTSAIQLLHSKSGLQL  120

Query  578  --------------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMV  459
                                +S EQ++  + L+ +    E  +E      Q ++A  +MV
Sbjct  121  EAQLPAFLDGGSLGDGDLGGLSAEQLQAADQLQRRTVRRERAIEEVAAGAQESLATTKMV  180

Query  458  ELARLGGGDTVA--DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASAS  285
            ELA  GG D     ++ +      +++V++MAD +RL+TL+G++ ++ P  ++HFL +A+
Sbjct  181  ELAGKGGMDAAEGMELEMDAKAEAMKRVLEMADALRLETLRGVVGLLRPAQAVHFLVAAA  240

Query  284  MLQIQMRKCGK  252
             L + + + G+
Sbjct  241  ELHLAVHEFGR  251



>ref|XP_002984747.1| hypothetical protein SELMODRAFT_181239 [Selaginella moellendorffii]
 gb|EFJ13997.1| hypothetical protein SELMODRAFT_181239 [Selaginella moellendorffii]
Length=245

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 122/235 (52%), Gaps = 29/235 (12%)
 Frame = -3

Query  854  ESFTDFFEKW----MAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            E +TDF++ W    + QLEE  +  L +  +E + + LV+K   HY  YY AK  AA+++
Sbjct  10   ERYTDFYDDWSNTQLQQLEEL-ERALNSNMSESEIKALVDKAKMHYDYYYGAKDNAAKQN  68

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRL---VAGE-------------------GMS  573
            VL    P W T LE+A++W  GW+P+  F+L   +AG+                    +S
Sbjct  69   VLQVMTPAWKTPLETAFMWTGGWRPTMVFQLAYALAGQLVEAELSDLLSGVDSPSLASLS  128

Query  572  EEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL--GGGDTVADVAVKNML  399
              Q++K+  ++ K++ +E+ +   M   Q  MAD+  V + +      D   + AV + L
Sbjct  129  ARQLEKINEMQVKVQKQEDDISHRMAVLQQGMADQPFVGITQTLAASEDDKMEAAVDSKL  188

Query  398  GGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
              LE +++ AD +R +TL  +LD + P  +  +L +A+ LQ+  RK G  ++  S
Sbjct  189  KDLESLLEEADNLRRETLHNMLDTLTPVQAAQYLVAAAQLQVAFRKIGAVKNGSS  243



>ref|XP_008227573.1| PREDICTED: transcription factor TGA2-like [Prunus mume]
Length=272

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 129/253 (51%), Gaps = 50/253 (20%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENE---------------KDHEFLVNKLTTHYKNY  720
            ESF +FFE W+A+  +  Q L+IA++N                     LV ++  HY+ Y
Sbjct  11   ESFHNFFECWLAEQNQHLQDLIIASKNNLYNGNPTTTAAANTNTSLRTLVERVVKHYEQY  70

Query  719  YTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFR----------------LVA  588
            Y AK    ++DVL   +P W TSLE A+LW+ GW+PS  F                 L+ 
Sbjct  71   YEAKSRWVKQDVLRMLSPSWTTSLEDAFLWIGGWRPSMTFHLFYSKSGLQLEARLTELIE  130

Query  587  GEG------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL------  444
            G G      +S+ Q+ +V+ L+ +   EE  +  +M +QQ ++AD   VEL+ +      
Sbjct  131  GLGTGDLADISQHQLMQVDHLQRRTVKEERDITEKMAKQQESVADTSTVELSHVITELMS  190

Query  443  --GGGD-TVADVAVKNMLG----GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASAS  285
              GG +  V    V+++L     GLE++++ AD +RLKTLK +  ++ P  ++HF  +A+
Sbjct  191  ANGGHEHEVEADRVESVLASKERGLEEILQRADSLRLKTLKAITHILTPIQAVHFFIAAA  250

Query  284  MLQIQMRKCGKTQ  246
             L +++   GK +
Sbjct  251  ELHLRLHDWGKKE  263



>ref|XP_010104546.1| hypothetical protein L484_025521 [Morus notabilis]
 gb|EXC01147.1| hypothetical protein L484_025521 [Morus notabilis]
Length=235

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 126/219 (58%), Gaps = 14/219 (6%)
 Frame = -3

Query  854  ESFTDFFEKWMA-QLEECAQLLLIAAEN-EKDHE-----FLVNKLTTHYKNYYTAKWAAA  696
            + F  F+E+W+A Q     QLLL+AAE  EKD++      L+ +  +HY+ Y+  +   A
Sbjct  11   DRFEAFYEEWLAGQQAILNQLLLVAAETAEKDNDCERRRSLIEQSLSHYQRYFEERNDIA  70

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAe  522
             +DV   F+  WL+SLE AYLW+ G++P+   RLV      +S EQ ++++ L+ +    
Sbjct  71   SDDVFVVFSSPWLSSLERAYLWIAGYRPTLILRLVESGVADLSPEQARRMDRLKAEAVRL  130

Query  521  eekveremerqqVAMADRRMVEL-ARLG----GGDTVADVAVKNMLGGLEKVMKMADCVR  357
            E++V   M   Q ++A R +V L +R+G    G  +  DVA+  +   +  V++ AD +R
Sbjct  131  EQEVSEAMAAVQESVAARPLVALVSRMGRAVDGEVSAIDVAMDRLRAEMVGVLESADALR  190

Query  356  LKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
              T++  ++V+ P  ++ FL +A+  Q+++R+ G+ + +
Sbjct  191  GSTMRRAIEVLSPAQAVKFLVAAAEFQLRIRRWGQQRDS  229



>ref|XP_002985809.1| hypothetical protein SELMODRAFT_123200 [Selaginella moellendorffii]
 gb|EFJ12986.1| hypothetical protein SELMODRAFT_123200 [Selaginella moellendorffii]
Length=245

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/235 (30%), Positives = 123/235 (52%), Gaps = 29/235 (12%)
 Frame = -3

Query  854  ESFTDFFEKW----MAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            ES+TDF++ W    + QLEE  + L  +  +E + + LV+K   HY  YY AK  AA+++
Sbjct  10   ESYTDFYDDWSNTQLQQLEELERAL-NSNMSESEIKALVDKAKMHYDYYYGAKDNAAKQN  68

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRL---VAGE-------------------GMS  573
            VL    P W T LE+A++W  GW+P+  F+L   +AG+                    +S
Sbjct  69   VLQVMTPAWKTPLETAFMWTGGWRPTMVFQLAYALAGQLVEAELSELLSGVDSPSLASLS  128

Query  572  EEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL--GGGDTVADVAVKNML  399
              Q++++  ++ K++ +E+ +   M   Q  MAD+  V + +      D   + A+ + L
Sbjct  129  ARQLERINEMQVKVQKQEDDISHRMAVLQQGMADQPFVGITQTLAASEDDKMEAALDSKL  188

Query  398  GGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
              LE +++ AD +R +TL  +LD + P  +  +L +A+ LQ+  RK G  ++  S
Sbjct  189  KDLESLLEEADNLRRETLHNMLDTLTPVQAAQYLVAAAQLQVAFRKIGAVKNGKS  243



>ref|XP_008807787.1| PREDICTED: transcription factor HBP-1b(c38)-like [Phoenix dactylifera]
Length=216

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 117/212 (55%), Gaps = 16/212 (8%)
 Frame = -3

Query  839  FFEKWMAQLEECAQLLLIAAENEKD-HEFLVNKLTTHYKNYYTAKWAAAREDVLAFFAPV  663
            FF+ W+A LEE    LL A  +  D    LV +   H+++YY  K   A  DVL  F+P 
Sbjct  4    FFDAWIAGLEELQNELLSAPRDRPDVLRPLVARALAHHQDYYHQKARLAARDVLRVFSPR  63

Query  662  WLTSLESAYLWVTGWKPSTAFRLVAG--------EGMSEEQMKKVEVLRGKIKAeeekve  507
            WLT  E ++LW+ GWKPS AFRL+             S EQ + V VL+ +  + E  + 
Sbjct  64   WLTPFERSFLWIAGWKPSIAFRLLRSLDDDDDGDASHSPEQRRAVAVLQRETASAERALS  123

Query  506  remerqqVAMADRRMVELAR-LGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLD  330
             +M R Q AMA  +++  AR +  G+  A+ A + ++  LE ++  AD +R +T+  L+D
Sbjct  124  EDMARAQEAMALPQVLAAARGVRNGEARAE-AAEMVVRSLELLLASADALRARTVTRLVD  182

Query  329  VMGPTHSIHFLASASMLQIQ-----MRKCGKT  249
            ++ P  ++ FL +A+ L+++     MR+ G++
Sbjct  183  ILTPAQTVDFLLAAAQLRLRVHRWGMRRDGRS  214



>gb|KDP41541.1| hypothetical protein JCGZ_15948 [Jatropha curcas]
Length=232

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 126/231 (55%), Gaps = 15/231 (6%)
 Frame = -3

Query  866  SKVEESFTDFFEKWMAQLEECAQLLLIA--AENEKDHEF---LVNKLTTHYKNYYTAKWA  702
            ++  E+F  FF  W+ +L+  ++ L IA  AEN +  E+   L++++ +HYK YY  K  
Sbjct  2    ARPSENFETFFNGWLDRLQALSEQLRIAIEAENAQRTEYRKYLIDQVLSHYKLYYQVKVN  61

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLRGKIK  528
            AARED   F  P WL+S E   LW+  + PS  F+L+  +   ++ EQ+++++ ++  I+
Sbjct  62   AAREDPFLFLNPPWLSSFERTLLWLGDFNPSVIFKLIDRSVTDLTPEQIERIKEVKLAIR  121

Query  527  AeeekveremerqqVAMADRRMVELAR--------LGGGDTVADVAVKNMLGGLEKVMKM  372
             EE  +   M   Q ++A   ++ LAR        + G  +  +VA   +   +  V++ 
Sbjct  122  REERVLSDTMASIQESLASPPILNLARRFGRSGRLIDGEVSEIEVAEDMLKTQVHNVLES  181

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLSLITNS  219
            AD +R  T+  +L+++ P  S+ F+ +A+  Q++MR+ G+    L + +N 
Sbjct  182  ADALRGLTVAKVLEILSPVQSVTFMIAAADFQLRMRRLGQQTDALRVASND  232



>dbj|BAJ05339.1| hypothetical protein [Triticum aestivum]
Length=260

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 129/251 (51%), Gaps = 35/251 (14%)
 Frame = -3

Query  911  SSPWKPSRQFSSSMRSKVEESFTDFFEKWMAQLEEC-----AQLLLIAAENEKDHEFLVN  747
            S P  P+   + +  S   ESF  FFE W+  LE+       +    A  ++ D   LV+
Sbjct  5    SRPQHPNGSLAPA--SDGGESFAKFFECWI--LEQSRDLAALRAAATARPDDADLRRLVD  60

Query  746  KLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----  579
            ++  HY++YY AK AAA  DVL  FAP W+++ ES YLW  GW+P+ A +L+  +     
Sbjct  61   RVLGHYEHYYRAKSAAASADVLPMFAPSWISATESLYLWCGGWRPTAAIQLLYSKSGVQL  120

Query  578  --------------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMV  459
                                +S EQ++  + L+ +    E ++E      Q ++A  +MV
Sbjct  121  EAKLPAFLDGGSLGDGDLGGLSAEQLQAADQLQRRTIRGEREIEEAAAGAQESLATTKMV  180

Query  458  ELARLGGGDTVADV--AVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASAS  285
            ELA  GG D    +   +      +++V++MAD +RL+TL+G++ ++ P  ++HFL +A+
Sbjct  181  ELAGKGGVDAAEGMEREMDAKAEAMKRVLEMADALRLETLRGVVGLLRPAQAVHFLVAAA  240

Query  284  MLQIQMRKCGK  252
             L + + K G+
Sbjct  241  ELHLAVHKFGR  251



>ref|XP_006830264.1| hypothetical protein AMTR_s00130p00113960 [Amborella trichopoda]
 gb|ERM97680.1| hypothetical protein AMTR_s00130p00113960 [Amborella trichopoda]
Length=255

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 130/241 (54%), Gaps = 27/241 (11%)
 Frame = -3

Query  875  SMRSKVEESFTDFFEKWMAQLEECAQLLLIAAE---NEKDHEFLVNKLTTHYKNYYTAKW  705
            S   K E+ F  FFE+W+A+ E     L+ A+    NEK    L+ ++  HY+ YY AK 
Sbjct  2    SRTRKEEDPFKRFFEEWIAEQERQLHELMAASHAHINEKTLRSLIERVMAHYEAYYDAKS  61

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG------------------  579
             AA+E+++  F+P W + LE+A+LW+ GW+P+  FRL+  +                   
Sbjct  62   KAAKENIVGMFSPTWTSKLENAFLWIAGWRPAMVFRLLYAKAGLQLDSDLADLLQGLSRR  121

Query  578  ----MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL-GGGDTVADVA  414
                +S  Q+  V  L+ K   EEE++ R+M + Q  +AD+ +V L ++    +   + A
Sbjct  122  NLADLSPSQLMAVNELQMKTIKEEEEISRKMAKLQEGVADQPLVGLVQMVNAEEDGVEAA  181

Query  413  VKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG-KTQHNL  237
            ++    GLE+V++ AD +RL+TLK ++ V+    ++  L +A+ L +++ + G K   NL
Sbjct  182  LEEQEEGLERVLECADRLRLETLKSVVGVLNLIQAVDLLVAAAQLHLKIHEWGMKRDGNL  241

Query  236  S  234
            +
Sbjct  242  N  242



>dbj|BAJ05340.1| hypothetical protein [Hordeum vulgare]
 dbj|BAJ90591.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99476.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=260

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 126/248 (51%), Gaps = 34/248 (14%)
 Frame = -3

Query  899  KPSRQFSSSMR-SKVEESFTDFFEKWMAQLEEC-----AQLLLIAAENEKDHEFLVNKLT  738
            +P     S  R S   ESF  FFE W+  LE+       +    A  ++ D   LV+++ 
Sbjct  6    RPQHHNGSLARASDGGESFAKFFECWI--LEQSRDLAALRAAATARPHDADLRRLVDRVL  63

Query  737  THYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG-------  579
             HY+NYY AK AAA  DVL  FAP W+++ ES YLW  GW+P+ A +L+  +        
Sbjct  64   GHYENYYRAKSAAASADVLPMFAPSWISATESLYLWCGGWRPTAAVQLLYSKSGVQLEAQ  123

Query  578  -----------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA  450
                             +S EQ++  + L  +    E ++E      Q ++A  RMVELA
Sbjct  124  LPAFLDGGSLGDGDLGGLSAEQLQAADQLHRRTIRREREIEEAAASAQESLATTRMVELA  183

Query  449  RLGGGDTVADV--AVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQ  276
              GG D    +   +      +++V++MAD +RL+TL+G++ ++ P  ++HFL +A+ L 
Sbjct  184  GKGGMDAAEGMEREMDAKAEAMKRVLEMADGLRLETLRGVVGLLRPAQAVHFLVAAAELH  243

Query  275  IQMRKCGK  252
            + + K G+
Sbjct  244  LAVHKFGQ  251



>ref|XP_003524316.1| PREDICTED: transcription factor TGA4-like [Glycine max]
Length=285

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 126/243 (52%), Gaps = 42/243 (17%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENE--KDHEF--LVNKLTTHYKNYYTAKWAAARED  687
            ESF  FFE W+++ ++  + LL A   +   D E   L +K+  HY+ YY AK   A++D
Sbjct  22   ESFHKFFECWISEQKQHLKDLLAAESTQLISDEELQALNDKVVEHYEYYYKAKSRCAKQD  81

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------------------MS  573
            VLA  +P W++SLE A+LW+ GW+PS AF L+  +                       +S
Sbjct  82   VLAMLSPTWMSSLEEAFLWIGGWRPSMAFHLIYSKSGLQFEARLDEVLQGLRTHDLGDLS  141

Query  572  EEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL--------GGGDTVADV  417
              Q+ +++ ++ +   EE ++   M R Q  +AD  MVEL+ +          G+     
Sbjct  142  ASQLAQLDEMQRRTILEEREITDLMARHQETVADASMVELSHVVSEMIRANQRGEVDQSK  201

Query  416  AVKNML--------GGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
             ++N +         GLEK++  AD +R  TLK ++DV+ P  +IHFL +A+ L +++ +
Sbjct  202  EIENKVESTLVLKEEGLEKILLKADELRFITLKDVVDVLTPKQAIHFLIAAAELHLRLHE  261

Query  260  CGK  252
             GK
Sbjct  262  WGK  264



>ref|XP_003630355.1| Transcription factor HBP-1b(c1) [Medicago truncatula]
 gb|AET04831.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=272

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 127/238 (53%), Gaps = 41/238 (17%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAE------NEKDHEFLVNKLTTHYKNYYTAKWAAAR  693
            ESF  FFE WM +  +    L+ A        N++ H  L++K+  HY+ YY  K + A+
Sbjct  13   ESFNKFFECWMVEQNKYLNELVAAKSAQPQLTNDRMHT-LIDKVVEHYECYYKTKSSFAK  71

Query  692  EDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL----------------VAGE------G  579
            +DVL+ F+P WL++LE A+LW+ GW+PS AF L                + G+       
Sbjct  72   KDVLSMFSPPWLSTLEEAFLWIGGWRPSMAFHLLYSKCSMQFQARLNDLIQGQKTCDLGD  131

Query  578  MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL------GGGDTVADV  417
            ++  Q+ + + L+ K   EE ++   +   Q  +AD  MVEL+ +      GG +   ++
Sbjct  132  LTASQLAEFDDLQKKTIREEREITDMLAEHQETVADAPMVELSHVVSEMIRGGENEKKEL  191

Query  416  ------AVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
                   ++  + GLEK++  AD +RL+ L+G+++++ P  +IHFL +A+ L +++ +
Sbjct  192  EERIESVLEPKVEGLEKILYRADDLRLRALQGIVNILTPKQAIHFLIAAAELHLRLHE  249



>ref|XP_010104255.1| hypothetical protein L484_016398 [Morus notabilis]
 gb|EXB99422.1| hypothetical protein L484_016398 [Morus notabilis]
Length=226

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 115/207 (56%), Gaps = 8/207 (4%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-EKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAF  675
            SF  F E W+ + E     LL   ++ + D   LV ++  HY+ YY  K   A  ++   
Sbjct  16   SFERFLEGWLVRQEHYLDELLSCRDSPDDDLRDLVYRILAHYQQYYDEKSKIAERNIFLV  75

Query  674  FAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeekvere  501
             +P W TSLE A+LW+ G+KP  AFRLV    + ++++Q + +  L  + K+EE  +  E
Sbjct  76   LSPTWFTSLEHAFLWIGGFKPGLAFRLVNDSIDDLTDDQRRSIGRLVQETKSEERALNDE  135

Query  500  merqqVAMADRRMVELAR-----LGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGL  336
            + + Q ++A   +++++R     + G    ADVA+  +   LE V+  AD +R+ T   +
Sbjct  136  LAKIQESVAAPPLLDISRRCTRQVDGEIAGADVAIATLRTALETVVTAADSLRMSTALKV  195

Query  335  LDVMGPTHSIHFLASASMLQIQMRKCG  255
            ++V+ P  ++ FLA+A+ LQ+++R  G
Sbjct  196  MEVLRPAQNVRFLATAAQLQLRLRTWG  222



>gb|EYU45430.1| hypothetical protein MIMGU_mgv1a012463mg [Erythranthe guttata]
Length=250

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 115/220 (52%), Gaps = 20/220 (9%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHE---FLVNKLTTHYKNYYTAKWAAAREDVL  681
            SF  FF+ W+ +     Q L+ AA           L+  +  HY++YY  K   A++D+L
Sbjct  20   SFHMFFDSWIVEQNHQLQELVSAASASASASEASVLIPLVVQHYEHYYKTKSMWAKKDIL  79

Query  680  AFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE---------GMSEEQMKKVEVLRGKIK  528
            + F P W +SLE AY+WV GW+P+  F L+  +          +S  QM++V+ L     
Sbjct  80   SMFRPSWRSSLEKAYMWVGGWRPTMTFHLLYSKCGLQFQDTGNLSHSQMERVDKLHKTTL  139

Query  527  AeeekveremerqqVAMADRRMVEL---ARLGGGDTV-----ADVAVKNMLGGLEKVMKM  372
             +E+ +  ++ + Q  MAD  MVEL   +R GG   V      D A+     GL  +++M
Sbjct  140  WKEKMITEKLAKLQETMADSSMVELTDHSRHGGDQVVHHQGLVDAALAPKEKGLVGILQM  199

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            AD +RL TLK L+ ++ P   ++FL +A+ L ++M   GK
Sbjct  200  ADELRLNTLKDLILILSPIQGVYFLIAAAELHLRMHDWGK  239



>gb|EYU20609.1| hypothetical protein MIMGU_mgv1a010868mg [Erythranthe guttata]
Length=299

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 129/253 (51%), Gaps = 52/253 (21%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKD-HEF---------------LVNKLTTHYKN  723
            ESF  FFE W+ + +     L+ A+++ +D H+                L+ ++  HY++
Sbjct  23   ESFHKFFECWIVEQDHHLHELVSASKDIEDRHQHHGGATAELNGRVLRPLLERVVQHYEH  82

Query  722  YYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG------------  579
            YY AK   A+ DVL+ F P W +SLE A+LW+ GW+PS AF L+  +             
Sbjct  83   YYRAKSRWAKNDVLSMFNPSWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLQLEARAIDDL  142

Query  578  -----------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA------  450
                       +S  Q+ +V+ L+     EE+++  ++ + Q  +AD  MVEL+      
Sbjct  143  ILGLTNGDLSDLSTGQLGRVDALQKVTLREEKEITEKLAKLQETVADSSMVELSHAVSEL  202

Query  449  -RLGGGDTVA------DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLAS  291
             +   GD VA      + A+     GL  V++ AD +R+KTLKG++D++ PT  +HFL +
Sbjct  203  IQEEAGDRVAEQEGRVEAALAPKEEGLVGVLEKADELRMKTLKGVIDILSPTQGVHFLIA  262

Query  290  ASMLQIQMRKCGK  252
            A+ L +++   GK
Sbjct  263  AAELHLRVHDWGK  275



>ref|XP_004503896.1| PREDICTED: transcription factor HBP-1b(c38)-like [Cicer arietinum]
Length=277

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 123/244 (50%), Gaps = 43/244 (18%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKD-----HEFLVNKLTTHYKNYYTAKWAAARE  690
            ESF +FFE W+ +  +    L+ A  ++          L++K+  HY+ YY  K   A++
Sbjct  17   ESFHNFFECWLVEQNQHLNELVAAKSSQPQLAIDRMHTLIDKVVEHYQFYYKEKSRYAKK  76

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE----------------------GM  576
            DVL+ F+P W++SLE A+LW+ GW+PS AF LV  +                       +
Sbjct  77   DVLSMFSPSWISSLEEAFLWIGGWRPSMAFHLVYSKCSMQFQARLNDLIQGLKTCDLGDL  136

Query  575  SEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELAR-----LGGGDTVADVAV  411
            S  Q+ + + L+ +   EE ++   M   Q  +AD  MVEL+      +   + + +   
Sbjct  137  SSSQLAEFDDLQKRTIKEEREITGLMAEHQETVADAPMVELSHVVSEIIRDDNQIGEENE  196

Query  410  KNM-----------LGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMR  264
            K +           + GLEK++  AD +RL+TL+G++ ++ P   IHFL +A+ L +++ 
Sbjct  197  KKLEERIESTLEPKVEGLEKILHRADDLRLRTLQGIVSILTPQQGIHFLIAAAELHLRLH  256

Query  263  KCGK  252
            + GK
Sbjct  257  EWGK  260



>gb|KHN17404.1| Transcription factor TGA4 [Glycine soja]
Length=402

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 126/243 (52%), Gaps = 42/243 (17%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENE--KDHEF--LVNKLTTHYKNYYTAKWAAARED  687
            ESF  FFE W+++ ++  + LL A   +   D E   L +K+  HY+ YY AK   A++D
Sbjct  22   ESFHKFFECWISEQKQHLKDLLAAESTQLISDEELQALNDKVVEHYEYYYKAKSRCAKQD  81

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------------------MS  573
            VLA  +P W++SLE A+LW+ GW+PS AF L+  +                       +S
Sbjct  82   VLAMLSPTWMSSLEEAFLWIGGWRPSMAFHLIYSKSGLQFEARLDEVLQGLRTHDLGDLS  141

Query  572  EEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGG--------GDTVADV  417
              Q+ +++ ++ +   EE ++   M R Q  +AD  MVEL+ +          G+     
Sbjct  142  ASQLAQLDEMQRRTILEEREITDLMARHQETVADASMVELSHVVSEMIRANQRGEVDQSK  201

Query  416  AVKNML--------GGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
             ++N +         GLEK++  AD +R  TLK ++DV+ P  +IHFL +A+ L +++ +
Sbjct  202  EIENKVESTLVLKEEGLEKILLKADELRFITLKDVVDVLTPKQAIHFLIAAAELHLRLHE  261

Query  260  CGK  252
             GK
Sbjct  262  WGK  264



>gb|EYU23355.1| hypothetical protein MIMGU_mgv1a023684mg, partial [Erythranthe 
guttata]
Length=261

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/234 (30%), Positives = 118/234 (50%), Gaps = 32/234 (14%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFF  672
            SF  FF+ WM +     Q L+ A +       +V ++  HY++YY  K   A++D+L+ F
Sbjct  7    SFHMFFDSWMVEQNYQLQELVSATKEWGGRSDVVEQVVHHYEHYYKTKSMWAKKDILSMF  66

Query  671  APVWLTSLESAYLWVTGWKPSTAFRLVAGE-------------------------GMSEE  567
            +P W +SLE A++WV GW+P+TAF L+  +                          +S  
Sbjct  67   SPTWTSSLEKAFMWVGGWRPTTAFHLLYSKCGLQLEAALEDYHHLPSGLNTGDLGDLSHS  126

Query  566  QMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA-------RLGGGDTVADVAVK  408
            QM +V+ L      EE+ +  ++ ++Q  +AD  MV L               V D A+ 
Sbjct  127  QMVRVDELHKSTLREEKMITEKLAKKQETIADSSMVRLTTELMVHMEEHDQQVVVDAALA  186

Query  407  NMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            +   GL +V++MAD +RLKTLK L+ ++ P    +FL +A+ L +++ + GK +
Sbjct  187  SKENGLVRVLQMADDLRLKTLKELILILSPIQGAYFLIAAAELHLKIHEWGKNR  240



>ref|XP_002510006.1| Transcription factor HBP-1b, putative [Ricinus communis]
 gb|EEF52193.1| Transcription factor HBP-1b, putative [Ricinus communis]
Length=199

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 104/189 (55%), Gaps = 7/189 (4%)
 Frame = -3

Query  800  QLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTG  621
            QL L+  EN + H+ L+ +L +HYK YY  K  AAREDV  F  P WL+S E   LW+ G
Sbjct  11   QLHLVMLENTEQHKHLIAQLLSHYKCYYEEKSNAAREDVFLFMNPPWLSSFERTLLWLGG  70

Query  620  WKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELAR  447
            +KP   FRL+      ++ EQ +++E +R + + EE  +   M   Q ++A   ++ L+R
Sbjct  71   FKPLVMFRLINNSVTDLTPEQSERIEQVRFETRIEERALTETMASVQESLASPLILNLSR  130

Query  446  -----LGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASM  282
                 + G  +  + A++ +   +  + + AD +R  T   LL+V+ P  ++ FLA+A  
Sbjct  131  RFRQMIDGEVSEMEAALEGLKTAMFALSENADALRRSTAVNLLEVLSPAQAVRFLATALK  190

Query  281  LQIQMRKCG  255
             Q+Q+ + G
Sbjct  191  FQLQVMRQG  199



>ref|XP_009757325.1| PREDICTED: transcription factor TGA5-like [Nicotiana sylvestris]
Length=275

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/267 (29%), Positives = 132/267 (49%), Gaps = 51/267 (19%)
 Frame = -3

Query  869  RSKVEE---SFTDFFEKWMA-QLEECAQLLLIAAENEKDHEF---------LVNKLTTHY  729
            R+ VEE   +F  FFE W+A Q +E  +L+  + +  KD+           L+ ++  HY
Sbjct  8    RNGVEENDNTFHKFFETWLAEQNQELKELVSASRDVSKDNNIVVEERVLVPLIERVIQHY  67

Query  728  KNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------  579
            + YY  K     EDV     P W ++LE A+LW+ GW+PS AF L+  +           
Sbjct  68   EGYYGEKSKYTEEDVFGMLNPTWRSNLEGAFLWIGGWRPSMAFHLLYSKSGLQFEPRLPQ  127

Query  578  ------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGG  435
                        +S +Q+ KV+ L+ K   EE+    ++ + Q  +AD  MVEL+ +   
Sbjct  128  LIRGITTGDLGDLSPDQISKVDELQKKTIREEKDSSEKLAKVQETVADASMVELSHVVTQ  187

Query  434  --------------DTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFL  297
                          +  A++A K    GL  +++ AD +RL TLK +L ++ PT +IHFL
Sbjct  188  LMMISGGGGGILEEEVEANLATKE--EGLVIILQKADNLRLNTLKEILAILTPTQAIHFL  245

Query  296  ASASMLQIQMRKCGKTQHNLSLITNSS  216
             +A+ L +++ + GK +   +L ++++
Sbjct  246  IAAAELHLRLHEWGKKKDAATLYSDAN  272



>ref|XP_010674364.1| PREDICTED: transcription factor TGA6-like [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 124/251 (49%), Gaps = 51/251 (20%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAA-----ENEKDHEF------LVNKLTTHYKNYYTAK  708
            ESF  FFE W+ + E   + L  AA       + D E+      LVN++  HY+NYY  K
Sbjct  24   ESFAQFFETWLLEQEHDLEELKAAATCYTESTQSDTEWNQQLTSLVNRVMCHYENYYRVK  83

Query  707  WAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV------------------AGE  582
              +A  DVL   +P W ++LE A+LWV GW+PSTAF L+                   G 
Sbjct  84   SESADHDVLTMLSPSWRSNLEEAFLWVGGWRPSTAFHLLYSVTGLQLEAGFHELLRGLGS  143

Query  581  G----MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGG--------  438
            G    +S +Q+ +V+ L+ +   EE ++       Q  +AD  MVEL+ +          
Sbjct  144  GNLADLSPDQLVRVDELQRQTVWEERELTENFAAIQETVADSTMVELSHVATELIRDPNS  203

Query  437  ------GDTVADVAVKNMLGG----LEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASA  288
                  G    +  V++ +G     L++++  AD +RL+TLK +LD++ P  ++ FL +A
Sbjct  204  VTTGPVGPESVNERVESTIGTKENKLKEILGRADDLRLRTLKNVLDILTPIQAVDFLIAA  263

Query  287  SMLQIQMRKCG  255
            + L +++ + G
Sbjct  264  AELHLRVHQWG  274



>gb|EPS72055.1| hypothetical protein M569_02704, partial [Genlisea aurea]
Length=158

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 95/158 (60%), Gaps = 16/158 (10%)
 Frame = -3

Query  677  FFAPVWLTSLESAYLWVTGWKPSTAFRLVAG---EGMSEEQMKKVEVLRGKIKAeeekve  507
            F++  WLT LE  YLW TG++P+ +F ++      G++EEQ +K+E LR + + +E KV+
Sbjct  1    FYSAPWLTPLEQCYLWHTGYRPTISFNVLESLPPAGITEEQRRKIEALRERTRMDEAKVD  60

Query  506  remerqqVAMADRRMVELA-------RLGGGDTVADVA------VKNMLGGLEKVMKMAD  366
             EMER QV +A RR+V++        R      +A+ A      V  M+ G+EKVM+ AD
Sbjct  61   TEMERHQVEVASRRVVDVVATERKALRSQDPTAMAEAAAMVRATVNGMVAGVEKVMRSAD  120

Query  365  CVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            C RL+ LKG+LDV+ P   + FL S S   IQ+R  GK
Sbjct  121  CARLRCLKGILDVLNPDQRLRFLTSMSAALIQLRASGK  158



>ref|XP_009623095.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana tomentosiformis]
Length=247

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/227 (31%), Positives = 121/227 (53%), Gaps = 19/227 (8%)
 Frame = -3

Query  878  SSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAE--NEKDHE----FLVNKLTTHYKNYY  717
            S  RS  + SF  F E W+ + E+  + LL+A +  +E+  E     L++++  HY+ YY
Sbjct  5    SYRRSYDDNSFGVFLEGWLIRQEQYLEELLVAQDTFDEETEEGVIRDLISRVLAHYQEYY  64

Query  716  TAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVL  543
              K   +  +V   F+P W T LE  +LW+TG+KP  AF LV      +S  Q++++  L
Sbjct  65   EEKSRMSHRNVFLVFSPTWFTPLERTFLWITGFKPGLAFTLVTDSVNDLSGNQVQRINRL  124

Query  542  RGKIKAeeekveremerqqVAMADRRMVELARLGGGD-----------TVADVAVKNMLG  396
            R + K EE+ +  E+ + Q ++A   ++ELAR  G             T  D  ++ +  
Sbjct  125  RYETKIEEKSLTDELAKIQESVAAPPLMELARRIGMQLLYTDGINIEITDGDENIETLKS  184

Query  395  GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +E V+  AD +R +T + ++ V+ P  S+ FL +A+ LQ+++R  G
Sbjct  185  AMENVVTDADRLRTRTAERVVGVLSPLQSLRFLTAAAQLQLRLRMMG  231



>ref|XP_010920869.1| PREDICTED: transcription factor TGA3-like [Elaeis guineensis]
Length=260

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 135/260 (52%), Gaps = 42/260 (16%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQLEECAQLLLIAA----------ENEKDH--EFLVNKLTTHY  729
            M  +  + F   +E W+A+     Q L  AA          E E+D   +  V ++  H 
Sbjct  1    MPDRPSDQFDRLYECWLAEKHSDLQALRAAASAPRPKTPEEEAEEDRRLKLPVERVLGHC  60

Query  728  KNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-----------AGE  582
            +NYY AK A A  DV   F+P W +S E+ +LWV GW+PS AF L+            GE
Sbjct  61   ENYYRAKAACATRDVTPMFSPTWTSSTENLFLWVGGWRPSVAFHLLYSKSGLQLEAQLGE  120

Query  581  -----------GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL---  444
                        +S EQ++++  L+ +   +E+++  E  R Q  +AD +MVEL+ +   
Sbjct  121  VIRGVPTRDLADLSLEQLQRINELQCRTIRKEKEISEEEARTQEGVADTQMVELSHVLSE  180

Query  443  -GGGDTVADV---AVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQ  276
             GG    A++   A++    G+ +V++ AD +RL+TLKG+++++ P  ++HFL +A+ LQ
Sbjct  181  TGGTAEAAEMMETAMQEKREGMGRVLEKADELRLETLKGVVEILRPMQAVHFLIAAAELQ  240

Query  275  IQMRKCGKTQHNLSLITNSS  216
            + + + G T+ +    T SS
Sbjct  241  LWLHEYG-TKKDAERGTASS  259



>ref|XP_009802153.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana sylvestris]
Length=247

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 119/224 (53%), Gaps = 19/224 (8%)
 Frame = -3

Query  869  RSKVEESFTDFFEKWMAQLEECAQLLLIAAE--NEKDHE----FLVNKLTTHYKNYYTAK  708
            RS  +  F  F E W+ + E+    LL+A +  +E+  E     L++++  HY+ YY  K
Sbjct  8    RSYDDNLFGGFLEGWLIRQEQFLDELLVAQDTFDEETQEGAIRDLISRVLAHYQEYYEEK  67

Query  707  WAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGK  534
               +  +V   F+P W T LE  +LW+TG+KP  AF LV      +SE Q++++  LR +
Sbjct  68   SRMSHRNVFHVFSPTWFTPLERTFLWITGFKPGLAFTLVTDSVNDLSENQVQRINRLRYE  127

Query  533  IKAeeekveremerqqVAMADRRMVELARLGGGD-----------TVADVAVKNMLGGLE  387
             K EE+ +  E+ + Q ++A   ++E+AR  G             T  D  ++ +   +E
Sbjct  128  TKVEEKSLTDELAKIQESVAAPPLIEMARRVGMQLLHTDGINIEITDGDENIETLKSAME  187

Query  386  KVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             V+  AD +R +T + ++ ++ P  S+ FL +A+ LQ+++R  G
Sbjct  188  NVVTDADRLRTRTAERVVGLLSPLQSLRFLTAAAQLQLRLRMMG  231



>ref|XP_002532112.1| Transcription factor HBP-1b, putative [Ricinus communis]
 gb|EEF30274.1| Transcription factor HBP-1b, putative [Ricinus communis]
Length=232

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 115/212 (54%), Gaps = 12/212 (6%)
 Frame = -3

Query  860  VEESFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAA  696
            + +SF  FFE W+ + E     LL   ++     E+D + LV+++ +HY+ YY  K    
Sbjct  18   IAQSFVSFFEGWLVRQEHYLDELLSVQQHCHESTEEDLKELVSRILSHYEQYYEEKSRLV  77

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAe  522
            + +V   F+P W +SLE ++ W+ G+KPS AFR+++     +SE+Q  +V  L  + K  
Sbjct  78   QGNVFLVFSPPWFSSLEQSFFWIAGFKPSLAFRVLSNSVNDLSEDQNSEVGRLEKETKVN  137

Query  521  eekveremerqqVAMADRRMVELARLGG-----GDTVADVAVKNMLGGLEKVMKMADCVR  357
            E  +  E  + Q ++A   +++ ARL G     G     +AV ++   LE V+  AD +R
Sbjct  138  ERLLADEFAKIQESLASPPLLQEARLQGRAGEDGRVSDRLAVGSLRSRLEAVVAKADLLR  197

Query  356  LKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
              T+  +++++     ++FL + + LQ+++R 
Sbjct  198  TNTVVKVMEILNSVQKVNFLTAVTRLQLRIRN  229



>ref|XP_009799260.1| PREDICTED: transcription factor TGA6-like [Nicotiana sylvestris]
Length=286

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 125/243 (51%), Gaps = 43/243 (18%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAEN----EKDHEF----LVNKLTTHYKNYYTAKWAA  699
            E+F  FFE W+ +  +    L+ A++     E+++      ++ ++  HY+NYY  K  +
Sbjct  18   ETFHKFFESWLVEQNQDLDQLVRASKEVNGIEENNRIMLSPIIQRVIQHYENYYKEKSRS  77

Query  698  AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-AGEGMSEE---------------  567
            A+EDVL    P W ++LE A+LW+ GW+PS AF L+ +  G+  E               
Sbjct  78   AKEDVLGMLNPTWRSNLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAGFHDLFRGISTGDL  137

Query  566  ------QMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGG------GDTVA  423
                  Q+ K++ L+ K   EE+K+   + + Q  MAD  MVEL+ +        G  V 
Sbjct  138  GDLSGIQLGKIDELQNKTLKEEKKLSERLAKVQETMADTSMVELSHVVSEILREEGRQVE  197

Query  422  DVA---VKNMLGGLE----KVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMR  264
            +     VKN +   E    +V+K AD +RL+TLK +L ++ P  ++HFL +A+ L +++ 
Sbjct  198  ETEEEKVKNNIAKKEENLLEVLKKADDLRLRTLKEILGILKPIQAVHFLIAAAELHLRIH  257

Query  263  KCG  255
              G
Sbjct  258  DWG  260



>ref|XP_010093103.1| hypothetical protein L484_007912 [Morus notabilis]
 gb|EXB53541.1| hypothetical protein L484_007912 [Morus notabilis]
Length=292

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 81/271 (30%), Positives = 135/271 (50%), Gaps = 58/271 (21%)
 Frame = -3

Query  884  FSSSMR--SKVEESFTDFFEKWMAQLEECAQLLLIAAE------NEKDHEFLVNKLTTHY  729
             SS++R  S   ESF  FFE W++   +  Q L+ AA+      +E     L+ ++  HY
Sbjct  11   LSSAIRNNSPEHESFQKFFECWLSGQNQHLQELISAAKSPASAADEAALRSLIERVVKHY  70

Query  728  KNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------  579
            + YY AK   +R DVLA   P W ++LE A+LW+ GW+PS AF L+  +           
Sbjct  71   ECYYRAKATWSRRDVLAMLTPSWRSTLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAPGRL  130

Query  578  -----------------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADR  468
                                   +S EQ+ +V+ L+ +   EE+++  EM ++Q  +A  
Sbjct  131  SELINAMTTTTATATAIREDLADISPEQLSRVDGLQRRTIKEEKEISEEMAKRQETLAAP  190

Query  467  RMVELARL--------GGGDTVAD---------VAVKNMLGGLEKVMKMADCVRLKTLKG  339
             +VEL+ +        GGG    D          A+K    GLE+V++ AD +RL+TLK 
Sbjct  191  DIVELSHVVSEQMTAGGGGSRDGDEEEEEERVETALKPKEKGLEEVLERADELRLRTLKD  250

Query  338  LLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            ++ ++ P  ++HFL +A+ L +++ + GK +
Sbjct  251  VIHLLTPIQAVHFLIAAAELHLRIHEWGKKR  281



>ref|XP_002272336.1| PREDICTED: transcription factor TGA5-like [Vitis vinifera]
Length=240

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 73/230 (32%), Positives = 117/230 (51%), Gaps = 18/230 (8%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKDH---------EFLVNKLTTHYKNYYTAKWA  702
            E F  FF  W+ + EE   LL  A E + D          + L+ ++  HY  YY AK  
Sbjct  11   EPFEIFFRGWLVRHEEVRLLLQQADERDCDETREDEEARVQELIGRVVAHYAEYYKAKQR  70

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIK  528
              REDV+  F P WLT  E + LW+ G+ P  AFRLV    + ++ EQ + +E L+ +  
Sbjct  71   VVREDVMTLFEPPWLTPFERSLLWIAGFMPGFAFRLVMNYVKDLNGEQTRMMEQLKTETA  130

Query  527  AeeekveremerqqVAMADRRMVELARLGG--GDTVADVAVKNMLGGLEKVMKM----AD  366
            AEE  +  E+ + + +     +VE+A  G    D   D AVK  +  ++  M+M    AD
Sbjct  131  AEEIDLTAELVKVKRSPTMISLVEMAARGREWADGERD-AVKEKIDMVKLAMEMLVECAD  189

Query  365  CVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLSLITNSS  216
            C+R KT   +++++ P+ ++ FL + + LQ+++R  G  +   S   NS 
Sbjct  190  CLRYKTALKIMEILNPSQNVKFLLAITGLQLRVRNWGLQREAESRNDNSP  239



>ref|XP_011097086.1| PREDICTED: transcription factor TGA2-like [Sesamum indicum]
Length=300

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 85/277 (31%), Positives = 140/277 (51%), Gaps = 60/277 (22%)
 Frame = -3

Query  884  FSSSMRSKVEE--SFTDFFEKWMA-QLEECAQLLLIAAENEK-------DHEFL------  753
             + ++RS+ EE  +F +FFE W++ Q     +L+L + E+E+       DH  +      
Sbjct  11   MAQALRSEAEEYETFHEFFECWLSEQSRHLEELVLASKESERLQEQGHDDHRPVTQQEVD  70

Query  752  -------VNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL  594
                   + ++  HY+ YY  K   A  DVL  F   W +SLE A+LW+ GW+PS AF L
Sbjct  71   ERILRPKIAEVIEHYEQYYHVKSLWAENDVLLMFNQSWRSSLEDAFLWIGGWRPSIAFHL  130

Query  593  VAGE----------------------GMSEEQMKKV-EVLRGKIKAeeekveremerqqV  483
            +  +                      G+S  Q+ +V E+ RG I+ E+E  E+  ++Q+ 
Sbjct  131  LYSKSGLQLEARLDELRQGLTVNDLGGLSYTQLNQVNELQRGTIREEKEITEKLAKQQEK  190

Query  482  AMADRRMVELA-------RLGG--GDTVADVAVKNMLG----GLEKVMKMADCVRLKTLK  342
             +AD  MVEL+       R G   G  VAD  ++  L     G  +++K AD +RLKTL+
Sbjct  191  -VADSLMVELSHAVTESIREGNQAGPIVADERIEATLAVKEEGFTEIIKRADDLRLKTLR  249

Query  341  GLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLSL  231
             L++ + P+  +HFL +A+ L +++ + GK +   SL
Sbjct  250  ELINTLTPSQGVHFLIAAAELHMRLHEWGKKRDARSL  286



>ref|XP_009617985.1| PREDICTED: transcription factor TGA5-like [Nicotiana tomentosiformis]
Length=234

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 115/213 (54%), Gaps = 13/213 (6%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEE-CAQLLLIAAE--NEK---DHEFLVNKLTTHYKNYYTAKWAAAR  693
            ESF  FF+ W+ + E    QLL +++E  NE    +   +++++  HY+ YY AK    +
Sbjct  16   ESFETFFQSWLIEQERYLQQLLRLSSESCNENCISEKRLIIDQVLAHYRAYYIAKSKVTQ  75

Query  692  EDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAee  519
            E+V    +P W T+ E  YLW+ G++P  AF LV      +S  Q   ++ L  +IKAEE
Sbjct  76   ENVFLVLSPTWFTAFERTYLWIAGFRPGLAFTLVNKNVSDLSRNQSLMLKELLDEIKAEE  135

Query  518  ekveremerqqVAMADRRMVELAR-----LGGGDTVADVAVKNMLGGLEKVMKMADCVRL  354
            +++  E  R Q  M  + M+ LAR       G  T  + A+  +   +E +++ AD +R 
Sbjct  136  KQLTDEFTRVQQTMVSQTMILLARDEGPLENGRLTELNRAIDRLRLAMETLVECADYLRG  195

Query  353  KTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            KT+  +++++    S+ FL +A+  Q+++R  G
Sbjct  196  KTVLRIVEILSAAQSVRFLVAATQFQLRIRSLG  228



>gb|EYU23876.1| hypothetical protein MIMGU_mgv11b017687mg [Erythranthe guttata]
Length=270

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 130/261 (50%), Gaps = 42/261 (16%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKW-------MAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYT  714
            M +  E +F +F+ KW       + +L   ++      +++     LV ++ +HY+ YY 
Sbjct  1    MEATSENNFQEFYVKWQNKHNQHLYELTNASKTQPQQPQSDSSLSGLVERVISHYEEYYR  60

Query  713  AKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG---------------  579
             K   A+ DV    +P W + LE A+LWV GW+P+TAF L+  +                
Sbjct  61   IKTKWAKTDVYLLLSPPWNSPLEDAFLWVGGWRPTTAFHLLYSKSGLQFQAQFSNMLIGA  120

Query  578  -------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA--------RL  444
                   +S +Q+ ++++ +     EE ++  +  +QQ  +AD+ MV L+        R 
Sbjct  121  KTGDLGDLSLDQLGRIDIFQKGTIQEEREITEKEAKQQDRVADKEMVGLSHDASSESTRP  180

Query  443  GGG-----DTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASML  279
             GG      ++ +  +K    G + +++ AD +R+KTLKG++D++ P  ++HFL +A+ L
Sbjct  181  VGGTSLDIGSLVNSVLKPKEEGFQMLLQSADELRMKTLKGVIDILSPIQAVHFLIAAAEL  240

Query  278  QIQMRKCGKTQHNLSLITNSS  216
            Q+ + + GK + +  L   SS
Sbjct  241  QLCLHEWGKDKQDEQLAAASS  261



>gb|EYU35712.1| hypothetical protein MIMGU_mgv1a011847mg [Erythranthe guttata]
Length=269

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 122/248 (49%), Gaps = 51/248 (21%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEFL-------------VNKLTTHYKNYYTA  711
            +F  FFE W+ + +   + L+ A++  + H                + ++  HY+ YY A
Sbjct  12   TFHSFFESWLVEQDHYLEELVSASKRRRVHHHPSAADDDDTVLRQKIARVIDHYEQYYRA  71

Query  710  KWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--------------------  591
            K   A+ D L  F P W +SLE A+LW+ GW+P+ AF L+                    
Sbjct  72   KSTCAKTDALPMFNPPWRSSLEDAFLWIGGWRPTMAFHLLYSKSGLQLQDKLADLLQGLA  131

Query  590  AGE--GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL---------  444
            AG+   +S  Q+ ++  L+     EE+++  ++ +QQ  +AD  MVEL+           
Sbjct  132  AGDLADLSPPQVNQINDLQRATVREEKEISEKLAKQQEKVADTSMVELSNAVTEAMRNPA  191

Query  443  -----GGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASML  279
                 GGG   A +A K +  GL +V++ AD +RLKTLK +L V+ P   +HFL +A+ L
Sbjct  192  AADDGGGGRVAAALAPKEV--GLAEVLQRADDLRLKTLKKVLGVLSPIQGVHFLIAAAEL  249

Query  278  QIQMRKCG  255
             +++ + G
Sbjct  250  HLRLHEWG  257



>ref|XP_004289493.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/255 (30%), Positives = 127/255 (50%), Gaps = 51/255 (20%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIA-------AENEKDHEFL---VNKLTTHYKNYYTAKWAA  699
            F  FFE W+++ ++  Q L+IA       A ++ D   L   V ++  HY+ YY  K   
Sbjct  13   FQAFFESWLSEQDQHLQDLIIASKQHQKRAADDDDRVLLSSLVERVVKHYEQYYNKKSQW  72

Query  698  AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAF----------------------RLVAG  585
            A++DVL   +P W +SLE A+LW+ GW+PS AF                      RL  G
Sbjct  73   AKQDVLRMLSPPWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLQLEASFAELMRGLRLSTG  132

Query  584  E--GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA------------R  447
            +   +S  Q+  V+ ++ +   +E+ +  +M + Q  +AD  +VELA             
Sbjct  133  DLGDLSHCQLTMVDKVQRRTIEDEKHLSEKMAKLQETVADATLVELAHEATEMMRNNEVH  192

Query  446  LGGGDTVADVAVKNMLG----GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASML  279
             GG D   +  V++ L     GLEK++  AD +R+KTL+ +  ++ P  ++HFL +A+ L
Sbjct  193  EGGADDHME-RVESTLASKEEGLEKILHKADDLRMKTLRNITQILSPLQAVHFLIAAAEL  251

Query  278  QIQMRKCGKTQHNLS  234
             +++   GK +  LS
Sbjct  252  HLRVHDWGKKKDALS  266



>ref|XP_008337157.1| PREDICTED: transcription factor HBP-1b(c38)-like [Malus domestica]
Length=284

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 123/262 (47%), Gaps = 59/262 (23%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKDHEF------------------LVNKLTTHY  729
            ESF  FFE W+A+  +    L+ AA+N                        LV ++  HY
Sbjct  12   ESFHRFFECWLAEQNQHLHDLITAAKNNTTSAATNPTTTAXINTSSRSLGTLVERVVKHY  71

Query  728  KNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------  579
            ++YY  K    ++DVL   +P WL+SLE A+LW+ GW+PS AF L   +           
Sbjct  72   EHYYEVKSRWVKQDVLGMLSPSWLSSLEDAFLWIGGWRPSMAFHLFHSKSGLQLEVRVAE  131

Query  578  ----------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELAR  447
                            +S  Q+ +V+ ++ +   EE  +  +M ++Q A+AD  +V L+ 
Sbjct  132  FIRGFCSSGSKGDLADLSSHQLTQVDQMQQRTVKEERDISEKMAKRQEAVADSSLVGLSH  191

Query  446  L---------GGGDTVA------DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTH  312
            +         G  D VA      + A+ +   GLE+V+  AD +RL TLK +  ++ P  
Sbjct  192  VITELMDAGNGXDDPVAEEDPRVEYALASKEEGLEEVLHRADNLRLXTLKAITHILTPIQ  251

Query  311  SIHFLASASMLQIQMRKCGKTQ  246
            ++HFL +A+ L +++   GK +
Sbjct  252  AVHFLIAAAELHLRLHDWGKKK  273



>ref|XP_010922993.1| PREDICTED: uncharacterized protein LOC105046169 [Elaeis guineensis]
Length=562

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 122/245 (50%), Gaps = 45/245 (18%)
 Frame = -3

Query  857  EESFTDFFEKWMAQLEECAQLLLIA--------------AENEKDH-EFLVNKLTTHYKN  723
            +E F  FFE W+ QL+   Q LL A              A N + H   LV+ +  HY+ 
Sbjct  4    QEIFAHFFECWLGQLDRDLQALLAADVPSLDPQHQPHSDANNNEHHLRSLVDMVKGHYEY  63

Query  722  YYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE-------------  582
            YY AK A+AR DVLA F+P W TS E  +LW  GW+P  AF+++  E             
Sbjct  64   YYRAKLASARRDVLAIFSPAWATSTEKLFLWAGGWRPGAAFQILYSESGRRVEPWLVQGV  123

Query  581  -------GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVA  423
                   G+S  Q+++V+ L+ +    E  +  E    Q  +A  +M+E++      TV+
Sbjct  124  LRDDDLAGLSALQLERVDQLQRRTLETERMISEEEAEAQELVAWPQMMEISH---EITVS  180

Query  422  DVAVKNMLGGL-------EKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMR  264
             + V  M  GL        +V++ AD +RL+T++ ++ ++ P  ++ FLA+A  L +++ 
Sbjct  181  GLEVAAMEDGLVGAKEAMRRVLERADQLRLETIQSVVGILSPRQAVQFLAAAGKLLLRVH  240

Query  263  KCGKT  249
            + GK 
Sbjct  241  EFGKA  245



>ref|XP_004288481.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Fragaria vesca subsp. vesca]
Length=280

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/249 (29%), Positives = 125/249 (50%), Gaps = 49/249 (20%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIA---AENEKDHE-----FLVNKLTTHYKNYYTAKWAA  699
            + F  FF+ W+A+  +    L++A   A+   DH+      LV ++  HY+ YY AK+  
Sbjct  24   DGFQAFFKCWIAEQNQHLDDLVVASKAADYNGDHDQVLLSSLVERVLKHYEQYYNAKFQW  83

Query  698  AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG--------------------  579
            A+++VL+  +P W +SLE A+LW+ GW+PS AF L+  +                     
Sbjct  84   AKQEVLSMLSPPWRSSLEDAFLWIGGWRPSMAFHLLYSKSGLHPEDCSAELMRGLRFSNT  143

Query  578  -----MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL----------  444
                 +S+ Q+  V+ L+ +   EE+ +  +M + Q  +AD  +VEL+ L          
Sbjct  144  GDLGDLSQWQLTMVDELQRRTIQEEKHISEKMAKLQETLADNPLVELSHLATDKMRKNNN  203

Query  443  ----GGGDTVADV--AVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASM  282
                GG D +  V   + +   GLEK++  AD +R+ TLK +  ++ P  ++HFL +A+ 
Sbjct  204  VHEEGGDDHMERVESTLASKEEGLEKILHKADDLRITTLKNITQILSPLQAVHFLIAAAE  263

Query  281  LQIQMRKCG  255
            L +++   G
Sbjct  264  LNLRVHDWG  272



>ref|XP_009594445.1| PREDICTED: transcription factor TGA6-like [Nicotiana tomentosiformis]
Length=286

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 129/257 (50%), Gaps = 49/257 (19%)
 Frame = -3

Query  884  FSSSMRSKVE--ESFTDFFEKWMA-QLEECAQLLLIAAE-------NEKDHEFLVNKLTT  735
             S++ R+ V+  E+F  FFE W+  Q ++  QL+  + E       N +    L+ ++  
Sbjct  6    MSNNSRNGVQNRETFHKFFESWLVEQNQDLEQLVRASKEVNGVEENNRRMLSPLIQRVIH  65

Query  734  HYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV---------AG-  585
            HY+NYY  K  +A+EDVL    P W ++LE A+LW+ GW+PS AF L+         AG 
Sbjct  66   HYENYYKEKSRSAKEDVLGMLNPTWRSNLEDAFLWIGGWRPSMAFHLLYSKSGLQLEAGF  125

Query  584  ----EGMSEE--------QMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL-  444
                 G+S          Q+ K++ L+ K   EE+K+   + + Q  +AD  MVEL+ + 
Sbjct  126  HDLFRGISRGDLGDLSGIQLGKIDELQNKTLREEKKLTERLAKVQETVADTSMVELSHIV  185

Query  443  --------------GGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSI  306
                                 ++A K    GL + +K AD +RL+TLK +L ++ P  ++
Sbjct  186  SELMREEGRQVEETEEEKVKTNIAKKEE--GLLEALKKADDLRLRTLKEILGILKPIQAV  243

Query  305  HFLASASMLQIQMRKCG  255
            HFL +A+ L +++   G
Sbjct  244  HFLIAAAELHLRIHDWG  260



>gb|KDP24433.1| hypothetical protein JCGZ_24997 [Jatropha curcas]
Length=232

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 115/209 (55%), Gaps = 10/209 (5%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            SF +FFE W+ + E     LL   ++     ++D + L+ ++ +HY+ YY  K   A+ +
Sbjct  16   SFEEFFEGWLVRQEHYLDELLSVEQHYHESRDEDLKDLIARVLSHYEQYYEEKSRMAQRN  75

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeek  513
            V   F+P W T  +   LW+ G+KP+  F++V G    +SE+Q +++  L  +  A E  
Sbjct  76   VFLVFSPPWFTPFQRTLLWIAGFKPALTFQIVNGSVNDLSEDQSQRMSRLNEETTASERI  135

Query  512  veremerqqVAMADRRMVELARLGGGD--TVADVAVKNMLG-GLEKVMKMADCVRLKTLK  342
            +  E+ R   ++A   +++LAR  G       +V+ K+ +G  +E ++  AD +R  T+ 
Sbjct  136  LTDELARIHESVASPPLLDLARRQGRGRWEEDEVSYKSTIGSAMESLVATADLLRTNTVT  195

Query  341  GLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +++++ P  ++ FL++A+ L +++R  G
Sbjct  196  KVVEILNPVQNVKFLSAATQLHLRIRNLG  224



>gb|EYU26796.1| hypothetical protein MIMGU_mgv1a026861mg [Erythranthe guttata]
Length=232

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 116/214 (54%), Gaps = 13/214 (6%)
 Frame = -3

Query  857  EESFTDFFEKWMAQLEECAQLLLIA-----AENEKDHEFLVNKLTTHYKNYYTAKWAAAR  693
            ++SF  F  +W+   E     LL        ENE+  + L++   +HYK Y+ AK    R
Sbjct  6    DQSFEAFQSRWLIGQEHHLHDLLQVIESGDEENEQRCKNLIDDNISHYKQYFEAKTRLVR  65

Query  692  EDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAee  519
            +DV    AP W++SLE A+LW+ G++P  AF +V      ++E+Q +++     +IK EE
Sbjct  66   QDVFLVLAPTWISSLERAHLWIGGFRPRLAFLIVINNVLDLTEDQTQRINQGLEEIKEEE  125

Query  518  ekveremerqqVAMADRRMVELARLGGG------DTVADVAVKNMLGGLEKVMKMADCVR  357
             ++  E ++ Q  M    +V+LAR  G       D   + AV  +   +E V++ AD +R
Sbjct  126  NELTNEFDKVQERMISSSVVQLARQMGRPRNGVWDHSMETAVDMLRVSIEDVVECADFLR  185

Query  356  LKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             K+   +L+++ PT  + FLA+A+ LQI +R+ G
Sbjct  186  RKSGIIILEILNPTQCLRFLAAAAKLQINLRRLG  219



>ref|XP_009798761.1| PREDICTED: transcription factor TGA5 [Nicotiana sylvestris]
Length=226

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 116/221 (52%), Gaps = 28/221 (13%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIA---AENEKDHEF---LVNKLTTHYKNYYTAKWAAARE  690
            SF  F+E W  QL+     L  A   A N++ HE    LV K+ +HY  YY  K  AA+ 
Sbjct  2    SFQLFYETWFEQLKGMVHQLGQAPRPATNDQHHELHQQLVQKVMSHYSEYYRVKSLAAKN  61

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG---------  537
            D+L+ F+  W TSLE +  W++GW+P+TAF L+  E     +   +++LRG         
Sbjct  62   DILSVFSAPWCTSLERSLHWISGWRPTTAFHLIYTESSVLFESHIIDILRGLRYGDLGDL  121

Query  536  --KIKAeeekveremerqqVAMADRRMVELARLGGGDT-----VADVAVKNMLGGLEKVM  378
                     +++ +  +++ A+AD    EL+    G +     + D+  K  + GL  ++
Sbjct  122  SPDQLRRVSELQCQAVQEENAIAD----ELSDWQDGASEVIGLMGDIDAK--MEGLVSIL  175

Query  377  KMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            + AD +R+KT++ L+ ++ P  ++ FL +A+ LQ  +R+ G
Sbjct  176  ERADKLRMKTIENLVQLLSPQQAVEFLIAAAHLQFGIRRWG  216



>gb|EYU23363.1| hypothetical protein MIMGU_mgv1a023034mg [Erythranthe guttata]
Length=292

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 127/257 (49%), Gaps = 49/257 (19%)
 Frame = -3

Query  869  RSKVEE--SFTDFFEKWMAQLEECAQLLLIAAENEKDHEF--------------LVNKLT  738
            R  VEE  SF  FF+ W+ +     Q L+ A++                     +V ++ 
Sbjct  16   RGGVEEHVSFHMFFDSWIVEQNHHLQKLVSASKEWGGGGGGVAFDVSGRSVLIPVVEQVV  75

Query  737  THYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV----------A  588
             HY++YY  K   A++D+L+ F+P W  SLE A++WV GW+P+TA  L+          A
Sbjct  76   HHYEHYYKTKSMWAKKDILSMFSPTWTHSLEKAFMWVGGWRPATAIHLLYSKCGLQLEAA  135

Query  587  GEG--------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA  450
             EG              +S  QM +V+ L      EE+ +  ++ +QQ  +AD  MV L 
Sbjct  136  FEGDYLPRGLNTGDLGDLSHSQMVRVDELHKSTLWEEKMITEKLAKQQETIADSSMVGLT  195

Query  449  -----RLGGGD----TVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFL  297
                 R+   D     V D A+ +   GL  +++MAD +RLKTLKGL+ ++ P   +HFL
Sbjct  196  TELMIRVEEHDHDQQVVVDAALASKEKGLVVILQMADDLRLKTLKGLILILTPIQGVHFL  255

Query  296  ASASMLQIQMRKCGKTQ  246
             +A+ L +++ + GK +
Sbjct  256  IAAAELHLKIHEWGKNR  272



>gb|KDO56688.1| hypothetical protein CISIN_1g047612mg [Citrus sinensis]
Length=238

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/210 (30%), Positives = 114/210 (54%), Gaps = 13/210 (6%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            SF  FF  W+ + E     L+ A EN     ++D + LV ++  HY+ YY  K   A+ +
Sbjct  17   SFETFFRAWLVRQEHLLDELISAQENHHQSRDEDLKELVKRVLAHYQQYYQEKSKVAQHN  76

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLRGKIKAeeek  513
            V   FAP W T  E  + W+ G+ P+ AFR+V  + + +++EQ ++++ L  + + EE+ 
Sbjct  77   VFLLFAPTWFTPFEQTFFWIAGFNPTLAFRVVNESVKDLADEQRQRMDSLSVETRVEEKL  136

Query  512  veremerqqVAMADRRMVELA----RLGGGDTVADVAV--KNMLGGLEKVMKMADCVRLK  351
            +  E+ R Q ++A   ++ELA    RLG  +    V V   N+   LE ++  AD +R  
Sbjct  137  LNDELARIQESVAGPTIMELARRRGRLGEWEMTEGVEVTESNLRASLESLVANADMLRTT  196

Query  350  TLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
            T   +++++ P  ++ F  + + LQ+++R+
Sbjct  197  TTAKVVEILDPLQNVKFFTAVARLQLRIRR  226



>ref|XP_004156023.1| PREDICTED: transcription factor TGA6-like [Cucumis sativus]
 gb|KGN54766.1| hypothetical protein Csa_4G463190 [Cucumis sativus]
Length=255

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 125/244 (51%), Gaps = 43/244 (18%)
 Frame = -3

Query  857  EESFTDFFEKWMAQLEECAQLLLIAAE--NEKDHEFLVNKLTTHYKNYYTAKWAAAREDV  684
            E SF +FF+KWM +  +    L+  A+  N    E L+ ++  HY++YY  K     +D 
Sbjct  4    EISFGEFFQKWMKEQNQYLTELISTAKGGNNMVAEALMKRVMEHYEHYYKVKSRWVEKDT  63

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------EG----------------MSE  570
            L   +P W++S E A+LW+ GW+P+ AF L+        EG                +S 
Sbjct  64   LGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHGLSTGDLADLSS  123

Query  569  EQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL----------GGGDTVAD  420
             Q+ K++ L+  +  +E+++  +M + Q  +AD  MVEL+ +          GGG    +
Sbjct  124  HQVIKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKMGTSGGGGQNDGE  183

Query  419  ---------VAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQM  267
                     +A+     GL++V+KMAD +RL+TLK ++ ++  T  +HFL +A+ L +++
Sbjct  184  LNMVEEELKLALATKECGLKEVVKMADELRLETLKQIIGILTLTQRVHFLIAAAELHLRI  243

Query  266  RKCG  255
             + G
Sbjct  244  HEWG  247



>dbj|BAA05470.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=287

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 74/258 (29%), Positives = 126/258 (49%), Gaps = 54/258 (21%)
 Frame = -3

Query  863  KVEESFTDFFEKWMA-QLEECAQLLLIAAENEKDHEF---------LVNKLTTHYKNYYT  714
            K +++F +FFE W+A Q +E  +L+  + +  K +           L+ ++  HY+ YY 
Sbjct  13   KNDKTFHEFFETWLAEQKQELKELVSASRDVSKGNNNVVEERVLVPLIKRVIQHYEGYYE  72

Query  713  AKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG---------------  579
             K     EDV     P W ++LE A+LW+ GW+PS AF L+  +                
Sbjct  73   EKSKYTEEDVFGMLNPTWRSNLEGAFLWIGGWRPSMAFHLLYSKSGLQFEARLPQLIRGI  132

Query  578  -------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA----------  450
                   +S +Q+ KV+ L+ K   EE+K   ++ R Q  +AD  MVEL+          
Sbjct  133  TTGDLGYLSPDQIDKVDELQKKTIREEKKSSEKLARVQETVADASMVELSHIVTQLMMIS  192

Query  449  ----------RLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHF  300
                      ++   +  A++A K    GL  +++ AD +RL TLK +L ++ PT +IHF
Sbjct  193  GSRGGGGGGGKILDEEVEANLATKE--EGLIIILQKADNLRLNTLKEILAILTPTQAIHF  250

Query  299  LASASMLQIQMRKCGKTQ  246
            L +A+ L +++ + GK +
Sbjct  251  LIAAAELHLRLHEWGKIE  268



>ref|XP_006432080.1| hypothetical protein CICLE_v10002078mg [Citrus clementina]
 ref|XP_006464938.1| PREDICTED: transcription factor TGA2-like [Citrus sinensis]
 gb|ESR45320.1| hypothetical protein CICLE_v10002078mg [Citrus clementina]
 gb|KDO52212.1| hypothetical protein CISIN_1g023115mg [Citrus sinensis]
Length=287

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 121/247 (49%), Gaps = 44/247 (18%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKDH------EFLVNKLTTHYKNYYTAKWAAAR  693
            ESF  FFE W+ +  +  Q L+ A++ ++++      E  V  +  HY+ YY AK    +
Sbjct  29   ESFQKFFESWLVEQNQHLQALISASKQQENNSSSSNFEEQVRVVVEHYEQYYRAKSRWVK  88

Query  692  EDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------EG----------------  579
             DVL    P W +SLE ++LW+ GW+PS AF L+        EG                
Sbjct  89   LDVLGMLTPSWRSSLEDSFLWIGGWRPSMAFHLLYSKSGLQLEGKLHDLIRGLSSGDLGD  148

Query  578  MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA------------RLGGG  435
            +S  Q+ +V+ L+  I  EE+ +  ++ + Q  +AD  +VEL+            R    
Sbjct  149  LSPTQLTRVDGLQRVIIKEEKDLSEKLAKYQETVADSSLVELSHVVTELMSTNDDRQDSD  208

Query  434  DTVADVAVKNML----GGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQM  267
              + D  +++        LE++   AD +RLKT K ++D++ P  ++HFL +A+ L +++
Sbjct  209  RRLMDDQIESNFVTKEAKLEEIFHKADDLRLKTFKAVIDILTPIQAVHFLIAAAELHLRL  268

Query  266  RKCGKTQ  246
               GK +
Sbjct  269  HDWGKQR  275



>ref|NP_001042081.1| Os01g0159000 [Oryza sativa Japonica Group]
 dbj|BAB08196.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF03995.1| Os01g0159000 [Oryza sativa Japonica Group]
 gb|EAZ10627.1| hypothetical protein OsJ_00459 [Oryza sativa Japonica Group]
Length=269

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 122/235 (52%), Gaps = 34/235 (14%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEE---------CAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWA  702
            ESF  FFE W+++             A     A  ++ +   LVN++  HY++YY  K A
Sbjct  22   ESFAKFFECWISEQSRDLAALRSAASAATNPAAPPDDAELHRLVNRVLGHYEHYYRTKSA  81

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG-------------------  579
            AA  DVL  F+P W ++ E+ YLW  GW+P+ A  L+  +                    
Sbjct  82   AASTDVLRMFSPSWTSTTENLYLWCGGWRPTAALHLLYSKSGAQLETQLPVFLAGGGLGA  141

Query  578  -----MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVA-DV  417
                 +S EQ++  + L+    ++E ++E      Q ++A  +MVELA  GG D    ++
Sbjct  142  GDLGDLSAEQLQAADQLQRITVSKEREIENAAASAQESLATVKMVELAGGGGMDAEGMEM  201

Query  416  AVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
             +++   G+ +V++MAD +RL+T++ ++ ++ P+ ++HFL +A+ L + + + G+
Sbjct  202  EMRSKADGMRRVLEMADGLRLETMREVVALLRPSQAVHFLIAAAELHLAVHEFGR  256



>ref|XP_009606302.1| PREDICTED: transcription factor TGA7-like [Nicotiana tomentosiformis]
Length=246

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 122/231 (53%), Gaps = 16/231 (7%)
 Frame = -3

Query  878  SSMRSKVEESFTDFFEKWMAQLEECAQLL--------LIAAENEKDHEFLVNKLTTHYKN  723
            +S    +E +   ++E W+ QLE   + L        +   E E++   LV ++  HY+ 
Sbjct  6    TSRNPCLEANIDAYYENWLIQLENLLEKLNKVSASYDVFNEEAEENRSKLVTQVLDHYQE  65

Query  722  YYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVA---GEGMSEEQMKKV  552
            YY  K+ A   D     +P W TSLE  +LW+ G+KPS  F  +    G+ ++ EQ +K+
Sbjct  66   YYQEKFKATNGDTFLLNSPPWYTSLERTFLWIAGFKPSMLFPTINYSIGQELTPEQGEKL  125

Query  551  EVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVA-VKNMLGGLEK---  384
            + L+ +IK EE+ +E+ M + Q  +A   + EL + GG     + + ++ ++ GL++   
Sbjct  126  KRLKSEIKREEKAIEKGMAKVQEKVAAPPIFELMKRGGLLVDGEASELETVIDGLKQSIM  185

Query  383  -VMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
             V++ A+ +R   +K +LD++ P  ++  LA+ +   +Q RKCG    N S
Sbjct  186  AVIEAAEHLRGAAVKKVLDILPPKQAVKLLAAVAQFHLQARKCGLRMDNQS  236



>ref|XP_006429421.1| hypothetical protein CICLE_v10012620mg [Citrus clementina]
 ref|XP_006481058.1| PREDICTED: uncharacterized protein LOC102613676 [Citrus sinensis]
 gb|ESR42661.1| hypothetical protein CICLE_v10012620mg [Citrus clementina]
Length=238

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 61/213 (29%), Positives = 114/213 (54%), Gaps = 19/213 (9%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            SF  FF  W+ + E     L+ A EN     ++D + LV ++  HY+ YY  K   A+ +
Sbjct  17   SFETFFRAWLVRQEHLLDELISAQENHHQSRDEDLKELVKRVLAHYQQYYQEKSKVAQHN  76

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLRGKIKAeeek  513
            V   FAP W T  E  + W+ G+ P+ AFR+V  + + +++EQ ++++ L  + + EE+ 
Sbjct  77   VFLLFAPTWFTPFEQTFFWIAGFNPTLAFRVVNESVKDLADEQRQRMDSLSVETRVEEKL  136

Query  512  veremerqqVAMADRRMVELARLGG---------GDTVADVAVKNMLGGLEKVMKMADCV  360
            +  E+ R Q ++A   ++ELAR  G         G+ V +    N+   LE ++  AD +
Sbjct  137  LNDELARIQESVAGPTIMELARRRGRLGEWEMTEGEEVTE---SNLRASLESLVANADML  193

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
            R  T   +++++ P  ++ F  + + LQ+++R+
Sbjct  194  RTTTAAKVVEILDPLQNVKFFTAVARLQLRIRR  226



>ref|XP_011079057.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
 ref|XP_011079058.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=245

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/225 (31%), Positives = 117/225 (52%), Gaps = 15/225 (7%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAENEKDHE--------FLVNKLTTHYKNYYTAKWAAAR  693
            F  F  +W+   E   + LL   E  +  E         L+ ++  HYK+Y+ AK     
Sbjct  11   FEAFLGRWLIDQERYLRDLLGLMERNRSEEEEYEVRCKDLIQQVMGHYKHYFEAKARVVE  70

Query  692  EDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAee  519
            E+V     P W +S E AYLW+ G++P   FRLV      ++EEQ +++  L  +IK EE
Sbjct  71   ENVFLVLMPTWFSSFERAYLWIGGFRPGLLFRLVKNNVLDLTEEQSQRINRLMAEIKEEE  130

Query  518  ekveremerqqVAMADRRMVELA-RLG----GGDTVADVAVKNMLGGLEKVMKMADCVRL  354
            +++  E +R Q  +A   MVEL  RLG    G     + AV  +   LE +++ AD +R+
Sbjct  131  KELTDEFDRVQEVVASPPMVELVRRLGRLRNGAQHNMESAVDRLKLSLETLVECADFLRM  190

Query  353  KTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLSLITNS  219
            KT   L++++ P  ++  LA+ + LQ+++R+ G  +   + + N+
Sbjct  191  KTGIILVEILKPAQAVRLLAAVAQLQLRVRRWGMQRDGQNRMHNA  235



>ref|XP_010497879.1| PREDICTED: uncharacterized protein LOC104775604, partial [Camelina 
sativa]
Length=88

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 65/87 (75%), Gaps = 5/87 (6%)
 Frame = -3

Query  479  MADRRMVELARLG---GGDTVA--DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPT  315
            M DR+MVELARLG   GG++V   + AVK +  GLEK++K ADCVRLKTLKG+LD++ P 
Sbjct  1    MGDRKMVELARLGCHVGGESVVVIEAAVKGLATGLEKMVKAADCVRLKTLKGILDILAPP  60

Query  314  HSIHFLASASMLQIQMRKCGKTQHNLS  234
              + FLA+A+  Q+Q+R+ G  +HN++
Sbjct  61   QCVEFLAAAAAFQVQLRRWGNQRHNVT  87



>ref|XP_006338981.1| PREDICTED: transcription factor TGA6-like [Solanum tuberosum]
Length=248

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 117/231 (51%), Gaps = 19/231 (8%)
 Frame = -3

Query  896  PSRQFSSSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAE----NEKDHEFLVNKLTTHY  729
            P   + SS  S  + SF  F E W+ + E+    L++A +     E D   L++++  HY
Sbjct  2    PGGSYRSS--SHDDNSFEVFLEGWLIRQEQFLNELVVAQDTFDDQENDMRDLISRVLAHY  59

Query  728  KNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKK  555
            + YY  K      +V   F+P W + LE ++LW+TG+ P   F LV      +SE Q+++
Sbjct  60   QEYYEEKSRMTHRNVFRAFSPTWFSPLERSFLWITGFNPGLIFNLVTDSVNNLSEHQVQR  119

Query  554  VEVLRGKIKAeeekveremerqqVAMADRRMVELARLGG-----GDTVA------DVAVK  408
            +  L+ + KAEE  +  EM + Q ++A   + +LAR  G      D +       D  + 
Sbjct  120  LNWLKHETKAEERSLTEEMTQIQESVASPPLADLARRVGMQLIYTDNINTEIEEIDGNID  179

Query  407  NMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +   LE V+  AD +R +T + ++ ++ P  S+ FL++   LQ+++R  G
Sbjct  180  QLKTALENVVTDADRLRTRTAERVVGLLNPLQSLKFLSAVGQLQLRVRMMG  230



>ref|XP_002263705.1| PREDICTED: transcription factor TGA2-like [Vitis vinifera]
Length=231

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 111/211 (53%), Gaps = 14/211 (7%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAAREDV  684
            F  F ++WM   E     LL    N     EK+   LV+++ THY+ YY  K      +V
Sbjct  11   FERFLQRWMVSQEHYLDELLTTERNCGEYGEKEMTDLVSRVLTHYQLYYEQKSRVIERNV  70

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLVA---GEGMSEEQMKKVEVLRGKIKAeeek  513
               F+P W T LE   LW+ G+KP  AFR+VA   GE +SE+Q +++  L+ + + EE  
Sbjct  71   FVVFSPPWFTPLERTLLWIGGFKPGLAFRIVAEAVGE-LSEDQRRRMNELQEETRTEERL  129

Query  512  veremerqqVAMADRRMVELARLGG----GDTVADVAVKNML-GGLEKVMKMADCVRLKT  348
            +  E+ R Q  +A   ++ELAR  G    G+ +   +V  +L   LE V++ A+ +R+ T
Sbjct  130  LSDELARIQETVAAPPLMELARQAGRRRDGEILGSDSVTELLSSALETVVRDAELLRMST  189

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
               +++++ P  ++ FL +     +++R  G
Sbjct  190  AVKVVEILTPIQNVKFLGAVGRFHMKIRTWG  220



>ref|XP_008442175.1| PREDICTED: transcription factor TGA2-like isoform X2 [Cucumis 
melo]
Length=280

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 126/250 (50%), Gaps = 49/250 (20%)
 Frame = -3

Query  857  EESFTDFFEKWMAQLEECAQLLL--IAAENEKDH------EFLVNKLTTHYKNYYTAKWA  702
            +ESF +FF+KWM +  +    L+  +     KD+      E L+ ++  HY++YY  K  
Sbjct  23   QESFGEFFKKWMKEQNQYLTELISTVKGGGNKDNDGDIVAEALMKRVMEHYEHYYRVKSH  82

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------EG-------------  579
               +D L   +P W++S E A+LW+ GW+P+ AF L+        EG             
Sbjct  83   WVEKDALGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHGLSTGD  142

Query  578  ---MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL---------GGG  435
               +S  Q+ K++ L+  +  +E+++  +M + Q  +AD  MVEL+ +         GGG
Sbjct  143  LADLSSHQVVKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKMETSGGG  202

Query  434  DTVA----------DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASAS  285
            +              +A+     GL++V+KMAD +RL TLK ++ ++  T  +HFL +A+
Sbjct  203  EQNNRDLSMVEEELKLALAGKEDGLKEVVKMADELRLGTLKQIIGILTSTQRVHFLIAAA  262

Query  284  MLQIQMRKCG  255
             L +++ + G
Sbjct  263  ELHLRIHEWG  272



>ref|XP_008806140.1| PREDICTED: transcription factor TGA7-like [Phoenix dactylifera]
Length=277

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 126/243 (52%), Gaps = 43/243 (18%)
 Frame = -3

Query  857  EESFTDFFEKWMAQLEECAQLLLIAAE-------------NEKDHEF--LVNKLTTHYKN  723
            +E F  FF+ W+ QL+   + LL A E             N+ +H+   LV  +  HY+ 
Sbjct  8    QEIFAHFFDCWLGQLDRDLRALLAADEPSLDTRHHPHDDANDDEHQLRSLVEMVLGHYEY  67

Query  722  YYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE-------------  582
            YY AK A+AR DVL  F+  W +S E  +LW  GW+PS AF+L+  E             
Sbjct  68   YYRAKLASARRDVLTIFSTAWASSTEKLFLWAGGWRPSAAFQLLYSELGRRIERCLVQGV  127

Query  581  -------GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELAR--LGGGDT  429
                    +S  Q+++V+ L+ K    E K+  E  + Q  +A  +MVE++      G  
Sbjct  128  LRVQDLTRLSALQLEQVDRLQRKTIKTERKISEEEAKAQELVAWPQMVEISHEITESGRE  187

Query  428  VADVAVKNMLGG----LEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
            VA  A++  L G    +++V++ AD +R++T+KG++ ++ P  ++ FLA+A  L +++ +
Sbjct  188  VA--AMEEGLVGAKEAMKRVLERADQLRMETIKGVVGILRPRQAVQFLAAAGKLLLRVHR  245

Query  260  CGK  252
             GK
Sbjct  246  FGK  248



>ref|XP_009379553.1| PREDICTED: transcription factor TGA6-like [Pyrus x bretschneideri]
Length=285

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/208 (31%), Positives = 108/208 (52%), Gaps = 40/208 (19%)
 Frame = -3

Query  755  LVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG-  579
            LV ++  HY++YY  K   A++DVL   +P WL+SLE A+LW+ GW+PS AF L   +  
Sbjct  65   LVERVVKHYEHYYEVKSRWAKQDVLGMLSPSWLSSLEDAFLWIGGWRPSMAFHLFHSKSG  124

Query  578  -------------------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMA  474
                                     +S  Q+ +++ ++ +   EE  +  +M ++Q A+A
Sbjct  125  LQLEARVSEFIRGFCSSSSKGNLADLSSHQLTQMDQMQQRTVKEERDISEKMAKRQEAVA  184

Query  473  DRRMVELARL--------GGGDTVA--DVAVKNMLG----GLEKVMKMADCVRLKTLKGL  336
            D  MV L+ +         G D VA  D  V++ L     GLE+++  AD +RL+TLK +
Sbjct  185  DSSMVNLSHVITELMNAGSGDDPVAEEDPRVESALASKEQGLEEILHRADNLRLRTLKSV  244

Query  335  LDVMGPTHSIHFLASASMLQIQMRKCGK  252
              ++ P  ++HFL +A+ L +++   GK
Sbjct  245  THILTPIQAVHFLIAAAELHLRVHDWGK  272



>ref|XP_007026666.1| Response to aba and salt 1, putative [Theobroma cacao]
 gb|EOY07168.1| Response to aba and salt 1, putative [Theobroma cacao]
Length=235

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 118/211 (56%), Gaps = 12/211 (6%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            SF  FF+ W+ + E+    LL   +      E D + L+ ++ +H++ YY  K   A  +
Sbjct  16   SFDAFFQVWLERQEQYLDELLSVQQRSHEAREDDLKDLITRVLSHHQQYYEEKSRVAHRN  75

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeek  513
            +   F+P WL+S E A LW+ G+KP  A +LV+   + +S+EQ ++++ L  + + EE  
Sbjct  76   IFLVFSPTWLSSFERASLWIAGFKPGFALKLVSNSVQDLSQEQSERIKRLMAETRVEERV  135

Query  512  veremerqqVAMADRRMVELARLGGGDTVADV-----AVKNMLGGLEKVMKMADCVRLKT  348
            +  E+ R Q ++A   ++E+AR       A++     A+ ++   +E+V+  AD +R+ T
Sbjct  136  LNDELARVQESIAAPPLLEIARKRARLMNAEIAGEQAALASLRKAVEEVVAAADLLRMTT  195

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
               +++++ P  +++FL +A+ L +++R  G
Sbjct  196  AMRVVEILNPVQNVNFLTAATQLLVKLRNWG  226



>ref|XP_011100139.1| PREDICTED: transcription factor TGA1-like, partial [Sesamum indicum]
Length=276

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/257 (30%), Positives = 125/257 (49%), Gaps = 56/257 (22%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAA--------------------ENEKDHEF--LVNKL  741
            +SF  FFE W+ + ++  Q L+ AA                    E+ +D     L+ ++
Sbjct  2    QSFHKFFECWIVEQDQHLQELISAAREYEERRGRGCRQDDGTTVEEDVQDRTLRPLLERV  61

Query  740  TTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG------  579
              HY++YY AK   A+ DVL+ F P W +SLE A++W+ GW+PS  F L+  +       
Sbjct  62   IQHYEHYYRAKSRWAKSDVLSMFNPSWRSSLEDAFMWIGGWRPSMTFHLLYSKSGLQLEA  121

Query  578  ----------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA-  450
                            +S  Q+ +V  L+ +   EE+ +  ++ +QQ  +AD  MVEL  
Sbjct  122  RLTELLQGLSTGDLGDLSPSQLDQVNELQKQTIREEKDITEKLAKQQETVADSSMVELTH  181

Query  449  ------RLGGGDTVADVA-VKNMLG----GLEKVMKMADCVRLKTLKGLLDVMGPTHSIH  303
                  R G  D   D   V   L     GL +V++ AD +RLKTLK +L+++ P   ++
Sbjct  182  VVTEMMREGQVDQAMDTERVDETLAPKEEGLVEVLQRADGLRLKTLKEVLNILSPIQGVY  241

Query  302  FLASASMLQIQMRKCGK  252
            FL +A+ L +++ + GK
Sbjct  242  FLIAAAELHLRVHEWGK  258



>ref|XP_010497886.1| PREDICTED: transcription factor HBP-1b(c38)-like, partial [Camelina 
sativa]
Length=84

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 56/78 (72%), Gaps = 3/78 (4%)
 Frame = -3

Query  815  LEECAQLLLIAAE---NEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLE  645
            LE+    LLIA     +E +   L++KLTTH+K YYTAKWAA  EDVLAFF PVWLT LE
Sbjct  1    LEQYLHQLLIAHNTTMSEIELRALISKLTTHHKAYYTAKWAAIGEDVLAFFGPVWLTPLE  60

Query  644  SAYLWVTGWKPSTAFRLV  591
             A  W+TGWKPST FR+V
Sbjct  61   KACFWLTGWKPSTVFRMV  78



>ref|XP_010277360.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Nelumbo 
nucifera]
Length=275

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 114/211 (54%), Gaps = 13/211 (6%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAE------NEKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            F  F E W+ + ++    ++ A         E+D   L+ ++ +HY+ Y   K  AA  D
Sbjct  54   FHAFLEGWLVRQQQFLDEIVYAKRFCHDDSREQDLRDLIARVLSHYQQYLGEKSRAAHRD  113

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAeeek  513
            V    +P W +SLE A  W+ G++P   FRLVA     +S++Q++ +E LR +  AEE +
Sbjct  114  VFLVLSPPWFSSLERALFWIGGFRPGLVFRLVANSVGDLSQDQVQWMETLRAETSAEERQ  173

Query  512  veremerqqVAMADRRMVELAR-----LGGGDTVADVAVKNMLGGLEKVMKMADCVRLKT  348
            +E E+ R Q ++    + EL R     + G +  A+  +++M+   E ++  AD +R  T
Sbjct  174  LEEELARLQESVVAPPLSELLRRRGRAVNGEEGNANPVLESMITEFEILLGSADMLRANT  233

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
               ++ ++ P  ++ FLA+A+ LQ+++R+ G
Sbjct  234  ATKMIQILSPVQTVSFLAAAAQLQLRIRRLG  264



>ref|XP_004239641.1| PREDICTED: transcription factor TGA6-like [Solanum lycopersicum]
Length=273

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/249 (30%), Positives = 122/249 (49%), Gaps = 39/249 (16%)
 Frame = -3

Query  866  SKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDHEF-----LVNKLTTHYKNYYTAKWA  702
            SK  +SF  FFE W+ +  E    L+ A+E  K++       L++ +  HY+ YY  K  
Sbjct  5    SKNGKSFHKFFESWLVKQSEDLDELVRASEEYKNNNDMLLSPLIHSVVKHYEEYYREKSQ  64

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--------------------  582
             A  DVL    P WL++LE A+LW+ GW+PS AF L+  +                    
Sbjct  65   YAASDVLGMLHPSWLSNLEDAFLWIGGWRPSMAFHLLYSKSGIQLEANLHELIRGFSKED  124

Query  581  --GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAV-  411
               +S +Q+  ++ L+ K  +EE K+  ++   Q ++AD  MVEL+ +        + V 
Sbjct  125  LGNLSGQQLGLIDELQHKTISEERKLSEKLAIVQESVADTSMVELSHVVSELMREQLVVH  184

Query  410  --------KNMLGGLE---KVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMR  264
                    KN+    E    ++K AD +RL T+K +L +  P  S+HFL +A+ L +++ 
Sbjct  185  EEEEKKIGKNISKKEESLLDLLKKADDLRLSTIKEILRISTPIQSVHFLIAAAELHLRVH  244

Query  263  KCGKTQHNL  237
            + GK +  L
Sbjct  245  EWGKNKDAL  253



>ref|XP_007048544.1| TGACG-sequence-specific DNA-binding protein TGA-2.1, putative 
[Theobroma cacao]
 gb|EOX92701.1| TGACG-sequence-specific DNA-binding protein TGA-2.1, putative 
[Theobroma cacao]
Length=245

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 126/243 (52%), Gaps = 45/243 (19%)
 Frame = -3

Query  884  FSSSMRSKV--EESFTDFFEKWMAQLEECAQLLLIAAENE----KDHEF--LVNKLTTHY  729
             +S++RS     E+F +FFE W+ +  +  Q L+ A++       D     L+ ++  +Y
Sbjct  1    MASAVRSPAPERETFQNFFECWLVEQNQHLQELIAASQQHHSTADDDSLCSLIKRVLENY  60

Query  728  KNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAF----------------R  597
            ++YY AK    +EDVLA  +P W ++ + A+LW+ GW+P  AF                 
Sbjct  61   EHYYKAKARWGKEDVLAMLSPAWTSTFKDAFLWIGGWRPIMAFHLLYFKSGLQLEDQLNE  120

Query  596  LVAGEG------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVEL------  453
            L+ G G      +S  Q+ +++ L+ K   EE++V  +M + Q  +AD  M+EL      
Sbjct  121  LIRGMGRGDLGDLSPCQLSRIDELQAKTIKEEKEVTEKMAKHQETVADSSMLELNHLVSG  180

Query  452  -------ARLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLA  294
                    R G G+  + +  K    GL+++++ AD +RL+TLK ++D++ P  ++HFL 
Sbjct  181  NDEERGWGRCGSGEGESAMECKEE--GLKEMLQRADDLRLRTLKAVIDILTPIQAVHFLI  238

Query  293  SAS  285
            +A+
Sbjct  239  AAA  241



>ref|XP_006643777.1| PREDICTED: transcription factor TGA6-like [Oryza brachyantha]
Length=266

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 122/242 (50%), Gaps = 31/242 (13%)
 Frame = -3

Query  908  SPWKPSRQFSSSMRSKVEESFTDFFEKWMAQLEE-----CAQLLLIAAENEKDHEFLVNK  744
            SP  P R   +   +   E+F  FFE W+++         +      A  + D   LV++
Sbjct  4    SPHSPQRN-GNHAPAHSGETFAKFFECWISEQSRDLAALRSAASASPAPPDVDLRGLVDR  62

Query  743  LTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG-----  579
            +  HY+ YY  K AAA  DVL  F+P W ++ E+ YLW  GW+P+ A  L+  +      
Sbjct  63   VLGHYEYYYRTKSAAASNDVLCMFSPSWTSTTENLYLWCGGWRPTAALHLLYSKSGAQLE  122

Query  578  -------------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVE  456
                               +S EQ++  + L+     +E ++E  +   Q ++A  +MV 
Sbjct  123  AQLPMFLTGGSLGTNDLGDLSAEQLQAADQLQRSTVRKEREIENAVASAQESLATVKMVA  182

Query  455  LARLGGGDTVA-DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASML  279
            LA  GG D  A +  +K+   G+++V++MAD +RL+T++ ++ ++ P+ ++HFL +A+ L
Sbjct  183  LAGGGGMDVEAMETEMKSKAEGMKRVLEMADGLRLETMREVVALLRPSQAVHFLIAAAEL  242

Query  278  QI  273
             +
Sbjct  243  HL  244



>gb|EAY72627.1| hypothetical protein OsI_00493 [Oryza sativa Indica Group]
Length=269

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/235 (28%), Positives = 122/235 (52%), Gaps = 34/235 (14%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEE---------CAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWA  702
            ESF  FFE W+++             A     A  ++ +   LV+++  HY++YY  K A
Sbjct  22   ESFAKFFECWISEQSRDLAALRSAASAATNPAAPPDDAELRRLVDRVLGHYEHYYRTKSA  81

Query  701  AAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG-------------------  579
            AA  DVL  F+P W ++ E+ YLW  GW+P+ A  L+  +                    
Sbjct  82   AASTDVLRMFSPSWTSTTENLYLWCGGWRPTAALHLLYSKSGAQLETQLPVFLAGGGLGT  141

Query  578  -----MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVA-DV  417
                 +S EQ++  + L+    ++E ++E      Q ++A  +MVELA  GG D    ++
Sbjct  142  GDLGDLSAEQLQAADQLQRITISKEREIENAAASAQESLATVKMVELAGGGGVDAEGMEM  201

Query  416  AVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
             +++   G+ +V++MAD +RL+T++ ++ ++ P+ ++HFL +A+ L + + + G+
Sbjct  202  EMRSKADGMRRVLEMADGLRLETMREVVALLRPSQAVHFLIAAAELHLAVHEFGR  256



>ref|XP_011082768.1| PREDICTED: transcription factor TGA1 [Sesamum indicum]
Length=227

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/219 (31%), Positives = 107/219 (49%), Gaps = 25/219 (11%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLL---LIAAENEKDH---EFLVNKLTTHYKNYYTAKWAAARED  687
            F  F++ W  QL +  Q L    I    E+ H     LV+K  +HY  YY AK AAA+ D
Sbjct  3    FQRFYDTWFEQLRQLVQQLSEAPIPPTTEEHHLQLRQLVHKAMSHYAEYYRAKSAAAKHD  62

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG----------  537
            VLAFF+  W TSLE +  W+ GW+P+TAF LV  E     +   V++LRG          
Sbjct  63   VLAFFSAPWTTSLERSLHWIGGWRPTTAFHLVYTESSILFESHVVDILRGFHTGDLGDLS  122

Query  536  -----KIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNMLGGLEKVMKM  372
                 ++   + +  ++       ++D +      LG      D  ++     L K+++ 
Sbjct  123  PGQFRRVSELQIETVQQENDITDELSDWQDDTTDILGTKYGDGDRKMEK----LAKILER  178

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            AD +RLKT++ L++++ P  +  FL +A+ L   +R  G
Sbjct  179  ADQLRLKTIETLVELLTPQQAAEFLVAAAELHFGVRGWG  217



>ref|XP_004137901.1| PREDICTED: transcription factor TGA7-like [Cucumis sativus]
 ref|XP_004156668.1| PREDICTED: transcription factor TGA7-like [Cucumis sativus]
 gb|KGN58743.1| hypothetical protein Csa_3G731050 [Cucumis sativus]
Length=235

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 108/207 (52%), Gaps = 7/207 (3%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAE---NEKDHEFLVNKLTTHYKNYYTAKWAAAREDV  684
            +SF  FFE W+ +       LL  A      +D +  ++++ +HY++YY  K   A+ D+
Sbjct  9    DSFKAFFEAWLLRQRNYLDDLLSTAHGTPQNRDLQVSISRILSHYEDYYEKKSRIAQTDI  68

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLRGKIKAeeekv  510
               F P W T+ E   LW+ G++P    RLV  + + +S+EQ+ ++  L+   K EE  +
Sbjct  69   FLVFTPPWFTTYEKTLLWIGGFRPGLIVRLVNQSIDDLSDEQVVRIRRLKDDTKVEERLL  128

Query  509  eremerqqVAMADRRMVELARLGGGDTV--ADVAVKNMLGGLEKVMKMADCVRLKTLKGL  336
              ++ + Q  +A   ++E  R GG D V   + A++++    + V+  AD +R  T   +
Sbjct  129  NNDLAKIQEKVAAPPLLEFFRHGGHDGVIGGEAAMESLKAAFQSVLASADLLRRDTALKV  188

Query  335  LDVMGPTHSIHFLASASMLQIQMRKCG  255
              ++ P  ++ FLA+ + L +++R  G
Sbjct  189  TQILTPAQTVRFLAAVAQLHLRVRALG  215



>ref|XP_009769468.1| PREDICTED: transcription factor TGA6-like [Nicotiana sylvestris]
Length=262

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/215 (28%), Positives = 114/215 (53%), Gaps = 16/215 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-EKDHEFLVNKLTT----HYKNYYTAKWAAARED  687
            SF  FF+ W+ + E+    L+IA    ++  E ++  L +    HY+ Y+  K   +  +
Sbjct  15   SFEAFFQGWLLRQEQFLNELIIAQNTFDESQEGVIKNLISGVLAHYQEYFEEKSRMSHRN  74

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeek  513
            V   F+P W T LE +YLW+ G+KP  AF LV    + +S+ Q++++  L+ + + +E+ 
Sbjct  75   VFNVFSPAWFTPLEKSYLWIAGFKPGLAFSLVMNSVDDLSQNQVERINRLKFETRVQEKN  134

Query  512  veremerqqVAMADRRMVELARL---------GGGDTVADVAVKNMLGGLEKVMKMADCV  360
            +  E+ + Q ++A    + LA+          GG     D  ++ +   LE V+  AD +
Sbjct  135  LMDELAKIQESVAAPPFMGLAQQFGVHLLRGDGGKIREVDENIETLRSALENVITDADKL  194

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            R +T + ++ ++ P  S+ FL +A+ LQ+++R  G
Sbjct  195  RTRTAERVVGILNPLQSLRFLTAAAQLQLRIRMLG  229



>gb|EYU23360.1| hypothetical protein MIMGU_mgv1a019261mg [Erythranthe guttata]
Length=289

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 71/245 (29%), Positives = 119/245 (49%), Gaps = 43/245 (18%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEFL-----VNKLTTHYKNYYTAKWAAARED  687
            SF  FF+ WM +     Q L+ A +       L     V ++  HY++YY  K   A++D
Sbjct  26   SFHMFFDSWMVEQNYQLQELVSATKEWGGGSVLLIPDVVEQVVHHYEHYYKTKSMWAKKD  85

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE-------------------------  582
            +L+ F+P W  SLE A++W  GW+P+T F L+  +                         
Sbjct  86   ILSMFSPTWTHSLEKAFMWAGGWRPATTFHLLYSKCGLQLEAAFEDDYHLPSGLNTGDLG  145

Query  581  GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA---------RLGGGD-  432
             +S  QM +V+ L  +   EE+ +  ++ ++Q  +AD  MV L          R+   D 
Sbjct  146  DLSHSQMVRVDELHKRTLWEEKMITEKLAKKQETIADSSMVGLTHSVATELMIRVEEHDH  205

Query  431  ---TVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
                V D A+ +   GL  +++MAD +RLKTLK L+ ++ P   +HFL +A+ L +++ +
Sbjct  206  DQQVVVDAALASKEKGLVVILQMADDLRLKTLKQLILILSPIQGVHFLIAAAELHLKIHE  265

Query  260  CGKTQ  246
             GK +
Sbjct  266  WGKNR  270



>ref|XP_002272378.1| PREDICTED: transcription factor TGA5-like [Vitis vinifera]
Length=243

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 109/217 (50%), Gaps = 19/217 (9%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAA----------ENEKDHEFLVNKLTTHYKNYYTAKW  705
            E F  FF  W+ + EE  QLLL A           + E   + L+ ++  HY  YY AK 
Sbjct  13   EPFETFFRGWLVRQEEVRQLLLQATTERDCDKAREDEEARLQGLIGRVVAHYAEYYKAKL  72

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKI  531
               RED L  F P W T  E   LW+ G+KP  A RLV      ++EEQ + +E +R ++
Sbjct  73   RVVREDALNMFEPPWFTLFERNLLWIGGFKPGLALRLVRNYVTNLTEEQTRMMEDVRTEM  132

Query  530  KAeeekveremerqqVAMADRRMVELA-----RLGGGDTVADVAVKNMLGGLEKVMKMAD  366
              EE ++  E+E+ +       +VE+A     R  G     D  ++ +   +E +++ AD
Sbjct  133  AEEERELAAELEKVKTGPTMISLVEMATRGRERSNGERDEVDEQIEIVKLAVETLVECAD  192

Query  365  CVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +R KT   ++D++ P+ ++ FL + +  Q+Q+R C 
Sbjct  193  YLRCKTALKIMDILNPSQNLKFLLAIT--QLQLRVCN  227



>ref|XP_006356862.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Solanum tuberosum]
Length=236

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/225 (30%), Positives = 120/225 (53%), Gaps = 18/225 (8%)
 Frame = -3

Query  881  SSSMRSKVEESFTDFFEKWMAQLEE-CAQLLLIAA-----ENEKDHEFLVNKLTTHYKNY  720
            +S+  S+   +   ++E W+ QL+    +L  I++     E E     LV K+  HY++Y
Sbjct  2    ASTSTSQTPSNINPYYENWLIQLQNFLEKLNAISSSYGEDEEENKSSELVTKVLDHYQDY  61

Query  719  YTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVA---GEGMSEEQMKKVE  549
            Y  K+ +   DV    +P W TSLE  +LW+ G+KPST F  +    G  ++ EQ +K++
Sbjct  62   YREKFNSTNRDVFLLVSPPWYTSLEKTFLWIAGFKPSTLFPTINYSIGSELTTEQEEKLK  121

Query  548  VLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVAD---VAVKNMLGGLEKVM  378
             L+ + K EE+ +E+ M + Q   A   + EL + GG  TV D     +++++ G++  M
Sbjct  122  RLKAETKREEKVIEKGMAKVQERGAAPPIFELMKRGG--TVVDGEATDLESIIDGMKNSM  179

Query  377  ----KMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
                + A+ +R  T++ +LD++    S+  LA+ +   +Q RK G
Sbjct  180  MSMVETAEHLRGSTVRKILDILQQKQSVKLLAAVAQFHLQARKLG  224



>ref|XP_006472990.1| PREDICTED: transcription factor TGA5-like [Citrus sinensis]
Length=313

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 115/209 (55%), Gaps = 12/209 (6%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLL--IAAENEKD---HEFLVNKLTTHYKNYYTAKWAAARED  687
            +F  FF+ W+ + E  +  LL  IA EN  +   H+ L++++ +HY+ YY  K  AA ED
Sbjct  83   NFEAFFKDWLIRQENLSYQLLDAIAPENIHNNELHQCLIDQVLSHYQQYYLEKSLAATED  142

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeek  513
            V    +P WLT  E  +LW+ G++PS  F+L+A   + ++ EQ  +V+ ++ + + EE +
Sbjct  143  VFQIISPPWLTFPERTFLWIGGFRPSLIFKLIANSVQDLTAEQESEVQQVKAETRREERE  202

Query  512  veremerqqVAMADRRMVELAR-----LGGGDTVADVAVKNMLGGLEKVMKMADCVRLKT  348
            + + M R Q ++A    + LAR     + G    A+ A+K +  G+  V++ AD +R   
Sbjct  203  LGQTMARVQESVASAPFMNLARRSANLVDGEVPEAEAAMKELQKGMVAVLEAADALRSTA  262

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRK  261
               +L ++ P  ++ FLA+ +   +  R+
Sbjct  263  AWKVLQILLPIQTVKFLAAVAQFHLTTRR  291



>ref|XP_007206845.1| hypothetical protein PRUPE_ppa027068mg [Prunus persica]
 gb|EMJ08044.1| hypothetical protein PRUPE_ppa027068mg [Prunus persica]
Length=245

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/210 (30%), Positives = 108/210 (51%), Gaps = 12/210 (6%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAAREDV  684
            F  FFE W+ + E     LL A +      ++D   LV ++  HY+ YY  K   A+ DV
Sbjct  12   FGAFFEAWLVRQEHFLDELLSAQQRINEARDEDQRDLVYRVLLHYQQYYDEKSRIAQRDV  71

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAeeekv  510
               F+P W TS E + LW+ G+KP  AFRL+      +S+ Q  ++  L  + + EE  +
Sbjct  72   FLVFSPPWFTSFERSLLWIAGYKPGLAFRLLTESVPDLSDGQRVRMARLMEETRVEERAL  131

Query  509  eremerqqVAMADRRMVELARLGG----GDTV-ADVAVKNMLGGLEKVMKMADCVRLKTL  345
              ++ +   ++A   +V++AR  G    G+ V  DVA+  +   LE V++ ++ +R    
Sbjct  132  NDKLAKIHESVAAPPLVDVARRYGRFANGEIVEEDVAIDELKSALESVLENSNLLRTTMA  191

Query  344  KGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
              L+D++    ++ FLA+    Q+++R  G
Sbjct  192  TKLVDMLSSAQAVRFLAAVVQFQLKIRSLG  221



>ref|XP_008442399.1| PREDICTED: transcription factor HBP-1b(c38) [Cucumis melo]
Length=235

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 108/207 (52%), Gaps = 7/207 (3%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAE---NEKDHEFLVNKLTTHYKNYYTAKWAAAREDV  684
            +SF  FFE W+ +       LL AA    + +D +  ++++ +HY++YY  K   A+ D+
Sbjct  9    DSFKAFFEAWLLRQRNYLDDLLSAAHGSPHNRDLQVSISRILSHYEDYYEKKSRIAQTDI  68

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLRGKIKAeeekv  510
               F P W T+ E   LW+ G++P    RLV  + + +S+EQ+ ++  L+   K EE  +
Sbjct  69   FLVFTPPWFTTYERTLLWIGGFRPGLIIRLVNQSIDDLSDEQVVRIRRLKDDTKIEERLL  128

Query  509  eremerqqVAMADRRMVELARLGGGDTV--ADVAVKNMLGGLEKVMKMADCVRLKTLKGL  336
              ++ + Q  +A   ++E  R GG D     + A++ +    + V+  AD +R  T   +
Sbjct  129  NNDLAKIQEKVAAPPLLEFFRHGGHDGAVGGEEAMETLKAAFQSVLASADLLRRDTALKV  188

Query  335  LDVMGPTHSIHFLASASMLQIQMRKCG  255
              ++ P  ++ FLA+ + L +++R  G
Sbjct  189  TQILTPAQTVRFLAAVAQLHLRVRALG  215



>ref|XP_010277361.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Nelumbo 
nucifera]
Length=269

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 113/210 (54%), Gaps = 13/210 (6%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAE------NEKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            F  F E W+ + ++    ++ A         E+D   L+ ++ +HY+ Y   K  AA  D
Sbjct  54   FHAFLEGWLVRQQQFLDEIVYAKRFCHDDSREQDLRDLIARVLSHYQQYLGEKSRAAHRD  113

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAeeek  513
            V    +P W +SLE A  W+ G++P   FRLVA     +S++Q++ +E LR +  AEE +
Sbjct  114  VFLVLSPPWFSSLERALFWIGGFRPGLVFRLVANSVGDLSQDQVQWMETLRAETSAEERQ  173

Query  512  veremerqqVAMADRRMVELAR-----LGGGDTVADVAVKNMLGGLEKVMKMADCVRLKT  348
            +E E+ R Q ++    + EL R     + G +  A+  +++M+   E ++  AD +R  T
Sbjct  174  LEEELARLQESVVAPPLSELLRRRGRAVNGEEGNANPVLESMITEFEILLGSADMLRANT  233

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKC  258
               ++ ++ P  ++ FLA+A+ LQ+++R+ 
Sbjct  234  ATKMIQILSPVQTVSFLAAAAQLQLRIRRT  263



>ref|XP_009768149.1| PREDICTED: transcription factor TGA7-like [Nicotiana sylvestris]
Length=249

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 120/235 (51%), Gaps = 19/235 (8%)
 Frame = -3

Query  881  SSSMRSKVEESFTDFFEKWMAQLEECAQLL-----------LIAAENEKDHEFLVNKLTT  735
            S+S     E +   ++E W+ QLE   + L             A EN      LV ++  
Sbjct  5    STSKNPSFEANIDTYYENWLIQLENFLEKLNEVSASYDVFNEEAEENRSSSSKLVTQVLD  64

Query  734  HYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVA---GEGMSEEQ  564
            HY+ YY  K+ A   D     +P W TSLE  +LW+ G+KPS  F  +    G+ ++ +Q
Sbjct  65   HYQEYYQEKFKATNGDTFFLNSPPWYTSLERTFLWMAGFKPSMLFPTINYSIGQELTPDQ  124

Query  563  MKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVA-VKNMLGGLE  387
             +K++ L+ +IK +E+ +E+ M + Q ++A   + EL + GG     + + ++ ++ GL+
Sbjct  125  GEKLKKLKSEIKRDEKAIEKGMAKVQESVAAPPIFELMKRGGLLVDGEASELETVIDGLK  184

Query  386  KVM----KMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNLS  234
            + M    + A+ +R   ++ +LD++ P  ++  LA+ +   +Q RKCG    N S
Sbjct  185  QSMMAMIEAAEHLRGSAVRKVLDILPPKQAVKLLAAVAQFHLQARKCGLRMDNQS  239



>ref|XP_008219160.1| PREDICTED: transcription factor HBP-1b(c38) [Prunus mume]
Length=232

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 117/211 (55%), Gaps = 13/211 (6%)
 Frame = -3

Query  848  FTDFFEKWMAQ----LEECAQLLLIAAENEKDHE--FLVNKLTTHYKNYYTAKWAAARED  687
            F  F   W+ +    L++  +L+ + +   K H+   L+ ++  HY+ Y++ K   A ED
Sbjct  13   FIAFLGGWLERQQTFLDQLLRLVDLPSSENKAHQQRHLIEQVLCHYQQYFSEKDLTAEED  72

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeek  513
            V   F+P WL+S E   LW+ G+KPS   R+V    E ++EEQ +K+E ++G+ +  E +
Sbjct  73   VFVLFSPPWLSSFERTMLWLAGFKPSLVLRMVDSSVEDLTEEQARKMEAVKGETRWAERE  132

Query  512  veremerqqVAMADRRMVELAR-----LGGGDTVADVAVKNMLGGLEKVMKMADCVRLKT  348
            +  +M R Q ++A   ++ LAR     + G  +  D+A++ +   +  V + AD +R  +
Sbjct  133  LSEKMARIQESVAAPPILALARRVGRLMDGEISSLDLAMETLKTAMLGVFESADGLRGSS  192

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            ++ +++V+ P  ++  LA+ +  Q+ +R+ G
Sbjct  193  VRKVVEVLRPEQTVKVLAAVAQFQLGIRRLG  223



>ref|XP_008442174.1| PREDICTED: transcription factor TGA2-like isoform X1 [Cucumis 
melo]
Length=281

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/251 (29%), Positives = 127/251 (51%), Gaps = 50/251 (20%)
 Frame = -3

Query  857  EESFTDFFEKWMAQLEECAQLLL--IAAENEKDH------EFLVNKLTTHYKNYYTAKWA  702
            +ESF +FF+KWM +  +    L+  +     KD+      E L+ ++  HY++YY  K  
Sbjct  23   QESFGEFFKKWMKEQNQYLTELISTVKGGGNKDNDGDIVAEALMKRVMEHYEHYYRVKSH  82

Query  701  AAREDVLA-FFAPVWLTSLESAYLWVTGWKPSTAFRLVAG------EG------------  579
               +D LA   +P W++S E A+LW+ GW+P+ AF L+        EG            
Sbjct  83   WVEKDALAGILSPSWISSFEDAFLWLGGWRPTMAFHLLYSKSGLQLEGRLLDLIHGLSTG  142

Query  578  ----MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL---------GG  438
                +S  Q+ K++ L+  +  +E+++  +M + Q  +AD  MVEL+ +         GG
Sbjct  143  DLADLSSHQVVKIDTLQRGVVKQEKEITEKMAKYQETIADPSMVELSHMATKFKMETSGG  202

Query  437  GDTVA----------DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASA  288
            G+              +A+     GL++V+KMAD +RL TLK ++ ++  T  +HFL +A
Sbjct  203  GEQNNRDLSMVEEELKLALAGKEDGLKEVVKMADELRLGTLKQIIGILTSTQRVHFLIAA  262

Query  287  SMLQIQMRKCG  255
            + L +++ + G
Sbjct  263  AELHLRIHEWG  273



>gb|KGN62783.1| Transcription factor HBP-1b [Cucumis sativus]
Length=237

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 114/226 (50%), Gaps = 13/226 (6%)
 Frame = -3

Query  899  KPSRQFSSSMRSKVEESFTDFFEKWMAQ----LEECAQLLLIAAENEKDHEFLVNKLTTH  732
             PSR    S+   V E+F DF+E W+      LE+   +  IA   E+    L+ ++  H
Sbjct  3    NPSRPMPHSV--SVIENFADFYESWLTTQRGFLEQLLHVSQIADYKEERQLGLIKQVLAH  60

Query  731  YKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMK  558
            Y+ Y+     AA EDV   F+  WLTS E   LW++G+KPS  FRLV G  + ++  Q  
Sbjct  61   YQLYHEEISKAAGEDVFRVFSAPWLTSYERTLLWISGFKPSIVFRLVDGAVKDLTPVQAA  120

Query  557  KVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADV-----AVKNMLGG  393
             VE L+  +K +E  +   M   Q  +A   +V LAR  G     ++     A++ +  G
Sbjct  121  SVEELKTDVKRKERDLAEAMASLQETVAAPPIVGLARRAGRLVDGEICEMENAIEELKIG  180

Query  392  LEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +  V   AD +R  T+K +++++    ++  L +A+  Q ++R+ G
Sbjct  181  MLGVFDGADSLRGTTMKRVMEILRTDQTLRLLTAATEFQQRIRQWG  226



>ref|XP_004249821.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
Length=246

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 111/217 (51%), Gaps = 21/217 (10%)
 Frame = -3

Query  842  DFFE----KWMAQLEECAQLLLIAAE----NEKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            +FFE     W  + E+    L++A +     E D   L++++  HY+ YY  K      +
Sbjct  12   NFFEVFLVGWFIRQEQFQNELVVAQDTFDDQENDMRGLIHRVLAHYQQYYEEKSRMTHRN  71

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeek  513
            V   F+P W + LE ++LW+TG+ P   F LV      +SE Q++++  L+ + KA+E  
Sbjct  72   VFRVFSPTWFSPLERSFLWITGFNPGLVFNLVTNSINDLSEHQVERLNRLKQETKAQERS  131

Query  512  veremerqqVAMADRRMVELARLGG-----GDTV------ADVAVKNMLGGLEKVMKMAD  366
            + +E+ + Q ++A   +V+LAR  G      D +       D  +  +   LE V+  AD
Sbjct  132  LTKELAQIQESVASPPLVDLARRLGTQLLYTDNINTDIEEVDGDIDQLKTALENVVTDAD  191

Query  365  CVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +R +T + ++ ++ P  S+ FL++   LQ++ R  G
Sbjct  192  RLRTRTAERVVGLLSPLQSLKFLSAVGQLQLRARMMG  228



>ref|XP_009618663.1| PREDICTED: transcription factor TGA1-like [Nicotiana tomentosiformis]
Length=228

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 113/221 (51%), Gaps = 28/221 (13%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLL---LIAAENEKDHEF---LVNKLTTHYKNYYTAKWAAARE  690
            SF  F++ W  QL+     L      A +++ HE    LV K+ +HY  YY  K  AA+ 
Sbjct  2    SFQRFYDAWFEQLKGMVHQLNQVPRPATSDQHHELHKQLVQKVMSHYYEYYRVKSLAAKN  61

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKA-----  525
            D+ + F+  W TSLE +  W+ GW+P+TAF L+  E     +   +++LRG         
Sbjct  62   DIFSVFSAPWSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRGLRYGDLGDL  121

Query  524  ------eeekveremerqqVAMADRRMVELARLGGGDT-----VADVAVKNMLGGLEKVM  378
                     +++ E  +++ A+AD    EL+    G +       D+ VK  + GL  ++
Sbjct  122  SPDQLHRVSELQCEAVQEENAIAD----ELSDWQDGASEVIGLTGDIDVK--MEGLVSIL  175

Query  377  KMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            + AD +R+KT++ L+ ++ P  ++ FL +A+ LQ  +R+ G
Sbjct  176  ERADKLRMKTIENLVQLLSPQQAVEFLIAAAHLQFGIRRWG  216



>ref|XP_006366944.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum tuberosum]
Length=240

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 111/210 (53%), Gaps = 11/210 (5%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAE--NEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLA  678
            SF  F + W  + E+    L I     +E     L++++ +HY+ YY  K   +  +V  
Sbjct  14   SFEAFLQGWFLRQEQFLNELTITQTTLDESIMRNLISRILSHYQEYYEEKSRMSHINVFY  73

Query  677  FFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeekver  504
             F+P W T LE ++LW+ G+KP  AF LV      +SE Q++++  LR + + EE  +  
Sbjct  74   MFSPSWFTPLEKSFLWIAGFKPGLAFPLVMNSVNDLSENQIERINRLRIETRIEERNLMD  133

Query  503  emerqqVAMADRRMVELARLGGGD-------TVADVAVKNMLGGLEKVMKMADCVRLKTL  345
            ++ + Q ++A   ++ LA+  G +       T  D  ++ +   +E V+  AD +R +T 
Sbjct  134  KLAKLQESVAAPPLMGLAQQYGMEMLRDGEITEVDEEIEILRTAVENVVTDADRLRTRTA  193

Query  344  KGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
              ++ ++ P  S+ FLA+A+ LQ+++R  G
Sbjct  194  DSVVGILNPLQSLKFLAAAAQLQLRIRMVG  223



>ref|XP_007021794.1| Uncharacterized protein TCM_031867 [Theobroma cacao]
 gb|EOY13319.1| Uncharacterized protein TCM_031867 [Theobroma cacao]
Length=261

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 103/214 (48%), Gaps = 16/214 (7%)
 Frame = -3

Query  839  FFEKWMAQLEECAQLLLIAAENE--KDH----EFLVNKLTTHYKNYYTAKWAAAREDVLA  678
            F+  W  QL    + L  A +    +DH      LV KL +HY  YY  K AAA  DV  
Sbjct  44   FYNTWSDQLHHLLRQLCSAPKPPTMQDHLHHLNHLVTKLLSHYSEYYRVKAAAAERDVFD  103

Query  677  FFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekverem  498
             FA  W +SLE +  W+ GW+P+T F LV  E     +   V++LRG    +   +    
Sbjct  104  IFAAPWASSLEKSLHWIAGWRPTTVFHLVYTESSILFESHIVDILRGVRTGDLGDLSPSQ  163

Query  497  erqqVAMADRRMVELARLGG-----GDTVADVA-----VKNMLGGLEKVMKMADCVRLKT  348
             R+   +    + E   +         +V D+       + M+G L  +++ AD +RL+T
Sbjct  164  FRRVSELQCETVKEENAITDELSEWQHSVTDLVGSFTDAEQMIGRLVSIVQKADDLRLRT  223

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            LK ++D++ P  ++ FL +A+ LQ  +R+ G  Q
Sbjct  224  LKRVVDLLTPQQAVEFLIAAAELQFGIREWGLNQ  257



>emb|CDP06468.1| unnamed protein product [Coffea canephora]
Length=249

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 115/219 (53%), Gaps = 20/219 (9%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENE------KDHEF---LVNKLTTHYKNYYTAKWAA  699
            SF  FFE W+ + +     LL A E+        D +    L+ ++  HY+ YY  K   
Sbjct  15   SFQAFFEDWLVRQQRFLDELLSAQESSSTTSRIDDTDVVGDLIARVLAHYQEYYDEKSRM  74

Query  698  AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKA  525
            A  +V   F+P W T LE  +LW+ G+KP    RL  G  + ++E+Q+ ++  L  +   
Sbjct  75   AHRNVFLAFSPTWFTPLERTFLWIAGFKPGLVCRLALGSLDDLTEDQIHRINGLSRETNW  134

Query  524  eeekveremerqqVAMADRRMVELARLGG-------GDTVADV--AVKNMLGGLEKVMKM  372
            +E+ ++++M + Q ++A   +V+LAR  G       G  + DV   ++ +   ++ +++ 
Sbjct  135  QEKLLDQKMAKIQESVASPPLVDLARSEGMQIQSATGSDIDDVDNQIEPLKSAMQNILRD  194

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            AD +R +T + +  ++ P  ++ FL++A+ LQ ++R  G
Sbjct  195  ADGLRTRTAETMAGILSPLQNVRFLSAAARLQFRIRMLG  233



>ref|XP_004244373.1| PREDICTED: transcription factor TGA5 [Solanum lycopersicum]
Length=226

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 110/229 (48%), Gaps = 44/229 (19%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLL------LIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARE  690
            SF  F+E W  QL+E  + L        +  + + H+ LV K+ +H   YY  K  AA+ 
Sbjct  2    SFQRFYETWFDQLKEIVRQLNQVPRPATSDHHRELHQLLVQKVVSHIYEYYRVKSLAAKN  61

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekv  510
            D+L+ F+  W TSLE +  W+ GW+P+TAF L+  E     +   +++LRG         
Sbjct  62   DILSVFSAPWSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRG---------  112

Query  509  eremerqqVAMADRRMVELARLG--------GGDTVAD---------VAVKNMLGGLE--  387
                  +   + D    +LAR+           +++ D           +  ++G +E  
Sbjct  113  -----LRYGDLGDLSPEQLARVSEFQCETVHEENSITDELNDWQDGASEIIGLMGDIEEK  167

Query  386  -----KVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
                 ++++ AD +R+KT++ L+ ++ P  ++ FL +++ LQ  +RK G
Sbjct  168  MEKLVEILEKADKLRMKTIENLVQLLTPQQAVEFLIASAHLQFGIRKWG  216



>ref|XP_010086637.1| hypothetical protein L484_004349 [Morus notabilis]
 gb|EXB22356.1| hypothetical protein L484_004349 [Morus notabilis]
Length=232

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 102/232 (44%), Gaps = 40/232 (17%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAE--NEKDHEF----LVNKLTTHYKNYYTAKWAAARED  687
            F +F+E W+ QL    + L  A       DH +    LV K+ +HY  YY  K  AA  D
Sbjct  9    FCNFYETWLEQLHHLVRQLTAAPRPPTTPDHHYDLDVLVGKVMSHYAEYYRVKSVAAERD  68

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekve  507
             L+ FA  W ++LE +  W+ GW+P+T F LV  E     +   +++LRG    +   + 
Sbjct  69   TLSVFAAPWASALERSLHWIAGWRPTTVFHLVYSESSILFESHIIDILRGLRTGDLGDLS  128

Query  506  remerqqVAMADRRMVELARLGGGDTV----------------------ADVAVKNMLGG  393
                        RR+ EL      DTV                      A   +K  +G 
Sbjct  129  PSQF--------RRVSELQ----CDTVREENAITEEFSEWQDSASELVNARADLKEKIGR  176

Query  392  LEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNL  237
            L  V++ AD +RL+T + ++D++ P  +  FL +A+ LQ  +R  G     L
Sbjct  177  LVSVLRKADDLRLRTFQSVVDLLTPQQAAEFLIAAAELQFGVRGWGVNHDRL  228



>ref|XP_004514219.1| PREDICTED: uncharacterized protein LOC101514340 [Cicer arietinum]
Length=231

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/213 (29%), Positives = 113/213 (53%), Gaps = 14/213 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAE-----NEKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            SF +F + WM +     + LL A +     ++ D   L+N++  HY  YY  K   A+++
Sbjct  8    SFEEFIQGWMVRQRNYLEELLSAQQQRQELDDSDRMSLLNRVLCHYGQYYEEKSKIAQQN  67

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeek  513
            +L  F+P WL+SLE ++LWV G+KP  AF +V    E +S++Q +++  +  + K +E +
Sbjct  68   ILLVFSPPWLSSLEKSFLWVAGFKPGMAFHVVNRVLEDLSQDQKQRLSQINQETKMKERE  127

Query  512  veremerqqVAMADRRMVELARLGG-----GDTVADVAVKNML--GGLEKVMKMADCVRL  354
            +  E+ +   +MA   +V++ R  G        +A+     M     LE ++  AD +R 
Sbjct  128  LNDELAKVHESMAAPPLVDMIRSHGRVCLSRSFMAEEGTVPMTFKETLENLVTNADALRT  187

Query  353  KTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +T   ++ V+ P   ++F  + + LQI++R  G
Sbjct  188  ETALRVVQVLKPAQVLNFFVAVAELQIKIRSLG  220



>ref|XP_008345524.1| PREDICTED: transcription factor TGA4-like [Malus domestica]
Length=251

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 106/211 (50%), Gaps = 12/211 (6%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            +F  FFE W+ + E     LL A        ++D + L++++  HY+ YY  K   A+ D
Sbjct  13   TFVAFFEGWLVRQEHFLDELLSAQRTVDEARDEDLQDLISRVLLHYQQYYDEKSRLAQRD  72

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAeeek  513
            V   F+P W +S E   LW+ G+KP   FR+V       S+ Q   +  LR + + EE  
Sbjct  73   VFLVFSPTWFSSYERTLLWIAGYKPGLVFRIVTESVPDFSDRQRINIARLRVETRIEERA  132

Query  512  veremerqqVAMADRRMVELARLGG----GDTVADVAV-KNMLGGLEKVMKMADCVRLKT  348
            +  ++     ++A    V++ R  G    G+ V D+AV +++   LE V+  A+ +R   
Sbjct  133  LNDKLANIHESVAAPPFVDVLRRYGRARDGEIVEDIAVIESLKPALESVLVNANLLRTTM  192

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +  L++++    ++ FL + +  Q+++R  G
Sbjct  193  VTKLVEILSSRQAVRFLTAVAQFQLKIRSLG  223



>ref|XP_008386261.1| PREDICTED: transcription factor TGA5-like [Malus domestica]
Length=227

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 102/218 (47%), Gaps = 16/218 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN----EKDHEFL--VNKLTTHYKNYYTAKWAAARE  690
            SFT F+E W  QL      L          +  H+ L  V K+  HY  YY  K  AA  
Sbjct  3    SFTSFYETWFEQLHHLVHQLSTCPRPPTTPDHHHQLLHVVQKVMAHYAEYYRVKSLAAER  62

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekv  510
            D L+ F   W T+LE +  W+ GW+P+TAF LV  E     +   V++LRG    +   +
Sbjct  63   DALSVFVAPWATTLERSLHWIGGWRPTTAFHLVYSESSIHFEAHIVDILRGYRTGDLGDL  122

Query  509  eremerqqVAMADRRMVELARL---------GGGDTVADVA-VKNMLGGLEKVMKMADCV  360
                 R+   +    + E   +         G  + + +   ++  +G L  V+K AD +
Sbjct  123  TPSQFRRVSDLQCETVKEENAISDELSEWQDGACELMGEYTNLETNMGLLVSVLKKADEL  182

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            RLKTL+ +++++ P  ++ FL +A+ LQ  +R  G  Q
Sbjct  183  RLKTLRKVVELLTPQQAVEFLIAAAELQFGVRGWGLNQ  220



>ref|NP_001237999.1| bZIP transcription factor bZIP132 [Glycine max]
 gb|ABI34670.1| bZIP transcription factor bZIP132 [Glycine max]
Length=225

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/214 (28%), Positives = 107/214 (50%), Gaps = 24/214 (11%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFF  672
            +F DF+E+W  +L+   Q L      E   E ++ K+  H++NYY AK AAA +D L  F
Sbjct  12   AFADFYEQWFEELQSLMQQL----RGEGRKEEVMEKVMWHHQNYYVAKSAAAEKDPLNVF  67

Query  671  APVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG---------------  537
               W T+LE +  W+TGW+P+TAF L+  E     +   +++L+G               
Sbjct  68   LSPWATTLERSLHWITGWRPTTAFHLIYTESSLMFESHIIDILQGLRTGDLGDLSPSQFR  127

Query  536  KIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNMLGGLEKVMKMADCVR  357
            ++   +    +E       +++ +      +G G  + D      +G L  ++K AD +R
Sbjct  128  RVSDIQCDTVKEENAITEELSEWQDSVSEMMGPGANIND-----KIGRLVCIIKKADDLR  182

Query  356  LKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            L+TL+ ++ ++ P  +I FL +++ L + +R  G
Sbjct  183  LRTLRSVVGLLSPQQAIEFLIASAELLVGIRGWG  216



>ref|XP_003530288.1| PREDICTED: transcription factor HBP-1b(c38)-like [Glycine max]
 gb|KHN44703.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=233

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/219 (30%), Positives = 111/219 (51%), Gaps = 24/219 (11%)
 Frame = -3

Query  851  SFTDFFEKWMAQ----LEE--CAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARE  690
            SF  F + WM +    L+E   AQ      +++ D   L+N++  HY  Y+  K   A +
Sbjct  8    SFEAFLQGWMVRQRGYLDELLSAQQHYQEMQDDDDVRQLINRVICHYGQYFEEKSKIAHQ  67

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLRGKIKAeee  516
            +VL  F+P W +SLE  +LWV G+KP  +F++V  A E +SEEQ +++ +L  + K +E 
Sbjct  68   NVLLVFSPPWFSSLERTFLWVGGFKPGVSFQVVNTALEDLSEEQKERLSLLNQETKVKER  127

Query  515  kveremerqqVAMADRRMVELARLGG------------GDTVADVAVKNMLGGLEKVMKM  372
             +  E+ +   ++A   +V++AR  G            G +V     +     LE ++  
Sbjct  128  ALNDELAKLHESVAAPPLVDMARSHGRVCFSRSFMAEEGSSVPSTFRET----LENLVAN  183

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            AD +R  T   +  V+ P   + FL + + LQI++R  G
Sbjct  184  ADALRTNTSLKIFQVLRPAQIVSFLVAVAELQIRIRSWG  222



>ref|XP_004148432.1| PREDICTED: transcription factor TGA4-like [Cucumis sativus]
 ref|XP_004166651.1| PREDICTED: transcription factor TGA4-like [Cucumis sativus]
Length=230

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 109/213 (51%), Gaps = 11/213 (5%)
 Frame = -3

Query  860  VEESFTDFFEKWMAQ----LEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAR  693
            V E+F DF+E W+      LE+   +  IA   E+    L+ ++  HY+ Y+     AA 
Sbjct  7    VIENFADFYESWLTTQRGFLEQLLHVSQIADYKEERQLGLIKQVLAHYQLYHEEISKAAG  66

Query  692  EDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAee  519
            EDV   F+  WLTS E   LW++G+KPS  FRLV G  + ++  Q   VE L+  +K +E
Sbjct  67   EDVFRVFSAPWLTSYERTLLWISGFKPSIVFRLVDGAVKDLTPVQAASVEELKTDVKRKE  126

Query  518  ekveremerqqVAMADRRMVELARLGGGDTVADV-----AVKNMLGGLEKVMKMADCVRL  354
              +   M   Q  +A   +V LAR  G     ++     A++ +  G+  V   AD +R 
Sbjct  127  RDLAEAMASLQETVAAPPIVGLARRAGRLVDGEICEMENAIEELKIGMLGVFDGADSLRG  186

Query  353  KTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             T+K +++++    ++  L +A+  Q ++R+ G
Sbjct  187  TTMKRVMEILRTDQTLRLLTAATEFQQRIRQWG  219



>ref|XP_006348396.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Solanum tuberosum]
Length=226

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/215 (27%), Positives = 113/215 (53%), Gaps = 16/215 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLL------LIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARE  690
            SF  F++ W  QL+E  + L        + ++ + H+ LV K+ +H   YY  K  AA+ 
Sbjct  2    SFQRFYDTWFDQLKEIVRQLSQVPRPATSEQHRELHQQLVQKVVSHIYEYYRVKSLAAKN  61

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekv  510
            D+L+ ++  W TSLE +  W+ GW+P+TAF L+  E     +   +++LRG    +   +
Sbjct  62   DILSVYSAPWSTSLERSLHWIAGWRPTTAFHLIYTESSILFESHIIDILRGLRYGDLGDL  121

Query  509  eremerqqVAMADRRMVELARLGG-----GDTVADV--AVKNMLGGLEK---VMKMADCV  360
              +   +   +    + E   +        D+ +++   + ++ G +EK   +++ AD +
Sbjct  122  SPDQLARVSELQCEAVQEENSITDEFNDWQDSASEILGLMGDIEGKMEKLVEILEKADKL  181

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            RLKT++ L++++ P  +I FL +++ LQ  +R+ G
Sbjct  182  RLKTIENLVELLTPQQAIEFLIASAHLQFGIRRWG  216



>ref|XP_010905699.1| PREDICTED: transcription factor HBP-1b(c38)-like [Elaeis guineensis]
Length=169

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 93/201 (46%), Gaps = 40/201 (20%)
 Frame = -3

Query  839  FFEKWMAQLEECAQLLLIAAENEKDH-EFLVNKLTTHYKNYYTAKWAAAREDVLAFFAPV  663
            FF+ W+A LEE    LL A  +  D    LV +   HY++YY  K   A  DVL  F+P 
Sbjct  4    FFDAWIAGLEELQNELLSAPRDRPDLLRPLVARALNHYQDYYHEKARLAARDVLRVFSPR  63

Query  662  WLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekveremerqqV  483
            WLT  E ++ W+ GWKPS AF +   + ++  +  +    RG+                 
Sbjct  64   WLTPFERSFHWIAGWKPSLAFPMALSQVLAVARRVRDGEARGQ-----------------  106

Query  482  AMADRRMVELARLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIH  303
                                  A + ++  LE ++  AD +R +T+  L+D++ P  S+ 
Sbjct  107  ----------------------AAEMVVRSLELLLASADALRTRTVTCLVDILTPAQSVD  144

Query  302  FLASASMLQIQMRKCGKTQHN  240
            FL +A+ L++++R+ G  ++ 
Sbjct  145  FLLAAAQLRLRVRRWGMRRYG  165



>ref|XP_003596341.1| Transcription factor TGA5 [Medicago truncatula]
 gb|ABD32966.1| tumor-related protein-like, putative [Medicago truncatula]
 gb|AES66592.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=222

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 107/211 (51%), Gaps = 14/211 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFF  672
            +F  F+E W  Q       L ++   + D E L+ K+ +H+++YY AK  AA +D L   
Sbjct  3    NFAQFYESWHTQFNNLIHQLKLSTSTQTDSEELIQKVLSHHQDYYNAKSMAAEKDPLHVL  62

Query  671  APVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLR-------GKIKAeeek  513
            A  W T+LE +  W+ GW+P+TAF L+  E     +   +++LR       G +   + +
Sbjct  63   ASPWATTLERSLHWIAGWRPTTAFHLIYTESSLLFESHIIDILRGFRTGDLGDLSPNQFR  122

Query  512  veremerqqVAMADRRMVELARLGGGDTVADV-----AVKNMLGGLEKVMKMADCVRLKT  348
               +++   V   +    EL+     D+ +D+      + + +  L  ++K AD +RL+T
Sbjct  123  RVSDLQCDTVKEENAITEELSEW--QDSASDMMGSEADINDKIERLVSIIKKADDLRLRT  180

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            L+ +++ + P  ++ FL +++ L + +R  G
Sbjct  181  LRSVVEFLSPQQAVEFLIASAELVVGIRGWG  211



>ref|XP_009789761.1| PREDICTED: transcription factor TGA2-like [Nicotiana sylvestris]
Length=234

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/219 (30%), Positives = 107/219 (49%), Gaps = 26/219 (12%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIA---AENEKDHEF---LVNKLTTHYKNYYTAKWAAARED  687
            F  F E+W  QL E  Q L  A   A N++ HE    LV K T+HY  YY  K  AA+ D
Sbjct  11   FHQFHEEWHEQLRELVQQLKKAPRPATNQEQHELHTHLVQKFTSHYYEYYRVKSMAAKND  70

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG----------  537
            +L  F+  W  SLE +  W+ GW+P+TAF ++  +     +   V++LRG          
Sbjct  71   ILHIFSAPWSNSLERSLYWIAGWRPTTAFHIIYTKSSILFESPIVDILRGFGNGDLGDLS  130

Query  536  -----KIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNMLGGLEKVMKM  372
                 ++   + +  ++       ++D +    A +G   T+ DV  K  +G L ++++ 
Sbjct  131  PNQLSRLSEFQYETVQQENAITEQLSDWQDSGNAIIG---TMGDVDGK--MGRLVEILEK  185

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            AD +R+KT++ LL ++    +  FL  A+ L   +R  G
Sbjct  186  ADQLRMKTIENLLQLLTAQQAAEFLILAAHLLFGIRGWG  224



>ref|XP_007137287.1| hypothetical protein PHAVU_009G114600g [Phaseolus vulgaris]
 gb|ESW09281.1| hypothetical protein PHAVU_009G114600g [Phaseolus vulgaris]
Length=181

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 94/171 (55%), Gaps = 3/171 (2%)
 Frame = -3

Query  758  FLVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AG  585
             ++ ++  HY+ +   K   A  DV   F+P WL++ ES+ LW+  +KPS   RL   A 
Sbjct  1    MVIEQVLCHYQQFLEEKSNVANGDVFLLFSPPWLSAYESSLLWIGDYKPSLILRLADCAV  60

Query  584  EGMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELAR-LGGGDTVADVAVK  408
            +  + EQ  K+E +R + K  E ++   M   Q +MA  RM+ L R + G  T  ++A++
Sbjct  61   KSFTPEQRDKMERVRDETKRAEREISEAMASVQESMASPRMLALVREVDGEITEQELALR  120

Query  407  NMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +   L+KV +  D +R  T++ +++++ P  ++  LA+    Q+++RK G
Sbjct  121  GLKEALKKVSERGDALRASTMRKVVEILSPPQTVQLLAATMRFQMRVRKHG  171



>ref|XP_010037696.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 gb|KCW49450.1| hypothetical protein EUGRSUZ_K02977 [Eucalyptus grandis]
Length=246

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/215 (31%), Positives = 111/215 (52%), Gaps = 16/215 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            SF  F E W+ + +   + LL A  +     + DH  L++++  HY+ YY  K   A  D
Sbjct  19   SFESFLEAWLVRQKRYLEELLSAQHSSCEVRQDDHLELIHRVLYHYQQYYEEKSRVANWD  78

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeek  513
            V   F+P WLT+LE A LW+ G++P+  FRLV+     M+E+Q ++++ L  + + EE+ 
Sbjct  79   VFLVFSPPWLTNLERALLWIAGFRPNLLFRLVSSSVNDMTEDQSRRMDRLVAETRMEEKA  138

Query  512  veremerqqVAMADRRMVELARLGG-----GDTVADVAVKNMLGG----LEKVMKMADCV  360
            +  E+ + Q  +    +    R  G     G+T       + LGG    LEKV+  AD +
Sbjct  139  LNDELAKIQERVGAPPLANAIRRYGRTAQDGETADGSGDDSALGGLRKALEKVVANADML  198

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            R  T + +  V+ P   +  LA+ + LQ+++R  G
Sbjct  199  RATTGEKVALVLTPPQMVKVLAAVAQLQLKVRGLG  233



>ref|XP_006593493.1| PREDICTED: bZIP transcription factor bZIP132 isoform X1 [Glycine 
max]
Length=266

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 108/207 (52%), Gaps = 12/207 (6%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFF  672
            +F DF+E+W  +L+   Q L      E   E ++ K+  H++NYY AK AAA +D L  F
Sbjct  55   AFADFYEQWFEELQSLMQQL----RGEGRKEEVMEKVMWHHQNYYVAKSAAAEKDPLNVF  110

Query  671  APVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekveremer  492
               W T+LE +  W+TGW+P+TAF L+  E     +   +++L+G    +   +     R
Sbjct  111  LSPWATTLERSLHWITGWRPTTAFHLIYTESSLMFESHIIDILQGLRTGDLGDLSPSQFR  170

Query  491  qqVAM---ADRRMVELARLGGGDTVADV-----AVKNMLGGLEKVMKMADCVRLKTLKGL  336
            +   +    +   +        D+V+++      + + +G L  ++K AD +RL+TL+ +
Sbjct  171  RVSDIQCDTEENAITEELSEWQDSVSEMMGPGANINDKIGRLVCIIKKADDLRLRTLRSV  230

Query  335  LDVMGPTHSIHFLASASMLQIQMRKCG  255
            + ++ P  +I FL +++ L + +R  G
Sbjct  231  VGLLSPQQAIEFLIASAELLVGIRGWG  257



>ref|XP_008444975.1| PREDICTED: transcription factor TGA4 [Cucumis melo]
Length=237

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 113/226 (50%), Gaps = 13/226 (6%)
 Frame = -3

Query  899  KPSRQFSSSMRSKVEESFTDFFEKWMAQ----LEECAQLLLIAAENEKDHEFLVNKLTTH  732
             PSR    S+   V E+F DF+E W+      LE+   +  I    E+    L+ ++  H
Sbjct  3    NPSRPIPHSV--SVIENFADFYESWLTTQRSLLEQLLHVSQITDYKEERQLGLIKQVLAH  60

Query  731  YKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMK  558
            Y+ Y+     A  EDV   F+  WLTS E   LW++G+KPS  FRLV  A + ++  Q  
Sbjct  61   YQLYHEEISKAVSEDVFRTFSAPWLTSYERTLLWISGFKPSIVFRLVDSAVKDLTPAQAA  120

Query  557  KVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADV-----AVKNMLGG  393
             +E L+  +K +E  +   M   Q  +A   +V LAR  G     ++     A++ +  G
Sbjct  121  SLEELKADVKRKERDLTEAMASLQETVAAPPLVGLARRAGRLVDGEICEMKNAIEELKIG  180

Query  392  LEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +  V   AD +R  T+K +++++    ++  LA+A+  Q ++R+ G
Sbjct  181  MLGVFYSADLLRGSTMKRVMEILKTDQTLRPLAAATEFQQRIRRWG  226



>ref|XP_011075022.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=262

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 118/242 (49%), Gaps = 39/242 (16%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLE-ECAQLLLIAAENEKDHEF--LVNKLTTHYKNYYTAKWAAAREDV  684
            ++F +F+ +W  +       L+  A +      F  LV+++ +HY+ YY  K  + + DV
Sbjct  14   KNFEEFYIRWKEKQNLHLHDLITTATKPSPSSSFPALVDRVISHYEEYYRVKSKSIKTDV  73

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------------------MSE  570
            L   +  W T LE A+ WV GW+PS AF L+  +                       +S 
Sbjct  74   LLILSAPWKTGLEVAFNWVGGWRPSAAFHLLYSKSGLQLEAKLSELTKGVDMGDLSDLSS  133

Query  569  EQMKKVEVLRGKIKAeeekveremerqqVAMADRRMV-------ELARLGGGDT------  429
             Q+ +++ L+     +E ++  ++ ++Q   AD  MV       ELAR  GG +      
Sbjct  134  AQLSRMDKLQRITIQQEREISEKVAKRQERAADWEMVELSHDVSELARTQGGQSNNSKMA  193

Query  428  -VADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
               D  +K+    L+ V++ AD +RLKTLK ++D++ P  ++HFL +A+ L +++   GK
Sbjct  194  RAVDSTLKHKEKDLQLVVQSADNLRLKTLKSIVDILSPIQAVHFLIAAAELHLRIHDWGK  253

Query  251  TQ  246
             +
Sbjct  254  VK  255



>ref|XP_008243515.1| PREDICTED: transcription factor TGA4-like [Prunus mume]
Length=246

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 106/210 (50%), Gaps = 12/210 (6%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAAREDV  684
            F  FFE W+ + E     LL A +      ++D   LV ++  HY+ YY  K   A+ DV
Sbjct  14   FGAFFEAWLVRQEHFLDELLSAQQRINEARDEDLRDLVYRVLLHYQQYYDEKSRIAQRDV  73

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAeeekv  510
               F+P W TS E + LW+ G+KP  AFRL+      + + Q  ++  L  + + EE  +
Sbjct  74   FLVFSPPWFTSFERSLLWIAGYKPGLAFRLLTESVPDLCDGQRVRMARLMEETRVEERAL  133

Query  509  eremerqqVAMADRRMVELARLGG----GDTV-ADVAVKNMLGGLEKVMKMADCVRLKTL  345
              ++ +   ++A   +V++AR  G    G+ V  DVA+  +   LE V+  ++ +R    
Sbjct  134  NDKLAKIHESVAAPPLVDVARRYGRFANGEIVEEDVAIDELQSALESVLANSNLLRTTMA  193

Query  344  KGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
              L+D++    ++ FL + +  Q+++R  G
Sbjct  194  TKLVDMLSSAQAVRFLGAVAQFQLKIRSLG  223



>ref|XP_010276977.1| PREDICTED: transcription factor TGA2 [Nelumbo nucifera]
Length=232

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 99/187 (53%), Gaps = 17/187 (9%)
 Frame = -3

Query  770  KDHEFL---VNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAF  600
            +DH +L    +++ THY++YY  K  AA+ DVLA F+  W TSLES+  W+ GW+P+T F
Sbjct  38   EDHRYLSQLADRVMTHYEDYYRIKSHAAKHDVLAMFSAPWTTSLESSLHWIAGWRPTTVF  97

Query  599  RLVAGEGMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARL--------  444
             +V  E     + + V++LRG    +   +      +   +  + + E   +        
Sbjct  98   HIVYTESSVRFEAQIVDLLRGHRTGDLGDLTPRQLTRVSELQCQTVREENEITEELSQWQ  157

Query  443  -GGGDTVADVAVKNMLGGLEK---VMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQ  276
                D V+  A  NM   +E+   V++ AD +RLKTL+ +++++ P  ++ FL + + +Q
Sbjct  158  NNSCDLVSPSA--NMEANIERLVEVLEKADDLRLKTLRRVVEILTPQQAVEFLIATAEVQ  215

Query  275  IQMRKCG  255
            + +R  G
Sbjct  216  LGIRGWG  222



>ref|XP_009339278.1| PREDICTED: transcription factor TGA5 [Pyrus x bretschneideri]
Length=229

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 114/214 (53%), Gaps = 15/214 (7%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKDHE-------FLVNKLTTHYKNYYTAKWAAA  696
            E F  F   W+ + +     LL   E+  D+E        L+ ++ +HY+ Y+  K   A
Sbjct  9    ERFVTFLGGWLDRQQTFLDQLLNLVES-PDYENKDARERILIEQVLSHYQQYFAEKARTA  67

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAe  522
             ED    F+P WL+S E + LW+ G+KPS   R+V    E ++ EQ+++++ ++G+ +  
Sbjct  68   EEDAFVLFSPPWLSSFERSLLWLGGFKPSMVLRMVDSSVEDLTAEQVREMDAVKGETRRA  127

Query  521  eekveremerqqVAMADRRMVELAR-----LGGGDTVADVAVKNMLGGLEKVMKMADCVR  357
            E  +   M R Q ++A   ++ LAR     + G  +  D+A++ +   +  V + AD +R
Sbjct  128  ERDLSETMARIQESVAAPPILALARRVGRPMEGEISSLDMAMEMLKTAMLGVFESADGLR  187

Query  356  LKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
              T++ +++V+ P  ++  LA+ +  Q+++R+ G
Sbjct  188  GSTVRKVVEVLSPEQTVKVLAAVAQFQLRIRRWG  221



>ref|XP_007212919.1| hypothetical protein PRUPE_ppa022280mg [Prunus persica]
 gb|EMJ14118.1| hypothetical protein PRUPE_ppa022280mg [Prunus persica]
Length=229

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 102/218 (47%), Gaps = 16/218 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLV------NKLTTHYKNYYTAKWAAARE  690
            SFT F+E W  QL      L          +          K+ +HY  YY  K  AA  
Sbjct  5    SFTSFYETWFEQLHNLVHQLSTCPRPPTTPDHHHHLLHVVQKVMSHYDEYYRVKALAAER  64

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLR-------GKI  531
            D LA F   W T+LE +  W+ GW+P+TAF LV  E     +   V++LR       G +
Sbjct  65   DALAVFVAPWATTLERSLHWIAGWRPTTAFHLVYSESSIHFEAHIVDILRGFSTGDLGDL  124

Query  530  KAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNM---LGGLEKVMKMADCV  360
               + +   E++ + V   +    EL+    G +    A  N+   +G L  V+K AD +
Sbjct  125  SPSQFRRVSELQCETVKEENAISEELSEWQEGASELMGACTNLDMKMGRLVTVLKKADNL  184

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            RL+T++ +++++ P  ++ FL +A+ LQ  +R  G  Q
Sbjct  185  RLRTVRKVVELLTPQQAVEFLIAAAELQFGVRGWGMNQ  222



>ref|XP_009629955.1| PREDICTED: transcription factor TGA1-like [Nicotiana tomentosiformis]
Length=227

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 105/219 (48%), Gaps = 26/219 (12%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIA---AENEKDHEF---LVNKLTTHYKNYYTAKWAAARED  687
            F  F E W  QL E AQ L  +   A N++ HE    L+ K T+HY  YY  K  AA+ D
Sbjct  4    FHQFHEAWHEQLREIAQQLKKSPRPATNQEQHELHTQLIQKFTSHYYEYYRVKSMAAKND  63

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG----------  537
            +L  F   W  SLE +  W+ GW+P+TAF +   E     + + V++LRG          
Sbjct  64   ILHIFTAPWSNSLERSLYWIAGWRPTTAFHIFYTESSILFESQIVDILRGFRNGDLVDLS  123

Query  536  -----KIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNMLGGLEKVMKM  372
                 +    + +  ++       ++D +      +G   T+ DV  K  +  L ++++ 
Sbjct  124  PNQLSRFSELQYETVQQENAITEQLSDWQDSANDMIG---TMGDVDRK--MERLVEILEK  178

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            AD +R+KT++ LL ++    ++ FL +A+ L   +R  G
Sbjct  179  ADQLRMKTIENLLQLLTAQQAVEFLIAAAHLLFGIRGWG  217



>ref|XP_009377744.1| PREDICTED: transcription factor TGA4-like [Pyrus x bretschneideri]
Length=251

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLL-----IAAENEKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            +F  FFE W+ + E     LL     I    ++D   L++++  HY+ YY  K   A  D
Sbjct  13   TFVAFFEGWLVRQEHFLDELLSTQQTIDEARDEDLRDLISRVLLHYQQYYDEKSRLAHRD  72

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAeeek  513
            V   F+P W +S E   LW+ G+KP   FR+V      +S+ Q   +  LR + + EE  
Sbjct  73   VFLVFSPKWFSSYERTLLWIAGYKPGLVFRIVTESVPDLSDRQRVNIARLREETRVEERA  132

Query  512  veremerqqVAMADRRMVELARLGG----GDTVADVAV-KNMLGGLEKVMKMADCVRLKT  348
            +  ++ +   ++A    V++ R  G    G  V D+AV +++   LE V+  A+ +R   
Sbjct  133  LNDKLAKIHESVAAPPFVDVLRRYGRARDGGIVEDIAVIESLKPALESVLVNANLLRTTM  192

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +  L++++    ++ FL + +  Q+++R  G
Sbjct  193  VTKLVEILSSRQAVRFLTAVAQFQLKIRSLG  223



>ref|XP_004489078.1| PREDICTED: transcription factor HBP-1b(c38)-like [Cicer arietinum]
Length=223

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 103/214 (48%), Gaps = 22/214 (10%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFF  672
            +F  F++ W  Q     Q L     N+ D E L+ K+ +H+++YY AK  AA +D L   
Sbjct  6    TFAQFYDSWFDQFHCLVQQL--NTPNQTDAEELIRKVMSHHEDYYNAKSMAAEKDPLHVL  63

Query  671  APVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG---------------  537
            A  W T+LE +  W+ GW+P+TAF L+  E     +   +++LRG               
Sbjct  64   ASPWATTLERSLYWIAGWRPTTAFHLIYTESSLLFESHIIDILRGLRTGDLGDLSPTQFR  123

Query  536  KIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNMLGGLEKVMKMADCVR  357
            ++   +    +E       +++ +      +G  D      +   +G L  ++K AD +R
Sbjct  124  RVSDLQCDTVKEENAITEELSEWQDNASELMGSEDD-----INENIGRLVCIIKKADDLR  178

Query  356  LKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            L+TL+ +++ + P  +I FL +++ L + +R  G
Sbjct  179  LRTLRSVVEFLSPQQAIEFLIASAELLVGIRGWG  212



>ref|XP_010064245.1| PREDICTED: transcription factor TGA1-like [Eucalyptus grandis]
 gb|KCW66703.1| hypothetical protein EUGRSUZ_F00466 [Eucalyptus grandis]
Length=265

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 116/245 (47%), Gaps = 28/245 (11%)
 Frame = -3

Query  896  PSRQFSSSMRSKVE-ESFTDFFEKWMAQLEECAQLLLIAAENEKDH--------------  762
            P+   S   RS    E+F  FFE W+AQ E     LL+ A   +                
Sbjct  14   PNFPLSYDSRSPPHMETFEAFFEDWLAQQEAFLDQLLLRASAPQGQSCPSHDHRGDGDGD  73

Query  761  ----EFLVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL  594
                  L+ ++  HY+ +Y  K   ARED   FF+  WLTS E  +LW+  +KP+  FR 
Sbjct  74   GEADRALIEQVLGHYQRFYEEKTRVAREDAFLFFSAPWLTSFERTFLWIGDFKPTLLFRF  133

Query  593  V--AGEGMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVAD  420
            +  A +G++  Q ++VE +  + +  E ++   M R Q ++    ++ L R   G    D
Sbjct  134  LGSAVDGLTAAQSEEVERIGAETRWRERELTEAMARVQESVGAPPLLCLLRASAGQPPRD  193

Query  419  -------VAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
                   VA+  +   +  V++ A+ +R  T + L++V+ P  ++  LA+A+  Q+++R 
Sbjct  194  GELCALEVAMAQLKEAMVAVLEDANALRAATARRLMEVLSPAQTVKLLAAAAQFQVRIRW  253

Query  260  CGKTQ  246
             GK +
Sbjct  254  WGKQR  258



>ref|XP_004238547.1| PREDICTED: transcription factor HBP-1b(c38) [Solanum lycopersicum]
Length=243

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 118/226 (52%), Gaps = 19/226 (8%)
 Frame = -3

Query  881  SSSMRSKVEESFTDFFEKWMAQLEE-CAQLLLIAA------ENEKDHEFLVNKLTTHYKN  723
            S+S         + ++E W+ QL+    +L  I++      E E     LV ++  HY++
Sbjct  3    STSTSQTPSNIISPYYENWLIQLQYFLEKLNAISSSYGGDDEEENRSNELVTQVLDHYQD  62

Query  722  YYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVA---GEGMSEEQMKKV  552
            YY  K+ +   DV    +P W TSLE  +LW+ G+KPST F  +    G  ++ EQ + +
Sbjct  63   YYREKFNSTNRDVFLLVSPPWYTSLEKTFLWIAGFKPSTLFPTINYSIGSELTTEQCENL  122

Query  551  EVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVAD---VAVKNMLGGLEKV  381
            + L+ + K EE+ +E+ M + Q  +A   + EL + GG  TV D     +++++ G++  
Sbjct  123  KRLKAETKREEKVIEKGMAKVQEKVAAPPIFELMKRGG--TVVDGEASELESVIDGMKHS  180

Query  380  M----KMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            M    + A+ +R  T+K +LD++    ++  LA+ +   +Q RK G
Sbjct  181  MMSMVETAEHLRGSTVKNILDILRQKQAVKLLAAVAQFHLQARKLG  226



>ref|XP_008366197.1| PREDICTED: transcription factor TGA5-like [Malus domestica]
Length=229

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 113/214 (53%), Gaps = 15/214 (7%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEKDHEF-------LVNKLTTHYKNYYTAKWAAA  696
            E F  F   W+ + +     LL   E+  D+E        L+ ++ +HY+ Y+  K   A
Sbjct  9    ERFVKFLGGWLDRQQTFLDQLLKLVES-PDYENKDARERNLIEQVLSHYQQYFAEKARTA  67

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAe  522
             EDV   F+P WL+S E + LW+ G+KPS   R+V    E ++ EQ ++++ ++G+ +  
Sbjct  68   EEDVFVLFSPPWLSSFERSLLWLAGFKPSMVLRMVDSSVEDLTAEQAREMDAVKGETRRG  127

Query  521  eekveremerqqVAMADRRMVELAR-----LGGGDTVADVAVKNMLGGLEKVMKMADCVR  357
            E  +   M R Q ++A   ++ L R     + G  +  D+A++ +   +  V + AD +R
Sbjct  128  ERDLSETMARIQESVAAPPILALVRRVGRQMDGEISSLDMAMEMLKTAMLGVFESADGLR  187

Query  356  LKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
              T++ +++V+ P  ++  LA+ +  Q+++R+ G
Sbjct  188  GSTVRKVVEVLSPEQTVKVLAAVAQFQLRIRRWG  221



>ref|XP_007140269.1| hypothetical protein PHAVU_008G097900g [Phaseolus vulgaris]
 gb|ESW12263.1| hypothetical protein PHAVU_008G097900g [Phaseolus vulgaris]
Length=231

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/216 (29%), Positives = 111/216 (51%), Gaps = 20/216 (9%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEK-----DHEFLVNKLTTHYKNYYTAKWAAARED  687
            SF  F + WM + +E    LL A +  +     D   L++++  HY  Y+  K   A  +
Sbjct  8    SFEAFLQGWMVRQKEFLGELLSAQQQYQEGRRADVRPLIDRVICHYGQYFEEKSKLAHHN  67

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLRGKIKAeeek  513
            +   F+P W +SLE ++LWV G+KP  AF++V  A   ++E+Q +K+  L+ + K +E  
Sbjct  68   IFLVFSPPWFSSLEKSFLWVGGFKPGVAFQVVNTALRDLTEDQKEKMSKLKKESKVKERT  127

Query  512  veremerqqVAMADRRMVELARLGG----------GDTVADVAVKNMLGGLEKVMKMADC  363
            +  ++ + Q ++AD  +V++AR  G             +   A K     LE ++  AD 
Sbjct  128  LNDDLAKLQESVADPPLVDMARSQGRLCFSRSFMVDQGLVPSAFKE---KLENLVADADA  184

Query  362  VRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +R  T   ++ ++ P   + F+ SA+ LQI++R  G
Sbjct  185  LRTDTALKIMKILRPAQIVSFMVSAAELQIKIRSWG  220



>gb|EYU45030.1| hypothetical protein MIMGU_mgv1a018123mg [Erythranthe guttata]
Length=467

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 107/218 (49%), Gaps = 17/218 (8%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAE----NEKDHEF--LVNKLTTHYKNYYTAKWAAARED  687
            F  +++ W +QL +  Q L  +      +E  H+   L+NK  +HY +YY AK  +A+ D
Sbjct  243  FQCYYDTWFSQLRQLVQQLSQSPNPPTTDEHHHQLRQLINKAMSHYADYYAAKSVSAKHD  302

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekve  507
            VL FF+P W T+LE +  W+ GW+P+TAF LV  E     +   +++LRG    +   + 
Sbjct  303  VLEFFSPPWTTALERSLHWIGGWRPTTAFHLVYTESSILFESHVIDILRGFHTGDLGDLS  362

Query  506  remerqqVAMADRRMVELARLGGG-----DTVADVA------VKNMLGGLEKVMKMADCV  360
                 +   +  + + E   +        D  +D+A      V   +  L  +++ AD +
Sbjct  363  PAQFARVSELQIQTVHEENDITDDLSDWQDEASDLAAAIYGDVGRKMEKLVGILERADQL  422

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            RL+T+K L++++       FL +A+ LQ  +   G  Q
Sbjct  423  RLRTMKSLVELLTLQQGAEFLVAAAELQFGIHGWGLQQ  460


 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 105/240 (44%), Gaps = 33/240 (14%)
 Frame = -3

Query  881  SSSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAE--NEKDHEFLVNKLTTHYKNYYTAK  708
            SS++ ++    F D+ ++    L E     L+AA+  +    + LV K   H++ Y   +
Sbjct  4    SSNLHNQFHSCFNDWIDQQNHDLHE-----LVAADISDGAQTKRLVEKGVQHFEEYCGKR  58

Query  707  WAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIK  528
               A+ D ++  +P W TSLE+A LWV G +PS + RLV     SE   +  E LRG  K
Sbjct  59   AVMAQHDAISLMSPAWCTSLENAALWVGGCRPSLSIRLVYSVCGSELDEQLEEFLRGVRK  118

Query  527  AeeekveremerqqVAMADRRMVELARLGG-----GDTVADVAVKNMLGGLEKV------  381
                ++  +      A+  R + E  ++        + +AD  +  +  G E+V      
Sbjct  119  GNLAEISGQQLHMINALHCRIVKEEDKISARIATLQEEIADKPLAVIAKGAERVGEWSRD  178

Query  380  ---------------MKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
                           +  AD +RL T K L+ ++ P+ ++  L +   L I M +  KT 
Sbjct  179  VERAANAHSLSLAGILVEADRLRLSTFKELMAILTPSQALDLLIATKKLHISMHEVKKTN  238



>ref|XP_006477767.1| PREDICTED: transcription factor TGA1-like [Citrus sinensis]
 gb|KDO35852.1| hypothetical protein CISIN_1g040790mg [Citrus sinensis]
Length=231

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 106/211 (50%), Gaps = 17/211 (8%)
 Frame = -3

Query  827  WMAQLEECAQLLLIAA------ENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFFAP  666
            W  QL +  Q L  AA      +  +D E LV K  THY  YY  K A A+ DV   FA 
Sbjct  13   WFEQLNQLVQQLSAAARPPTTYDQHQDLEKLVAKTLTHYTEYYKVKSAEAQRDVFNVFAA  72

Query  665  VWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLR-------GKIKAeeekve  507
             W +SLE +  W+ GW+P+T F LV  E  +  +   V++LR       G +   + +  
Sbjct  73   PWASSLERSLHWIAGWRPTTVFHLVYTESSTLFESHIVDILRGLRTGDLGDLSPSQFRRV  132

Query  506  remerqqVAMADRRMVELA--RLGGGDTVAD--VAVKNMLGGLEKVMKMADCVRLKTLKG  339
             E++ + V   +    EL+  + G  + V D   +V   +  L  +++ AD +RL+T++ 
Sbjct  133  SELQCETVKEENAITDELSEWQDGASELVGDCSASVDEKIRLLVSIVQKADDLRLRTVRR  192

Query  338  LLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            ++D++    ++ FL +A+ LQ  +RK G  Q
Sbjct  193  VVDLLTTQQAVEFLIAAAELQFGVRKWGLDQ  223



>gb|KDP34795.1| hypothetical protein JCGZ_10575 [Jatropha curcas]
Length=229

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/224 (29%), Positives = 107/224 (48%), Gaps = 22/224 (10%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHE------FLVNKLTTHYKNYYTAKWAAARE  690
            SF  F+E W  QL      L   ++   + +        V+KL  HY  YY  K AAA  
Sbjct  6    SFGRFYETWFDQLHHMVNQLRKTSKPPPNQDAAAHLSHFVDKLMNHYAEYYRVKSAAAER  65

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG---------  537
            DVL+ F   W +SLE +  W+ GW+P+T F L+  E     +   V++LRG         
Sbjct  66   DVLSVFTAPWASSLERSLHWIAGWRPTTLFHLMYTESSILFESHIVDILRGLRTGDLGDL  125

Query  536  KIKAeeekveremerqqVAMADRRMVE----LARLGGGDTVADVAVKNMLGGLEKVMKMA  369
                   +++ E  +++ A+ D ++ E     + L G  +  DV  K  +G L  ++  A
Sbjct  126  SPTQRVSELQCETVKEENALTD-QLSEWQDGASELAGSTSGTDVDEK--IGRLVSIVHRA  182

Query  368  DCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHNL  237
            D +RL+T++ ++D++ P  +  FL + + LQ  +   G+ Q  L
Sbjct  183  DDLRLRTVRMIVDMLTPYQAAEFLVAVADLQFGIHIRGRNQDRL  226



>ref|XP_004246934.1| PREDICTED: transcription factor TGA2-like [Solanum lycopersicum]
Length=240

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 111/211 (53%), Gaps = 13/211 (6%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEF---LVNKLTTHYKNYYTAKWAAAREDVL  681
            SF  F + W+ + EE    L    +N  D      L++++  HY+ YY  K   +  +V 
Sbjct  14   SFEAFLQGWLIRQEELLNEL-TTTQNTLDESIIRNLISRILAHYQEYYEEKSRMSHINVF  72

Query  680  AFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeekve  507
              F+P W + LE ++LW+ G+KP  AF LV      ++E Q++ +  L+ + + +E  + 
Sbjct  73   YMFSPSWFSPLEKSFLWIAGFKPGLAFPLVMNSVNDLTENQIEMINGLKIETRIQERDLM  132

Query  506  remerqqVAMADRRMVELAR------LGGGD-TVADVAVKNMLGGLEKVMKMADCVRLKT  348
             ++ + Q ++A   ++ LA+      L  G+ +  D  ++ +   +E V+  AD +R KT
Sbjct  133  DKLAKIQESVAAPPLMGLAQQYRMEMLQDGEISEVDEEIEIIRTAMENVVTDADRLRTKT  192

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
               ++ ++ P  S+ FLA+A+ LQ+++R  G
Sbjct  193  ADSVVGILNPLQSLKFLAAAAQLQLRIRMIG  223



>gb|KEH23189.1| transcription factor TGA5-like protein [Medicago truncatula]
Length=231

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/213 (27%), Positives = 108/213 (51%), Gaps = 14/213 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            +F +F + WM +       LL A +      + D   L+N++  HY  YY  K   A ++
Sbjct  8    AFDEFLQGWMIRQRNYLNDLLSAQQQPQELADSDRLNLLNRVLCHYGQYYEEKSKIAHQN  67

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeek  513
            +L  F+P W +SLE ++LWV G+KP   F LV    E +SE+Q +++  L+ +IK +E +
Sbjct  68   ILLLFSPPWFSSLEKSFLWVAGFKPGLTFHLVNKTLEDLSEDQRQRLSELKQEIKMKERE  127

Query  512  veremerqqVAMADRRMVELARLGGGDTVA-------DVAVKNMLGGLEKVMKMADCVRL  354
            +  E+ +   +MA   +++  R  G   ++            +    LE ++  AD +R 
Sbjct  128  LNDELAKVHESMAAPPVLDNVRSHGRVCLSRSFMAEEGTVSSSFKETLENLVTNADALRT  187

Query  353  KTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +T   ++ ++ P   ++F  + + LQ+++R  G
Sbjct  188  ETALRVVQILKPAQVLNFFVAVAELQLKVRSLG  220



>ref|XP_011085128.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=240

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/216 (31%), Positives = 117/216 (54%), Gaps = 17/216 (8%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLL-IAAENEKDHEF-------LVNKLTTHYKNYYTAKWAA  699
            ++F  F ++W    E   + LL + + N  D+E        L++++  H++ Y+ AK   
Sbjct  15   QTFEAFVDQWFIDKEHYLRDLLGLISRNGCDNEVNEAQCKDLIDRVIRHFRQYFEAKARM  74

Query  698  AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKA  525
              ++V     P W +S E AYLW+ G++P  A+RLV      ++EEQ  ++  L  +IK 
Sbjct  75   IGDNVFLVLMPTWFSSFERAYLWMGGFRPGLAYRLVINNVLDLTEEQSWRINTLMTEIKE  134

Query  524  eeekveremerqqVAMADRRMVELARLGG------GDTVADVAVKNMLGGLEKVMKMADC  363
            EE+++  E ++ Q  M    M+EL R GG      G ++A + V  +   LE +++ AD 
Sbjct  135  EEKEITDEFDKVQEVMTSPPMLELLRHGGQLRNGLGHSMA-LLVDQLKSVLEALVECADF  193

Query  362  VRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +R+KT   L++++    +I FLA+A  LQ+ +R+ G
Sbjct  194  LRMKTGIMLIEILKSGQTIRFLAAAMQLQLILRRWG  229



>ref|XP_006602670.1| PREDICTED: transcription factor HBP-1b(c38)-like [Glycine max]
Length=232

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 110/219 (50%), Gaps = 23/219 (11%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAARE  690
            +SF  F + W  +       LL A ++     + D + L+N++  HY  Y+  K   A +
Sbjct  7    DSFEAFLQGWRVRQRGYLDELLSAQQHYHELQDDDVKQLINRVVCHYGQYFEEKSKIAHQ  66

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLRGKIKAeee  516
            +VL  F+P W +SLE  +LWV G+KP  AF++V  A E +SEEQ +++ +L  + K +E 
Sbjct  67   NVLLVFSPPWFSSLERTFLWVGGFKPGVAFQVVNAALEVLSEEQKERLSLLNQETKVKER  126

Query  515  kveremerqqVAMADRRMVELAR------------LGGGDTVADVAVKNMLGGLEKVMKM  372
             +  E+ +   ++A   +V++AR              GG +V     +     LE ++  
Sbjct  127  ALNDELAKLHESVAAPPLVDMARSHGRVCFSRSFMAEGGSSVPSTFRET----LENLVAN  182

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            AD +R  T   +  ++ P+  + FL + + LQI++   G
Sbjct  183  ADALRTNTSLKIFQILRPSQLVSFLVAVAELQIRIGSWG  221



>ref|XP_007149576.1| hypothetical protein PHAVU_005G081900g [Phaseolus vulgaris]
 gb|ESW21570.1| hypothetical protein PHAVU_005G081900g [Phaseolus vulgaris]
Length=215

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/214 (28%), Positives = 106/214 (50%), Gaps = 19/214 (9%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFF  672
            SF  F+ +W  QL+E  Q L      ++ +E +++K+   +++YY AKWAA  +D L  F
Sbjct  4    SFAKFYRRWFEQLQEMVQRL-----KDEHNEEVMDKVMRQHQDYYRAKWAAVEKDPLCVF  58

Query  671  APVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLR-------GKIKAeeek  513
               W T+LE +  W+TGW+P+TAF L+  E     +   +++L        G +   + +
Sbjct  59   LSPWTTTLERSLHWITGWRPTTAFHLIYTESSLLFESHIIDILHGLRTGDLGDLTPSQFR  118

Query  512  veremerqqVAMADRRMVELARLGG-----GDTVADVAVKNMLGGLEKVMKMADCVRLKT  348
               +++   V   +    EL+         GD   D+ +   +  L  ++K AD +RL T
Sbjct  119  HVSDLQCDTVKEENAIQEELSEWQDSASEMGD--PDMDMNEKIIQLVPIIKKADDLRLTT  176

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            L+ ++ ++    +I FL ++  L I +R  G  Q
Sbjct  177  LRSVVRLLSTQQAIEFLIASGELLIGIRSWGMNQ  210



>ref|XP_011074300.1| PREDICTED: transcription factor TGA1 [Sesamum indicum]
Length=274

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 114/210 (54%), Gaps = 11/210 (5%)
 Frame = -3

Query  857  EESFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLA  678
            + SFT FFE+W+++ E   + L     + +  E ++ ++ +HY+  Y  K  AA  DV  
Sbjct  47   DSSFTSFFERWLSRQEAFLRQLETLHRHRECSE-IIPQVFSHYQELYREKSRAAHADVFL  105

Query  677  FFAPVWLTSLESAYLWVTGWKPSTAFRL----VAGEGMSEEQMKKVEVLRGKIKAeeekv  510
              +  WLTS E + LW++G++PS  F +    V GE +S EQ +++E ++ + + +E ++
Sbjct  106  LLSAPWLTSFERSMLWISGFRPSILFPILVNSVGGE-LSAEQRQRIEAVKAETRRKEREI  164

Query  509  eremerqqVAMADRRMVELAR-----LGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTL  345
             + M R Q  +A++ +  L R     + G  T  D ++  +   +  V++ AD ++  T 
Sbjct  165  TQAMARVQETVAEQPLYSLMRKFGKLVDGEVTEFDTSMDRLKAAMLVVVENADALQGWTA  224

Query  344  KGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
              +++++ P   + FLA+ +  Q+Q R+ G
Sbjct  225  VEVVEILSPVQGVKFLAAVARFQLQSRRWG  254



>ref|XP_004305124.1| PREDICTED: transcription factor TGA4-like [Fragaria vesca subsp. 
vesca]
Length=229

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 104/213 (49%), Gaps = 14/213 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            SF  FFE W+ + E     L  A +      E D   LV+++  HY+ YY  K   A+ D
Sbjct  3    SFETFFEGWLVRQEHYLDELQSAQQRAHEAREVDLRDLVSRVLLHYQQYYEEKSRIAQRD  62

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAeeek  513
            V   F+P W TSLE A LW+ G+KP  AFRLV+     +S++Q  +V  L  + + EE  
Sbjct  63   VFMVFSPTWFTSLERALLWIAGFKPGLAFRLVSDSVPDLSDDQRVRVTRLVEETRVEERA  122

Query  512  veremerqqVAMADRRMVELARLGG-------GDTVADVAVKNMLGGLEKVMKMADCVRL  354
            +  ++ +   ++A   +V++AR           +   + A   +   LE V+  A+ +R 
Sbjct  123  LNDKLAKIHESVAAPPLVDVARRHARYVESEGAEGEEEEAATRLKSALEDVLADANLLRT  182

Query  353  KTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
                 L+++M    ++ FL +    Q+++R  G
Sbjct  183  TVATKLVEMMSGAQAVRFLVAVGQFQLKIRSWG  215



>gb|KHG25856.1| Transcription factor TGA1 -like protein [Gossypium arboreum]
Length=226

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 108/218 (50%), Gaps = 16/218 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAE--NEKDH----EFLVNKLTTHYKNYYTAKWAAARE  690
            +FT F+  W  QL++  + L  A +    +DH      LVNK+ +HY  YY  K AAA  
Sbjct  3    TFTAFYTAWSDQLQQLLRQLCSAPKPPTTQDHLHHLNHLVNKVLSHYAEYYRVKAAAAER  62

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekv  510
            DVL  FA  W ++ E +  W+ GW+P+T F LV  E     +   V++LRG    +   +
Sbjct  63   DVLDIFAAPWASAFEKSLHWIAGWRPTTVFHLVYTESSILFESHIVDILRGVRTGDLGDL  122

Query  509  eremerqqVAMADRRMVELARLGG-----GDTVADV-----AVKNMLGGLEKVMKMADCV  360
                 R+   +    + E   +         +V+D+      V  M+  L  V++ AD +
Sbjct  123  SPTQFRRVSELQCETVKEENAITDELSEWQHSVSDLMGATPDVDKMIERLVTVVRKADDL  182

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            RL+TLK ++D++ P  ++ FL +A  LQ  +R+ G  Q
Sbjct  183  RLRTLKRVVDLLTPQQALEFLIAAVELQQGIREWGMNQ  220



>ref|XP_006442481.1| hypothetical protein CICLE_v10022056mg [Citrus clementina]
 gb|ESR55721.1| hypothetical protein CICLE_v10022056mg [Citrus clementina]
Length=231

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 105/211 (50%), Gaps = 17/211 (8%)
 Frame = -3

Query  827  WMAQLEECAQLLLIAA------ENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFFAP  666
            W  QL +  Q L  A       +  +D E LV K  THY  YY  K A A+ DV   FA 
Sbjct  13   WFEQLNQLVQQLSAAPRPPTTHDQHQDLEKLVAKTLTHYTEYYKVKSAEAQRDVFNVFAA  72

Query  665  VWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLR-------GKIKAeeekve  507
             W +SLE +  W+ GW+P+T F LV  E  +  +   V++LR       G +   + +  
Sbjct  73   PWASSLERSLHWIAGWRPTTVFHLVYTESSTLFESHIVDILRGLRTGDLGDLSPSQFRRV  132

Query  506  remerqqVAMADRRMVELA--RLGGGDTVAD--VAVKNMLGGLEKVMKMADCVRLKTLKG  339
             E++ + V   +    EL+  + G  + V D   +V   +  L  +++ AD +RL+T++ 
Sbjct  133  SELQCETVKEENAITDELSEWQDGASELVGDCSASVDEKIRLLVSIVQKADDLRLRTVRR  192

Query  338  LLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            ++D++    ++ FL +A+ LQ  +RK G  Q
Sbjct  193  VVDLLTTQQAVEFLIAAAELQFGVRKWGLDQ  223



>emb|CAN72574.1| hypothetical protein VITISV_036367 [Vitis vinifera]
Length=227

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 101/226 (45%), Gaps = 27/226 (12%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEF-----LVNKLTTHYKNYYTAKWAAARED  687
            SF  F+  W   L      L +A +     +      LV K+ +HY  YY AK  AA+ D
Sbjct  2    SFHRFYASWFDHLNXLVHQLTLAPKPTTPQDNPALLQLVQKVISHYSQYYRAKSVAAQND  61

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG----------  537
             ++ FA  W +SLE +  WV GW+P+  F L+  E  +  +    ++L G          
Sbjct  62   AVSLFAAPWSSSLERSLHWVAGWRPTIVFHLIYTETSARFESHIADILHGVRTGDLGDLS  121

Query  536  -----KIKAeeekveremerqqVAMA--DRRMVELARLGGGDTVADVAVKNMLGGLEKVM  378
                 ++   + +  RE       +A      VEL   GG     D  V+  +GGL  V+
Sbjct  122  TAQLHRVSELQCETVREENEITSELAKWQEGAVELVEAGG-----DGNVEEKIGGLMSVL  176

Query  377  KMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
              AD +R++T+  + +++ P  ++ FL +A+ LQ  +R  G    N
Sbjct  177  VKADELRMRTIWRVAEMLTPQQAVEFLIAAAELQFGVRVLGLNHDN  222



>ref|XP_002283108.1| PREDICTED: transcription factor HBP-1b(c1)-like [Vitis vinifera]
Length=227

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 101/226 (45%), Gaps = 27/226 (12%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEF-----LVNKLTTHYKNYYTAKWAAARED  687
            SF  F+  W   L      L +A +     +      LV K+ +HY  YY AK  AA+ D
Sbjct  2    SFHRFYASWFDHLNHLVHQLTLAPKPTTPQDNPALLQLVQKVISHYSQYYRAKSVAAQND  61

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG----------  537
             ++ FA  W +SLE +  WV GW+P+  F L+  E  +  +    ++L G          
Sbjct  62   AVSLFAAPWSSSLERSLHWVAGWRPTIVFHLIYTETSARFESHIADILHGVRTGDLGDLS  121

Query  536  -----KIKAeeekveremerqqVAMA--DRRMVELARLGGGDTVADVAVKNMLGGLEKVM  378
                 ++   + +  RE       +A      VEL   GG     D  V+  +GGL  V+
Sbjct  122  TAQLHRVSELQCETVREENEITRELAKWQEGAVELVEAGG-----DGNVEEKIGGLMSVL  176

Query  377  KMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
              AD +R++T+  + +++ P  ++ FL +A+ LQ  +R  G    N
Sbjct  177  VKADELRMRTIWRVAEMLTPQQAVEFLIAAAELQFGVRVLGLNHDN  222



>ref|XP_004968271.1| PREDICTED: transcription factor TGA6-like [Setaria italica]
Length=310

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/248 (28%), Positives = 116/248 (47%), Gaps = 32/248 (13%)
 Frame = -3

Query  890  RQFSSSMRSKVEESFTDFFEKWMAQ-----LEECAQLLLIAAENEKDHEFLVNKLTTHYK  726
            R  S    S   ESF+ FFE W+A+         A         E D   L +++  HY+
Sbjct  51   RNGSIPSLSPSNESFSRFFESWIAEQSRDLAALRAAASADPPTREADLRRLADRVLGHYE  110

Query  725  NYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-AGEGMSEEQMKKVE  549
            +YY  K AAA  D+L  F P W ++ E+ +LW  GW+P+ A  L+    GM  E      
Sbjct  111  HYYRTKAAAAAVDLLRMFTPSWTSTTENLFLWCGGWRPTAALHLLYTKSGMQLEHQLPAF  170

Query  548  VLRGKIKAeeekveremerqqVAMADR----------------------RMVELARLGGG  435
            +  G +KA+   +     +    +  R                      +++ELA  GGG
Sbjct  171  LNGGSLKADLGDLSAGQLQDADQLQRRTIKREREIEDAAASAQEALATAKILELAGGGGG  230

Query  434  -DTVA-DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
             D  A +  +K    G+++V++MAD +RL+T++G++ ++ P  ++HFL +A+ + + +  
Sbjct  231  VDADAMEREMKTKADGMKRVLEMADALRLETMRGVVALLRPAQAVHFLLAAAEIHLAVHD  290

Query  260  --CGKTQH  243
              C K  H
Sbjct  291  FGCRKDGH  298



>dbj|BAH30346.1| hypothetical protein [Arabidopsis thaliana]
Length=225

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 106/217 (49%), Gaps = 17/217 (8%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEK-----DHEFLVNKLTTHYKNYYTAKWAA---  699
            E+F  FF  W+ +  +  Q L   A+        + E LV+   +HY  YY  K  A   
Sbjct  8    ETFASFFNDWLCRHRQFVQQLAHLADKTTIVTPIEEESLVSNFLSHYLQYYEEKSVAMSV  67

Query  698  AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKA  525
            A +D+  FF+P WL+S E   LW+ G+KP   F+L+      ++  Q+ ++E +R + K 
Sbjct  68   AGDDIYDFFSPPWLSSYEKLILWIGGFKPGMVFKLITTSVNDLTSHQIDQLESIRLETKR  127

Query  524  eeekveremerqqVAMADR------RMVELARLGGGDTVA-DVAVKNMLGGLEKVMKMAD  366
             E  + R     Q ++ D       R + + RLG G+    + A++ +   + K MK AD
Sbjct  128  RERDLMRRFALLQQSVGDPLLMVPFRRIGVLRLGEGEQPEMEDAMEVLKVEMIKAMKNAD  187

Query  365  CVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +R  T+  +++V+ P  SI  L +A    +++R  G
Sbjct  188  QLRCVTVGKVVEVLNPRQSIKLLRAAGEFYLRLRDLG  224



>ref|XP_010313918.1| PREDICTED: transcription factor TGA5-like [Solanum lycopersicum]
Length=232

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 100/217 (46%), Gaps = 15/217 (7%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLL------LIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            F  F E+W   L E  Q +          ++E++ + L+ K+ +H   YY  K  AA+ D
Sbjct  4    FQKFHEEWHGHLRELVQQMSKLPKFCTTNQDEQNTKLLIQKVISHINEYYRVKSLAAKND  63

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekve  507
            +L  F+  W  SLE +  W+ GW+P+TAF ++  E   + +     +L G    +   + 
Sbjct  64   ILYIFSAPWSNSLERSLYWIAGWRPTTAFHIIYSECGIQLESHITNILNGFRNGDLADLS  123

Query  506  remerqqVAMADRRMVELARL-----GGGDTVADVAVKNMLGGLEK---VMKMADCVRLK  351
             +   +   +    + +   +        D+V D+ ++N+   +E    ++K AD VRL 
Sbjct  124  PDQLTRFSELQCETIQQENNITEQLSNWQDSVNDI-IENIDKKMETLLGILKRADEVRLN  182

Query  350  TLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
            TL  L+ ++ P   + F  +AS L  ++R  G    N
Sbjct  183  TLHNLVHLLTPQQLLEFFIAASNLLFEIRSWGINYDN  219



>ref|NP_564730.1| protein ZW2 [Arabidopsis thaliana]
 gb|AAF82255.1|AC008051_6 Identical to gene ZW2 from Arabidopsis thaliana gb|AB028196 [Arabidopsis 
thaliana]
 dbj|BAA87938.1| ZW2 [Arabidopsis thaliana]
 gb|ABF19046.1| At1g58330 [Arabidopsis thaliana]
 gb|AEE33536.1| transcription factor-like protein [Arabidopsis thaliana]
Length=225

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 106/217 (49%), Gaps = 17/217 (8%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENEK-----DHEFLVNKLTTHYKNYYTAKWAA---  699
            E+F  FF  W+ +  +  Q L   A+        + E LV+   +HY  YY  K  A   
Sbjct  8    ETFASFFNDWLCRHRQFVQQLAHLADETTIVTPIEEESLVSNFLSHYLQYYEEKSVAMSV  67

Query  698  AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKA  525
            A +D+  FF+P WL+S E   LW+ G+KP   F+L+      ++  Q+ ++E +R + K 
Sbjct  68   AGDDIYDFFSPPWLSSYEKLILWIGGFKPGMVFKLITTSVNDLTSHQIDQLESIRLETKR  127

Query  524  eeekveremerqqVAMADR------RMVELARLGGGDTVA-DVAVKNMLGGLEKVMKMAD  366
             E  + R     Q ++ D       R + + RLG G+    + A++ +   + K MK AD
Sbjct  128  RERDLMRRFALLQQSVGDPLLMVPFRRIGVLRLGEGEQPEMEDAMEVLKVEMIKAMKNAD  187

Query  365  CVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +R  T+  +++V+ P  SI  L +A    +++R  G
Sbjct  188  QLRCVTVGKVVEVLNPRQSIKLLRAAGEFYLRLRDLG  224



>ref|XP_003634633.1| PREDICTED: transcription factor TGA4-like [Vitis vinifera]
Length=246

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/237 (25%), Positives = 104/237 (44%), Gaps = 30/237 (13%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMAQ----LEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKW  705
            M S     F   F+ W+ Q    L+E  Q+L   + +      L+ K   H+++Y   + 
Sbjct  1    MASSSHRLFHCCFQDWINQQHQDLQELLQVLDTDSPDSDHLRHLIQKSLQHFQDYSATRA  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKA  525
              ++ D  +FF P W+TS E+++LW+ G +PS A RL+     SE Q +  + L+G  + 
Sbjct  61   ELSKLDAPSFFCPSWITSFENSFLWLGGCRPSLAIRLLYSISGSELQAQLPDFLKGCTRG  120

Query  524  eeekveremerqqVAM----------------------ADRRMVELAR----LGGGDTVA  423
                +         A+                      AD  +  +A+    +G      
Sbjct  121  NLADISATQLISINALHGWIVREEDRLSSRMASMQEDTADEPLAIIAKKLRTVGEYSRTV  180

Query  422  DVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            + A++     L +V++ AD +RL T KGL +++ P    HFL ++  L + M + GK
Sbjct  181  NSAIETHSQALARVLEEADKLRLSTFKGLQEILTPLQGAHFLVASKKLHLSMHEWGK  237



>ref|XP_011101404.1| PREDICTED: transcription factor TGA6-like [Sesamum indicum]
Length=250

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 112/241 (46%), Gaps = 34/241 (14%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMA----QLEECAQLLLIAAENEKDH----EFLVNKLTTHYKNYY  717
            M +  E S    F +WM+     L E  Q L +   +  DH      LV K   H++ Y 
Sbjct  1    MENNDEGSRLSCFREWMSLQEQDLSELLQSLRLNNADGDDHTAELSQLVEKNIRHFQEYL  60

Query  716  TAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV------------------  591
              + + AREDV  +F+P W TSLE + LW  G +PS   RLV                  
Sbjct  61   CRRVSLAREDVYPYFSPTWCTSLEGSMLWAGGCRPSIFIRLVYALSGKEISSRLDEYLHG  120

Query  590  ---AGEG-MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMV----ELARLGGG  435
                G G +S  Q+  +  L+ K   EEEK+  ++   Q  MAD+ +     ELA     
Sbjct  121  NRTGGLGELSPSQINSINSLQLKTIREEEKLSSKLASMQEEMADQPIAIIAKELAAHSEA  180

Query  434  DTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             T A+ A+K++   +  +++ AD +RL TLK L+ ++ P  ++ FLA+   L + +   G
Sbjct  181  STEAEEALKSLAVSMTSMLEEADNLRLNTLKELMSILTPVQAVDFLATGRKLHLCIHAWG  240

Query  254  K  252
            +
Sbjct  241  R  241



>ref|XP_004146086.1| PREDICTED: transcription factor TGA5-like [Cucumis sativus]
 ref|XP_004173947.1| PREDICTED: transcription factor TGA5-like [Cucumis sativus]
 gb|KGN55047.1| hypothetical protein Csa_4G625020 [Cucumis sativus]
Length=232

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/218 (28%), Positives = 103/218 (47%), Gaps = 18/218 (8%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECA-QLLLIAAENEK-----DHEFLVNKLTTHYKNYYTAKWAAARE  690
            +FT F+  W   L     QL   A +N       DH  LV  + +HY +YY  K  AA  
Sbjct  7    NFTSFYATWFDHLHRLVDQLSSTAKDNHNSSSAPDH--LVQTVMSHYSDYYRVKSMAAER  64

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekv  510
            D L+ F+  W TSLE +  W+ GW+P+T F L+  E     + +  ++LRG    +   +
Sbjct  65   DPLSVFSAPWATSLERSLHWIAGWRPTTTFHLIYTESSILFESRIFDILRGLHTGDLGDL  124

Query  509  eremerqqVAMADRRMVELARLGG-----GDTVADV-----AVKNMLGGLEKVMKMADCV  360
                 R+   +    + E   +        D V+++      V   + GL  ++K AD +
Sbjct  125  SPSQIRRVSELQCETVEEENAITEELSEWQDDVSELLGTRTEVTGRVEGLVNIIKKADAL  184

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            RL+T++ +++++ P  ++ F  +A+ LQ  +R  G  Q
Sbjct  185  RLRTVQKVVELLTPKQAVEFFIAAAELQFGVRGWGLDQ  222



>ref|XP_008351209.1| PREDICTED: transcription factor TGA7-like [Malus domestica]
Length=309

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 101/211 (48%), Gaps = 12/211 (6%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            +F  F+E W+   E     LL A +      ++D   LV+ +  HY+ YY  K    + D
Sbjct  74   TFEAFYEGWLVXQEHFLDELLSAQQTIDEARDEDLRDLVSXVLFHYQQYYDEKSRLGQRD  133

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMKKVEVLRGKIKAeeek  513
            VL  F+P W TS E + LW+ G+KP   FRLV      +S++Q  ++   R   + EE  
Sbjct  134  VLLXFSPTWYTSYERSLLWIAGYKPGIVFRLVTESVPDLSDQQRVRMAXXREATRVEERA  193

Query  512  veremerqqVAMADRRMVELARLGG----GDTVADVAV-KNMLGGLEKVMKMADCVRLKT  348
            +  ++ +    +A    ++  R  G    G  V D AV K++   LE V++ A+  R   
Sbjct  194  LXDKLAKIHXXVAAPPFMDAVRRYGRAXHGXXVEDDAVXKSLKSALETVVENANLXRTTM  253

Query  347  LKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
               L+D++    ++ FL +    Q+++R  G
Sbjct  254  ATKLVDLLSSGQAVRFLTAVMQFQLKIRSLG  284



>ref|XP_003565204.1| PREDICTED: transcription factor TGA2-like [Brachypodium distachyon]
Length=257

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/214 (29%), Positives = 106/214 (50%), Gaps = 29/214 (14%)
 Frame = -3

Query  854  ESFTDFFEKWMAQ----LEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARED  687
            E FT FF  W+++    L    +    A+ +  D   LV+++  HY++YY AK AAA  D
Sbjct  18   EPFTKFFGCWISEQSRDLAALREAAAAASSSSADLRRLVDRVLGHYEHYYRAKSAAAAAD  77

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE-------------------------  582
            V A FAP W+++ ES YLW  GW+P+ A  L+  +                         
Sbjct  78   VRAMFAPSWISTTESLYLWCGGWRPTAALHLLYSKSGAQLEAQLPAFLDGTGSLRGDDLG  137

Query  581  GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNM  402
            G+S +Q+   + L+ +    E ++E      Q ++A  +MVELA         +  ++  
Sbjct  138  GLSADQLHAADQLQRRTIGREREIEEAAAAAQESLATGKMVELATGAMEAAGLEREMEAK  197

Query  401  LGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHF  300
              G+ +V++MAD +RL T++ ++ ++ P  ++HF
Sbjct  198  AEGMRRVLEMADGLRLDTMRAVVALLRPPQAVHF  231



>ref|XP_006433711.1| hypothetical protein CICLE_v10003662mg, partial [Citrus clementina]
 gb|ESR46951.1| hypothetical protein CICLE_v10003662mg, partial [Citrus clementina]
Length=206

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 98/177 (55%), Gaps = 12/177 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLL--IAAENEKD---HEFLVNKLTTHYKNYYTAKWAAARED  687
            +F  FF+ W+ + E  +  LL  IA EN  +   H+ L++++ +HY+ YY  K  AA ED
Sbjct  30   NFEAFFKDWLIRQENLSYQLLDAIAPENIHNNELHQCLIDQVLSHYQQYYLEKSLAATED  89

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAeeek  513
            V    +P WLT  E  +LW+ G++PS  F+L+A   + ++ EQ  +V+ ++ + + EE +
Sbjct  90   VFQIISPPWLTFPERTFLWIGGFRPSLIFKLIANSVQDLTAEQESEVQQVKAETRREERE  149

Query  512  veremerqqVAMADRRMVELARLGGG-----DTVADVAVKNMLGGLEKVMKMADCVR  357
            + + M R Q ++A    + LAR            A+ A+K +  G+  V++ AD +R
Sbjct  150  LGQTMARVQESVASAPFMNLARRSANLVDREVPEAEAAMKELQKGMLAVLEAADALR  206



>ref|XP_006345765.1| PREDICTED: transcription factor TGA1-like [Solanum tuberosum]
Length=285

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 117/245 (48%), Gaps = 43/245 (18%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEKDHEF---------LVNKLTTHYKNYYTAKWAA  699
            SF  FFE W+ +  +    L+ A++++ ++           L++ +  HY+ YY  K   
Sbjct  14   SFHKFFESWLVKQNQDLDQLVRASKDDDNNNKNNNDMMLSSLIHSVVKHYEEYYREKSRY  73

Query  698  AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE---------------------  582
            A  D+L    P WL++LE A+LW+ GW+PS AF L+  +                     
Sbjct  74   AISDILGMLHPSWLSNLEDAFLWIGGWRPSMAFHLLYSKSGIQLEANLHELIRGFNTKDL  133

Query  581  -GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAV--  411
              +S  Q+  ++ L+ K  +EE K+   + + Q  +AD  MVEL+ +       D  V  
Sbjct  134  GNLSGNQLVLIDELQHKTISEERKLSENLAKVQETLADASMVELSHVVSELMRDDQLVVN  193

Query  410  -------KNMLGGLE---KVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
                   KN+    E    ++K AD +RL T+K +L ++  T  +HFL +A+ L +++ +
Sbjct  194  DEEEKIKKNISKKEESLLDLLKKADDLRLSTIKEILRILTSTQGVHFLIAAAELHLRIHE  253

Query  260  CGKTQ  246
             GK +
Sbjct  254  WGKKK  258



>ref|XP_008463763.1| PREDICTED: transcription factor TGA5 [Cucumis melo]
Length=235

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/219 (28%), Positives = 103/219 (47%), Gaps = 17/219 (8%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECA-QLLLIAAENEK-----DH-EFLVNKLTTHYKNYYTAKWAAAR  693
            +FT F+  W  QL     QL   A +N       DH   LV  + +HY +YY  K  AA 
Sbjct  7    NFTSFYATWFDQLHRLVDQLSSTAKDNHNSSSAADHLARLVQTVMSHYCDYYRVKSMAAE  66

Query  692  EDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeek  513
             D L+ F+  W TSLE +  W+ GW+P+T F L+  E     + + V++LRG    +   
Sbjct  67   RDPLSVFSAPWATSLERSLHWIAGWRPTTTFHLIYSESSILFESRIVDILRGLHTGDLGD  126

Query  512  veremerqqVAMADRRMVELARLGG-----GDTVADV-----AVKNMLGGLEKVMKMADC  363
            +     R+   +    + E   +        D V+++      V      L  ++K AD 
Sbjct  127  LSPSQIRRVSELQCETVEEENAITEELSEWQDDVSELMGTRTEVTGRFEDLVNIIKKADA  186

Query  362  VRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
            +RL+T++ +++++ P  ++ F  +A+ LQ  +R  G  Q
Sbjct  187  LRLRTVQKVVELLTPKQAVEFFIAAAELQFGVRGWGLDQ  225



>ref|XP_003634664.1| PREDICTED: transcription factor HBP-1b(c38) [Vitis vinifera]
Length=231

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 100/214 (47%), Gaps = 15/214 (7%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAE---NEKDHEFL--VNKLTTHYKNYYTAKWAAARED  687
            SF  F E W   L +  Q L +A +    ++D   L  V+K+ THY  YY A    AR D
Sbjct  2    SFESFNEAWFDHLHDLLQQLRLAPKATAPDRDRALLDLVHKVRTHYSQYYRAMSYTARHD  61

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekve  507
            V++ FA  W +SLE +  WV GW+P+ AF L+        +   V++LRG    +   + 
Sbjct  62   VVSLFAAPWSSSLERSLHWVAGWRPTIAFHLIYTHSSILFETHIVDILRGAHNGDLGDLS  121

Query  506  remerqqVAMADRRMVELARLGGGDTVADVAVKNMLGG----------LEKVMKMADCVR  357
                ++   +  + + E   +    +    +V  ++G           L  V++ A+ +R
Sbjct  122  PAQLQRVSELQCQTVGEENEITAELSECFNSVSGLVGAVFDPVENVERLRNVVERAENLR  181

Query  356  LKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +T+  +++++ P  ++ FL +   LQ  +R  G
Sbjct  182  FRTICSVVEILNPQQAVEFLVAVMELQFWVRGMG  215



>ref|XP_010274492.1| PREDICTED: transcription factor TGA5-like [Nelumbo nucifera]
Length=248

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 107/226 (47%), Gaps = 32/226 (14%)
 Frame = -3

Query  836  FEKWMAQ----LEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFFA  669
            F+ W+AQ    LEE  Q L I   ++     +V K   H++ Y   +   ARE+  +FFA
Sbjct  15   FQSWIAQQQADLEELLQALTIYKGDDTHLNLIVEKNIQHFQEYTEKRSILARENATSFFA  74

Query  668  PVWLTSLESAYLWVTGWKPSTAFRLV-----------------------AGEGMSEEQMK  558
            P W TSLE+++LW+ G +PS A RLV                        GE +S  Q+ 
Sbjct  75   PSWCTSLENSFLWIAGCRPSLAIRLVYSLCGSELEAQLNEFLQGVRKGNLGE-LSARQLS  133

Query  557  KVEVLRGKIKAeeekveremerqqVAMADRRMV----ELARLGGGDTVADVAVKNMLGGL  390
             V  L+ +   EEEK+  +M   Q  +AD+ ++    E   +G      D  +      L
Sbjct  134  LVNDLQCRTIREEEKLSTQMASLQEDIADQPLLTKANEYGLIGASIEHVDTTLDEHALAL  193

Query  389  EKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
              +++ AD +RL TLK L++++ P  +   L +A  L + + + GK
Sbjct  194  AGILEEADKLRLSTLKELINILTPLQAADLLVAAKKLHLSIHEWGK  239



>ref|XP_010062825.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 gb|KCW69956.1| hypothetical protein EUGRSUZ_F03274 [Eucalyptus grandis]
Length=234

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 107/226 (47%), Gaps = 20/226 (9%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAEN--EKDHEF----LVNKLTTHYKNYYTAKWAAARE  690
            SF  F+  W  QL      L  A +     DH      LV+K   HY  Y+  K      
Sbjct  3    SFDRFYGGWQEQLRHLVDQLAAAPKPPISPDHHHQLHHLVSKFMDHYAEYHRTKALEVDR  62

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLR-------GKI  531
            DVL+  A  W+T+LE +  W+ G +P+T F LV  E     +   +++LR       G +
Sbjct  63   DVLSVLAAPWITALERSLQWIGGCRPTTVFHLVYTESSILFESHMIDILRGYRTGDLGDL  122

Query  530  KAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNM---LGGLEKVMKMADCV  360
               + +   E++   V   +    EL+    G +   VA  N+   +G L  ++K AD +
Sbjct  123  SPSQFRGVSELQCDTVREENAITEELSEWQDGMSDLMVASSNLEEKIGKLGAIVKKADDL  182

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMR----KCGKTQHNLS  234
            RLKT++ +++++ P  ++ FL SAS LQ  +R      GK+ +NL+
Sbjct  183  RLKTVRRVVELLTPQQAVEFLISASELQFGIRGWGLNLGKSPNNLT  228



>gb|EYU36422.1| hypothetical protein MIMGU_mgv1a025661mg [Erythranthe guttata]
Length=236

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 114/215 (53%), Gaps = 14/215 (7%)
 Frame = -3

Query  857  EESFTDFFEKWMAQ----LEECAQLLLIAAENEKDHEF--LVNKLTTHYKNYYTAKWAAA  696
            E +FT FF+ W+ +    L +   LL  A   +++ E   ++ ++ +HY+  Y  K A A
Sbjct  4    ESNFTSFFDSWLTRQEAFLRQLEALLSPADGFDRNRECAAIIPRVFSHYQEMYMEKAALA  63

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV---AGEGMSEEQMKKVEVLRGKIKA  525
             EDV    +  WL+S E   +W++G++PS  F ++     E +S+EQ +++E ++ +I+ 
Sbjct  64   GEDVFLLMSAPWLSSFERTLVWISGFRPSMLFPMIETAVAEDLSDEQKREIEGVKAEIRR  123

Query  524  eeekveremerqqVAMADRRMVEL----ARLGGGDTVA-DVAVKNMLGGLEKVMKMADCV  360
            +E ++ ++M R Q  +A+  +  L     RL  G+T   + A+  +   +  V+  AD +
Sbjct  124  KEREINQKMARVQETVAEPPLCGLVKKFGRLVDGETTELEAAMVELKAAMLVVVGNADEL  183

Query  359  RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            R  T   ++ ++ P   + F A+ +  Q+Q RK G
Sbjct  184  RGWTAAAVVGILNPVQGVKFFAAVARFQLQARKWG  218



>ref|XP_010089698.1| hypothetical protein L484_006320 [Morus notabilis]
 gb|EXB38221.1| hypothetical protein L484_006320 [Morus notabilis]
Length=249

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 99/218 (45%), Gaps = 30/218 (14%)
 Frame = -3

Query  836  FEKWMA----QLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFFA  669
            F +WM      L E  Q L +  +N+ +   L  K   H+++Y + + + +R DV +FF+
Sbjct  13   FLEWMKLQERDLSELLQALTLTPQNDAELTKLAQKAIEHFESYISQRSSLSRNDVASFFS  72

Query  668  PVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekveremerq  489
            P W T  E++  W+ G +PS   RL+     ++ + K  E+LRGK   +   +     R 
Sbjct  73   PSWCTPWENSLFWIAGCRPSAFIRLIYALDGADIESKLSEILRGKTVGDIGDLSARQMRA  132

Query  488  qVAMADRRMVELARL-----GGGDTVADVAVKNMLGGLEKVMKM----------------  372
               +  R + E  RL     G  + VAD  +  +  G++++ +M                
Sbjct  133  VDELQRRTIREEERLTARLAGLQEDVADQPISAIAKGVDRIGEMSGEIEKVLNEHEQSMA  192

Query  371  -----ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQI  273
                 AD +RL TLK +L ++ P   + FLA +  L +
Sbjct  193  EVLEEADKLRLNTLKEILGILRPVQGVEFLAMSKKLHL  230



>ref|XP_010490486.1| PREDICTED: transcription factor TGA4-like [Camelina sativa]
Length=236

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 112/226 (50%), Gaps = 20/226 (9%)
 Frame = -3

Query  878  SSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAEN--------EKDHEFLVNKLTTHYKN  723
            S+  S   +SFT F   W+ +     + L+ A+ +        E++ + LV +  +H   
Sbjct  2    SNTASSSHQSFTSFANGWLIRHRYFVEQLMCASSSDETNSITLEEEQQSLVTQFLSHCLQ  61

Query  722  YYTAKWAA---AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMK  558
            YY  K+AA   A ++V  FF P W +S     LWV  +KPS  FRL     + ++  Q  
Sbjct  62   YYQEKYAAVSIAGDNVFTFFCPPWFSSYAKLILWVGDFKPSLIFRLTDASVDDLTSHQRD  121

Query  557  KVEVLRGKIKAeeekveremerqqVAMAD-------RRMVELARLGGGDTVADVAVKNML  399
            ++  LR + + +E +V R+    Q ++AD       RR+  +  + G +T  + A++ + 
Sbjct  122  RISCLRSETRRKEREVMRDFALVQQSVADPPVMLAARRVGVVGMVDGEETDLEEAMEVLK  181

Query  398  GGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
             G+   M  AD +R  T+  +++++ P+ +I  L +   L +++R+
Sbjct  182  SGMAAAMNNADQLRCSTVGKVVEILTPSQAIKVLRTIGELHLRLRE  227



>ref|XP_007213175.1| hypothetical protein PRUPE_ppa027008mg, partial [Prunus persica]
 gb|EMJ14374.1| hypothetical protein PRUPE_ppa027008mg, partial [Prunus persica]
Length=230

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 110/229 (48%), Gaps = 31/229 (14%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWM----AQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKW  705
            M S+  E     F++WM      L E  Q L +  +N+   + L  K   H+++Y   + 
Sbjct  1    MASRDREQSKCCFKEWMELQEQDLSELLQALKLDPQNKDQLKHLAEKGICHFQDYINKRT  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV----------------------  591
              AR DV AFFAP W TS E++ LW+ G +PS  FRLV                      
Sbjct  61   QLARRDVSAFFAPTWCTSWENSLLWIAGCRPSLFFRLVYVLGGSKMESKLSEFLQDTREG  120

Query  590  -AGEGMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELAR----LGGGDTV  426
              GE ++  Q+  V  L+ K   EEE++  E+   Q  +AD+ +  +A+    LG  +  
Sbjct  121  SLGEVLTCSQLVVVNSLQSKTIREEERLTGELAALQEDIADQPIAMIAKGLSQLGEMNRE  180

Query  425  ADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASML  279
             + A+      + ++++ AD +RL T+K L++++ P  ++ FL ++  L
Sbjct  181  VEEALDEHGQAMVRILEEADQLRLNTVKELVNILTPLQAVDFLVASKKL  229



>emb|CDP10926.1| unnamed protein product [Coffea canephora]
Length=307

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/271 (24%), Positives = 119/271 (44%), Gaps = 67/271 (25%)
 Frame = -3

Query  863  KVEESFTDFFEKWMAQLEECAQLLLIAAEN---------------------------EKD  765
            + EE+F  F+E W  Q  +  Q L+ A+E                              +
Sbjct  17   QTEENFEQFYETWKKQQNQHLQELITASEQVSSPTPPTEGITACSSSSPPPPTDGITATN  76

Query  764  HEFLVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG  585
               LV ++  HY+ YY  K   A ++ L   +P W +SLE A+LW+ GW+P+ A  L+  
Sbjct  77   LSNLVKRVVEHYEEYYKTKSEWADKNTLQILSPPWTSSLEDAFLWIGGWRPTMAIHLLYS  136

Query  584  EG-----------------------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMA  474
            +                        ++E Q+  ++ L+     EE+++  +M +QQ   A
Sbjct  137  KSSLQFESKFNDWMQGKLTKHDLGDLTESQISLIDELQKNTIIEEKEITGKMAKQQEKAA  196

Query  473  DRRMVELARL-----------------GGGDTVADVAVKNMLGGLEKVMKMADCVRLKTL  345
               MVEL+ L                     + A+ ++     G +K+++ AD +RL+TL
Sbjct  197  GADMVELSHLVSEALREEEKGTKARDHEAEQSQAESSLSPKEKGFKKILEKADNLRLRTL  256

Query  344  KGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            K +++ +  T ++HFL +A+ L +++ + GK
Sbjct  257  KSIIEALSATQAVHFLIAAAELHLRLHEWGK  287



>ref|XP_010511109.1| PREDICTED: transcription factor TGA4-like [Camelina sativa]
Length=231

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/218 (28%), Positives = 107/218 (49%), Gaps = 19/218 (9%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLL------LIAAENEKDHEFLVNKLTTHYKNYYTAKWAA--  699
            E+FT FF  W+ +  +  Q L       I+   E++ E LV +  +H   YY  K AA  
Sbjct  8    ETFTSFFNDWLLRHRQLIQQLAHFDDETISVTPEEE-ESLVTQFLSHCLQYYQEKSAAVS  66

Query  698  -AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIK  528
             A +D+  FF+P WL+S E   LW+ G+KP   F+L+      ++  Q  ++E +R + K
Sbjct  67   VAGDDIYDFFSPPWLSSCEKLILWIGGFKPGMVFKLITTSVNDLTSHQKDQLESIRLETK  126

Query  527  AeeekveremerqqVAMADR-RMVELARLGG------GDTVADVAVKNMLGGLEKVMKMA  369
              E  +       Q ++ D   MV   R+G         +  + A++ +   +++ MK A
Sbjct  127  RRERALMGRFAHLQQSVGDPLLMVPFKRIGALRLGEREQSEMEEAMEVLKREMKEAMKNA  186

Query  368  DCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            D +R  T++ +++V+ P  +I  L +A    +++R  G
Sbjct  187  DQLRCVTVRKVVEVLNPGQAIKLLRAAGEFYLKLRDLG  224



>ref|XP_006370140.1| DNA-binding family protein [Populus trichocarpa]
 gb|ERP66709.1| DNA-binding family protein [Populus trichocarpa]
Length=232

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 103/217 (47%), Gaps = 17/217 (8%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIA-----AENEKDH-EFLVNKLTTHYKNYYTAKWAAARE  690
            SFT F++ W  QL +  + L  A     +++++ H   L  K+ +HY  +Y  K  A   
Sbjct  6    SFTRFYDTWFDQLNQLLEQLRTAPKPPSSQDDRSHLSSLAQKIVSHYAEFYRVKSMAIES  65

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekv  510
            DVL+ F   W +  E +  W+ GW+P+T F LV  E     +    ++L+G+   +   +
Sbjct  66   DVLSVFTAPWASCFERSLHWIAGWRPTTLFHLVYTESSILFEFHIADILKGRSTGDLGDL  125

Query  509  eremerqqVAMADRRMVELARLGG-----GDTVADVAVKNM------LGGLEKVMKMADC  363
                 R+   +    + E   + G      D+  +V + +       +G L  V+K AD 
Sbjct  126  SPNQFRRVSELQCETVKEENAITGELSEWQDSANEVMLGSFTDLGDKVGRLVSVVKKADD  185

Query  362  VRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            +RL+T+K +++++    ++ FL +A  LQ  +   G+
Sbjct  186  LRLRTIKRVVELLTTQQAVEFLVAAGELQFGVYGWGR  222



>ref|XP_010695960.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor TGA5 [Beta 
vulgaris subsp. vulgaris]
Length=242

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 106/225 (47%), Gaps = 26/225 (12%)
 Frame = -3

Query  863  KVEESFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDV  684
            +  ES+TD   K + +L         ++ + +    LV+K+ THY  YY  K A A  DV
Sbjct  6    RFHESWTDKLNKLITELASTPTPRPTSSSDHQHIRHLVDKVVTHYAQYYEKKAATAXTDV  65

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKA-----ee  519
            L+ FA  W ++LE +  WV G++P+T F L+  E     +    ++LRG           
Sbjct  66   LSLFAAPWASALERSLNWVAGFRPTTLFHLIYTESSIRFESHVADILRGCRTGDLGELTP  125

Query  518  ekveremerqqVAMADRRMV---------ELAR--------LGGGDTVADVAVKNMLGGL  390
             ++ R  E Q + + D   +         E+AR         G G       +  +L  L
Sbjct  126  GQLARVSELQCLTVQDENQIGDELGTWQEEVARSEPEWSGLCGNGPD----GLNRLLAKL  181

Query  389  EKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
              V+  AD +R+KT++ +++++ P  +  FL +A+ LQ+ +R+ G
Sbjct  182  GTVVAKADDLRMKTIRQVVELLTPQQAAEFLIAAAELQLGIRRWG  226



>ref|XP_010667750.1| PREDICTED: transcription factor HBP-1b(c38)-like [Beta vulgaris 
subsp. vulgaris]
Length=257

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 110/225 (49%), Gaps = 11/225 (5%)
 Frame = -3

Query  899  KPSRQFSSSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAENE-KDHEFLVNKLTTHYKN  723
            KP+   ++  +  + ++F  FF+ W+   +     L+  AE+E K+   L+ ++ +HY  
Sbjct  25   KPTCLATTKEKMPISDTFAAFFKGWLEHQQAFLDQLVDTAEHEDKNSSQLIEQVLSHYAE  84

Query  722  YYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSE---EQMKKV  552
            YY  K     +DV   F+P WLT +E  +LWV G+KPS  F L      S+   EQ++K+
Sbjct  85   YYEMKAQVIWQDVFVAFSPPWLTPIEKTFLWVGGFKPSLTFCLAEVSNNSDMILEQVEKL  144

Query  551  EVLRGKIKAeeekveremerqqVAMADRRMVEL----ARLGGGDT--VADVAVKNMLGGL  390
              L+ +    E+ +   +   Q +M    ++ L     RL  G+    ADV +      +
Sbjct  145  ASLKAETIWAEKNLVDALASVQESMGSPPLISLVKQYGRLVDGEVSEFADV-IDKWKESM  203

Query  389  EKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +V++ AD +R  T+  +++++     + FLA  +   + +R  G
Sbjct  204  SRVLESADNLRRNTVIKVIEILNVKQGLKFLAVVAKYYLGIRAWG  248



>ref|XP_010317335.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
Length=250

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 111/221 (50%), Gaps = 35/221 (16%)
 Frame = -3

Query  827  WMA-QLEECAQLLLIAA---ENEKDH---EFLVNKLTTHYKNYYTAKWAAAREDVLAFFA  669
            WM+ Q EE  +L   AA   + EKD      L  K+  H++ +   +   AR+DV  FFA
Sbjct  20   WMSLQHEELTELEDAAAQIQDGEKDEGKLTQLAEKIIQHFQEHSDNRLRLARKDVSPFFA  79

Query  668  PVWLTSLESAYLWVTGWKPSTAFRLVAG---------------EG--------MSEEQMK  558
            PV  + LE++ LW+ G +PS+  RL+                 EG        +SE+Q++
Sbjct  80   PVTCSPLENSVLWIAGCRPSSFIRLIYALCGFEPDVQGTDPCLEGIVTEDLRELSEKQLR  139

Query  557  KVEVLRGKIKAeeekveremerqqVAMADRRMV-ELARLGGGDTVADVAVKNMLGGLEKV  381
             +  L+GK   EE ++  +    Q    D+ +  ++ + G G   AD A+    G +  V
Sbjct  140  MINELQGKTIREERRISTKFASLQEDTVDQPLAGKMKKEGHGCEKADEALDEHSGHMADV  199

Query  380  MKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKC  258
            ++ AD +R+KTLK +++++ P  ++ +LA+A     +MR C
Sbjct  200  IEEADRLRMKTLKEIVNILEPVQAVEYLAAAK----KMRFC  236



>ref|XP_008351887.1| PREDICTED: transcription factor TGA4-like, partial [Malus domestica]
Length=191

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 87/166 (52%), Gaps = 7/166 (4%)
 Frame = -3

Query  731  YKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE--GMSEEQMK  558
            Y+ YY  K    + DVL  F+P W TS E + LW+ G+KP   FRLV      +S++Q  
Sbjct  1    YQQYYDEKSRLGQRDVLLVFSPTWYTSYERSLLWIAGYKPGIVFRLVTESVPDLSDQQRV  60

Query  557  KVEVLRGKIKAeeekveremerqqVAMADRRMVEL----ARLGGGDTVADVAV-KNMLGG  393
            ++  LR   + EE  +  ++ +   ++A  + +++     R G G+ V D AV K++   
Sbjct  61   RIARLREATRVEERALNDKLAKIHESVAAPQFMDVVRRYGRAGHGEIVEDDAVIKSLKSA  120

Query  392  LEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            LE V++ A+ +R      L+D++    ++ FL +    Q+++R  G
Sbjct  121  LETVVENANLLRTTMATKLVDLLSSGQAVRFLTAVMQFQLKIRSLG  166



>ref|XP_009762839.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana sylvestris]
Length=255

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 121/248 (49%), Gaps = 39/248 (16%)
 Frame = -3

Query  869  RSKVEESFTDFFEKWMA-QLEECAQLLLIAAENEKDHEF----LVNKLTTHYKNYYTAKW  705
            R+  +ES    +E WM  Q EE  +L   AA N    E     L+ K+  H+++Y   + 
Sbjct  9    RNNEQESL---YESWMNLQHEELRELEQAAAANSPKDEHKQTQLIEKIINHFQDYSNNRS  65

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV----------------------  591
              A++DV  FFAP   T LE++ LW+ G +PS+  RL+                      
Sbjct  66   RLAQKDVSPFFAPTSCTPLENSVLWIGGCRPSSFIRLIYALFCGMEIESHITQFLQGITA  125

Query  590  AGE--GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADV  417
             GE    + EQM  V+ L+ K   EE K+   +   Q A+ D+ ++  ++    D   DV
Sbjct  126  NGELPKFTAEQMNMVDELQSKTIREEGKLSSRLASLQEAIIDQPLISKSKKKKDDGDDDV  185

Query  416  AVKNMLGGLEK-------VMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKC  258
              +N    L+K       +M+ AD +R+KTLK ++ ++ P  ++ +LA+A  +++ +++ 
Sbjct  186  VCENADEPLDKHNKYMAAIMEEADELRMKTLKEIVVILEPDQAVEYLAAAKKIRLCLQQW  245

Query  257  GKTQHNLS  234
            GK + + S
Sbjct  246  GKKREHDS  253



>gb|EPS59924.1| hypothetical protein M569_14883, partial [Genlisea aurea]
Length=163

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 84/166 (51%), Gaps = 17/166 (10%)
 Frame = -3

Query  758  FLVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGE-  582
            +LVNK   HY+ YY AK  AA  D+L FF     T LE +  W+ G++P+TAF L   + 
Sbjct  7    YLVNKAIEHYREYYRAKSVAAENDLLVFFLAPCATKLERSLSWIGGFRPTTAFHLAYTKI  66

Query  581  GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNM  402
            GM  E    + +LRG                   ++  ++ +++ L     +  V  +N 
Sbjct  67   GMMFES-GVMHILRG-----------IRTGDFGDISPPQLQKISEL----QIETVDEENR  110

Query  401  LGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMR  264
            L  L K++  AD +RLKT++ L+ ++ P  S  FL +A+ LQ  +R
Sbjct  111  LKELSKILGKADLLRLKTIESLVQLLTPQQSAEFLIAAAELQFGIR  156



>ref|XP_009118288.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Brassica rapa]
Length=231

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/217 (26%), Positives = 109/217 (50%), Gaps = 19/217 (9%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLLIAAENE-------KDHEFLVNKLTTHYKNYYTAKWAA-  699
            +SFT F   W+ +     + L  A+ ++       +D +FLV +  +H   YY AK +A 
Sbjct  8    QSFTSFANGWLIRHRHFVEQLACASSSDETNRITLQDQQFLVTQFLSHCLQYYQAKSSAV  67

Query  698  --AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKI  531
              A ++V  FF+P W TS     LWV  +KPS  F+L     + ++  Q  ++  LR + 
Sbjct  68   SVAGDNVFTFFSPPWFTSYARLILWVGDFKPSLVFKLTDSSVDDLTRRQKDRILSLRAET  127

Query  530  KAeeekveremerqqVAMADRRMVELAR-------LGGGDTVADVAVKNMLGGLEKVMKM  372
            + +E  V R+    Q ++AD  ++  AR       + G ++  + A++ +  G+   M  
Sbjct  128  RRKERDVMRDFALVQQSVADPPVMAAARGVGARGMVDGEESDLEEAMEVLKNGMAAAMNE  187

Query  371  ADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
            AD +R  T+  +++++ P+ ++  L +   L +++R+
Sbjct  188  ADELRCATVGRVVEILTPSQAVKVLRTIGELHLRLRE  224



>gb|KHN36891.1| Transcription factor TGA1 [Glycine soja]
Length=198

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 94/188 (50%), Gaps = 20/188 (11%)
 Frame = -3

Query  773  EKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL  594
            E   E ++ K+  H++NYY AK AAA +D L  F   W T+LE +  W+TGW+P+TAF L
Sbjct  7    EGRKEEVMEKVMWHHQNYYVAKSAAAEKDPLNVFLSPWATTLERSLHWITGWRPTTAFHL  66

Query  593  VAGEGMSEEQMKKVEVLRG---------------KIKAeeekveremerqqVAMADRRMV  459
            +  E     +   +++L+G               ++   +    +E       +++ +  
Sbjct  67   IYTESSLMFESHIIDILQGLRTGDLGDLSPSQFRRVSDIQCDTVKEENAITEELSEWQDS  126

Query  458  ELARLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASML  279
                +G G  + D      +G L  ++K AD +RL+TL+ ++ ++ P  +I FL +++ L
Sbjct  127  VSEMMGPGANIND-----KIGRLVCIIKKADDLRLRTLRSVVGLLSPQQAIEFLIASAEL  181

Query  278  QIQMRKCG  255
             + +R  G
Sbjct  182  LVGIRGWG  189



>ref|XP_004234088.1| PREDICTED: transcription factor TGA6-like [Solanum lycopersicum]
Length=251

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 116/246 (47%), Gaps = 34/246 (14%)
 Frame = -3

Query  881  SSSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAENE-KDHEF--LVNKLTTHYKNYYTA  711
            SSS R   E  +  +      +L+E    ++ A +NE  D E   L+ K+  +++ Y   
Sbjct  4    SSSNRKNEENLYNSWMNNQQEELKELQNAIVRARKNELNDDELNELLRKMVNNFQGYANG  63

Query  710  KWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--------------EGM-  576
            +   AR DV  FFAP W T LE++ LW+ G +PST  RL+                +GM 
Sbjct  64   RSRLARVDVSPFFAPTWCTPLENSVLWIGGCRPSTFIRLIYALCGIEIQSHTARYLQGMK  123

Query  575  -------SEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVAD-  420
                   S EQ+  ++ L+ +I  EE +    +   Q  + D+     AR+   DT  D 
Sbjct  124  IGEFGHLSGEQITMIDKLQRQIILEERRFSSRLASLQEDVVDQPFAMAARI--YDTERDE  181

Query  419  --VAVKNMLG-GLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK-  252
              +   N  G  +  +++  D +R+KTLK +L ++ P   + +LA+   +++ +++ GK 
Sbjct  182  NEIEPLNKHGEDMSNLLEEVDELRMKTLKEILGILTPIQGVEYLAATKRIRLCLQQWGKK  241

Query  251  --TQHN  240
               +HN
Sbjct  242  REQEHN  247



>ref|XP_010414743.1| PREDICTED: transcription factor TGA4-like [Camelina sativa]
Length=231

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 104/217 (48%), Gaps = 17/217 (8%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLLL-----IAAENEKDHEFLVNKLTTHYKNYYTAKWAA---  699
            E+FT FF  W+ +  +  Q L        +    + E LV +  +H   YY  K AA   
Sbjct  8    ETFTSFFNDWLLRHRQLIQQLAHFDDETTSVTPVEEESLVTQFLSHCLQYYQEKSAAVSV  67

Query  698  AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKA  525
            A +D+  FF+P WL+S E   LW+ G+KP   F+L+      ++ +Q  ++E +R + K 
Sbjct  68   AGDDIYDFFSPPWLSSCEKLILWIGGFKPGMVFKLITTSVNDLTCQQKDQLESIRLETKR  127

Query  524  eeekveremerqqVAMADR-RMVELARLGGG------DTVADVAVKNMLGGLEKVMKMAD  366
             E  +       Q ++ D   +V   R+G         +  + A++ +   +++ MK AD
Sbjct  128  RERALMGRFAHLQQSVGDPLLLVPFKRIGASRLGEREQSKMEEAMEVLKREMKEAMKNAD  187

Query  365  CVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             +R  T++ +++V+ P  +I  L +A     ++R  G
Sbjct  188  QLRCVTVRKVVEVLNPGQAIKLLRAAGEFYFKLRDLG  224



>ref|XP_003567594.2| PREDICTED: uncharacterized protein LOC100833996 [Brachypodium 
distachyon]
Length=255

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 101/206 (49%), Gaps = 10/206 (5%)
 Frame = -3

Query  839  FFEKWMAQLEE------CAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLA  678
            F++ W+ + EE       A  L ++A   +    LV+    H   YY  K   A  DV+A
Sbjct  38   FYDAWVGREEEIVADLTAALSLSLSARRREALAPLVDAAMDHVATYYEHKARLADRDVVA  97

Query  677  FFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGM-SEEQMKKVEVLRGKIKAeeekvere  501
               P WL  LE  +LW  GWKP+  FR V    + S +Q + +E LR    A E +VERE
Sbjct  98   ALDPRWLNPLERTFLWAWGWKPALVFRFVDEAAVGSAQQRRGLEDLRASTAAAEREVERE  157

Query  500  merqqVAMADRRMVELARL---GGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLD  330
            +   Q ++A  R++   R       +  AD AV  +   L  ++   D +R +T++G++ 
Sbjct  158  VAAMQESLAGPRVLAALRRQLHSPRNGEADEAVAAVGRSLRVLLAAGDALRERTVRGVVG  217

Query  329  VMGPTHSIHFLASASMLQIQMRKCGK  252
            ++GP  +  F+A+     + +R+ G+
Sbjct  218  LLGPEQAGAFVAALLRFHLGVRRAGR  243



>ref|XP_002455164.1| hypothetical protein SORBIDRAFT_03g005300 [Sorghum bicolor]
 gb|EES00284.1| hypothetical protein SORBIDRAFT_03g005300 [Sorghum bicolor]
Length=323

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 109/220 (50%), Gaps = 35/220 (16%)
 Frame = -3

Query  854  ESFTDFFEKWMAQ----LEEC-AQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARE  690
            ESF+ FFE W+ +    LEE  A      A  E D   LV+++  HY  YY+ K AAA  
Sbjct  70   ESFSKFFESWIGEQSRDLEELRAAASAEPAAPEADLRRLVDQVMGHYAQYYSTKAAAAAG  129

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRL----------------VAGEGMSEE---  567
            DV   F P W ++ E+ YLW  GW+P+ A +L                + G G++++   
Sbjct  130  DVSMMFTPSWTSTTENLYLWCGGWRPTAAIQLLYTKCGMQLEHRLPVFLDGGGLNKDDLS  189

Query  566  -----QMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVA----  414
                 Q++  + L+ +  + E ++E      Q A   + MVELA  GGG      A    
Sbjct  190  DLSVAQLRAADQLQHRTISREREIEEVAATAQEAPTSKTMVELAGGGGGGGGGMDAGAMD  249

Query  413  --VKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHF  300
              ++    G+ +V++MAD +RL+T++ ++ ++ P  ++HF
Sbjct  250  REMQTKAEGMRQVLEMADGLRLETMREVVALLRPAQAVHF  289



>ref|XP_008349608.1| PREDICTED: transcription factor TGA5-like [Malus domestica]
Length=175

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 91/163 (56%), Gaps = 7/163 (4%)
 Frame = -3

Query  722  YYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVE  549
            Y+  K   A EDV   F+P WL+S E + LW+ G+KPS   R+V    E ++ EQ ++++
Sbjct  5    YFAEKARTAEEDVFVLFSPPWLSSFERSLLWLAGFKPSMVLRMVDSSVEDLTAEQAREMD  64

Query  548  VLRGKIKAeeekveremerqqVAMADRRMVELAR-----LGGGDTVADVAVKNMLGGLEK  384
             ++G+ +  E  +   M R Q ++A   ++ L R     + G  +  D+A++ +   +  
Sbjct  65   AVKGETRRXERDLSETMARIQESVAAPPILALVRRVGRXMDGEISSLDMAMEMLKTAMLG  124

Query  383  VMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            V + AD +R  T++ +++V+ P  ++  LA+ +  Q+++R+ G
Sbjct  125  VFESADGLRGSTVRKVVEVLSPEQTVKVLAAVAQFQLRIRRWG  167



>ref|XP_010458320.1| PREDICTED: transcription factor TGA4-like [Camelina sativa]
Length=238

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 112/228 (49%), Gaps = 22/228 (10%)
 Frame = -3

Query  878  SSMRSKVEESFTDFFEKWMAQ----LEE--CAQLLLIAAEN----EKDHEFLVNKLTTHY  729
            S+  S   +SFT F   W+ +    +E+  CA        N    E++ + LV +  +H 
Sbjct  2    SNTASSSHQSFTSFANGWLNRHRYFVEQLMCASSSSSDETNSITLEEEQQSLVTQFLSHC  61

Query  728  KNYYTAKWAA---AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQ  564
              YY  K+AA   A ++V  FF P W +S     LWV  +KPS  F+L     + ++  Q
Sbjct  62   LQYYQEKYAAVSIAGDNVFTFFCPPWFSSYAKLILWVGDFKPSLIFKLTDASVDDLTSHQ  121

Query  563  MKKVEVLRGKIKAeeekveremerqqVAMAD-------RRMVELARLGGGDTVADVAVKN  405
              ++  LR + + +E +V R+    Q ++AD       RR+  +  + G ++  + A++ 
Sbjct  122  RDRISCLRSETRRKEREVMRDFALVQQSVADPPVMLAARRVGVVGMVDGEESDLEEAMEV  181

Query  404  MLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRK  261
            +  G+   M  AD +R  T+  +++++ P+ +I  L +   L +++R+
Sbjct  182  LKSGMAAAMNNADQLRCSTVGKVVEILTPSQAIKVLRTIGELHLRLRE  229



>ref|XP_011085982.1| PREDICTED: transcription factor HBP-1b(c38)-like [Sesamum indicum]
Length=253

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 109/239 (46%), Gaps = 36/239 (15%)
 Frame = -3

Query  866  SKVEESFTDFFEKWMA-QLEECAQL----LLIAAENEKDHEF--LVNKLTTHYKNYYTAK  708
             +V ES   F+++WM  Q EE ++L     L A     D E   L+ K+  HY++Y   +
Sbjct  5    DQVRESC--FYQEWMNLQEEELSELNRAISLNANGRTADAELTRLIEKIMDHYQDYVQRR  62

Query  707  WAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIK  528
               AR DV  +FAP W TSLE + LW+ G +PS+  RL+      E +    E LRG   
Sbjct  63   SLMARADVSPYFAPTWCTSLERSVLWIGGCRPSSFVRLIYALCGEEIESHLSEFLRGVRI  122

Query  527  AeeekveremerqqVAMADRRMVE----LARLGG------GDTVADVAVK----------  408
                ++          +  + + E      RL G         +A +AVK          
Sbjct  123  GHLGELSGRQISMVDELQSKTIREERKLCTRLAGLQENVLDHPLASIAVKTRGRSCEVSD  182

Query  407  NMLGGLEK-------VMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            N+   L+K       ++  AD +RL TL+ ++ ++ P  ++ FLA+   L++ M+  GK
Sbjct  183  NLEDALDKHGRAMAEILGEADQLRLNTLREVVGILTPRQAVDFLAAGKKLRLCMQDWGK  241



>ref|XP_004293959.1| PREDICTED: uncharacterized protein LOC101299272 [Fragaria vesca 
subsp. vesca]
Length=253

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 115/240 (48%), Gaps = 27/240 (11%)
 Frame = -3

Query  884  FSSSMRSKVEESFTDFFEKWMAQLEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKW  705
             +S  R + +  F ++ E     L E  Q + +  EN +  + L  K  TH+++Y   + 
Sbjct  1    MASGDRKESKCCFKEWMETQERDLTELLQAVTVEPENIEQLKQLAGKCITHFEDYIKKRN  60

Query  704  AAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV----------------------  591
              A +D+ A+FAP W +  E++ +W+ G +PS  FRL+                      
Sbjct  61   KLAHKDISAYFAPDWCSPWENSLIWIAGCRPSLFFRLIYALSGSEVESNLTEFLRGTKNG  120

Query  590  -AGEGMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELA----RLGGGDTV  426
              GE MS  Q+  V  L+ K  +EEE++   +   Q  +AD+ +  +A    ++G  +  
Sbjct  121  YLGEVMSSTQLVMVNALQSKTISEEERLTMRLAALQEDIADQPIAMIAKGLSKVGEMNEE  180

Query  425  ADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
             + A+ +    + K+++ AD +R+ TLK +L ++ P   + FL ++  L + + K G+ +
Sbjct  181  VEKALDDHGQHMVKLLEEADELRMNTLKEVLKILTPLQGVDFLVASKKLHLCVHKWGRQR  240



>ref|XP_011007917.1| PREDICTED: transcription factor HBP-1b(c38) [Populus euphratica]
Length=232

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 102/217 (47%), Gaps = 17/217 (8%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIA-----AENEKDH-EFLVNKLTTHYKNYYTAKWAAARE  690
            SFT F++ W  QL +  + L  A     +++++ H   L  K+ +HY  +Y  K  A   
Sbjct  6    SFTRFYDTWFDQLNQLLEQLRTAPKPPSSQDDRSHLSSLAQKIVSHYAEFYRMKSMAIES  65

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeeekv  510
            DVL+ F   W +  E +  W+ GW+P+T F LV  E     +    ++L+G+   +   +
Sbjct  66   DVLSVFTAPWASCFERSLHWIAGWRPTTLFHLVYTESSILFEFHIADILKGRSTGDLGDL  125

Query  509  eremerqqVAMADRRMVELARLGG-----GDTVADV------AVKNMLGGLEKVMKMADC  363
                 R+   +    + E   + G      D+  +V       + + +G L  V+K AD 
Sbjct  126  SPNQFRRVSELQCETVKEENAITGELSDWQDSANEVMLGSFTNLGDKVGRLVSVVKKADD  185

Query  362  VRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            +RL+T++ +++++    ++ FL +A  L   +   G+
Sbjct  186  LRLRTIRRVVELLTTQQAVEFLVAAGELHFGVYGWGR  222



>ref|XP_004134926.1| PREDICTED: transcription factor TGA1-like [Cucumis sativus]
 ref|XP_004155627.1| PREDICTED: transcription factor TGA1-like [Cucumis sativus]
 gb|KGN49311.1| hypothetical protein Csa_6G519630 [Cucumis sativus]
Length=263

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 107/205 (52%), Gaps = 30/205 (15%)
 Frame = -3

Query  779  ENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAF  600
            E E+    LV+K    +++Y   +   A+ DV  FFAPVW ++ E++ LW+ G +PS   
Sbjct  48   ETERQLTQLVDKSIEQFQDYIDRRMQLAKNDVSLFFAPVWCSTREASLLWIAGCRPSVFI  107

Query  599  RL-------------------------VAGEGMSEEQMKKVEVLRGKIKAeeekvereme  495
            RL                         +AGE ++ +QM++++ L+ +   EEE++  E+ 
Sbjct  108  RLAYSLTGYELETRMAEFLQGMKSMEELAGE-LTPQQMEQLDSLQMRTIKEEERLTSELA  166

Query  494  rqqVAMADRRMVELA----RLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDV  327
            R Q  MAD+ +V +A    +  GG    + A++   G + ++++ AD +R++TL  L ++
Sbjct  167  RVQEEMADQTVVGIAMRSMKEEGGSEELERALEKQDGEMVRLIQQADKLRIRTLNELTEI  226

Query  326  MGPTHSIHFLASASMLQIQMRKCGK  252
              P  ++ FLA +  L + +R+ G+
Sbjct  227  FRPLQAVLFLAFSKKLHLSIREWGQ  251



>ref|XP_009383925.1| PREDICTED: transcription factor HBP-1b(c38)-like [Musa acuminata 
subsp. malaccensis]
Length=214

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 93/186 (50%), Gaps = 13/186 (7%)
 Frame = -3

Query  839  FFEKWMAQLEECAQLLLIAAENEKDHEFL--VNKLTTHYKNYYTAKWAAAREDVLAFFAP  666
            FF  W+A+L+E    LL AA   + H  L  V+ +  HY+ Y  A+   A  DVL   + 
Sbjct  4    FFVSWLARLDELRSDLL-AALIHRPHLILPAVDAILDHYREYRDARARHADADVLDVISH  62

Query  665  VWLTSLESAYLWVTGWKPSTAFRLVAGEG---------MSEEQMKKVEVLRGKIKAeeek  513
             WLT  E  +LWV GWKPS AFRL+  EG         +  +Q   +E LR ++ A E +
Sbjct  63   SWLTPFERTFLWVAGWKPSLAFRLLFHEGGDGGRDGCLLWPDQRTAMEELRRQVVAAEHR  122

Query  512  veremerqqVAMADRRMVELARLGGGD-TVADVAVKNMLGGLEKVMKMADCVRLKTLKGL  336
            +   +   Q AMA + ++   R G  + +    A   +   L  V+  AD +R  TL+ +
Sbjct  123  ISEGLAEAQEAMASQAVLGAVRAGSRNVSARAAAADVVARELRAVVSAADELRDATLRQV  182

Query  335  LDVMGP  318
            ++++ P
Sbjct  183  VEILTP  188



>ref|XP_011101452.1| PREDICTED: transcription factor TGA5-like [Sesamum indicum]
Length=249

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 90/194 (46%), Gaps = 26/194 (13%)
 Frame = -3

Query  755  LVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-----  591
            LV+K   H++ Y + +   AR  V  FF+P W TSLE + LW  G +PS   RLV     
Sbjct  47   LVDKNIRHFQEYASQRARLARNHVSPFFSPTWCTSLEGSMLWAGGCRPSIFVRLVYVLSG  106

Query  590  ----------------AGEG-MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRM  462
                             G G +S  Q+  +  L+ +   +E+K+   +   Q  MAD+ +
Sbjct  107  KELASHLDEYLHGGRSGGLGELSASQINSINSLQLRTIQQEDKLSANLASIQEEMADQPI  166

Query  461  V----ELARLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLA  294
                 ELA      T AD A+  +   L  V+  AD +RL TLK L  ++ P  S+ F+A
Sbjct  167  FIIAKELAACSQTSTEADEALNALTASLIGVLGEADSLRLNTLKELTSILTPVQSVDFIA  226

Query  293  SASMLQIQMRKCGK  252
            +A  L + +   G+
Sbjct  227  TARKLHLCVHAWGR  240



>ref|NP_001042845.2| Os01g0306400 [Oryza sativa Japonica Group]
 gb|EAY73690.1| hypothetical protein OsI_01574 [Oryza sativa Indica Group]
 dbj|BAF04759.2| Os01g0306400 [Oryza sativa Japonica Group]
Length=245

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 98/211 (46%), Gaps = 9/211 (4%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLL---LIAAENEKD-HEFLVNKLTTHYKNYYTAKWAAARED  687
            E    F+E W+ + E     L   L+ A   +D    LV+    H   YY  K   A  D
Sbjct  24   EEMVAFYEAWVGREERIVADLTDALLPARRRRDVLAPLVDAAVGHVSEYYERKARLADRD  83

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRL----VAGEGMSEEQMKKVEVLRGKIKAee  519
            V+A   P WL  LE  +LW  GWKP+  FR     VAG    ++Q + +E +R      E
Sbjct  84   VVAALDPRWLNPLERTFLWAWGWKPALVFRFADGAVAGGSSHQQQRRALERVRAATAEAE  143

Query  518  ekveremerqqVAMADRR-MVELARLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLK  342
             +V+RE+   Q ++A  R +  L R    +  AD AV  +   L  ++  AD +R +T++
Sbjct  144  REVDREVAVVQESLAGPRVLAALRRQHPRNGEADEAVAAVGRSLRVLLAAADALRERTVR  203

Query  341  GLLDVMGPTHSIHFLASASMLQIQMRKCGKT  249
             ++  + P  +  FLA+     + + + G+ 
Sbjct  204  DVVGTLAPDQAGAFLAAMLRFHLGVHRAGRN  234



>ref|XP_002888220.1| hypothetical protein ARALYDRAFT_893661 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64479.1| hypothetical protein ARALYDRAFT_893661 [Arabidopsis lyrata subsp. 
lyrata]
Length=230

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 101/216 (47%), Gaps = 16/216 (7%)
 Frame = -3

Query  854  ESFTDFFEKWMAQ----LEECAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAA---A  696
            E+F  FF  W+ +    ++E + L         + E L++   +H   YY  K  A   A
Sbjct  8    ETFASFFNDWLLRHRQFVQELSHLADETTRTPVEEESLLSNFLSHCLQYYEEKSVAMSVA  67

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIKAe  522
             +DV  FF+P WL+S E   LW+ G+KP   F+L+      ++  Q+ ++E +R + K  
Sbjct  68   GDDVYDFFSPPWLSSYEKLILWIGGFKPGMVFKLITTSVNDLTSHQIDQLENIRLETKRR  127

Query  521  eekveremerqqVAMADR-RMVELARLG------GGDTVADVAVKNMLGGLEKVMKMADC  363
            E  + R     Q ++ D   MV   R+G      G  +  + A+  M   +   MK AD 
Sbjct  128  ERDLMRRFALLQQSVGDPLLMVPFRRIGVLSLGEGEQSEMEEAMDVMKEEMITAMKNADQ  187

Query  362  VRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            +R  T+  +++V+ P  +I  L +A    + +R  G
Sbjct  188  LRCVTVGKVVEVLNPRQAIKLLRAAGEFYLLLRDLG  223



>dbj|BAK01043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=186

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEEC-----AQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARE  690
            ESF  FFE W+  LE+       +    A  ++ D   LV+++  HY+NYY AK AAA  
Sbjct  22   ESFAKFFECWI--LEQSRDLAALRAAATARPHDADLRRLVDRVLGHYENYYRAKSAAASA  79

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV  591
            DVL  FAP W+++ ES YLW  GW+P+ A +L+
Sbjct  80   DVLPMFAPSWISATESLYLWCGGWRPTAAVQLL  112



>dbj|BAB64034.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAB93383.1| hypothetical protein [Oryza sativa Japonica Group]
Length=277

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 98/211 (46%), Gaps = 9/211 (4%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEECAQLL---LIAAENEKD-HEFLVNKLTTHYKNYYTAKWAAARED  687
            E    F+E W+ + E     L   L+ A   +D    LV+    H   YY  K   A  D
Sbjct  56   EEMVAFYEAWVGREERIVADLTDALLPARRRRDVLAPLVDAAVGHVSEYYERKARLADRD  115

Query  686  VLAFFAPVWLTSLESAYLWVTGWKPSTAFRL----VAGEGMSEEQMKKVEVLRGKIKAee  519
            V+A   P WL  LE  +LW  GWKP+  FR     VAG    ++Q + +E +R      E
Sbjct  116  VVAALDPRWLNPLERTFLWAWGWKPALVFRFADGAVAGGSSHQQQRRALERVRAATAEAE  175

Query  518  ekveremerqqVAMADRR-MVELARLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLK  342
             +V+RE+   Q ++A  R +  L R    +  AD AV  +   L  ++  AD +R +T++
Sbjct  176  REVDREVAVVQESLAGPRVLAALRRQHPRNGEADEAVAAVGRSLRVLLAAADALRERTVR  235

Query  341  GLLDVMGPTHSIHFLASASMLQIQMRKCGKT  249
             ++  + P  +  FLA+     + + + G+ 
Sbjct  236  DVVGTLAPDQAGAFLAAMLRFHLGVHRAGRN  266



>ref|XP_009758860.1| PREDICTED: transcription factor TGA3-like [Nicotiana sylvestris]
Length=263

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/248 (27%), Positives = 119/248 (48%), Gaps = 41/248 (17%)
 Frame = -3

Query  881  SSSMRS--KVEESFTDFFEKWMA-QLEECAQLLLIAAE------NEKDHEFLVNKLTTHY  729
            SSS R+  K EES    +E WM  Q EE  +L   A +      N+++   L+ K+T ++
Sbjct  5    SSSTRTNRKEEESL---YETWMNLQREELTELEQAATQARNGHINDQELTKLIQKITNNF  61

Query  728  KNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--------------  591
            + Y   +   A+ D   FFAP+  T LE++ LW+ G +PS+  R +              
Sbjct  62   QEYSNNRKRLAQIDAPTFFAPISCTPLENSVLWIGGCRPSSFIRFIYSLCGIEIESHLTE  121

Query  590  ------AGE--GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGG  435
                   GE   ++ +Q+  V+ L+GK   EE ++   +   Q  + D+ +    +   G
Sbjct  122  FFQGTKIGELSDLTAKQITMVDELQGKTITEERELCSRLSSLQANIVDQPLPSKLKKDNG  181

Query  434  DTVADVAVKNMLGGLEK-------VMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQ  276
            D   D   +N    L++       V++ AD +R+KTL+ +  ++ P  ++ +LA+A  L+
Sbjct  182  DDQGDQYSENAYERLDEQIHEMATVVEEADELRMKTLQEITSLLTPAQAVEYLAAAKRLR  241

Query  275  IQMRKCGK  252
            +  ++ GK
Sbjct  242  LCFQQWGK  249



>ref|XP_007025355.1| Delay of germination 1, putative [Theobroma cacao]
 gb|EOY27977.1| Delay of germination 1, putative [Theobroma cacao]
Length=408

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 108/231 (47%), Gaps = 34/231 (15%)
 Frame = -3

Query  836  FEKWMA-QLEECAQLL--LIAAEN-----EKDHEFLVNKLTTHYKNYYTAKWAAAREDVL  681
            F++WM  Q +E ++LL  L   EN     E  +  L  K    ++ Y   +   +R+DV 
Sbjct  12   FQEWMTIQEQELSELLQALNLKENDVNSSENTYAKLAEKSINSFQEYIDKRNQLSRQDVS  71

Query  680  AFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG------------  537
              FAP W T+LE++ LW+ G +PS   RL      S+ + + +E+L+G            
Sbjct  72   GLFAPSWNTALENSLLWIGGCRPSMYIRLTYALCGSQVEFQLLEILQGLARGDLGQISAT  131

Query  536  ----------KIKAeeekveremerqqVAMADRRMV----ELARLGGGDTVADVAVKNML  399
                      K   EEE++   +   Q  +AD+ +      L R+G      D A+    
Sbjct  132  QLGKINDLHMKTMKEEERLSNNLASLQENIADQPIAVIAKRLCRVGESSGEVDRALDEHE  191

Query  398  GGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQ  246
              +  +++ AD +RL TLK LL ++ P   + FLA++  L + M + GKT+
Sbjct  192  SSMANILQEADKLRLSTLKELLGILTPVQGVDFLAASKKLHLCMHEWGKTR  242



>ref|XP_010920258.1| PREDICTED: transcription factor TGA2 [Elaeis guineensis]
Length=257

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 111/245 (45%), Gaps = 44/245 (18%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAENEKDH-----EFLVNKLTTHYKNYYTAKWAAAREDV  684
            F   F++W+ + E     LL + ++E+         LV K   HYK Y   + A ARED 
Sbjct  5    FRSCFDEWVREQESDLNELLESMQSERRESDSRLRELVEKSMRHYKEYSEKRRALAREDG  64

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG---------------------------  585
              FF P W T+ E+++LW+ G +P+ + RL+                             
Sbjct  65   PTFFCPPWCTAFENSFLWLGGCRPTLSIRLLYALSGYELEAHLDDILAPGGLAAAFQRGL  124

Query  584  EGMSEEQMKKVEVLRGKIKAeeekveremerqqVAMAD-----------RRMVELARLGG  438
             G+S  Q+  V  L  +   EE+++  +M   Q  +AD           RR  E+A   G
Sbjct  125  VGLSAAQLATVNDLHCRTLKEEDRLSAKMATLQEDVADKPLLPIAVDRARRRAEVAEGSG  184

Query  437  GDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLL-DVMGPTHSIHFLASASMLQIQMRK  261
            G  V +  +K     L  +++ AD +R+ TL+ L+ +++ P  ++  L +A  LQ+ +R+
Sbjct  185  GREVVEATMKEHEEKLAGMVEEADQLRVATLRTLVTEILTPLQAVELLVAAKQLQLSVRQ  244

Query  260  CGKTQ  246
             G+ +
Sbjct  245  WGQRR  249



>gb|EYU43340.1| hypothetical protein MIMGU_mgv1a020768mg, partial [Erythranthe 
guttata]
Length=244

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 108/230 (47%), Gaps = 38/230 (17%)
 Frame = -3

Query  839  FFEKWM----AQLEECAQLLLI--------AAENEKDHEFLVNKLTTHYKNYYTAKWAAA  696
             +++WM     +L E  Q L +         A +E  H  L++K+  H+  Y   +   A
Sbjct  13   IYKEWMKLQEQELSELNQALTLTAAGCTTTGAADELSH--LIDKIMAHFVEYTQIRSCMA  70

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG----------------------E  582
            + DV  +FAP W TSLE + LW+ G +PS+  RL+                         
Sbjct  71   QADVSPYFAPTWCTSLERSVLWIGGCRPSSFIRLIYALSGLEIESRLSEFLRGARIGNLG  130

Query  581  GMSEEQMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNM  402
            G+S +Q+  V+ L+G+   EE K+   M   Q  + D  +  +A    G+   D A+ + 
Sbjct  131  GLSGDQIFMVDELQGRTIGEERKLSTRMASLQEDLLDHPLASIAVKSEGNL--DAALDDH  188

Query  401  LGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
               + +++  AD +RL +LK L+ ++ P  ++ F+A+   L++ M+  GK
Sbjct  189  GRAMAEMLAEADQLRLSSLKELIGILTPRQAVDFMAAGKKLRLCMQDWGK  238



>ref|XP_009338174.1| PREDICTED: transcription factor TGA2-like [Pyrus x bretschneideri]
Length=217

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 100/219 (46%), Gaps = 32/219 (15%)
 Frame = -3

Query  881  SSSMRSKVEESFTDFFEKWMAQ----LEE--CAQLLLIAAENEKDHEFLVNKLTTHYKNY  720
            + S       +F  F+E W+ +    L+E   AQ  +  A +E D   LV+++  HY+ Y
Sbjct  3    NGSQSGNASNTFEAFYEGWLVRQGHFLDELLSAQQTIDEARDE-DLRDLVSRVLFHYQQY  61

Query  719  YTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLR  540
            Y  K    + DVL  F+P W TS E + LW+ G+K S  F+LV          + V  L 
Sbjct  62   YDEKSRLGQRDVLLVFSPTWYTSYERSLLWIAGYKQSIVFQLVT---------ESVSDLS  112

Query  539  GKIKAeeekveremerqqVAMADRR---------------MVELARLGGGDTVADVAV-K  408
             +++    ++      ++ A+ D+R               +    R G G+ V D AV K
Sbjct  113  DQLRVRMARLREATRVEERALNDKRAKIHESVAAPPFMDAVRRYRRAGHGEIVEDDAVIK  172

Query  407  NMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLAS  291
            ++   LE V++ A+ +R      L+D++    ++  LA+
Sbjct  173  SLKSALETVVENANLLRTTMATKLVDLLSSGQAVKILAN  211



>ref|XP_002537773.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF24610.1| conserved hypothetical protein [Ricinus communis]
Length=255

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 94/194 (48%), Gaps = 26/194 (13%)
 Frame = -3

Query  755  LVNKLTTHYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG---  585
            L  K   H++ Y   +   A  DV  +FAP W ++LE++ LW+ G +PS   RLV     
Sbjct  52   LAEKNIEHFQEYVDKRNRLAHNDVSVYFAPTWNSALENSLLWLAGCRPSIFIRLVYALCG  111

Query  584  -----------EG--------MSEEQMKKVEVLRGKIKAeeekveremerqqVAMADR--  468
                       +G        +S +Q+  V VL  K    EEK+  ++   Q  +AD   
Sbjct  112  SQVESQIAEHLQGTRTGNLGDLSLQQLNMVNVLHCKTIKHEEKLTTQLASLQEDIADEPI  171

Query  467  RMV--ELARLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLA  294
             MV  E +  G  + V D A++N    + ++++ AD +RL TLK L+ ++ P  ++ +LA
Sbjct  172  SMVAKEQSHAGDSNEVVDRALQNHDEAMVRLLQEADNLRLTTLKELISILTPVQAVDYLA  231

Query  293  SASMLQIQMRKCGK  252
            +   L + M + GK
Sbjct  232  AGRKLHLCMHEWGK  245



>ref|XP_002524536.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37863.1| conserved hypothetical protein [Ricinus communis]
Length=136

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 56/111 (50%), Gaps = 6/111 (5%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIA-----AENEKDH-EFLVNKLTTHYKNYYTAKWAAARE  690
            SF  F+E W  QL      L  A     +E +  H   LV+KL  HY  YY  K  A   
Sbjct  3    SFCRFYETWFDQLHRLFHQLSKAPKPPTSEYDASHLSNLVDKLMDHYVEYYRVKSEAVER  62

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG  537
            DVLA F   W +SLE +  W+ GW+P+T F LV  E     + + V++LRG
Sbjct  63   DVLAVFTAHWTSSLERSLHWIAGWRPTTLFHLVYTESSILFEPRIVDILRG  113



>ref|NP_001145406.1| uncharacterized protein LOC100278763 [Zea mays]
 gb|ACG47325.1| hypothetical protein [Zea mays]
Length=219

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 96/206 (47%), Gaps = 12/206 (6%)
 Frame = -3

Query  839  FFEKWMAQLEE-----CAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDVLAF  675
            F++ W+ + E+      A L L           LV+    H   YY  K   A  DV+A 
Sbjct  4    FYDAWVGREEQIVAELTAALALQPRRRGDALALLVDGAVAHVAAYYEHKSRLADRDVVAA  63

Query  674  FAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLRGKIKAeeekvere  501
              P WL  +E  +LW  GWKP+  FR V   G G+  EQ + +E LRG     E +V+ +
Sbjct  64   LDPRWLNPIERTFLWAWGWKPALMFRFVESVGVGLRLEQRRALEELRGATAVAEREVDLQ  123

Query  500  merqqVAMADRRMVELAR---LGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLD  330
            +   Q ++A  R++   R   L  G+    VAV      L  ++  AD +R +TL+G++ 
Sbjct  124  VAAVQESLAGPRVLAALRRQPLRNGEAEDAVAVVGR--SLRVLLAAADALRDRTLRGVVG  181

Query  329  VMGPTHSIHFLASASMLQIQMRKCGK  252
            ++    +   +A+     + +R+ G+
Sbjct  182  LLATDQAGAVVAAMLRFHLGVRRAGR  207



>ref|XP_004967541.1| PREDICTED: transcription factor PERIANTHIA-like [Setaria italica]
Length=223

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 97/211 (46%), Gaps = 12/211 (6%)
 Frame = -3

Query  848  FTDFFEKWMAQLEE-----CAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAREDV  684
              +F++ W+ + E+      A L L           LV+    H   YY  K   A  DV
Sbjct  1    MAEFYDTWVGREEQIVADLTAALALPPRRRRDALPPLVDVAVGHVAAYYEHKARLADRDV  60

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-----AGEGMSEEQMKKVEVLRGKIKAee  519
            +A   P WL  LE  +LW  GWKP+  FR V        GM   Q + +E LR    A E
Sbjct  61   VAALDPRWLNPLERTFLWAWGWKPALVFRFVETGGVGVGGMGSTQRRALEDLRAATAAAE  120

Query  518  ekveremerqqVAMADRRMVELARL--GGGDTVADVAVKNMLGGLEKVMKMADCVRLKTL  345
             +V RE+   Q ++A  R++   R     G+  AD AV  +   L  ++  AD +R +TL
Sbjct  121  REVGREVAAVQESLAGPRVLAALRRQHAPGNGEADDAVAAVGRSLRVLLGAADALRERTL  180

Query  344  KGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            +G++ ++ P  +  F+A+     + +R  G+
Sbjct  181  RGVVGLLAPDQAAAFVAAMLRFHLAVRHAGR  211



>ref|NP_001118628.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY78741.1| DNA-binding protein-related [Arabidopsis thaliana]
 gb|AEE75583.1| uncharacterized protein AT3G14880 [Arabidopsis thaliana]
Length=237

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/211 (26%), Positives = 98/211 (46%), Gaps = 19/211 (9%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEK-----DHEFL---VNKLTTHYKNYYTAKWAAA  696
            SF  F + W+ QL      L  A  + +     D E L   V+++  H++ Y+ AKWAA 
Sbjct  9    SFKKFQQSWIEQLRNHLNHLRSAQNHHRNSATGDEERLREAVDRVMEHFREYHRAKWAAT  68

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRGKIKAeee  516
             +DV+   A  W ++LE +  WV GW+P+T F LV  E     + + V++LRG    +  
Sbjct  69   DKDVIEVMASPWASALERSLQWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLS  128

Query  515  kveremerqqVAMADRRMVELARLGG-----GDTVADVAVKNMLGGLEKVMKMADCV---  360
             +     R    +    + E   +        D  +D+ +       +++ ++A+ V   
Sbjct  129  DLSPSQFRTVSELQCETVKEENAITEELSEWQDDASDLVMGTSSDPDQRIRRLAEIVHRT  188

Query  359  ---RLKTLKGLLDVMGPTHSIHFLASASMLQ  276
               RL+T+  +++V+ P     FL +A+ L+
Sbjct  189  DDLRLRTITRVVEVLSPLQQAEFLVAAAELR  219



>ref|XP_008655844.1| PREDICTED: transcription factor TGA5-like [Zea mays]
 gb|AFW80595.1| hypothetical protein ZEAMMB73_105834 [Zea mays]
Length=225

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 97/211 (46%), Gaps = 12/211 (6%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEE-----CAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARE  690
            +    F++ W+ + E+      A L L           LV+    H   YY  K   A  
Sbjct  5    DDMAAFYDAWVGREEQIVAELTAALALQPRRRGDALALLVDGAVAHVAAYYEHKSRLADR  64

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLRGKIKAeee  516
            DV+A   P WL  +E  +LW  GWKP+  FR V   G G+  EQ + +E LRG   A E 
Sbjct  65   DVVAALDPRWLNPIERTFLWAWGWKPALMFRFVESVGVGLRLEQRRALEELRGATAAAER  124

Query  515  kveremerqqVAMADRRMVELAR---LGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTL  345
            +V+ ++   Q ++A  R++   R   L  G+    VAV      L  ++  AD +R +TL
Sbjct  125  EVDLQVAAVQESLAGPRVLAALRRQPLRNGEAEDAVAVVGR--SLRVLLVAADALRDRTL  182

Query  344  KGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            +G++ ++    +   + +     + +R+ G+
Sbjct  183  RGVVGLLATDQAGAVVVAMLRFHLGVRRAGR  213



>ref|XP_010543213.1| PREDICTED: transcription factor TGA2-like [Tarenaya hassleriana]
Length=222

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 98/206 (48%), Gaps = 10/206 (5%)
 Frame = -3

Query  848  FTDFFEKWMAQLEECAQLLLIAAENEKDHEF-----LVNKLTTHYKNYYTAKWAAAREDV  684
            F +F  +W+ + E     LL A E+  +  F     L+ ++  HYK Y+  K      D 
Sbjct  6    FAEFVGEWILRQEGFHDELLAAKEHAGEEGFCDRDDLIARVIRHYKEYFERKAVVRENDC  65

Query  683  LAFFAPVWLTSLESAYLWVTGWKPSTAFRLV--AGEGMSEEQMKKVEVLR-GKIKAeeek  513
             A  +P W + LE  +LWV G+KP     +V  A  G++ EQM K+++L    I AE   
Sbjct  66   FALLSPTWFSRLEICFLWVAGFKPGLGIGIVKDAVGGLTNEQMDKMDMLELETIVAETTI  125

Query  512  veremerqqVAMADRRMVELARLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLL  333
              R  E Q+ A A R +   +R       AD  V  +   ++ V+  AD +R++T   ++
Sbjct  126  EHRLAEIQRSAAALRAIRRQSREDNMAAQAD--VDWIATAMKGVVAAADALRMRTAIKIV  183

Query  332  DVMGPTHSIHFLASASMLQIQMRKCG  255
             ++     I FL +A+ L  ++R  G
Sbjct  184  GILQTAQKIEFLTAAATLYKKIRVRG  209



>ref|XP_007159877.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
 gb|ESW31871.1| hypothetical protein PHAVU_002G275400g [Phaseolus vulgaris]
Length=201

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 88/181 (49%), Gaps = 40/181 (22%)
 Frame = -3

Query  677  FFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEG----------------------MSEEQ  564
              +P W +SLE A+LW+ GW+PS AF L+  +                       +S  Q
Sbjct  1    MLSPTWTSSLEDAFLWIGGWRPSMAFHLLYSKSGLQFEARLQELVQGLRTHDLGDLSASQ  60

Query  563  MKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGG-----------------  435
            + +++ ++ ++  EE ++   M   Q  +AD  MVEL+ +                    
Sbjct  61   ISQLDEMQKRVILEERQITDLMAGHQETVADASMVELSHVASEMIRANERGEVEESKEFE  120

Query  434  DTVADVAVKNMLGGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
            D V    V+    GLEK+++ AD +RL TLK +++V+ P  +IHFL +A+ L +++ + G
Sbjct  121  DKVESTLVQKE-EGLEKILQKADELRLGTLKAIVNVLTPKQAIHFLIAAAELHLRLHEWG  179

Query  254  K  252
            K
Sbjct  180  K  180



>gb|EYU20277.1| hypothetical protein MIMGU_mgv1a018018mg [Erythranthe guttata]
Length=258

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/234 (26%), Positives = 115/234 (49%), Gaps = 37/234 (16%)
 Frame = -3

Query  842  DFFEKWMA-QLEECAQLL---------LIAAENEKDHEFLVNKLTTHYKNYYTAKWAAAR  693
            + +++WM+ Q +E  +L+            ++N+ +   L++K T  +++Y   +   AR
Sbjct  13   NMYKEWMSFQEQELTELIHSLNLNKTTATTSDNDAEINALLDKATQSFQDYIERRNRLAR  72

Query  692  EDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG---------------EGMSEE---  567
             D  AFF+P W +S ES+ LW+ G +PS+ F L                  +G S+E   
Sbjct  73   RDTSAFFSPRWCSSFESSMLWIAGCRPSSFFNLFYALCGSDIDSRLSQFLQDGKSDEFPQ  132

Query  566  ----QMKKVEVLRGKIKAeeekveremerqqVAMADRRMVELAR-LGGGDTVADVAVKNM  402
                Q+  ++ L+ +   EEEK+  +    Q   AD  +  +AR L G     +  V+  
Sbjct  133  LSPSQLVAIDNLQRRTIVEEEKLTSQFASLQQDKADVPLALIARKLEGPQYELNEDVRET  192

Query  401  LGGLEK----VMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGK  252
            +  +EK    +M+ AD +RL+T K ++ ++ P  ++ F+ +A  L++ +R  G+
Sbjct  193  IAEIEKAMVCLMEEADNLRLETFKEMVKILKPVQALEFIIAAKKLRVCVRSWGE  246



>ref|XP_008673985.1| PREDICTED: transcription factor PERIANTHIA-like [Zea mays]
 tpg|DAA54358.1| TPA: hypothetical protein ZEAMMB73_657016 [Zea mays]
Length=224

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 96/208 (46%), Gaps = 7/208 (3%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEE-----CAQLLLIAAENEKDHEFLVNKLTTHYKNYYTAKWAAARE  690
            E    F++ W+ + E+        L L           LV+    H   YY  K   A  
Sbjct  5    EDMASFYDAWVGREEQIVADLTTALALPPRRRSDALAPLVDAAVAHVVAYYEHKSRLADR  64

Query  689  DVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-AGEGMSEEQMKKVEVLRGKIKAeeek  513
            DV+A   P WL  LE  +LW  GWKP+  FR V  G G+  EQ + +E LR    A E +
Sbjct  65   DVVAALDPCWLNPLERTFLWAWGWKPALMFRFVEGGVGVRPEQRRALEELRAATAANERE  124

Query  512  veremerqqVAMADRR-MVELARLGGGDTVADVAVKNMLGGLEKVMKMADCVRLKTLKGL  336
            V+ ++   Q ++A  R +  L R    +  AD AV  +   L  ++  AD +R +TL+G+
Sbjct  125  VDMQVAAVQESLAGPRVLAALRRQPPLNGEADEAVAVVARSLRVLLAAADALRDRTLRGV  184

Query  335  LDVMGPTHSIHFLASASMLQIQMRKCGK  252
            + ++ P  +   +A+     + + + G+
Sbjct  185  VGLLAPDQAGAVVAAMLGFHLAVHRAGR  212



>ref|XP_006582492.1| PREDICTED: transcription factor HBP-1b(c38)-like [Glycine max]
Length=136

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 60/104 (58%), Gaps = 2/104 (2%)
 Frame = -3

Query  737  THYKNYYTAKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQ  564
            +HY+ +   K   A +DV   F+P WL++ E A LW+  +KPS   RLV G  +G++ EQ
Sbjct  4    SHYQQFMEEKSNVANDDVYLLFSPPWLSAYERALLWIGDYKPSLIHRLVDGAVKGLTAEQ  63

Query  563  MKKVEVLRGKIKAeeekveremerqqVAMADRRMVELARLGGGD  432
              +VE  R K K  E ++   +   Q +MA RRM+EL R+  G+
Sbjct  64   RGRVERTRDKTKRAERELTEAVASVQESMASRRMLELTRVVDGE  107



>gb|EYU28097.1| hypothetical protein MIMGU_mgv1a017794mg, partial [Erythranthe 
guttata]
Length=237

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/238 (26%), Positives = 107/238 (45%), Gaps = 36/238 (15%)
 Frame = -3

Query  872  MRSKVEESFTDFFEKWMA-QLEECAQL----LLIAAENEKDHEF--LVNKLTTHYKNYYT  714
            M +  E   T F+++WMA Q  E ++L     L A  +  D E   L++++ T++KNY  
Sbjct  1    MATSDEAKETCFYQQWMALQEHELSELNRAITLNANGSTSDFELTQLIDRILTNFKNYVK  60

Query  713  AKWAAAREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLV-AGEGMSEEQMKKVEVLRG  537
             +   A+EDV  + AP W T+LE + LW+ G +PS+  RL+ A  GM  E     E L G
Sbjct  61   MRRVMAKEDVSPYMAPTWCTTLERSVLWIGGCRPSSYIRLIYALCGMLTES-NLTEFLNG  119

Query  536  KIKAeeekveremerqqVAMADRRMVELARLGG----------GDTVADVAVKNML----  399
                   ++          +  + + E  R+             D +A +AV +      
Sbjct  120  SNTVNLGELSGAQMSMVDELQKKTIAEERRISTRMAGLQEDVLDDPLAVIAVGSEGGSCG  179

Query  398  -------------GGLEKVMKMADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMR  264
                         G +   ++ AD +R+ TL  ++ ++ P+  + +LA+   LQ+ M+
Sbjct  180  SSGTVEEALTEHGGAMAATLEAADQLRMDTLVEVIRILTPSQGVSYLAAGKKLQLCMQ  237



>ref|NP_188106.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA97051.1| tumor-related protein-like [Arabidopsis thaliana]
 gb|ABE65942.1| DNA-binding protein-like protein [Arabidopsis thaliana]
 dbj|BAH30453.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75582.1| uncharacterized protein AT3G14880 [Arabidopsis thaliana]
Length=244

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 104/230 (45%), Gaps = 27/230 (12%)
 Frame = -3

Query  851  SFTDFFEKWMAQLEECAQLLLIAAENEK-----DHEFL---VNKLTTHYKNYYTAKWAAA  696
            SF  F + W+ QL      L  A  + +     D E L   V+++  H++ Y+ AKWAA 
Sbjct  9    SFKKFQQSWIEQLRNHLNHLRSAQNHHRNSATGDEERLREAVDRVMEHFREYHRAKWAAT  68

Query  695  REDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAGEGMSEEQMKKVEVLRG-------  537
             +DV+   A  W ++LE +  WV GW+P+T F LV  E     + + V++LRG       
Sbjct  69   DKDVIEVMASPWASALERSLQWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLS  128

Query  536  -----KIKAeeekveremerqqVAMADRRMVELARLGGGDTVADVAVKNMLGGLEKVMKM  372
                 + +    K     E Q   + +   +        D  +D+ +       +++ ++
Sbjct  129  DLSPSQFRVPFVKGRTVSELQCETVKEENAITEELSEWQDDASDLVMGTSSDPDQRIRRL  188

Query  371  ADCV------RLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCGKTQHN  240
            A+ V      RL+T+  +++V+ P     FL +A+ L+  +   G T H+
Sbjct  189  AEIVHRTDDLRLRTITRVVEVLSPLQQAEFLVAAAELRTGVAGWG-TSHD  237



>ref|XP_006301016.1| hypothetical protein CARUB_v10021407mg [Capsella rubella]
 gb|EOA33914.1| hypothetical protein CARUB_v10021407mg [Capsella rubella]
Length=234

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 104/220 (47%), Gaps = 20/220 (9%)
 Frame = -3

Query  854  ESFTDFFEKWMAQLEE-CAQLLLIAAE-----NEKDHEFLVNKLTTHYKNYYTAKWAA--  699
            E+F  FF+ W+    +   QL   A E      + + E LV K  +H   YY  K +A  
Sbjct  8    ETFATFFDDWLNHHRQLIEQLAHFADEASTSVTQVEEESLVTKFLSHCLQYYQEKSSAMS  67

Query  698  -AREDVLAFFAPVWLTSLESAYLWVTGWKPSTAFRLVAG--EGMSEEQMKKVEVLRGKIK  528
             A ED+  FF+P WL S E   LW+ G+KP   F+L+      ++  Q  ++E +R + +
Sbjct  68   VAGEDLYDFFSPPWLNSYEKLILWIGGFKPGMVFKLITTSVNDLTSHQKDQLESIRLETQ  127

Query  527  AeeekveremerqqVAMADR------RMVELARLGGGDTVA---DVAVKNMLGGLEKVMK  375
              E  + R     Q ++ D       + +   RLG  +      + A++ +   + +VMK
Sbjct  128  RRERALTRGFALLQQSVGDPLLMVRFKNIGALRLGEREQPGMKEEEAMEVLKKEMTEVMK  187

Query  374  MADCVRLKTLKGLLDVMGPTHSIHFLASASMLQIQMRKCG  255
             AD +R  T++ +++V+ P  ++  L +     +++R  G
Sbjct  188  NADQLRCVTVEKVVEVLNPRQAVKLLRAVGEFYLRLRDLG  227



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2108914979916