BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c37865_g1_i1 len=576 path=[1:0-575]

Length=576
                                                                      Score     E

ref|XP_009804889.1|  PREDICTED: putative lipid-binding protein At...    111   2e-27   
ref|XP_009608848.1|  PREDICTED: putative lipid-binding protein At...    111   2e-27   
ref|XP_004229790.1|  PREDICTED: putative lipid-binding protein At...    110   3e-27   
ref|XP_006347893.1|  PREDICTED: putative lipid-binding protein At...    110   4e-27   
ref|XP_011090306.1|  PREDICTED: putative lipid-binding protein At...    109   1e-26   
ref|XP_011033419.1|  PREDICTED: putative lipid-binding protein At...    108   2e-26   
emb|CDP19512.1|  unnamed protein product                                108   3e-26   
gb|KFK30593.1|  hypothetical protein AALP_AA6G001800                    107   5e-26   
ref|XP_006375281.1|  hypothetical protein POPTR_0014s05870g             107   9e-26   
gb|ABK95307.1|  unknown                                                 107   9e-26   Populus trichocarpa [western balsam poplar]
ref|XP_007052128.1|  Bifunctional inhibitor/lipid-transfer protei...    107   1e-25   
ref|XP_010088891.1|  hypothetical protein L484_020879                   105   5e-25   
ref|XP_007218590.1|  hypothetical protein PRUPE_ppa013286mg             103   1e-24   
gb|KDP28789.1|  hypothetical protein JCGZ_14560                         103   2e-24   
emb|CBI38878.3|  unnamed protein product                                103   2e-24   
ref|XP_006288783.1|  hypothetical protein CARUB_v10002104mg             104   3e-24   
ref|XP_003633921.2|  PREDICTED: putative lipid-binding protein At...    103   4e-24   
ref|XP_002511666.1|  14 kDa proline-rich protein DC2.15 precursor...    102   4e-24   Ricinus communis
gb|AFK37174.1|  unknown                                                 102   4e-24   
ref|XP_007140792.1|  hypothetical protein PHAVU_008G142500g             102   5e-24   
ref|XP_008232589.1|  PREDICTED: putative lipid-binding protein At...    102   8e-24   
ref|NP_680546.1|  bifunctional inhibitor/lipid-transfer protein/s...    101   9e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144555.1|  PREDICTED: putative lipid-binding protein At...    101   1e-23   
ref|XP_008356291.1|  PREDICTED: putative lipid-binding protein At...    100   2e-23   
ref|XP_009375767.1|  PREDICTED: putative lipid-binding protein At...    100   3e-23   
ref|XP_002872966.1|  hypothetical protein ARALYDRAFT_327754             104   3e-23   
emb|CDY65570.1|  BnaCnng47750D                                        99.8    6e-23   
ref|XP_006396214.1|  hypothetical protein EUTSA_v10029074mg           99.0    9e-23   
gb|AAC19312.1|  contains similarity to Medicago sativa corC (GB:L...    103   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140487.1|  PREDICTED: putative lipid-binding protein At...  98.6    1e-22   
ref|XP_010692176.1|  PREDICTED: putative lipid-binding protein At...  98.6    2e-22   
gb|KCW78307.1|  hypothetical protein EUGRSUZ_D02487                   98.6    2e-22   
ref|XP_010053928.1|  PREDICTED: putative lipid-binding protein At...  98.2    3e-22   
ref|XP_004306947.1|  PREDICTED: putative lipid-binding protein At...  97.8    3e-22   
ref|XP_008458132.1|  PREDICTED: putative lipid-binding protein At...  97.4    5e-22   
ref|NP_001235244.1|  uncharacterized protein LOC100306451 precursor   90.9    1e-19   
ref|XP_010264239.1|  PREDICTED: putative lipid-binding protein At...  87.8    1e-18   
gb|KFK37310.1|  hypothetical protein AALP_AA4G240600                  86.7    6e-18   
ref|XP_010088890.1|  hypothetical protein L484_020878                 86.3    7e-18   
ref|XP_006295216.1|  hypothetical protein CARUB_v10024298mg           86.3    8e-18   
ref|NP_566036.1|  protease inhibitor/seed storage/lipid transfer ...  85.9    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010258990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    1e-17   
gb|ADW80126.1|  hybrid proline-rich protein                           85.5    1e-17   
ref|XP_007011824.1|  Bimodular protein                                85.5    1e-17   
sp|P14009.1|14KD_DAUCA  RecName: Full=14 kDa proline-rich protein...  85.5    1e-17   Daucus carota [carrots]
ref|XP_010099842.1|  hypothetical protein L484_008499                 84.3    3e-17   
ref|XP_006397698.1|  hypothetical protein EUTSA_v10001680mg           84.3    3e-17   
ref|XP_010506455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.3    3e-17   
ref|XP_010518131.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.3    4e-17   
ref|XP_008232588.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.3    4e-17   
emb|CBI31906.3|  unnamed protein product                              83.6    4e-17   
ref|XP_002285197.1|  PREDICTED: putative lipid-binding protein At...  83.6    6e-17   Vitis vinifera
ref|XP_004516834.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.6    7e-17   
ref|XP_009626056.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    8e-17   
ref|XP_006353678.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    8e-17   
emb|CDP05328.1|  unnamed protein product                              83.2    9e-17   
gb|AEX33654.1|  lipid transfer protein                                83.2    1e-16   
ref|XP_002271461.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    82.8    1e-16   Vitis vinifera
gb|AAX20042.1|  proline-rich protein                                  82.8    1e-16   Capsicum annuum
ref|XP_008219516.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.8    1e-16   
ref|XP_010508203.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.8    1e-16   
ref|XP_002880164.1|  hypothetical protein ARALYDRAFT_483654           82.8    2e-16   
ref|NP_001235511.1|  uncharacterized protein LOC100500518 precursor   82.4    2e-16   
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg           82.4    2e-16   
ref|XP_003588783.1|  14 kDa proline-rich protein DC2.15               82.8    2e-16   
ref|XP_009133710.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    82.4    2e-16   
emb|CAN77080.1|  hypothetical protein VITISV_025477                   81.6    2e-16   Vitis vinifera
gb|KHN09805.1|  14 kDa proline-rich protein DC2.15                    82.0    3e-16   
ref|NP_001235888.1|  uncharacterized protein LOC100500033 precursor   82.0    3e-16   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    3e-16   
emb|CDX95635.1|  BnaC03g25160D                                        82.0    3e-16   
ref|NP_001235027.1|  uncharacterized protein LOC100500229 precursor   82.0    3e-16   
ref|XP_007218576.1|  hypothetical protein PRUPE_ppa013120mg           82.0    3e-16   
ref|XP_009801825.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.6    3e-16   
emb|CAA59472.1|  hybrid proline-rich protein                          82.0    3e-16   Catharanthus roseus [chatas]
ref|XP_003526352.1|  PREDICTED: extensin-like                         83.6    3e-16   
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    4e-16   
ref|XP_003608741.1|  Cortical cell-delineating protein                81.6    4e-16   
ref|XP_008362163.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.6    4e-16   
ref|NP_001238461.1|  uncharacterized protein LOC100499693 precursor   81.3    4e-16   
ref|XP_003525817.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    4e-16   
gb|AFK47547.1|  unknown                                               81.6    5e-16   
gb|AIX10944.1|  PRP2-like protein                                     81.6    5e-16   
ref|XP_011081229.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    5e-16   
ref|XP_004241782.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    5e-16   
ref|XP_007226236.1|  hypothetical protein PRUPE_ppa017473mg           80.9    5e-16   
gb|ADD11814.1|  hybrid proline-rich protein                           81.3    6e-16   Cajanus cajan
ref|XP_011070108.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    6e-16   
ref|XP_003588785.1|  14 kDa proline-rich protein DC2.15               81.3    6e-16   
ref|XP_009801239.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    6e-16   
ref|XP_003559026.1|  PREDICTED: putative lipid-binding protein AIR1   81.3    7e-16   
emb|CAA81526.1|  14 kDa polypeptide                                   80.9    7e-16   Catharanthus roseus [chatas]
ref|XP_004516832.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    7e-16   
ref|XP_003588784.1|  14 kDa proline-rich protein DC2.15               81.6    7e-16   
ref|XP_004516833.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    7e-16   
gb|KHN08148.1|  Putative lipid-binding protein                        81.6    7e-16   
ref|XP_004291444.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    8e-16   
gb|ABQ01426.1|  bimodular protein                                     81.3    8e-16   Medicago falcata [sickle alfalfa]
ref|XP_010053451.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.5    8e-16   
gb|EYU18564.1|  hypothetical protein MIMGU_mgv1a016162mg              80.5    8e-16   
gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg              80.5    9e-16   
gb|AFK37038.1|  unknown                                               80.5    9e-16   
gb|AAA32650.1|  bimodular protein                                     81.3    9e-16   Medicago sativa [alfalfa]
ref|XP_007137003.1|  hypothetical protein PHAVU_009G092000g           81.3    9e-16   
ref|XP_003588779.1|  14 kDa proline-rich protein DC2.15               82.0    9e-16   
emb|CDP09932.1|  unnamed protein product                              80.9    1e-15   
gb|KCW77749.1|  hypothetical protein EUGRSUZ_D02043                   80.9    1e-15   
gb|AES59035.2|  Lipid transfer protein                                81.3    1e-15   
ref|XP_010264242.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.5    1e-15   
ref|XP_010258985.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    1e-15   
ref|XP_004498751.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    1e-15   
ref|XP_009607067.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    1e-15   
ref|XP_011036580.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    2e-15   
gb|KHN33896.1|  14 kDa proline-rich protein DC2.15                    79.7    2e-15   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    2e-15   
ref|XP_006445312.1|  hypothetical protein CICLE_v10022835mg           79.7    2e-15   
ref|XP_007039884.1|  Bifunctional inhibitor/lipid-transfer protei...  79.7    2e-15   
ref|XP_002309638.1|  hypothetical protein POPTR_0006s27220g           79.3    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002324869.2|  hypothetical protein POPTR_0018s01890g           79.0    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010696470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.3    2e-15   
ref|XP_003609035.1|  Proline-rich protein                             79.0    2e-15   
ref|NP_001275620.1|  uncharacterized protein LOC102590907 precursor   79.3    3e-15   
gb|AFK43955.1|  unknown                                               79.0    3e-15   
ref|XP_006856528.1|  hypothetical protein AMTR_s00046p00139540        78.6    3e-15   
ref|XP_008394102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    3e-15   
ref|XP_008663526.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    3e-15   
ref|XP_011039660.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    3e-15   
ref|XP_006579357.1|  PREDICTED: uncharacterized protein LOC100499...  79.0    4e-15   
gb|EPS71802.1|  hypothetical protein M569_02964                       79.0    4e-15   
ref|XP_009375766.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    4e-15   
ref|XP_003603362.1|  Proline-rich protein                             78.6    4e-15   
ref|XP_010053452.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.6    5e-15   
ref|XP_010676151.1|  PREDICTED: putative lipid-binding protein AIR1B  78.2    7e-15   
gb|EPS73889.1|  hypothetical protein M569_00868                       78.2    7e-15   
ref|XP_006366173.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.4    9e-15   
ref|XP_004306948.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    1e-14   
ref|XP_010523077.1|  PREDICTED: putative lipid-binding protein At...  77.0    1e-14   
ref|NP_001152564.1|  cortical cell-delineating protein precursor      77.4    1e-14   Zea mays [maize]
ref|XP_004291442.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.4    1e-14   
ref|XP_002464967.1|  hypothetical protein SORBIDRAFT_01g029610        77.0    1e-14   Sorghum bicolor [broomcorn]
ref|XP_004291443.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    1e-14   
ref|NP_001047651.1|  Os02g0662100                                     77.0    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010053929.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    77.0    2e-14   
ref|XP_010906608.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    2e-14   
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...  77.0    2e-14   
ref|XP_007161198.1|  hypothetical protein PHAVU_001G050300g           76.6    2e-14   
ref|XP_002515493.1|  14 kDa proline-rich protein DC2.15 precursor...  77.0    2e-14   Ricinus communis
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    77.0    2e-14   Vitis vinifera
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        76.6    2e-14   Sorghum bicolor [broomcorn]
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        76.6    2e-14   Sorghum bicolor [broomcorn]
ref|XP_004291441.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    2e-14   
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652           76.6    2e-14   
gb|AAC49369.1|  proline-rich 14 kDa protein                           76.6    2e-14   Phaseolus vulgaris [French bean]
ref|XP_004251936.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    2e-14   
ref|NP_001152587.1|  cortical cell-delineating protein precursor      76.6    3e-14   Zea mays [maize]
ref|XP_006647641.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        76.3    3e-14   Sorghum bicolor [broomcorn]
ref|XP_009388037.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_009384469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    3e-14   
ref|XP_011070106.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_007155643.1|  hypothetical protein PHAVU_003G219100g           76.3    3e-14   
ref|XP_009388030.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    3e-14   
gb|ADA67933.1|  putative 14 kDa proline-rich protein DC2.15           76.3    3e-14   Wolffia arrhiza
ref|XP_008232586.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    4e-14   
ref|XP_004298648.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    4e-14   
ref|XP_008786990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    5e-14   
emb|CDP18670.1|  unnamed protein product                              76.3    5e-14   
gb|KDP28790.1|  hypothetical protein JCGZ_14561                       75.9    5e-14   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           75.9    5e-14   
ref|XP_010258987.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    75.5    6e-14   
ref|NP_001148300.1|  cortical cell-delineating protein precursor      75.5    6e-14   Zea mays [maize]
ref|XP_004291445.1|  PREDICTED: uncharacterized protein LOC101307558  76.3    6e-14   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    6e-14   
ref|XP_004501349.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    6e-14   
ref|XP_008646032.1|  PREDICTED: cortical cell-delineating protein...  75.5    6e-14   
ref|XP_002446913.1|  hypothetical protein SORBIDRAFT_06g024770        75.1    7e-14   Sorghum bicolor [broomcorn]
gb|EMS62564.1|  14 kDa proline-rich protein DC2.15                    75.1    7e-14   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    8e-14   
ref|XP_008232632.1|  PREDICTED: lipid transfer protein EARLI 1-like   75.9    8e-14   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    8e-14   
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg           75.1    9e-14   
gb|KHG02760.1|  14 kDa proline-rich DC2                               75.1    9e-14   
ref|XP_006652622.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    9e-14   
ref|XP_004138721.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    9e-14   
ref|XP_006369032.1|  HyPRP family protein                             75.1    9e-14   
ref|XP_009589966.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    9e-14   
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like   75.1    1e-13   
ref|XP_007209690.1|  hypothetical protein PRUPE_ppa012402mg           75.5    1e-13   
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    1e-13   
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    1e-13   
ref|NP_001152585.1|  LOC100286225 precursor                           74.7    1e-13   Zea mays [maize]
ref|NP_001053512.1|  Os04g0554600                                     74.7    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008445235.1|  PREDICTED: pEARLI1-like lipid transfer prote...  75.1    1e-13   
ref|XP_008378389.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_004976456.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_003572782.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    1e-13   
ref|XP_008238562.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    1e-13   
ref|XP_004291440.1|  PREDICTED: putative lipid-binding protein At...  75.5    1e-13   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg           74.7    1e-13   
ref|NP_001053511.1|  Os04g0554500                                     74.7    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008786991.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    1e-13   
ref|XP_010695114.1|  PREDICTED: lipid transfer protein EARLI 1-like   75.5    1e-13   
gb|ABG91752.1|  HyPRP2                                                74.7    1e-13   Gossypium hirsutum [American cotton]
gb|EAY95110.1|  hypothetical protein OsI_16927                        74.3    1e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010919519.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    74.3    1e-13   
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    1e-13   
ref|XP_009795762.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_010093708.1|  hypothetical protein L484_019049                 74.3    2e-13   
ref|XP_010053450.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    73.9    2e-13   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like   74.3    2e-13   
ref|XP_010919520.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    2e-13   
ref|XP_009346182.1|  PREDICTED: putative lipid-binding protein AIR1   74.3    2e-13   
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg           74.3    2e-13   
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651           74.3    2e-13   
ref|XP_008437103.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    2e-13   
emb|CDY21275.1|  BnaC03g29590D                                        74.3    2e-13   
ref|XP_008232631.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    2e-13   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           73.9    2e-13   
ref|XP_006368194.1|  HyPRP family protein                             74.3    2e-13   
emb|CDY61290.1|  BnaCnng37610D                                        73.9    2e-13   
emb|CDY21034.1|  BnaA08g24910D                                        73.9    2e-13   
ref|XP_009373377.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.9    2e-13   
gb|EYU30301.1|  hypothetical protein MIMGU_mgv1a018370mg              73.6    2e-13   
ref|XP_009110670.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    73.9    2e-13   
ref|XP_004976454.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    2e-13   
ref|XP_010695113.1|  PREDICTED: lipid transfer protein EARLI 1-like   74.7    2e-13   
ref|XP_009134274.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.9    3e-13   
emb|CDX90834.1|  BnaA03g25140D                                        73.6    3e-13   
ref|XP_002446914.1|  hypothetical protein SORBIDRAFT_06g024780        73.6    3e-13   Sorghum bicolor [broomcorn]
ref|XP_002446915.1|  hypothetical protein SORBIDRAFT_06g024790        73.6    3e-13   Sorghum bicolor [broomcorn]
dbj|BAA11854.1|  extensin like protein                                73.6    3e-13   Populus nigra [black poplar]
ref|XP_009346906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    3e-13   
ref|XP_011018292.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    73.6    3e-13   
gb|KGN50240.1|  hypothetical protein Csa_5G161890                     73.6    3e-13   
gb|KHN04353.1|  14 kDa proline-rich protein DC2.15                    73.6    3e-13   
ref|XP_009346905.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    4e-13   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
emb|CDY31241.1|  BnaC08g15360D                                        73.2    4e-13   
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.6    4e-13   
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...  73.2    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.2    4e-13   
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.2    4e-13   
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...  73.2    4e-13   
ref|XP_010695178.1|  PREDICTED: pEARLI1-like lipid transfer prote...  74.7    4e-13   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    4e-13   
ref|XP_004976453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
ref|XP_008437101.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
ref|XP_011033953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
ref|XP_004298650.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
ref|XP_010906607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
ref|XP_010695112.1|  PREDICTED: lipid transfer protein EARLI 1-like   74.3    5e-13   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 72.8    5e-13   
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    5e-13   
ref|NP_001238293.1|  uncharacterized protein LOC100527330 precursor   73.2    5e-13   
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor          73.2    5e-13   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    5e-13   
ref|XP_004976455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    5e-13   
ref|NP_001151721.1|  LOC100285357 precursor                           72.8    5e-13   Zea mays [maize]
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    5e-13   
dbj|BAA05471.1|  tumor-related protein                                71.6    5e-13   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    5e-13   
ref|XP_007209745.1|  hypothetical protein PRUPE_ppa013010mg           73.2    5e-13   
gb|ACN26094.1|  unknown                                               72.8    5e-13   Zea mays [maize]
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg           72.8    5e-13   
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    5e-13   
ref|XP_002511665.1|  14 kDa proline-rich protein DC2.15 precursor...  72.8    6e-13   Ricinus communis
ref|XP_007039886.1|  14 kDa proline-rich protein DC2.15, putative     72.8    6e-13   
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg           72.8    6e-13   
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    6e-13   
ref|XP_008238564.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    6e-13   
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    6e-13   
emb|CAN80712.1|  hypothetical protein VITISV_033379                   73.2    6e-13   Vitis vinifera
ref|XP_008808739.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    6e-13   
emb|CDP09931.1|  unnamed protein product                              72.8    6e-13   
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    6e-13   
ref|NP_001047650.1|  Os02g0662000                                     72.8    6e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KHN04346.1|  14 kDa proline-rich protein DC2.15                    72.8    6e-13   
ref|XP_010919518.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    6e-13   
dbj|BAF46299.1|  extensin like protein                                72.4    7e-13   
ref|XP_004152412.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    7e-13   
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    7e-13   
ref|XP_004165755.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    7e-13   
ref|XP_006841163.1|  hypothetical protein AMTR_s00086p00157840        72.8    7e-13   
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...  72.4    7e-13   
ref|NP_001152584.1|  cortical cell-delineating protein precursor      72.4    7e-13   
gb|EYU30296.1|  hypothetical protein MIMGU_mgv1a015783mg              72.8    8e-13   
ref|XP_010041843.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    8e-13   
ref|XP_009355765.1|  PREDICTED: putative lipid-binding protein AIR1   72.4    8e-13   
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    8e-13   
gb|AFW63295.1|  cortical cell-delineating protein                     72.4    9e-13   
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    9e-13   
gb|EMS59022.1|  14 kDa proline-rich protein DC2.15                    72.0    9e-13   
gb|ABX84384.1|  protease inhibitor-like protein                       72.0    9e-13   
emb|CAI51313.1|  arachidonic acid-induced DEA1                        72.4    9e-13   
gb|ABQ88334.1|  lipid transfer protein                                72.4    9e-13   
ref|XP_002466039.1|  hypothetical protein SORBIDRAFT_01g050420        72.4    1e-12   
ref|XP_002466035.1|  hypothetical protein SORBIDRAFT_01g050360        72.4    1e-12   
ref|XP_010553781.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
ref|XP_009625139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    1e-12   
ref|XP_011081227.1|  PREDICTED: pEARLI1-like lipid transfer prote...  72.0    1e-12   
ref|XP_008437102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
ref|XP_002533291.1|  lipid binding protein, putative                  71.6    1e-12   
ref|XP_008796820.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    1e-12   
ref|XP_004235150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    1e-12   
ref|XP_004299470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like   71.6    1e-12   
ref|XP_006662586.1|  PREDICTED: cortical cell-delineating protein...  70.9    1e-12   
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...  71.6    1e-12   
ref|XP_008344389.1|  PREDICTED: lipid transfer protein EARLI 1-like   71.6    1e-12   
ref|NP_001235642.1|  uncharacterized protein LOC100500016 precursor   71.6    1e-12   
gb|KDP25644.1|  hypothetical protein JCGZ_20800                       71.6    1e-12   
ref|XP_009600481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    1e-12   
dbj|BAA13150.1|  NT16 polypeptide                                     72.4    1e-12   
ref|XP_004147199.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    1e-12   
ref|XP_004165754.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    2e-12   
gb|KDP25650.1|  hypothetical protein JCGZ_20806                       71.6    2e-12   
ref|XP_008786992.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    2e-12   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  71.6    2e-12   
ref|XP_007218581.1|  hypothetical protein PRUPE_ppa013196mg           71.6    2e-12   
ref|XP_009619251.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    2e-12   
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    2e-12   
ref|XP_006600137.1|  PREDICTED: uncharacterized protein LOC100500...  71.6    2e-12   
dbj|BAA89334.1|  EEF48                                                70.5    2e-12   
ref|XP_004299469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    2e-12   
gb|ACE82175.1|  extensin-like protein                                 71.2    2e-12   
ref|XP_004955126.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    2e-12   
ref|XP_002454527.1|  hypothetical protein SORBIDRAFT_04g032680        70.9    2e-12   
ref|XP_004986077.1|  PREDICTED: putative glycine-rich cell wall s...  72.4    2e-12   
ref|XP_002454521.1|  hypothetical protein SORBIDRAFT_04g032620        71.2    2e-12   
dbj|BAA99575.1|  DC2.15 like protein                                  71.2    2e-12   
ref|XP_009338026.1|  PREDICTED: vegetative cell wall protein gp1-...  73.6    2e-12   
gb|AAD01800.1|  HyPRP                                                 71.6    2e-12   
ref|XP_009123402.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    2e-12   
emb|CDY32208.1|  BnaA03g54590D                                        71.2    2e-12   
emb|CDX77712.1|  BnaC07g19660D                                        70.5    3e-12   
ref|XP_004152410.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    3e-12   
ref|XP_010544621.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    71.2    3e-12   
ref|XP_009401672.1|  PREDICTED: pEARLI1-like lipid transfer prote...  70.9    3e-12   
ref|XP_010494895.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    3e-12   
ref|XP_009598876.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.1    3e-12   
ref|XP_010676150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    3e-12   
ref|XP_006289530.1|  hypothetical protein CARUB_v10003073mg           71.2    3e-12   
emb|CDY33497.1|  BnaA06g35760D                                        70.5    3e-12   
emb|CDY21274.1|  BnaC03g29580D                                        71.2    3e-12   
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg           70.9    3e-12   
emb|CDY08680.1|  BnaC04g19890D                                        70.9    3e-12   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           71.2    3e-12   
ref|XP_002271593.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    70.9    3e-12   
ref|XP_009382414.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    3e-12   
gb|ABP35529.1|  proline-rich protein                                  70.5    3e-12   
ref|XP_006413657.1|  hypothetical protein EUTSA_v10026536mg           70.9    3e-12   
ref|XP_008437105.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    3e-12   
ref|XP_004299468.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    3e-12   
gb|EMT15319.1|  Cortical cell-delineating protein                     70.5    3e-12   
gb|KDP33576.1|  hypothetical protein JCGZ_07147                       70.5    3e-12   
ref|XP_010261664.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    3e-12   
ref|XP_003549906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    4e-12   
ref|XP_010553464.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    70.5    4e-12   
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    4e-12   
ref|XP_010441523.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    4e-12   
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1        70.9    4e-12   
tpg|DAA37198.1|  TPA: hypothetical protein ZEAMMB73_187029            70.5    4e-12   
ref|NP_001236284.1|  uncharacterized protein LOC100526941 precursor   71.2    4e-12   
ref|NP_001152193.1|  cortical cell-delineating protein precursor      70.5    4e-12   
emb|CDX90833.1|  BnaA03g25130D                                        70.9    4e-12   
gb|AAC60566.1|  proline-rich SAC51                                    70.5    4e-12   
ref|XP_006282307.1|  hypothetical protein CARUB_v10028597mg           70.1    4e-12   
ref|XP_006847372.1|  hypothetical protein AMTR_s01045p00008470        70.5    4e-12   
emb|CDP09930.1|  unnamed protein product                              70.1    4e-12   
ref|XP_004516836.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    4e-12   
ref|XP_010519362.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    4e-12   
ref|XP_009101469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    5e-12   
gb|EAY88189.1|  hypothetical protein OsI_09636                        70.9    5e-12   
ref|XP_008437107.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    5e-12   
gb|ABF93505.1|  retrotransposon protein, putative, Ty1-copia subc...  70.9    5e-12   
dbj|BAG50511.1|  qLTG-3-1                                             70.9    5e-12   
ref|XP_009623719.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    5e-12   
ref|XP_010933689.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    5e-12   
dbj|BAJ08379.1|  qLTG3-1                                              70.9    5e-12   
ref|NP_001048668.1|  Os03g0103300                                     70.9    5e-12   
ref|XP_009134272.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.5    5e-12   
gb|ACG33201.1|  cortical cell-delineating protein precursor           70.1    5e-12   
ref|XP_004235149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    5e-12   
dbj|BAJ08384.1|  qLTG3-1                                              70.9    5e-12   
dbj|BAJ08383.1|  qLTG3-1                                              70.9    5e-12   
dbj|BAJ08381.1|  qLTG3-1                                              70.9    5e-12   
emb|CDY33498.1|  BnaA06g35750D                                        69.7    5e-12   
ref|XP_004235416.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    6e-12   
ref|XP_006662037.1|  PREDICTED: cortical cell-delineating protein...  70.1    6e-12   
dbj|BAJ08382.1|  qLTG3-1                                              70.9    6e-12   
ref|XP_006282240.1|  hypothetical protein CARUB_v10028513mg           69.7    6e-12   
ref|XP_006396751.1|  hypothetical protein EUTSA_v10029036mg           70.5    6e-12   
dbj|BAJ08386.1|  qLTG3-1                                              70.9    6e-12   
ref|NP_176440.1|  bifunctional inhibitor/lipid-transfer protein/s...  70.1    6e-12   
dbj|BAJ08385.1|  qLTG3-1                                              70.9    6e-12   
ref|XP_004152411.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    6e-12   
gb|KFK28807.1|  hypothetical protein AALP_AA7G051200                  69.7    6e-12   
gb|EMS60376.1|  Cortical cell-delineating protein                     68.6    6e-12   
ref|XP_008437111.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    7e-12   
ref|XP_006396754.1|  hypothetical protein EUTSA_v10029528mg           70.1    7e-12   
gb|EMS64339.1|  Cortical cell-delineating protein                     69.7    7e-12   
gb|KDP25647.1|  hypothetical protein JCGZ_20803                       69.7    7e-12   
ref|XP_006304906.1|  hypothetical protein CARUB_v10011959mg           69.7    7e-12   
ref|XP_006289270.1|  hypothetical protein CARUB_v10002736mg           69.7    7e-12   
ref|NP_001104845.1|  GR1a protein precursor                           69.7    7e-12   
ref|XP_010476166.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    8e-12   
ref|XP_010264241.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    8e-12   
gb|ACG24992.1|  cortical cell-delineating protein precursor           69.7    8e-12   
ref|XP_004152415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    8e-12   
ref|XP_006396753.1|  hypothetical protein EUTSA_v10029038mg           70.1    8e-12   
ref|XP_010695115.1|  PREDICTED: putative lipid-binding protein AIR1B  69.3    8e-12   
ref|XP_011081224.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    8e-12   
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                  69.3    8e-12   
ref|NP_199501.1|  Bifunctional inhibitor/lipid-transfer protein/s...  69.3    8e-12   
ref|NP_001237154.1|  uncharacterized protein LOC100500124 precursor   69.3    9e-12   
ref|XP_002529775.1|  14 kDa proline-rich protein DC2.15 precursor...  69.7    9e-12   
ref|XP_008669243.1|  PREDICTED: uncharacterized protein LOC103646289  70.5    9e-12   
ref|XP_009114615.1|  PREDICTED: putative lipid-binding protein AIR1   69.3    9e-12   
gb|ACN54400.1|  hybrid proline-rich protein                           69.3    9e-12   
gb|EAY95111.1|  hypothetical protein OsI_16928                        69.3    9e-12   
emb|CDY33493.1|  BnaA06g35800D                                        68.9    9e-12   
ref|XP_004235151.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    9e-12   
ref|XP_008786988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    9e-12   
ref|XP_004245748.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    9e-12   
gb|AAM62750.1|  extA                                                  69.3    9e-12   
gb|ABU63756.1|  root specific protein                                 69.3    9e-12   
ref|NP_001148290.1|  gibberellin responsive2 precursor                69.3    1e-11   
ref|XP_004169260.1|  PREDICTED: putative lipid-binding protein At...  70.1    1e-11   
gb|KDP25653.1|  hypothetical protein JCGZ_20809                       68.6    1e-11   
ref|NP_001053513.2|  Os04g0554800                                     69.3    1e-11   
tpg|DAA42812.1|  TPA: hypothetical protein ZEAMMB73_664289            70.1    1e-11   
ref|XP_006281886.1|  hypothetical protein CARUB_v10028084mg           68.6    1e-11   
ref|XP_010458632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    1e-11   
ref|XP_006367622.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    1e-11   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  69.7    1e-11   
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        69.3    1e-11   
ref|XP_010529481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    1e-11   
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           69.3    1e-11   
ref|XP_002464968.1|  hypothetical protein SORBIDRAFT_01g029620        68.9    1e-11   
ref|XP_009376589.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
dbj|BAJ96792.1|  predicted protein                                    68.9    1e-11   
ref|XP_010433333.1|  PREDICTED: putative lipid-binding protein AIR1   68.9    1e-11   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.3    1e-11   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.3    1e-11   
ref|XP_009611018.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
ref|XP_009333598.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
ref|XP_006367621.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    1e-11   
ref|XP_008381149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
ref|XP_010493717.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
ref|XP_010553463.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
ref|XP_006396747.1|  hypothetical protein EUTSA_v10029313mg           68.9    1e-11   
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    68.9    1e-11   
ref|XP_006367620.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    1e-11   
ref|XP_003608743.1|  14 kDa proline-rich protein DC2.15               68.9    1e-11   
emb|CDY31240.1|  BnaC08g15350D                                        68.9    1e-11   
ref|XP_010422226.1|  PREDICTED: putative lipid-binding protein AIR1   68.6    1e-11   
ref|XP_009411010.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    2e-11   
ref|XP_009333632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    2e-11   
ref|XP_002863385.1|  hypothetical protein ARALYDRAFT_494287           68.6    2e-11   
ref|XP_010539616.1|  PREDICTED: lipid transfer protein EARLI 1-like   68.9    2e-11   
ref|XP_002533294.1|  14 kDa proline-rich protein DC2.15 precursor...  68.9    2e-11   
ref|XP_010906606.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    2e-11   
ref|XP_009134276.1|  PREDICTED: putative lipid-binding protein AIR1   68.6    2e-11   
emb|CDY03176.1|  BnaC09g19800D                                        68.6    2e-11   
gb|KFK43474.1|  hypothetical protein AALP_AA1G129700                  68.6    2e-11   
emb|CDX82944.1|  BnaC01g13940D                                        68.6    2e-11   
ref|XP_004152413.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    2e-11   
ref|XP_010093705.1|  hypothetical protein L484_019046                 68.2    2e-11   
ref|XP_010434049.1|  PREDICTED: putative lipid-binding protein AIR1   68.6    2e-11   
ref|XP_009333674.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    2e-11   
ref|XP_009798259.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    2e-11   
gb|EMS61013.1|  Cortical cell-delineating protein                     68.6    2e-11   
ref|NP_001237899.1|  uncharacterized protein LOC100527818 precursor   68.6    2e-11   
ref|XP_006281689.1|  hypothetical protein CARUB_v10027837mg           68.2    2e-11   
gb|KHN04344.1|  14 kDa proline-rich protein DC2.15                    68.2    2e-11   
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   68.6    2e-11   
ref|XP_010494894.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    2e-11   
ref|NP_001237995.1|  uncharacterized protein LOC100305616 precursor   68.6    2e-11   
ref|XP_010458633.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    2e-11   
ref|XP_010493725.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    2e-11   
ref|XP_006357014.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    2e-11   
dbj|BAJ97112.1|  predicted protein                                    68.2    2e-11   
gb|KDP25654.1|  hypothetical protein JCGZ_20810                       67.8    2e-11   
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   68.2    2e-11   
ref|XP_008808738.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    2e-11   
ref|XP_010258988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    2e-11   
ref|XP_009114316.1|  PREDICTED: pEARLI1-like lipid transfer prote...  68.2    2e-11   
ref|XP_006662589.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    2e-11   
dbj|BAA74804.1|  ZmGR1b                                               68.2    2e-11   
ref|XP_010439335.1|  PREDICTED: putative lipid-binding protein AIR1   68.2    2e-11   
emb|CDY72057.1|  BnaUnng04830D                                        67.0    2e-11   
ref|NP_199500.1|  bifunctional inhibitor/lipid-transfer protein/s...  68.2    2e-11   
ref|XP_003574313.1|  PREDICTED: acanthoscurrin-1-like                 69.3    2e-11   
ref|XP_009397884.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    3e-11   
ref|XP_010455702.1|  PREDICTED: putative lipid-binding protein AIR1   68.2    3e-11   
ref|XP_004171279.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    3e-11   
ref|XP_004501348.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    3e-11   



>ref|XP_009804889.1| PREDICTED: putative lipid-binding protein At4g00165 [Nicotiana 
sylvestris]
Length=133

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCGDWLGL+HEVIGA PSS+CC++L+G+A++EAA CLCTAIK + LG L ++IP
Sbjct  53   DTLKFGVCGDWLGLIHEVIGAKPSSQCCALLEGIADVEAALCLCTAIKVNALGALNLKIP  112

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +AISLVLNSCGKKVP GF C
Sbjct  113  IAISLVLNSCGKKVPKGFKC  132



>ref|XP_009608848.1| PREDICTED: putative lipid-binding protein At4g00165 [Nicotiana 
tomentosiformis]
Length=133

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCGDWLGL+HEVIGA PSS+CC++L+G+A++EAA CLCTAIK + LG L ++IP
Sbjct  53   DTLKFGVCGDWLGLIHEVIGAKPSSQCCALLEGIADVEAALCLCTAIKVNALGALNLKIP  112

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +AISLVLNSCGKKVP GF C
Sbjct  113  IAISLVLNSCGKKVPKGFKC  132



>ref|XP_004229790.1| PREDICTED: putative lipid-binding protein At4g00165 [Solanum 
lycopersicum]
Length=122

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFG+CGDWLGLVHEVIGA PSS+CC++L+G+A++EAA CLCTAI A+VLG LK+++P
Sbjct  42   DTLKFGICGDWLGLVHEVIGAKPSSKCCALLEGIADVEAALCLCTAINANVLGVLKLKVP  101

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +AIS+VLNSCGKKVP GF C
Sbjct  102  IAISVVLNSCGKKVPKGFKC  121



>ref|XP_006347893.1| PREDICTED: putative lipid-binding protein At4g00165-like [Solanum 
tuberosum]
Length=122

 Score =   110 bits (275),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFG+CGDWLGLVHEVIGA PSS+CC++L+G+A++EAA CLCTAI A+VLG LK+++P
Sbjct  42   DTLKFGICGDWLGLVHEVIGAKPSSKCCALLEGIADVEAALCLCTAINANVLGVLKLKVP  101

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +AIS+VLNSCGKKVP GF C
Sbjct  102  IAISVVLNSCGKKVPKGFKC  121



>ref|XP_011090306.1| PREDICTED: putative lipid-binding protein At4g00165 [Sesamum 
indicum]
Length=129

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCGDWLGLVHEV+G  PS++CC++++G+A+LEAA CLCTAIKA+VLG +K+EIP
Sbjct  50   DTLKFGVCGDWLGLVHEVVGVKPSTKCCALVEGLADLEAALCLCTAIKANVLGVIKVEIP  109

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++NSCGKKVP GFVC
Sbjct  110  VALSLLINSCGKKVPEGFVC  129



>ref|XP_011033419.1| PREDICTED: putative lipid-binding protein At4g00165 [Populus 
euphratica]
Length=128

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG+WLGLVHEV+G PPS ECC+++KG+A+LEAA CLCTAIKA+VLG +K+++P
Sbjct  48   DTLKFGVCGNWLGLVHEVLGTPPSEECCTLIKGLADLEAALCLCTAIKANVLGVVKLKVP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL+L++CGKKVP GF C
Sbjct  108  VAVSLLLSACGKKVPEGFKC  127



>emb|CDP19512.1| unnamed protein product [Coffea canephora]
Length=133

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LKFGVCGDWLGLVHEVIGA PS ECC+++KG+A+LEAA CLCTAIKA++LG ++++IP
Sbjct  53   DALKFGVCGDWLGLVHEVIGAKPSGECCALIKGLADLEAAVCLCTAIKANILGAIEVKIP  112

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VAIS+++NSCGKKVP GF C
Sbjct  113  VAISMLINSCGKKVPEGFKC  132



>gb|KFK30593.1| hypothetical protein AALP_AA6G001800 [Arabis alpina]
Length=133

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV+E IG PPS ECCS++KGV +LEAA CLCTA+KA++LG   ++IP
Sbjct  54   DTLKFGVCGSWLGLVYETIGTPPSKECCSLVKGVVDLEAAVCLCTALKANILGVTPVKIP  113

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL+LNSCGKKVP GFVC
Sbjct  114  VALSLILNSCGKKVPKGFVC  133



>ref|XP_006375281.1| hypothetical protein POPTR_0014s05870g [Populus trichocarpa]
 gb|ERP53078.1| hypothetical protein POPTR_0014s05870g [Populus trichocarpa]
Length=131

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG+WLGLVHE +G PPS ECC+++KG+A+LEAA CLCTAIKA+VLG +K+++P
Sbjct  51   DTLKFGVCGNWLGLVHEALGTPPSEECCTLIKGLADLEAALCLCTAIKANVLGVVKLKVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL+L++CGKKVP GF C
Sbjct  111  VAVSLLLSACGKKVPEGFKC  130



>gb|ABK95307.1| unknown [Populus trichocarpa]
Length=131

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG+WLGLVHE +G PPS ECC+++KG+A+LEAA CLCTAIKA+VLG +K+++P
Sbjct  51   DTLKFGVCGNWLGLVHEALGTPPSEECCTLIKGLADLEAALCLCTAIKANVLGVVKLKVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL+L++CGKKVP GF C
Sbjct  111  VAVSLLLSACGKKVPEGFKC  130



>ref|XP_007052128.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96285.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=135

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLVHEV+G PPS ECC+++ G+A+LEAA CLCTAIKA+VLG +K++ P
Sbjct  55   DTLKFGVCGSWLGLVHEVVGTPPSKECCTLIAGLADLEAALCLCTAIKANVLGVIKVKTP  114

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA++L++N+CGKKVP GFVC
Sbjct  115  VALTLLINACGKKVPEGFVC  134



>ref|XP_010088891.1| hypothetical protein L484_020879 [Morus notabilis]
 gb|EXB37088.1| hypothetical protein L484_020879 [Morus notabilis]
Length=138

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLG+V EVIGA PS ECCS++KG+A+LEAA CLCTAIKA+VLG +K+ +P
Sbjct  58   DTLKFGVCGSWLGVVTEVIGAKPSEECCSLIKGLADLEAAFCLCTAIKANVLGVVKLNVP  117

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +A+SL++NSCGKKVP GFVC
Sbjct  118  IALSLLVNSCGKKVPQGFVC  137



>ref|XP_007218590.1| hypothetical protein PRUPE_ppa013286mg [Prunus persica]
 gb|EMJ19789.1| hypothetical protein PRUPE_ppa013286mg [Prunus persica]
Length=131

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV EVIG  PS ECC+++KG+A+LEAA CLCTAIKA+VLG +K+E+P
Sbjct  51   DTLKFGVCGSWLGLVTEVIGTKPSKECCTLIKGLADLEAALCLCTAIKANVLGIVKLEVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++N+CG KVP GFVC
Sbjct  111  VALSLLVNACGGKVPQGFVC  130



>gb|KDP28789.1| hypothetical protein JCGZ_14560 [Jatropha curcas]
Length=130

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLVHEV+G  PS ECCS++KGVA+LEAA CLCTAIK++VLG +K+++P
Sbjct  50   DTLKFGVCGSWLGLVHEVVGTKPSKECCSLIKGVADLEAALCLCTAIKSNVLGIVKLQLP  109

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VAISL+L++C KKVP GF C
Sbjct  110  VAISLLLSACEKKVPQGFQC  129



>emb|CBI38878.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFG C +WLGLV EV+G PPSS+CC+++ G+A+LEAA C CTAIKA+VLG +K+E+P
Sbjct  47   DTLKFGACANWLGLVGEVVGTPPSSKCCALVAGLADLEAALCFCTAIKANVLGAIKVEVP  106

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA++L++N+CGKKVP GFVC
Sbjct  107  VALTLLVNACGKKVPEGFVC  126



>ref|XP_006288783.1| hypothetical protein CARUB_v10002104mg [Capsella rubella]
 gb|EOA21681.1| hypothetical protein CARUB_v10002104mg [Capsella rubella]
Length=172

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV+EVIG PPS ECCS++KG+A+ EAA CLCTA+K  +LG   +++P
Sbjct  93   DTLKFGVCGSWLGLVYEVIGTPPSKECCSLIKGLADFEAAVCLCTALKTSLLGVSPLKVP  152

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SLVLNSCGK VP GFVC
Sbjct  153  VALSLVLNSCGKNVPKGFVC  172



>ref|XP_003633921.2| PREDICTED: putative lipid-binding protein At4g00165 [Vitis vinifera]
Length=154

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFG C +WLGLV EV+G PPSS+CC+++ G+A+LEAA C CTAIKA+VLG +K+E+P
Sbjct  74   DTLKFGACANWLGLVGEVVGTPPSSKCCALVAGLADLEAALCFCTAIKANVLGAIKVEVP  133

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA++L++N+CGKKVP GFVC
Sbjct  134  VALTLLVNACGKKVPEGFVC  153



>ref|XP_002511666.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF50335.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=128

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTL FGVCG WLGLVHEVIG  PS ECC+++KGVA+LEAA CLCTAIK++VLG +K+E+P
Sbjct  48   DTLTFGVCGSWLGLVHEVIGTKPSKECCTLIKGVADLEAALCLCTAIKSNVLGVVKVEVP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VAISL+L++CG++VP GF C
Sbjct  108  VAISLLLSACGREVPQGFKC  127



>gb|AFK37174.1| unknown [Lotus japonicus]
Length=122

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV EVIG  PS ECCS+LKG+A+LEAA CLCTAIKA VLG +K+ +P
Sbjct  42   DTLKFGVCGSWLGLVTEVIGTKPSEECCSLLKGLADLEAAFCLCTAIKASVLGIVKLNVP  101

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++N+CGK VP GF C
Sbjct  102  VAVSLLVNACGKNVPEGFTC  121



>ref|XP_007140792.1| hypothetical protein PHAVU_008G142500g [Phaseolus vulgaris]
 gb|ESW12786.1| hypothetical protein PHAVU_008G142500g [Phaseolus vulgaris]
Length=128

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            +TLKFGVCG WLGLV EVIG+ PS +CC+V+KG+A+LEAA CLCTAIKA+V+G +K+++P
Sbjct  48   NTLKFGVCGSWLGLVKEVIGSKPSEKCCTVVKGLADLEAALCLCTAIKANVMGSVKLKVP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA++L++N+CGKKVP+GFVC
Sbjct  108  VALTLLINACGKKVPSGFVC  127



>ref|XP_008232589.1| PREDICTED: putative lipid-binding protein At4g00165 [Prunus mume]
Length=131

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV EVIG  PS ECC+++KG+A+LEAA CLCTAIKA+VLG +K+E+P
Sbjct  51   DTLKFGVCGSWLGLVTEVIGTKPSKECCTLIKGLADLEAALCLCTAIKANVLGIVKLEVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++++CG KVP GFVC
Sbjct  111  VALSLLVSACGGKVPQGFVC  130



>ref|NP_680546.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_001078336.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 sp|Q8RW93.1|LBP65_ARATH RecName: Full=Putative lipid-binding protein At4g00165; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM10392.1| AT4g00170/F6N15_21 [Arabidopsis thaliana]
 gb|AAV84509.1| At4g00165 [Arabidopsis thaliana]
 gb|AEE81831.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE81832.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=128

 Score =   101 bits (252),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV EVIG PPS ECCS++KG+A+ EAA CLCTA+K  +LG   ++IP
Sbjct  49   DTLKFGVCGSWLGLVSEVIGTPPSQECCSLIKGLADFEAAVCLCTALKTSILGVAPVKIP  108

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA++L+LNSCGK VP GFVC
Sbjct  109  VALTLLLNSCGKNVPQGFVC  128



>ref|XP_009144555.1| PREDICTED: putative lipid-binding protein At4g00165 [Brassica 
rapa]
 emb|CDX97272.1| BnaA02g20630D [Brassica napus]
Length=123

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVCG WLGLVHEVIG PPS ECCS++KG+A+LEAA CLCTA+K  +LG   +++P
Sbjct  44   DTVKFGVCGSWLGLVHEVIGTPPSQECCSLVKGLADLEAALCLCTALKTSLLGVAPVKLP  103

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA++L+LNSCGK +P GFVC
Sbjct  104  VALTLLLNSCGKTLPQGFVC  123



>ref|XP_008356291.1| PREDICTED: putative lipid-binding protein At4g00165 [Malus domestica]
Length=131

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV EVIG  PS ECC+++KGVA+LEAA CLCTAIKA+VLG +K+ +P
Sbjct  51   DTLKFGVCGSWLGLVTEVIGTKPSKECCTLIKGVADLEAALCLCTAIKANVLGIVKLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA SL++N+CG  VP GFVC
Sbjct  111  VAFSLLVNACGGNVPQGFVC  130



>ref|XP_009375767.1| PREDICTED: putative lipid-binding protein At4g00165 [Pyrus x 
bretschneideri]
Length=128

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV EVIG  PS ECC+++KGVA+LEAA CLCTAIKA+VLG +K+ +P
Sbjct  48   DTLKFGVCGSWLGLVTEVIGTKPSKECCTLIKGVADLEAALCLCTAIKANVLGIVKLNVP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA SL++N+CG  VP GFVC
Sbjct  108  VAFSLLVNACGGNVPQGFVC  127



>ref|XP_002872966.1| hypothetical protein ARALYDRAFT_327754 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49225.1| hypothetical protein ARALYDRAFT_327754 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV EVIG PPS ECCS++KG+A+ EAA CLCTA+K  +LG   ++IP
Sbjct  301  DTLKFGVCGSWLGLVREVIGTPPSQECCSLIKGLADFEAAVCLCTALKTSILGIAPVKIP  360

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL+LNSCGK VP GFVC
Sbjct  361  VALSLLLNSCGKNVPQGFVC  380



>emb|CDY65570.1| BnaCnng47750D [Brassica napus]
Length=123

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVCG WLGLVHEVIG PPS ECCS++KG+A+LEAA CLCTA+K  +LG   +++P
Sbjct  44   DTVKFGVCGSWLGLVHEVIGTPPSQECCSLVKGLADLEAAICLCTALKTSLLGVAPVKLP  103

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA++L LNSCGK +P GFVC
Sbjct  104  VALTLHLNSCGKTLPQGFVC  123



>ref|XP_006396214.1| hypothetical protein EUTSA_v10029074mg [Eutrema salsugineum]
 gb|ESQ37667.1| hypothetical protein EUTSA_v10029074mg [Eutrema salsugineum]
Length=124

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVCG WLGLV+EVIG PPS ECCS++KG+A+ EAA CLCTA+K  ++G   ++IP
Sbjct  45   DTVKFGVCGSWLGLVYEVIGTPPSQECCSLVKGLADFEAAVCLCTALKTSLVGVAPVKIP  104

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA++L+LNSCGK +P GFVC
Sbjct  105  VALTLLLNSCGKTLPQGFVC  124



>gb|AAC19312.1| contains similarity to Medicago sativa corC (GB:L22305) [Arabidopsis 
thaliana]
 emb|CAB80775.1| putative proline-rich protein [Arabidopsis thaliana]
Length=399

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV EVIG PPS ECCS++KG+A+ EAA CLCTA+K  +LG   ++IP
Sbjct  320  DTLKFGVCGSWLGLVSEVIGTPPSQECCSLIKGLADFEAAVCLCTALKTSILGVAPVKIP  379

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA++L+LNSCGK VP GFVC
Sbjct  380  VALTLLLNSCGKNVPQGFVC  399



>ref|XP_004140487.1| PREDICTED: putative lipid-binding protein At4g00165-like [Cucumis 
sativus]
 ref|XP_004168671.1| PREDICTED: putative lipid-binding protein At4g00165-like [Cucumis 
sativus]
 gb|KGN46569.1| proline-rich protein DC2.15 [Cucumis sativus]
Length=131

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGL+ E IGA PS +CCS+L G+A+LEAA CLCTA+KA+VLG + +++P
Sbjct  51   DTLKFGVCGSWLGLISEQIGAKPSKKCCSLLTGLADLEAALCLCTALKANVLGVVSLDVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +A+SLV+NSCGK +P GFVC
Sbjct  111  IALSLVVNSCGKSIPQGFVC  130



>ref|XP_010692176.1| PREDICTED: putative lipid-binding protein At4g00165 [Beta vulgaris 
subsp. vulgaris]
Length=128

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV EVIG  PS ECC+++KG+A+LEAA CLCTA+KA+VLG + +  P
Sbjct  49   DTLKFGVCGSWLGLVTEVIGTKPSPECCTLVKGIADLEAAVCLCTALKANVLGVVNLNAP  108

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL+LN CGKKVP GF C
Sbjct  109  VALSLLLNGCGKKVPQGFQC  128



>gb|KCW78307.1| hypothetical protein EUGRSUZ_D02487 [Eucalyptus grandis]
Length=125

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV E IGA PS ECC+++ G+A+LEAA CLCTAIKA+VLG +K+++P
Sbjct  45   DTLKFGVCGSWLGLVTENIGAKPSKECCTLVAGLADLEAALCLCTAIKANVLGLVKIKVP  104

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +A+SL++N CGKKVP GFVC
Sbjct  105  LALSLLVNGCGKKVPEGFVC  124



>ref|XP_010053928.1| PREDICTED: putative lipid-binding protein At4g00165 [Eucalyptus 
grandis]
Length=135

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV E IGA PS ECC+++ G+A+LEAA CLCTAIKA+VLG +K+++P
Sbjct  55   DTLKFGVCGSWLGLVTENIGAKPSKECCTLVAGLADLEAALCLCTAIKANVLGLVKIKVP  114

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +A+SL++N CGKKVP GFVC
Sbjct  115  LALSLLVNGCGKKVPEGFVC  134



>ref|XP_004306947.1| PREDICTED: putative lipid-binding protein At4g00165-like [Fragaria 
vesca subsp. vesca]
Length=131

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFG+CG WLGLV EV+G  PS ECC+++KG+A+LEAA CLCTAIKA++LG +K+++P
Sbjct  51   DTLKFGLCGSWLGLVTEVVGTKPSEECCTLIKGLADLEAALCLCTAIKANLLGIVKLKVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+ L++N+CG KVP GFVC
Sbjct  111  VAVGLLVNACGGKVPEGFVC  130



>ref|XP_008458132.1| PREDICTED: putative lipid-binding protein At4g00165 [Cucumis 
melo]
Length=132

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGL+ E IG  PS +CCS+L G+A+LEAA CLCTA+KA+VLG + +++P
Sbjct  52   DTLKFGVCGSWLGLISEQIGTKPSKKCCSLLTGLADLEAALCLCTALKANVLGVVSLDVP  111

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +A+SLV+NSCGK +P GFVC
Sbjct  112  IALSLVVNSCGKSIPQGFVC  131



>ref|NP_001235244.1| uncharacterized protein LOC100306451 precursor [Glycine max]
 gb|ACU14635.1| unknown [Glycine max]
 gb|KHN25540.1| Putative lipid-binding protein [Glycine soja]
Length=128

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVCG WLGLV EVIG  PS ECC +LKG+A+LEAA CLCTAIKA+VLG +K+++ 
Sbjct  48   DTLKFGVCGSWLGLVKEVIGTKPSEECCILLKGLADLEAALCLCTAIKANVLGAVKVKVH  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++N+CGKKVP+GFVC
Sbjct  108  VAVSLLVNACGKKVPSGFVC  127



>ref|XP_010264239.1| PREDICTED: putative lipid-binding protein At4g00165 [Nelumbo 
nucifera]
Length=126

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK G+C + LGLV+ ++G PP   CC++L  + +LEAA CLCTAIKA+VLG +K+E+P
Sbjct  46   DTLKLGICANVLGLVNVLVGTPPYKPCCALLTELTDLEAALCLCTAIKANVLGVVKLELP  105

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +A+SLV+N+CGKKVP GF C
Sbjct  106  IALSLVVNTCGKKVPEGFQC  125



>gb|KFK37310.1| hypothetical protein AALP_AA4G240600 [Arabis alpina]
Length=132

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ V+G+PP + CC++LKG+A LEAA CLCTA+KA+VL GL + +P
Sbjct  54   DTLKLGVCADLLGLVNVVVGSPPKTPCCTLLKGLANLEAAVCLCTALKANVL-GLNLNVP  112

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGKK+P GF C
Sbjct  113  IDLSLLLNYCGKKLPYGFQC  132



>ref|XP_010088890.1| hypothetical protein L484_020878 [Morus notabilis]
 gb|EXB37087.1| hypothetical protein L484_020878 [Morus notabilis]
Length=135

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLKFGVC D L GL H ++G PP + CCS+LKG+A++EAA CLCTAIKA+VL G+ + I
Sbjct  55   DTLKFGVCADLLNGLEHVIVGTPPVTPCCSLLKGLADVEAAVCLCTAIKANVL-GINLNI  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKK P GF C
Sbjct  114  PVSLSLLLNYCGKKAPKGFQC  134



>ref|XP_006295216.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
 gb|EOA28114.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
Length=134

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ +IG+PP + CCS+L+G+A LEAA CLCTA+KA+VL G+ + +P
Sbjct  55   DTLKLGVCADLLGLVNVLIGSPPKTPCCSLLQGLANLEAAVCLCTALKANVL-GINLNVP  113

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGKK+P GF C
Sbjct  114  VDLSLLLNYCGKKLPYGFQC  133



>ref|NP_566036.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 gb|AAL11562.1|AF424568_1 At2g45180/T14P1.1 [Arabidopsis thaliana]
 gb|AAB82643.1| expressed protein [Arabidopsis thaliana]
 gb|AAM62919.1| unknown [Arabidopsis thaliana]
 gb|AAV84511.1| At2g45180 [Arabidopsis thaliana]
 dbj|BAF01874.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAF02133.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAE99283.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|ABI93898.1| At2g45180 [Arabidopsis thaliana]
 gb|AEC10522.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=134

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ V+G+PP + CC++L+G+A LEAA CLCTA+KA+VL G+ + +P
Sbjct  55   DTLKLGVCADLLGLVNVVVGSPPKTPCCTLLQGLANLEAAVCLCTALKANVL-GINLNVP  113

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + ++L+LN CGKKVP+GF C
Sbjct  114  IDLTLLLNYCGKKVPHGFQC  133



>ref|XP_010258990.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=135

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL + ++G PP   CC++L  + +LEAA CLCTAIKA+VLG +K+EIP
Sbjct  55   DMLKLGVCANLLGLANVLVGTPPHESCCALLTDLTDLEAALCLCTAIKANVLGVVKLEIP  114

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SLV+N+CGKK P GF C
Sbjct  115  VALSLVINACGKKAPEGFQC  134



>gb|ADW80126.1| hybrid proline-rich protein [Gossypium hirsutum]
Length=122

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G PPSS+CC++L+G+A+LEAA CLCTAIKA+VL G+ + IP
Sbjct  43   DTLKLGVCADVLGLVNVIVGTPPSSKCCALLQGLADLEAALCLCTAIKANVL-GINLNIP  101

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V++SL+L++C K+VP GF C
Sbjct  102  VSLSLILSACQKEVPPGFKC  121



>ref|XP_007011824.1| Bimodular protein [Theobroma cacao]
 gb|EOY29443.1| Bimodular protein [Theobroma cacao]
Length=133

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ V+G+PPSS+CC++L G+A+LEAA CLCTAIKA VL G+ + IP
Sbjct  54   DTLKLGVCADLLGLVNIVVGSPPSSKCCALLSGLADLEAALCLCTAIKASVL-GINLNIP  112

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V++SL+L++C K VP GF C
Sbjct  113  VSLSLILSACQKNVPAGFKC  132



>sp|P14009.1|14KD_DAUCA RecName: Full=14 kDa proline-rich protein DC2.15; Flags: Precursor 
[Daucus carota]
 emb|CAA33476.1| unnamed protein product [Daucus carota]
Length=137

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEV-IGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D L LVH V IG+PP+  CCS+L+G+  LEAA CLCTAIKA++LG   + +
Sbjct  57   DALKLGVCADVLNLVHNVVIGSPPTLPCCSLLEGLVNLEAAVCLCTAIKANILGK-NLNL  115

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+A+SLVLN+CGK+VPNGF C
Sbjct  116  PIALSLVLNNCGKQVPNGFEC  136



>ref|XP_010099842.1| hypothetical protein L484_008499 [Morus notabilis]
 gb|EXB80719.1| hypothetical protein L484_008499 [Morus notabilis]
Length=124

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVC D LGLV+ V+G+PPSS+CC++L G+A+LEAA CLCTAIKA+VL G+ + +P
Sbjct  45   DTLKFGVCADLLGLVNLVVGSPPSSKCCALLSGLADLEAAVCLCTAIKANVL-GINLNVP  103

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +S+++++C K VP+GF C
Sbjct  104  LTLSVLISACQKTVPSGFKC  123



>ref|XP_006397698.1| hypothetical protein EUTSA_v10001680mg [Eutrema salsugineum]
 gb|ESQ39151.1| hypothetical protein EUTSA_v10001680mg [Eutrema salsugineum]
Length=134

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ V G+PP + CC++LKG+A LEAA CLCTA+KA+VL G+ + +P
Sbjct  55   DTLKLGVCADLLGLVNVVAGSPPKTPCCALLKGLANLEAAVCLCTALKANVL-GINLNVP  113

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGKK+P GF C
Sbjct  114  VDLSLLLNYCGKKLPYGFQC  133



>ref|XP_010506455.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Camelina sativa]
 ref|XP_010506456.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Camelina sativa]
Length=131

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G+PP + CCS+L+G+A LEAA CLCTA+KA+VL G+ + +P
Sbjct  52   DTLKLGVCADLLGLVNVLVGSPPKTPCCSLLQGLANLEAAVCLCTALKANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGKK+P GF C
Sbjct  111  IDLSLLLNYCGKKLPYGFQC  130



>ref|XP_010518131.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=134

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ +IG+PP + CCS+L+G+A LEAA CLCTAIKA+V+ G+ + +P
Sbjct  55   DTLKLGVCADLLGLVNVLIGSPPKTPCCSLLQGLANLEAAVCLCTAIKANVV-GINLNVP  113

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGKK+P GF C
Sbjct  114  IDLSLLLNYCGKKLPYGFQC  133



>ref|XP_008232588.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=139

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVCGD L GLVH V+G PP + CCS++ G+A++EAA CLCTAIKA+VL G+ + +
Sbjct  59   DTLKLGVCGDLLNGLVHLVMGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVL-GINLNV  117

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK VP GF C
Sbjct  118  PVSLSLLLNYCGKSVPTGFQC  138



>emb|CBI31906.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC D L  L+H V+G PP S CCS++ G+A+LEAA CLCTAIKA+VLG +K+ +
Sbjct  33   DTLKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLG-IKLNV  91

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP G+ C
Sbjct  92   PVSLSLLLNYCGKKVPTGYQC  112



>ref|XP_002285197.1| PREDICTED: putative lipid-binding protein At4g00165 [Vitis vinifera]
Length=128

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLKFGVC D LG LV  V G+PPSS+CC+VL+G+A+LEAAACLCTAIKA VL G+ +++
Sbjct  48   DTLKFGVCADLLGGLVSLVAGSPPSSKCCAVLEGLADLEAAACLCTAIKASVL-GINVKV  106

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PVAISL++++CGK +P GF C
Sbjct  107  PVAISLLISACGKSIPPGFKC  127



>ref|XP_004516834.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=131

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVC D LGL++  +G PP + CCS++ G+A LEAA CLCTA+KA+VL G+ +++P
Sbjct  51   DTIKFGVCADLLGLINVQLGKPPKTPCCSLIDGLANLEAAVCLCTALKANVL-GINLDLP  109

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GFVC
Sbjct  110  INLSLILNYCGKGVPKGFVC  129



>ref|XP_009626056.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ VIG+PP + CCS+L G+A +EAA CLCTAIKA++L G+ + +P
Sbjct  49   DTLKLGVCADVLGLVNAVIGSPPVTPCCSLLSGLANVEAALCLCTAIKANIL-GINLNVP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++SL+LN C K+ P+GF C
Sbjct  108  ISLSLLLNVCSKEAPSGFQC  127



>ref|XP_006353678.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=129

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVCGD LGLV+  IG+  ++ CCS+L+G+A+LE AACLCTAIKA+VLG +K++IP
Sbjct  49   DTLKLGVCGDLLGLVNVAIGSQVTTPCCSLLEGLADLEVAACLCTAIKANVLGIIKLDIP  108

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+S ++++C KKVP GF C
Sbjct  109  VALSALVSACAKKVPTGFKC  128



>emb|CDP05328.1| unnamed protein product [Coffea canephora]
Length=129

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   IGAPP+  CCS+L+G+A+LEAA CLCTAI+A++L G+ + +P
Sbjct  50   DALKLGVCANVLGLIRVSIGAPPTLPCCSLLQGLADLEAALCLCTAIRANIL-GINLNLP  108

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SLVLN+CG+  PNGF+C
Sbjct  109  VTLSLVLNNCGRNPPNGFIC  128



>gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii]
Length=137

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+GAPP + CC++LKG+A+LEAA CLCTAIKA+VL G+ + +
Sbjct  54   DTLKLGVCANLLNDLVHLVVGAPPKTPCCTLLKGLADLEAALCLCTAIKANVL-GINLNV  112

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP GF C
Sbjct  113  PVSLSLLLNYCGKKVPTGFQC  133



>ref|XP_002271461.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=132

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC D L  L+H V+G PP S CCS++ G+A+LEAA CLCTAIKA+VLG +K+ +
Sbjct  52   DTLKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLG-IKLNV  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP G+ C
Sbjct  111  PVSLSLLLNYCGKKVPTGYQC  131



>gb|AAX20042.1| proline-rich protein [Capsicum annuum]
Length=136

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ VIG+PP + CCS+L G+A  EAA CLCTAIKA++L G+ + +P
Sbjct  57   DTLKLGVCADVLGLVNAVIGSPPVTPCCSLLSGLANAEAALCLCTAIKANIL-GINLNVP  115

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V++SL+LN C K+ P GF C
Sbjct  116  VSLSLLLNVCSKEAPAGFQC  135



>ref|XP_008219516.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=131

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+  +G PP+S+CC++L+G+A++EAA CLCTAIKA+VLG   +E+P
Sbjct  51   DTLKLGVCMDLLGLVNLPVGTPPTSKCCALLEGLADMEAAICLCTAIKANVLGVGALEVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++++C K VP GF C
Sbjct  111  VALSLLVSACQKSVPPGFKC  130



>ref|XP_010508203.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=131

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT K GVC D LGLV+ ++G+PP + CCS+L+G+A LEAA CLCTA+KA+VL G+ + +P
Sbjct  52   DTFKLGVCADLLGLVNVLVGSPPKTPCCSLLQGLANLEAAVCLCTALKANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGKK+P GF C
Sbjct  111  INLSLLLNYCGKKLPYGFQC  130



>ref|XP_002880164.1| hypothetical protein ARALYDRAFT_483654 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56423.1| hypothetical protein ARALYDRAFT_483654 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC + LGLV+ V+G+PP + CC++L+G+A LEAA CLCTA+KA+VL G+ + +P
Sbjct  55   DTLKLGVCAELLGLVNLVVGSPPKTPCCTLLQGLANLEAAVCLCTALKANVL-GINLNVP  113

Query  387  VAISLVLNSCGKKVPNGF  440
            V +SL+LN CGKK+P GF
Sbjct  114  VDLSLLLNYCGKKLPYGF  131



>ref|NP_001235511.1| uncharacterized protein LOC100500518 precursor [Glycine max]
 gb|ACU15619.1| unknown [Glycine max]
 gb|KHN09806.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=131

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVC D LGL++  +G PP + CCS+++G+A+LEAA CLCTA+KA+VL G+ + +P
Sbjct  52   DTVKFGVCADVLGLINVQLGKPPKTPCCSLIQGLADLEAAVCLCTALKANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK VP GFVC
Sbjct  111  VNLSLLLNYCGKGVPKGFVC  130



>ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|KDO61488.1| hypothetical protein CISIN_1g035808mg [Citrus sinensis]
Length=131

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+G PP + CCS++KG+ +LEAA CLCTAIKA++L G+ + +
Sbjct  51   DTLKLGVCANVLNDLVHLVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANIL-GINLNV  109

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GF C
Sbjct  110  PVSLSLLLNFCGKKVPSGFQC  130



>ref|XP_003588783.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES59034.1| Lipid transfer protein [Medicago truncatula]
Length=154

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G+P SS+CC++++G+A+L+AA CLCTAIKA+VL G+ + +P
Sbjct  75   DTLKLGVCADVLGLVNVIVGSPASSKCCTLIQGLADLDAAVCLCTAIKANVL-GINLNVP  133

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+L++C K VPNGF C
Sbjct  134  VTLSLLLSACEKSVPNGFQC  153



>ref|XP_009133710.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
 emb|CDX83396.1| BnaA03g21100D [Brassica napus]
Length=131

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G+PP + CC++L G+A +EAA CLCTA+KA+VL G+ + +P
Sbjct  52   DTLKLGVCADLLGLVNVLVGSPPKTPCCALLNGLANVEAAVCLCTALKANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGKK+P GF C
Sbjct  111  VDLSLLLNYCGKKLPYGFQC  130



>emb|CAN77080.1| hypothetical protein VITISV_025477 [Vitis vinifera]
Length=120

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLKFGVC D LG LV  V G+PPSS+CC+VL+G+A+LEAAACLCTAIKA VL G+ +++
Sbjct  40   DTLKFGVCADLLGGLVSLVAGSPPSSKCCAVLEGLADLEAAACLCTAIKASVL-GINVKV  98

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PVAISL++++CGK +P GF C
Sbjct  99   PVAISLLISACGKSIPXGFKC  119



>gb|KHN09805.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=131

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVC D LGL++  +G PP + CC++++G+A+LEAA CLCTA+KA+VL G+ + +P
Sbjct  52   DTIKFGVCADVLGLINVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK VP GFVC
Sbjct  111  VNLSLLLNYCGKGVPKGFVC  130



>ref|NP_001235888.1| uncharacterized protein LOC100500033 precursor [Glycine max]
 gb|ACU14667.1| unknown [Glycine max]
Length=131

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVC D LGL++  +G PP + CC++++G+A+LEAA CLCTA+KA+VL G+ + +P
Sbjct  52   DTIKFGVCADVLGLINVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK VP GFVC
Sbjct  111  VNLSLLLNYCGKGVPKGFVC  130



>ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=134

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+G PP + CCS++KG+ +LEAA CLCTAIKA++L G+ + +
Sbjct  54   DTLKLGVCANVLNDLVHLVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANIL-GINLNV  112

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GF C
Sbjct  113  PVSLSLLLNFCGKKVPSGFQC  133



>emb|CDX95635.1| BnaC03g25160D [Brassica napus]
Length=131

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGL++ ++G+PP + CC++L G+A +EAA CLCTA+KA+VL G+ + +P
Sbjct  52   DTLKLGVCADLLGLINVLVGSPPKTPCCALLNGLANVEAAVCLCTALKANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGKK+P GF C
Sbjct  111  VDLSLLLNYCGKKLPYGFQC  130



>ref|NP_001235027.1| uncharacterized protein LOC100500229 precursor [Glycine max]
 gb|ACU15232.1| unknown [Glycine max]
 gb|KHN09804.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=131

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVC D LGL++  +G PP + CC++++G+A+LEAA CLCTA+KA+VL G+ + +P
Sbjct  52   DTIKFGVCADVLGLINVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK VP GFVC
Sbjct  111  VKLSLLLNYCGKGVPKGFVC  130



>ref|XP_007218576.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
 gb|EMJ19775.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
Length=139

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVCG  L GLVH V+G PP + CCS++ G+A++EAA CLCTAIKA+VL G+ + +
Sbjct  59   DTLKLGVCGALLNGLVHLVVGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVL-GINLNV  117

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK VP GF C
Sbjct  118  PVSLSLLLNYCGKSVPTGFQC  138



>ref|XP_009801825.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=133

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ VIG+PP + CCS+L G+A +EAA CLC+AIKA++L G+ + +P
Sbjct  54   DTLKLGVCADVLGLVNAVIGSPPVAPCCSLLSGLANVEAALCLCSAIKANIL-GINLNVP  112

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++SL+LN C K+ P+GF C
Sbjct  113  ISLSLLLNVCSKEAPSGFQC  132



>emb|CAA59472.1| hybrid proline-rich protein [Catharanthus roseus]
Length=138

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D LG L+  VIGAPP + CCS+++G+A+LEAA CLCTAIKA+VL G+ + +
Sbjct  58   DALKLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVL-GINLNV  116

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN C KKVP GF+C
Sbjct  117  PVSLSLLLNVCSKKVPEGFIC  137



>ref|XP_003526352.1| PREDICTED: extensin-like [Glycine max]
Length=221

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+  +G PPSSECC+++KG+A+LEAA CLCTAIKA+VL G+ + +P
Sbjct  141  DTLKLGVCADILGLVNVTVGTPPSSECCALVKGLADLEAALCLCTAIKANVL-GINLNVP  199

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +S++L++C K VP GF C
Sbjct  200  VTLSVILSACQKTVPPGFQC  219



>ref|XP_006366172.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=120

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC + L LV+ ++G+PP+  CCS+++G+ +LEAA CLCTAI+A+VL G+ + +P
Sbjct  42   DTLKLGVCANILNLVNVIVGSPPTLPCCSLIQGLTDLEAAVCLCTAIRANVL-GINLNVP  100

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++SL+LNSCGK  P GF C
Sbjct  101  LSLSLILNSCGKNPPTGFTC  120



>ref|XP_003608741.1| Cortical cell-delineating protein [Medicago truncatula]
 gb|AES90938.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK48033.1| unknown [Medicago truncatula]
Length=132

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVC D LGL++  +G PP + CCS++ G+A LEAA CLCTA+KA+VL G+ + +P
Sbjct  53   DTIKFGVCADVLGLINVELGKPPKTPCCSLIDGLANLEAAVCLCTALKANVL-GINLNLP  111

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SLVLN CGK VP GFVC
Sbjct  112  INLSLVLNYCGKGVPKGFVC  131



>ref|XP_008362163.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=145

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVCGD L  LV  V+G PP + CCS++ G+A+LEAA CLCTAIKA+VLG + +++
Sbjct  65   DTLKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLG-INLDV  123

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK VPNGF C
Sbjct  124  PVSLSLLLNYCGKSVPNGFQC  144



>ref|NP_001238461.1| uncharacterized protein LOC100499693 precursor [Glycine max]
 gb|ACU13264.1| unknown [Glycine max]
 gb|AEM45873.1| proline-rich protein [Glycine max]
Length=131

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVC D LGL++  +G PP + CC++++G+A+LEAA CLCTA+KA+VL G+ + +P
Sbjct  52   DTIKFGVCADVLGLINVQLGKPPKTPCCNLIEGLADLEAAVCLCTALKANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK VP GFVC
Sbjct  111  VNLSLLLNYCGKGVPKGFVC  130



>ref|XP_003525817.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
Length=126

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVC D LGL++  +G PP + CC++++G+A+LEAA CLCTA+KA+VL G+ + +P
Sbjct  47   DTLKFGVCADVLGLINVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVL-GINLNVP  105

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V + L+LN CGK VP GFVC
Sbjct  106  VKLGLLLNYCGKGVPKGFVC  125



>gb|AFK47547.1| unknown [Lotus japonicus]
Length=139

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+K GVC D LGL++  +G PP + CCS+L+G+A+LEAA CLCTA++A+VL G+ + IP
Sbjct  60   DTIKLGVCADVLGLINVQLGKPPKTPCCSLLQGLADLEAAVCLCTALRANVL-GINLNIP  118

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GFVC
Sbjct  119  INLSLILNYCGKGVPKGFVC  138



>gb|AIX10944.1| PRP2-like protein [Gardenia jasminoides]
Length=147

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC D LGL+   IG+PP+  CCS+L+G+A+LEAA CLCTAIKA++L G+ + +P
Sbjct  68   DALKLGVCADLLGLIGISIGSPPTKPCCSLLEGLADLEAAVCLCTAIKANIL-GINLNVP  126

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++SL+LN+CGK VP GF C
Sbjct  127  ISLSLILNNCGKSVPKGFQC  146



>ref|XP_011081229.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+G PP + CC+++KG+A+LEAA CLCTAIKA+VLG   + I
Sbjct  53   DTLKLGVCANLLNDLVHLVVGTPPKTPCCTLIKGLADLEAAVCLCTAIKANVLGN-DLNI  111

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGKKVP GF C
Sbjct  112  PLSLSLLLNYCGKKVPTGFQC  132



>ref|XP_004241782.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=126

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+  IG+  ++ CCS+L+G+A+LE AACLCTAIKA+VLG +K++IP
Sbjct  46   DTLKLGVCADLLGLVNVAIGSQVTTPCCSLLEGLADLEVAACLCTAIKANVLGIVKLDIP  105

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+S ++++C KKVP GF C
Sbjct  106  VALSALVSACAKKVPTGFKC  125



>ref|XP_007226236.1| hypothetical protein PRUPE_ppa017473mg [Prunus persica]
 gb|EMJ27435.1| hypothetical protein PRUPE_ppa017473mg [Prunus persica]
Length=128

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+  +G PP+S+CC++L+G+A++EAA CLCT IK +VLG + +E+P
Sbjct  48   DTLKLGVCMDLLGLVNLPVGTPPTSKCCALLEGLADMEAALCLCTVIKNNVLGLVNLEVP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++++C K VP GF C
Sbjct  108  VALSLLVSACQKSVPPGFKC  127



>gb|ADD11814.1| hybrid proline-rich protein [Cajanus cajan]
Length=131

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVC + LGLV+  +G PP + CCS+++G+A+LEAA CLCTA+KA+VL G+ + +P
Sbjct  52   DTLKFGVCANLLGLVNVNLGKPPKTPCCSLIEGLADLEAAVCLCTALKANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGKK P  F+C
Sbjct  111  VKLSLLLNVCGKKTPKDFIC  130



>ref|XP_011070108.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=137

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+G PP + CCS++ G+A+LEAA CLCTAIKA+VLG + + +
Sbjct  57   DTLKLGVCANLLNDLVHLVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLG-INLNV  115

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GF C
Sbjct  116  PVSLSLLLNYCGKKVPSGFQC  136



>ref|XP_003588785.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES59036.1| protease inhibitor/seed storage/LTP family protein [Medicago 
truncatula]
 gb|AFK36514.1| unknown [Medicago truncatula]
 gb|AFK45094.1| unknown [Medicago truncatula]
Length=151

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G+P SS+CC++L+G+ +L+AA CLCTAIKA+VL G+ + +P
Sbjct  72   DTLKLGVCADVLGLVNVIVGSPASSKCCALLQGLVDLDAAICLCTAIKANVL-GINLNVP  130

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+L++C K VP+GF C
Sbjct  131  ITLSLLLSACEKSVPSGFQC  150



>ref|XP_009801239.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=129

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+  IG+  +S CCS+L+G+A+LE AACLCTAIKA+VLG +K++IP
Sbjct  49   DTLKLGVCADVLGLVNVAIGSQVTSPCCSLLQGLADLEVAACLCTAIKANVLGIVKLDIP  108

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+S ++++C K +P GF C
Sbjct  109  VALSALVSACAKTIPTGFKC  128



>ref|XP_003559026.1| PREDICTED: putative lipid-binding protein AIR1 [Brachypodium 
distachyon]
 gb|ACF22747.1| proline-rich protein [Brachypodium distachyon]
Length=144

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC + LGLV   +G PPS ECCS+L G+A+LEAA CLCTA+KA+VL G+ + IP
Sbjct  65   DTLKLGVCANVLGLVKVELGHPPSGECCSLLGGLADLEAAVCLCTALKANVL-GIVLNIP  123

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK  P GF+C
Sbjct  124  VKLSLLLNYCGKTAPQGFIC  143



>emb|CAA81526.1| 14 kDa polypeptide [Catharanthus roseus]
Length=138

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D LG L+  VIGAPP + CCS+++G+A+LEAA CLCTAIKA+VL G+ + +
Sbjct  58   DALKLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVL-GINLNV  116

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV+++L+LN C KKVP GF+C
Sbjct  117  PVSLTLLLNVCSKKVPEGFIC  137



>ref|XP_004516832.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=142

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%), Gaps = 4/80 (5%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVC D LG+VH +IG    S+CCS++ G+A L+AA CLCTA+KA+VLG + + IP
Sbjct  66   DTLKFGVCADLLGVVHIIIG---KSQCCSLIDGLANLDAAVCLCTALKANVLG-INLNIP  121

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN+CGK VP GFVC
Sbjct  122  INLSLILNNCGKGVPKGFVC  141



>ref|XP_003588784.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
Length=164

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G P SS+CC++++G+A+L+AA CLCTAIKA+VL G+ + +P
Sbjct  85   DTLKLGVCADVLGLVNVIVGNPASSKCCTLIQGLADLDAAVCLCTAIKANVL-GINLNVP  143

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+L++C K VPNGF C
Sbjct  144  VTLSLLLSACQKSVPNGFQC  163



>ref|XP_004516833.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=149

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKFGVC D LG+VH +IG    S+CCS++ G+A LEAA CLCTA+KA+VLG + + IP
Sbjct  73   DTLKFGVCADLLGVVHIIIG---KSQCCSLINGLANLEAAVCLCTALKANVLG-INLNIP  128

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GFVC
Sbjct  129  INLSLILNDCGKGVPKGFVC  148



>gb|KHN08148.1| Putative lipid-binding protein [Glycine soja]
Length=177

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK G C D LGLV+ ++G PPSS+CC+++KG+A+LEAA CLCTAIK++VL G+ + +P
Sbjct  97   DTLKLGACADLLGLVNIIVGTPPSSQCCALIKGLADLEAALCLCTAIKSNVL-GINLNVP  155

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +S++L++C K VP GF C
Sbjct  156  VTLSVILSACQKTVPPGFQC  175



>ref|XP_004291444.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=133

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+  IG+PP++ CCS+LKG+ +LEAA CLCTA+KA+VL G+ + +P
Sbjct  54   DTLKLGVCADLLGLVNLQIGSPPTTPCCSLLKGLTDLEAALCLCTALKANVL-GINLNVP  112

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++S+++++C K VP+GF C
Sbjct  113  ISLSVLVSACQKSVPSGFQC  132



>gb|ABQ01426.1| bimodular protein [Medicago falcata]
Length=166

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G+P SS+CC++++G+A+L+AA CLCTAIKA++L G+ + +P
Sbjct  87   DTLKLGVCADVLGLVNVIVGSPASSKCCTLIQGLADLDAAVCLCTAIKANIL-GINLNVP  145

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+L++C K +PNGF C
Sbjct  146  ITLSLLLSACEKSIPNGFQC  165



>ref|XP_010053451.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=131

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DT+K GVC + L  L+H V+G PP + CCS++ G+A+LEAA CLCTAIKA+VLG L + +
Sbjct  51   DTIKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLG-LNLNV  109

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GF C
Sbjct  110  PVSLSLLLNYCGKKVPSGFQC  130



>gb|EYU18564.1| hypothetical protein MIMGU_mgv1a016162mg [Erythranthe guttata]
Length=132

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 66/81 (81%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+G+PP + CCS++ G+A+LEAA CLCTA+KA+VLG + + +
Sbjct  52   DTLKLGVCANLLNDLVHLVVGSPPKTPCCSLIGGLADLEAAVCLCTAVKANVLG-INLNV  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GF C
Sbjct  111  PVSLSLLLNYCGKKVPSGFQC  131



>gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Erythranthe guttata]
Length=132

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+G+PP + CCS++ G+ +LEAA CLCTA+KA+VLG + + +
Sbjct  52   DTLKLGVCANLLNDLVHLVVGSPPKTPCCSLIGGLVDLEAAVCLCTAVKANVLG-INLNV  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GF C
Sbjct  111  PVSLSLLLNYCGKKVPSGFQC  131



>gb|AFK37038.1| unknown [Lotus japonicus]
Length=132

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+K GVC D LGL++  +G PP + CCS+L+G+ +LEAA CLCTA+KA+VL G+ + +P
Sbjct  53   DTIKLGVCADVLGLINVQLGKPPKTPCCSLLEGLVDLEAAVCLCTALKANVL-GINLNLP  111

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GFVC
Sbjct  112  INLSLILNYCGKGVPKGFVC  131



>gb|AAA32650.1| bimodular protein [Medicago sativa]
Length=166

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G+P SS+CC++++G+A+L+AA CLCTAIKA++L G+ + +P
Sbjct  87   DTLKLGVCADVLGLVNVIVGSPASSKCCTLIQGLADLDAAVCLCTAIKANIL-GINLNVP  145

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+L++C K +PNGF C
Sbjct  146  ITLSLLLSACEKSIPNGFQC  165



>ref|XP_007137003.1| hypothetical protein PHAVU_009G092000g [Phaseolus vulgaris]
 gb|ESW08997.1| hypothetical protein PHAVU_009G092000g [Phaseolus vulgaris]
Length=162

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGLVH ++G PPSS+CC+++K +A+LEAA CLCTAIKA+VL G+ + +P
Sbjct  83   DILKLGVCANVLGLVHVIVGTPPSSDCCALIKDLADLEAALCLCTAIKANVL-GINLNVP  141

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+S +L++C K VP+GF C
Sbjct  142  VALSAILSACQKTVPSGFKC  161



>ref|XP_003588779.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES59030.1| Lipid transfer protein [Medicago truncatula]
Length=210

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G+P SS CC++++G+A+L+AA CLCTAIKA+VL G+ + +P
Sbjct  131  DTLKLGVCADVLGLVNVIVGSPASSNCCTLIQGLADLDAAVCLCTAIKANVL-GINLNVP  189

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+L++C K VPNGF C
Sbjct  190  VTLSLLLSACQKSVPNGFQC  209



>emb|CDP09932.1| unnamed protein product [Coffea canephora]
Length=147

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + L ++   IG+PP+  CCS+L+G+A+LEAA CLCTAIKA++L G+ + +P
Sbjct  68   DALKLGVCANLLNIIGISIGSPPTEPCCSLLQGLADLEAALCLCTAIKANIL-GINLNVP  126

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V++S++LN CGKKVPNGF C
Sbjct  127  VSLSVILNDCGKKVPNGFQC  146



>gb|KCW77749.1| hypothetical protein EUGRSUZ_D02043, partial [Eucalyptus grandis]
Length=147

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DT+K GVC + L  L+H V+G PP + CCS++ G+A+LEAA CLCTAIKA+VLG L + +
Sbjct  67   DTIKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLG-LNLNV  125

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GF C
Sbjct  126  PVSLSLLLNYCGKKVPSGFQC  146



>gb|AES59035.2| Lipid transfer protein [Medicago truncatula]
Length=164

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G P SS CC++++G+A+L+AA CLCTAIKA+VL G+ + +P
Sbjct  85   DTLKLGVCADVLGLVNVIVGIPASSNCCTLIQGLADLDAAVCLCTAIKANVL-GINLNVP  143

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+L++C K VPNGF C
Sbjct  144  VTLSLLLSACQKSVPNGFQC  163



>ref|XP_010264242.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=133

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH VIG PP   CC++++G+A+LEAA CLCTAIKA++LG + + +
Sbjct  53   DTLKLGVCANLLNDLVHLVIGTPPKYPCCTLIEGLADLEAAVCLCTAIKANILG-IHLNV  111

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GF C
Sbjct  112  PVSLSLLLNYCGKKVPSGFQC  132



>ref|XP_010258985.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=137

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+G PP   CCS+++G+A+LEAA CLCTAIKA++LG + + +
Sbjct  57   DTLKLGVCANLLNDLVHLVVGTPPKYPCCSLIEGLADLEAAVCLCTAIKANILG-IHLNV  115

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GF C
Sbjct  116  PVSLSLLLNYCGKKVPSGFQC  136



>ref|XP_004498751.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=126

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G P SS+CC++L+G+A+LEAA CLCTAIKA+VL G+ + +P
Sbjct  47   DTLKLGVCADVLGLVNIIVGTPSSSKCCALLQGLADLEAAICLCTAIKANVL-GINLNVP  105

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+L++C K +P+GF C
Sbjct  106  ITLSLLLSACQKSIPSGFKC  125



>ref|XP_009607067.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=129

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+  +G+  +S CCS+L+G+A+LE AACLCTAIKA+VLG +K++IP
Sbjct  49   DTLKLGVCADVLGLVNVAVGSQVTSPCCSLLQGLADLEVAACLCTAIKANVLGIVKLDIP  108

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+S ++++C K +P GF C
Sbjct  109  VALSALVSACAKTIPTGFKC  128



>ref|XP_011036580.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=126

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK G C D LGLV+ V+G PP S+CC +L+G+A+LE A CLCTAIKA+VL G+ + +P
Sbjct  47   DTLKLGACADILGLVNVVVGTPPYSKCCPLLEGLADLEVALCLCTAIKANVL-GINLNVP  105

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+S+++++CGK +P GF C
Sbjct  106  VALSVLVSACGKSIPPGFKC  125



>gb|KHN33896.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=126

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV  V+G+P SS+CC++L+G+A+LEAA CLCTAIKA+VL G+ + +P
Sbjct  47   DTLKLGVCADILGLVTVVVGSPVSSKCCALLEGLADLEAALCLCTAIKANVL-GINLNVP  105

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +S++L++C K VP+GF C
Sbjct  106  ITLSVLLSACQKTVPSGFQC  125



>ref|XP_011081228.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+G PP + CC++++G+A+LEAA CLCTAIKA+VL G+ + +
Sbjct  53   DTLKLGVCANLLNDLVHLVVGTPPKTPCCTLIEGLADLEAAVCLCTAIKANVL-GINLNV  111

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKK P+GF C
Sbjct  112  PVSLSLLLNYCGKKAPSGFQC  132



>ref|XP_006445312.1| hypothetical protein CICLE_v10022835mg [Citrus clementina]
 ref|XP_006490869.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR58552.1| hypothetical protein CICLE_v10022835mg [Citrus clementina]
Length=130

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC D L  LVH V+G PP + CC++LKG+A+LEAA CLCTAIKA++L G+ + +
Sbjct  49   DTLKLGVCADLLNDLVHLVVGTPPVTPCCALLKGLADLEAAVCLCTAIKANIL-GINLNL  107

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CG  VP+GF C
Sbjct  108  PISLSLLLNYCGNGVPSGFQC  128



>ref|XP_007039884.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY24385.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=134

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D L L+H V+G P  + CCS+L G+A+ EA  CLCT IKA VLG   + IP
Sbjct  55   DTLKLGVCADLLNLMHAVVGNPAKTPCCSLLAGLADAEATVCLCTTIKASVLGA-NLNIP  113

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V++SL+LN CGK +P G+ C
Sbjct  114  VSLSLLLNYCGKNIPAGYQC  133



>ref|XP_002309638.1| hypothetical protein POPTR_0006s27220g [Populus trichocarpa]
 gb|EEE93161.1| hypothetical protein POPTR_0006s27220g [Populus trichocarpa]
Length=125

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LG V+ V G PP S+CCS+L+G+A++EAA+CLCTAIKA+VLG   + +P
Sbjct  47   DTLKLGVCADLLGPVNVVAGTPPYSKCCSLLEGLADMEAASCLCTAIKANVLGT-NLNVP  105

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+S ++++CGK +P GF C
Sbjct  106  VALSAIVSACGKSIPPGFQC  125



>ref|XP_002324869.2| hypothetical protein POPTR_0018s01890g [Populus trichocarpa]
 gb|ABK95939.1| unknown [Populus trichocarpa]
 gb|EEF03434.2| hypothetical protein POPTR_0018s01890g [Populus trichocarpa]
Length=121

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK G C D LGLV+ V+G+PP S+CC +L+G+A+LE A CLCTAIKA VL G+ + +P
Sbjct  42   DTLKLGACADILGLVNVVVGSPPYSKCCPLLEGLADLEVALCLCTAIKASVL-GINLNVP  100

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+S+++++CGK +P GF C
Sbjct  101  VALSVLVSACGKSIPPGFKC  120



>ref|XP_010696470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Beta vulgaris 
subsp. vulgaris]
Length=130

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPS-SECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC D LGLVH V+G PPS ++CC+++KG+A++EAA CLCTAIKA++L G+ + +
Sbjct  50   DTLKLGVCADVLGLVHAVLGNPPSGTKCCALIKGLADVEAAVCLCTAIKANIL-GINLNV  108

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++S++L++C K VP GF C
Sbjct  109  PISLSVLLSACQKDVPKGFQC  129



>ref|XP_003609035.1| Proline-rich protein [Medicago truncatula]
 gb|AES91232.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK41139.1| unknown [Medicago truncatula]
Length=123

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVC D LGL++  +G PP + CCS++  +A LEAA CLCTA+KA+VL G+ + +P
Sbjct  44   DTIKFGVCADVLGLINVELGKPPKTPCCSLIDDLANLEAAVCLCTALKANVL-GINLNLP  102

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SLVLN CGK VP GFVC
Sbjct  103  INLSLVLNYCGKGVPKGFVC  122



>ref|NP_001275620.1| uncharacterized protein LOC102590907 precursor [Solanum tuberosum]
 gb|AFW90552.1| 14 kDa proline-rich protein [Solanum tuberosum]
Length=133

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+ ++G+PP + CCS+L G+A  EAA CLCTA+KA++L G+ + +P
Sbjct  54   DTLKLGVCADVLGLVNVIVGSPPVTPCCSLLSGLANAEAAICLCTALKANIL-GINLNLP  112

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++SL+LN C K+ P GF C
Sbjct  113  ISLSLLLNVCSKEAPAGFQC  132



>gb|AFK43955.1| unknown [Lotus japonicus]
Length=128

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK G C D LGLV+ V+G+P SS+CC++L+G+A+LEAA CLCTA+KA+VL G+ + +P
Sbjct  49   DTLKLGACADLLGLVNVVLGSPASSKCCALLEGLADLEAAVCLCTAVKANVL-GINLNVP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +S++L++C K VP+GF C
Sbjct  108  VTLSVLLSACQKTVPSGFQC  127



>ref|XP_006856528.1| hypothetical protein AMTR_s00046p00139540 [Amborella trichopoda]
 gb|ERN17995.1| hypothetical protein AMTR_s00046p00139540 [Amborella trichopoda]
Length=117

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSE-CCSVLKGVaeleaaaclcTAIKADVLGGLKME  380
            D LK GVC D L GLV+ VIG+PPS + CC +L G+A+LEAA CLCTAIKA+VLG +K+E
Sbjct  35   DALKLGVCADLLSGLVNVVIGSPPSGDKCCPLLYGLADLEAAVCLCTAIKANVLGIIKVE  94

Query  381  IPVAISLVLNSCGKKVPNGFVC  446
            +PVA+SL++++C K +P GFVC
Sbjct  95   VPVALSLLISACQKTIPPGFVC  116



>ref|XP_008394102.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=125

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK G C D LGLV+  IG+PP+S CC++L+G+++LEAA CLCT IKA+ L GL ME+P
Sbjct  46   DTLKLGACVDLLGLVNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANAL-GLNMEVP  104

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++++C K VP GF C
Sbjct  105  VALSLLVSACQKTVPPGFKC  124



>ref|XP_008663526.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Zea mays]
 gb|AFW59244.1| hypothetical protein ZEAMMB73_930140 [Zea mays]
Length=128

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +LKG+ +LEAA CLCTAIK +VL G+K+ +P
Sbjct  49   DALKLGVCANVLGLIKAKVGVPPTEPCCPLLKGLVDLEAAVCLCTAIKGEVL-GIKLNLP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK+VP GF C
Sbjct  108  VDLSLILNHCGKRVPTGFKC  127



>ref|XP_011039660.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=123

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LG V+ V G PP S+CCS+L+G+A++E A CLCTAIKA+VLG   + +P
Sbjct  45   DTLKLGVCADLLGPVNVVAGTPPRSKCCSLLEGLADMEVALCLCTAIKANVLGT-NLNVP  103

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+S ++++CGK +P GF C
Sbjct  104  VALSAIVSACGKSIPPGFQC  123



>ref|XP_006579357.1| PREDICTED: uncharacterized protein LOC100499693 isoform X1 [Glycine 
max]
Length=131

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DT+KFGVC D LGL++  +G PP + CC++++G+A+LEAA CLCTA+KA+VL G+ + + 
Sbjct  52   DTIKFGVCADVLGLINVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVL-GINLNVT  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK VP GFVC
Sbjct  111  VNLSLLLNYCGKGVPKGFVC  130



>gb|EPS71802.1| hypothetical protein M569_02964 [Genlisea aurea]
Length=146

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + LG L+  VIG PP   CCSV++G+ +LEAA CLCTAIKAD+L G+ + I
Sbjct  66   DTLKLGVCANLLGDLLGVVIGTPPKEPCCSVIQGLVDLEAAVCLCTAIKADIL-GINLNI  124

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++S++LN C KKVP GF+C
Sbjct  125  PVSLSVLLNVCSKKVPPGFIC  145



>ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=142

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVCGD L  LV  V+G PP + CCS++ G+ +LEAA CLCTAIKA+VLG + +++
Sbjct  62   DTLKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLTDLEAAVCLCTAIKANVLG-INLDV  120

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK VP GF C
Sbjct  121  PVSLSLLLNYCGKSVPKGFQC  141



>ref|XP_003603362.1| Proline-rich protein [Medicago truncatula]
 gb|ACJ86111.1| unknown [Medicago truncatula]
 gb|AES73613.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK47287.1| unknown [Medicago truncatula]
Length=130

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 66/81 (81%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPS-SECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC D LGLV+ VIG PPS S+CC+++KG+A+LEAA CLCTA+KA+VL G+ + +
Sbjct  50   DTLKLGVCADLLGLVNVVIGNPPSGSKCCALIKGLADLEAALCLCTALKANVL-GINLNV  108

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+ +SL+L++C K VP GF C
Sbjct  109  PITLSLLLSACQKTVPPGFQC  129



>ref|XP_010053452.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW77751.1| hypothetical protein EUGRSUZ_D02045 [Eucalyptus grandis]
Length=134

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D L GLV+ V+G PP + CCS+L+G+A+LEAA CLCTAIKA VL G+ + +
Sbjct  54   DALKLGVCADLLNGLVNIVVGTPPKTPCCSLLEGLADLEAAVCLCTAIKASVL-GINLNV  112

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK VP GF C
Sbjct  113  PVSLSLLLNYCGKDVPYGFQC  133



>ref|XP_010676151.1| PREDICTED: putative lipid-binding protein AIR1B [Beta vulgaris 
subsp. vulgaris]
Length=131

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + LG L+H  IG PP   CCS+++G+ +LEAA CLCT I+A+VL  + + +
Sbjct  50   DTLKLGVCANLLGNLLHLQIGTPPVQPCCSLIQGLVDLEAAVCLCTVIRANVLDLINLNL  109

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV +SL+LN CG++VP GFVC
Sbjct  110  PVNLSLLLNVCGRQVPRGFVC  130



>gb|EPS73889.1| hypothetical protein M569_00868, partial [Genlisea aurea]
Length=137

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC D LG L+  VIG PP + CCS+++G+A+LEAA CLCTAIKA+VLG + +++
Sbjct  58   DTLKLGVCADLLGSLLGLVIGTPPKTPCCSLIEGLADLEAAVCLCTAIKANVLG-ISLDV  116

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN C KK+P GF C
Sbjct  117  PISLSLLLNDCSKKLPTGFQC  137



>ref|XP_006366173.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=121

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC + L LV+ V+G+PP+  CCS+++G+ +LEAA CL  AI+A+VLG + +++P
Sbjct  42   DTLKLGVCANILNLVNVVVGSPPTMPCCSLIQGLLDLEAAVCLSLAIRANVLGIINLQVP  101

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +AI L+L++CG+ +P    C
Sbjct  102  LAIDLILSACGRSIPTNSTC  121



>ref|XP_004306948.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=135

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+G PP + CCS+++G+ +LEAA CLCTA+KA+VL G+ + +
Sbjct  55   DTLKLGVCANLLNDLVHLVVGTPPKTPCCSLIEGLVDLEAAVCLCTALKANVL-GINLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGK VP GF C
Sbjct  114  PISLSLLLNYCGKGVPAGFQC  134



>ref|XP_010523077.1| PREDICTED: putative lipid-binding protein At4g00165 [Tarenaya 
hassleriana]
Length=110

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTA-IKADVLGGLKMEI  383
            D ++ G CG WLG+V EVIG PPS +CCS++ G+A+LEAA C C+A + ++VLG  K  I
Sbjct  29   DGVRLGACGSWLGVVREVIGTPPSEKCCSLVGGLADLEAAVCFCSALLHSNVLGVTKFTI  88

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P A+SL+LNSC K +P GFVC
Sbjct  89   PSALSLLLNSCEKNMPPGFVC  109



>ref|NP_001152564.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG43950.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG48252.1| cortical cell-delineating protein precursor [Zea mays]
 gb|AFW59243.1| cortical cell-delineating protein [Zea mays]
Length=131

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +LKG+ +LEAA CLCTAIK +VL G+K+ +P
Sbjct  52   DALKLGVCANVLGLIKAKVGVPPTEPCCPLLKGLVDLEAAVCLCTAIKGEVL-GIKLNLP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK VP GF C
Sbjct  111  VDLSLILNHCGKTVPTGFKC  130



>ref|XP_004291442.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=129

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+  IG+P SS CC++L+G+ + EAA CLCTA+KA++L G+ + +P
Sbjct  50   DTLKLGVCADLLGLVNVQIGSPASSPCCALLQGLVDAEAALCLCTALKANIL-GINLNVP  108

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++SL+L++C K+VP  F C
Sbjct  109  ISLSLLLSACQKEVPPNFKC  128



>ref|XP_002464967.1| hypothetical protein SORBIDRAFT_01g029610 [Sorghum bicolor]
 gb|EER91965.1| hypothetical protein SORBIDRAFT_01g029610 [Sorghum bicolor]
Length=124

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D+LK GVC + LGLV   IG+PP   CCS+L G+ +LEAA CLCTAIKA++L G+ + +P
Sbjct  45   DSLKLGVCANVLGLVKAKIGSPPYQPCCSLLDGLVDLEAAVCLCTAIKANIL-GINLNLP  103

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN+CGK  PN F C
Sbjct  104  IDLSLILNNCGKNCPNDFHC  123



>ref|XP_004291443.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 3 
[Fragaria vesca subsp. vesca]
Length=118

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+  IG+P SS CC++L+G+ + EAA CLCTA+KA++L G+ + +P
Sbjct  39   DTLKLGVCADLLGLVNVQIGSPASSPCCALLQGLVDAEAALCLCTALKANIL-GINLNVP  97

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++SL+L++C K+VP  F C
Sbjct  98   ISLSLLLSACQKEVPPNFKC  117



>ref|NP_001047651.1| Os02g0662100 [Oryza sativa Japonica Group]
 dbj|BAD25631.1| putative ZmGR1a [Oryza sativa Japonica Group]
 dbj|BAD27674.1| putative ZmGR1a [Oryza sativa Japonica Group]
 dbj|BAF09565.1| Os02g0662100 [Oryza sativa Japonica Group]
 gb|EAY86973.1| hypothetical protein OsI_08367 [Oryza sativa Indica Group]
 gb|EAZ24090.1| hypothetical protein OsJ_07828 [Oryza sativa Japonica Group]
 dbj|BAG86633.1| unnamed protein product [Oryza sativa Japonica Group]
Length=128

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            + LKF  C D LGLV   +G PP   CC VL G+A+LEAA CLCTAIKA+VL G+ ++IP
Sbjct  49   NALKFAACADVLGLVSAEVGQPPYEPCCGVLGGLADLEAAVCLCTAIKANVL-GITLDIP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL++N CGK VP+GF+C
Sbjct  108  VKLSLLVNYCGKNVPSGFIC  127



>ref|XP_010053929.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW78308.1| hypothetical protein EUGRSUZ_D02488 [Eucalyptus grandis]
Length=133

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+H V+G PP + CCS+++G+A+LEAA CLCTAIKA++LG   + I
Sbjct  53   DTLKLGVCANLLNDLLHLVVGTPPKTPCCSLIEGLADLEAAVCLCTAIKANILGN-NLNI  111

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CG+ VP GF C
Sbjct  112  PISLSLLLNYCGQGVPKGFQC  132



>ref|XP_010906608.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D L GL++  IG PP   CCS+L G+ +LEAA CLCTAIKA++LG + + I
Sbjct  49   DALKLGVCADVLSGLLNVTIGTPPKEPCCSLLSGLVDLEAAVCLCTAIKANILG-INLNI  107

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV +SL+LN CGKKVP+GF C
Sbjct  108  PVDLSLLLNYCGKKVPSGFQC  128



>ref|XP_007052129.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=139

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+H V+G PP + CC +++G+A+LEAA CLCTAIKA++LG + + +
Sbjct  59   DTLKLGVCANVLNDLIHLVVGTPPKTPCCPLIQGLADLEAAVCLCTAIKANILG-INLNV  117

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK VP GF C
Sbjct  118  PVSLSLLLNYCGKNVPKGFQC  138



>ref|XP_007161198.1| hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris]
 gb|ESW33192.1| hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris]
Length=121

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK G C D LGLV+ V+G+P SS+CC++L G+A+LEAA CLCTAIKA+VL G+ + +P
Sbjct  42   DTLKLGACADILGLVNIVVGSPVSSKCCALLSGLADLEAALCLCTAIKANVL-GINLNVP  100

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +S++L++C K VP+GF C
Sbjct  101  ITLSVLLSACQKTVPSGFQC  120



>ref|XP_002515493.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF46942.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=131

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPS-SECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D LGLV+ V+G PPS S+CC+VL+G+ + EAA CLCTAIKA+VL G+ + +
Sbjct  50   DALKLGVCADLLGLVNVVVGDPPSGSKCCAVLQGLVDAEAALCLCTAIKANVL-GINLNV  108

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL++++C K VP GF C
Sbjct  109  PVSLSLLVSACSKSVPPGFQC  129



>ref|XP_002270769.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN65287.1| hypothetical protein VITISV_042739 [Vitis vinifera]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + LG L+  V+G PP + CCS+++G+A+LEAA CLCTAIKA+VL G+ + I
Sbjct  55   DTLKLGVCANLLGGLIGAVVGTPPKTPCCSLIQGLADLEAAVCLCTAIKANVL-GINLNI  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN C KKVP GF C
Sbjct  114  PLSLSLLLNVCSKKVPPGFQC  134



>ref|XP_002454523.1| hypothetical protein SORBIDRAFT_04g032640 [Sorghum bicolor]
 ref|XP_002454526.1| hypothetical protein SORBIDRAFT_04g032670 [Sorghum bicolor]
 gb|EES07499.1| hypothetical protein SORBIDRAFT_04g032640 [Sorghum bicolor]
 gb|EES07502.1| hypothetical protein SORBIDRAFT_04g032670 [Sorghum bicolor]
Length=122

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L G+ +LEAA CLCTAIKA+VL G+ + +P
Sbjct  44   DALKLGVCANVLGLIKAQVGVPPAEPCCPLLAGLVDLEAAVCLCTAIKANVL-GINLNVP  102

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GF+C
Sbjct  103  LDLSLILNYCGKTVPTGFMC  122



>ref|XP_002454525.1| hypothetical protein SORBIDRAFT_04g032660 [Sorghum bicolor]
 gb|EES07501.1| hypothetical protein SORBIDRAFT_04g032660 [Sorghum bicolor]
Length=122

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L G+ +LEAA CLCTAIKA+VL G+ + +P
Sbjct  44   DALKLGVCANVLGLIKAQVGVPPAEPCCPLLAGLVDLEAAVCLCTAIKANVL-GINLNVP  102

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GF+C
Sbjct  103  LDLSLILNYCGKTVPTGFMC  122



>ref|XP_004291441.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=157

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LGLV+  IG+P SS CC++L+G+ + EAA CLCTA+KA++L G+ + +P
Sbjct  78   DTLKLGVCADLLGLVNVQIGSPASSPCCALLQGLVDAEAALCLCTALKANIL-GINLNVP  136

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++SL+L++C K+VP  F C
Sbjct  137  ISLSLLLSACQKEVPPNFKC  156



>ref|XP_002874779.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51038.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+   +G PP   CCS+LKG+ +LEAAACLCTA+KA+VLG  K+ +
Sbjct  49   DTLKLGVCANVLKDLLKIQLGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGN-KLNV  107

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CG+KVP+GFVC
Sbjct  108  PVSLSLLLNVCGRKVPSGFVC  128



>gb|AAC49369.1| proline-rich 14 kDa protein [Phaseolus vulgaris]
Length=127

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            +TLKFGVC D LGL+   +G PP + CC++++G+A+LEAA CLCTA++A+VL G+ + +P
Sbjct  48   NTLKFGVCADVLGLIGVELGKPPKTPCCNLIQGLADLEAAVCLCTALRANVL-GINLNVP  106

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + ++L+LN CGKK P  FVC
Sbjct  107  IKLNLLLNYCGKKTPKDFVC  126



>ref|XP_004251936.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=123

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + L LV+  +G+PP   CCS+++G+ +LEAA CLCTAI+A+VL G+ + IP
Sbjct  45   DALKLGVCANVLNLVNVTVGSPPPLPCCSLIQGLTDLEAAVCLCTAIRANVL-GINLNIP  103

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++SLVLN+CG+  P GF C
Sbjct  104  LSLSLVLNNCGRNPPTGFTC  123



>ref|NP_001152587.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG48385.1| cortical cell-delineating protein precursor [Zea mays]
 gb|AFW59241.1| cortical cell-delineating protein [Zea mays]
Length=134

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L+G+ +LEAA CLCTAIK +VL G+K+ +P
Sbjct  55   DALKLGVCANVLGLIKAKVGVPPTEPCCRLLEGLVDLEAAVCLCTAIKGEVL-GIKLNLP  113

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK VP GF C
Sbjct  114  VDLSLILNHCGKTVPTGFKC  133



>ref|XP_006647641.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Oryza brachyantha]
Length=128

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            + LK   C D LGLV   +G PP   CCSVL G+A+LEAA CLCTAIKA+VL G+ ++IP
Sbjct  49   NALKLAACADVLGLVSAEVGQPPYEPCCSVLGGLADLEAAVCLCTAIKANVL-GITLDIP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL++N CGK VP+GF+C
Sbjct  108  VKLSLLVNYCGKNVPSGFIC  127



>ref|XP_002454524.1| hypothetical protein SORBIDRAFT_04g032650 [Sorghum bicolor]
 gb|EES07500.1| hypothetical protein SORBIDRAFT_04g032650 [Sorghum bicolor]
Length=131

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L G+ +LEAA CLCTAIKA+VL G+ + +P
Sbjct  53   DALKLGVCANVLGLIKAQVGVPPAEPCCPLLAGLVDLEAAVCLCTAIKANVL-GINLNVP  111

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GF+C
Sbjct  112  LDLSLILNYCGKTVPTGFMC  131



>ref|XP_009388037.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=129

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK G+C + L GL++  +G PP   CCS+L+G+ +LEAA CLCTA+K +VLG LK+ I
Sbjct  49   DALKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLG-LKLNI  107

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL++N CGKKVP GF+C
Sbjct  108  PVSLSLLINYCGKKVPKGFLC  128



>ref|XP_009384469.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=138

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLKF  C D L L++  IG PP   CCS+++G+A+ EAA CLCTA+KA+VLG   + IP
Sbjct  59   DTLKFAACSDVLKLINVEIGKPPKKPCCSLVEGLADDEAALCLCTALKANVLGA-NLNIP  117

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +++SL++N CGKKVP GF C
Sbjct  118  ISLSLLVNYCGKKVPEGFQC  137



>ref|XP_011070106.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=127

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC D LG L+   IG PP + CC++++G+A+LEAA CLCTAIKA++LG + + +
Sbjct  47   DTLKLGVCADLLGGLLGITIGTPPKTPCCTLIEGLADLEAAVCLCTAIKANILG-INLNV  105

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN C KKVP GFVC
Sbjct  106  PLSLSLLLNVCSKKVPKGFVC  126



>ref|XP_009795308.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=132

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + LG L+  VIG PP   CC++++GVA+LEAA CLCTAIKA++LG + + +
Sbjct  52   DTLKLGVCANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAVCLCTAIKANILG-INLNV  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGKKVP+GF C
Sbjct  111  PLSLSLLLNVCGKKVPSGFQC  131



>ref|XP_007155643.1| hypothetical protein PHAVU_003G219100g [Phaseolus vulgaris]
 ref|XP_007155644.1| hypothetical protein PHAVU_003G219200g [Phaseolus vulgaris]
 gb|ESW27637.1| hypothetical protein PHAVU_003G219100g [Phaseolus vulgaris]
 gb|ESW27638.1| hypothetical protein PHAVU_003G219200g [Phaseolus vulgaris]
Length=131

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            +TLKFGVC D LGL+   +G PP + CC++++G+A+LEAA CLCTA++A+VL G+ + +P
Sbjct  52   NTLKFGVCADVLGLIGVELGKPPKTPCCNLIQGLADLEAAVCLCTALRANVL-GINLNVP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + ++L+LN CGKK P  FVC
Sbjct  111  IKLNLLLNYCGKKTPKDFVC  130



>ref|XP_009388030.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=143

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK G+C + L GL++  +G PP   CCS+L+G+ +LEAA CLCTA+K +VLG LK+ I
Sbjct  63   DALKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLG-LKLNI  121

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL++N CGKKVP GF+C
Sbjct  122  PVSLSLLINYCGKKVPKGFLC  142



>gb|ADA67933.1| putative 14 kDa proline-rich protein DC2.15 [Wolffia arrhiza]
Length=135

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L GL++  +G PP + CC+++KG+A+LEAA CLCT +KA+VLG + + +
Sbjct  54   DTLKLGVCANLLNGLINIQLGTPPKTPCCNLIKGLADLEAALCLCTVLKANVLGLISLNL  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+ +SL++N CGK VP GF+C
Sbjct  114  PINLSLLVNYCGKSVPTGFIC  134



>ref|XP_008232586.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=139

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVCGD L  LVH V+G P  + CCS++ G+ +L+AA CLCTAIKA+VL G+ + +
Sbjct  59   DTLKLGVCGDLLNELVHLVVGTPRKTPCCSLIAGLGDLDAAICLCTAIKANVL-GVNLNV  117

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK VP  F C
Sbjct  118  PVSLSLLLNYCGKSVPTDFQC  138



>ref|XP_004298648.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=138

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK G C D L GLVH V+G PP   CCS+++G+ +L+AA CLCTAIKA+VL G+ + +
Sbjct  59   DTLKLGACADVLNGLVHLVVG-PPKFPCCSLIQGLVDLDAAVCLCTAIKANVL-GINLNV  116

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+G+ C
Sbjct  117  PVSLSLLLNYCGKKVPSGYEC  137



>ref|XP_008786990.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=127

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L GL++  +G PP   CCS++KG+A+LEAA CLCTA+KA++LG +K+ I
Sbjct  47   DTLKLGVCANVLNGLINLNLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILG-IKLNI  105

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV +SL++N CGKKVP GF C
Sbjct  106  PVDLSLLINYCGKKVPTGFQC  126



>emb|CDP18670.1| unnamed protein product [Coffea canephora]
Length=148

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +3

Query  213  LKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIPVA  392
            LK GVC + LGL+   IG+PP+  CCS+L+G+A+LEAA CLCTAI+A+VL G+ +  PV+
Sbjct  71   LKLGVCANVLGLIGVTIGSPPTLPCCSLLQGLADLEAAVCLCTAIRANVL-GINLNFPVS  129

Query  393  ISLVLNSCGKKVPNGFVC  446
            +SL+LN+ G+  PNGF+C
Sbjct  130  LSLILNNYGRNTPNGFIC  147



>gb|KDP28790.1| hypothetical protein JCGZ_14561 [Jatropha curcas]
Length=135

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  LVH V+G PP + CC +L+G+A+LEAA CLCTA+KA VL GL + +
Sbjct  55   DTLKLGVCANLLNDLVHLVLGTPPKTPCCPLLQGLADLEAAVCLCTALKASVL-GLNLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CG+ VP GF C
Sbjct  114  PISLSLLLNYCGQGVPAGFQC  134



>ref|XP_006417265.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
 gb|ESQ35618.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
Length=134

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   L G V  VIG PP + CCSVL+G+ +LEAA CLCTAIKA++LG + ++I
Sbjct  54   DALKLGVCAKILDGAVGTVIGNPPDTPCCSVLQGLVDLEAAVCLCTAIKANILG-INIDI  112

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N+CGKK+P+ F+C
Sbjct  113  PISLSLLINTCGKKLPSDFIC  133



>ref|XP_010258987.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Nelumbo nucifera]
Length=135

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + L LV   +G PP   CCS++K +A+LEAAACLCTAIKA VL G+ + +P
Sbjct  56   DALKLGVCANVLKLVSVSVGTPPYLPCCSLIKDLADLEAAACLCTAIKAKVL-GINLNVP  114

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V++SL+LN+CGKKVP GF C
Sbjct  115  VSLSLILNNCGKKVPTGFKC  134



>ref|NP_001148300.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG30459.1| cortical cell-delineating protein precursor [Zea mays]
 gb|AFW72687.1| cortical cell-delineating protein [Zea mays]
Length=128

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  210  TLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIPV  389
             LKF  C + LGLV   +G PP+  CCS+L G+A+LEAA CLCTAIKA+VL G+ ++IPV
Sbjct  50   ALKFAACANVLGLVSAEVGHPPAEPCCSILGGLADLEAAVCLCTAIKANVL-GITVDIPV  108

Query  390  AISLVLNSCGKKVPNGFVC  446
             +SL++N CGK +P+GF+C
Sbjct  109  KLSLIINYCGKNLPSGFIC  127



>ref|XP_004291445.1| PREDICTED: uncharacterized protein LOC101307558 [Fragaria vesca 
subsp. vesca]
Length=174

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC + LGLV+  IG+P +S CC++L+G+A+ EAA CLCTA+KA+VL G+ ++IP
Sbjct  95   DTLKLGVCANLLGLVNLQIGSPVTSPCCALLEGLADSEAAICLCTALKANVL-GINLDIP  153

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++++C K VP GF C
Sbjct  154  VALSLLVSACQKTVPPGFQC  173



>ref|XP_011001498.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=132

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   LG L++  +G PP   CCSV++G+ +LEAA CLCTAIKA++LG + + I
Sbjct  52   DALKLGVCAGLLGSLLNVTVGTPPVQPCCSVIQGLLDLEAAVCLCTAIKANILG-INLNI  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP GF C
Sbjct  111  PVSLSLLLNVCGKKVPKGFQC  131



>ref|XP_004501349.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=145

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPS-SECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D LGLV+ +IG PPS S+CC+++KG+ +LEAA CLCTA+KA+VL G+ + +
Sbjct  65   DALKLGVCADVLGLVNVIIGNPPSGSKCCALIKGLTDLEAALCLCTALKANVL-GINLNV  123

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+ +SLVL++C K VP+ F C
Sbjct  124  PITLSLVLSACQKTVPSDFQC  144



>ref|XP_008646032.1| PREDICTED: cortical cell-delineating protein-like [Zea mays]
 gb|AFW72681.1| cortical cell-delineating protein [Zea mays]
Length=126

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +GAPP+  CC +L+G+ +LEAAACLCTAIK ++L G+ + +P
Sbjct  48   DALKLGVCANVLGLIKAKVGAPPAEPCCPLLEGLVDLEAAACLCTAIKGNIL-GINLNLP  106

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CG+ VP GF C
Sbjct  107  VDLSLILNYCGRTVPTGFKC  126



>ref|XP_002446913.1| hypothetical protein SORBIDRAFT_06g024770 [Sorghum bicolor]
 gb|EES11241.1| hypothetical protein SORBIDRAFT_06g024770 [Sorghum bicolor]
Length=130

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +LKG+  LEAA CLCTAIK  +L G+ + +P
Sbjct  51   DALKLGVCANLLGLIKAKVGVPPTEPCCPLLKGLVNLEAAVCLCTAIKGSIL-GINLNLP  109

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK VP GF C
Sbjct  110  VDLSLILNHCGKTVPTGFKC  129



>gb|EMS62564.1| 14 kDa proline-rich protein DC2.15 [Triticum urartu]
Length=126

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            + LK   C D LGLV   +G PP+  CCS+L G+A+LEAA CLCTAIKA+VL G+ ++IP
Sbjct  47   NALKLAACADVLGLVLAQVGQPPAEPCCSILGGLADLEAAVCLCTAIKANVL-GISLDIP  105

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL++N CGK +P+GF+C
Sbjct  106  VKLSLLVNYCGKNLPSGFIC  125



>ref|XP_010493743.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   L G V  VIG PP + CCSVL+G+ +LEAA CLCTAIKA++LG + ++I
Sbjct  52   DALKLGVCAKILDGAVGTVIGNPPDAPCCSVLQGLVDLEAAVCLCTAIKANILG-INIDI  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N+CGKK+P+ F+C
Sbjct  111  PISLSLLINTCGKKLPSDFIC  131



>ref|XP_008232632.1| PREDICTED: lipid transfer protein EARLI 1-like [Prunus mume]
Length=175

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVCG+ L  LVH V+G P  + CCS++ G+++++A  CLCTAIKA+VL G+ + +
Sbjct  95   DTLKLGVCGNLLNDLVHLVVGTPSKTPCCSLIAGLSDVDATVCLCTAIKANVL-GINLNV  153

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK VP  F C
Sbjct  154  PVSLSLLLNYCGKSVPTDFQC  174



>ref|XP_008392581.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=137

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L GL++  IG PP   CCS+++G+A+LEAA CLCTAIKA++LG + + I
Sbjct  57   DTLKLGVCANVLNGLLNITIGKPPVEPCCSLIQGLADLEAAVCLCTAIKANILG-INLNI  115

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CG KVP GF C
Sbjct  116  PISLSLLLNVCGNKVPKGFQC  136



>ref|XP_006396750.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
 gb|ESQ38203.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
Length=135

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEV-IGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  + ++ +G PP   CCSVLKG+ +LEAAACLCTA+KA+VLG +K+ +
Sbjct  55   DTLKLGVCANVLKDLLKIDVGKPPVKPCCSVLKGLVDLEAAACLCTALKANVLG-IKLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CG+K P+GF+C
Sbjct  114  PISLSLLLNVCGRKTPSGFIC  134



>gb|KHG02760.1| 14 kDa proline-rich DC2 [Gossypium arboreum]
Length=132

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + L LV+  +G+PP   CCS+L G+ +LEAAACLCTAI+A++L G+ + IP
Sbjct  54   DALKLGVCANVLNLVNVTVGSPPVMPCCSLLNGLVDLEAAACLCTAIRANIL-GINLNIP  112

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V++SL+LN C + VP GF C
Sbjct  113  VSLSLLLNVCSRNVPTGFQC  132



>ref|XP_006652622.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Oryza brachyantha]
Length=124

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L G+ +LEAAACLCTAI+ +VL G+ + +P
Sbjct  45   DALKLGVCANVLGLIKAKVGVPPAEPCCPLLDGLVDLEAAACLCTAIRGNVL-GINLNLP  103

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK+VP GF C
Sbjct  104  VDLSLILNYCGKRVPTGFKC  123



>ref|XP_004138721.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 ref|XP_004170531.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN62964.1| proline-rich protein DC2.15 [Cucumis sativus]
Length=145

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LG+   VIG+P S+ CC++L G+ ++EAAACLCTAIKA+VL G+ + IP
Sbjct  66   DTLKLGVCADILGIGSTVIGSPVSNNCCALLSGLTDVEAAACLCTAIKANVL-GINLNIP  124

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V+ISL+++SC K +P+G+ C
Sbjct  125  VSISLLISSCQKTLPDGYQC  144



>ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa]
 gb|ERP65601.1| HyPRP family protein [Populus trichocarpa]
Length=132

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D LG L++  +G PP   CCS+++G+ +LEAA CLCTAIKA++LG + + I
Sbjct  52   DALKLGVCADLLGSLLNVTVGTPPVEPCCSLIQGLLDLEAAVCLCTAIKANILG-INLNI  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP  F C
Sbjct  111  PVSLSLLLNVCGKKVPKDFQC  131



>ref|XP_009589966.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum]
Length=130

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + LG L+  VIG PP   CC++++GVA+LEAA CLCTAIKA++LG + + +
Sbjct  50   DTLKLGVCANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAICLCTAIKANILG-INLNV  108

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGK+VP+GF C
Sbjct  109  PLSLSLLLNVCGKQVPSGFQC  129



>ref|XP_010433369.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+   +G PP   CCS+L G+ +LEAAACLCTA+KA+VLG +K+ +
Sbjct  55   DTLKLGVCANVLKDLLKIELGKPPVKPCCSLLNGLVDLEAAACLCTALKANVLG-IKLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GFVC
Sbjct  114  PVSLSLLLNVCGKKVPSGFVC  134



>ref|XP_007209690.1| hypothetical protein PRUPE_ppa012402mg [Prunus persica]
 gb|EMJ10889.1| hypothetical protein PRUPE_ppa012402mg [Prunus persica]
Length=171

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK G C D L GLVH V+G PP   CCS+++G+ +L+AA CLCTAIKA+VL G+ + I
Sbjct  92   DTLKLGACADLLNGLVHLVVG-PPKFPCCSLIEGLVDLDAAVCLCTAIKANVL-GIHLNI  149

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK+VP+G+ C
Sbjct  150  PVSLSLLLNYCGKQVPSGYEC  170



>ref|XP_010055513.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=132

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   L G V+ +IG PP   CCSVL+G+ +LEAA CLCTAIKA++L G+ + I
Sbjct  52   DALKLGVCAKVLDGPVNAIIGTPPDMPCCSVLEGLLDLEAAVCLCTAIKANIL-GINLNI  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N+CGK VP+GF C
Sbjct  111  PISLSLLINTCGKNVPSGFQC  131



>ref|XP_009795760.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Nicotiana sylvestris]
Length=158

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   +G LV  VIG PP+  CCS++ G+A+LEAA CLCTAI+A+VLG + + +
Sbjct  79   DALKLGVCASLVGGLVGAVIGTPPTMPCCSLITGLADLEAAVCLCTAIRANVLG-INLNV  137

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SLVLN+CG+  PNGF C
Sbjct  138  PLSLSLVLNNCGRNPPNGFTC  158



>ref|XP_009795761.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Nicotiana sylvestris]
Length=146

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   +G LV  VIG PP+  CCS++ G+A+LEAA CLCTAI+A+VLG + + +
Sbjct  67   DALKLGVCASLVGGLVGAVIGTPPTMPCCSLITGLADLEAAVCLCTAIRANVLG-INLNV  125

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SLVLN+CG+  PNGF C
Sbjct  126  PLSLSLVLNNCGRNPPNGFTC  146



>ref|NP_001152585.1| LOC100286225 precursor [Zea mays]
 gb|ACG48364.1| cortical cell-delineating protein precursor [Zea mays]
Length=125

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +GAPP+  CC +L+G+ +LEAAACLCTAIK ++L G+ + +P
Sbjct  47   DALKLGVCANVLGLIKAKVGAPPAEPCCPLLEGLVDLEAAACLCTAIKGNIL-GINLNLP  105

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CG+ VP GF C
Sbjct  106  VDLSLILNYCGRTVPXGFKC  125



>ref|NP_001053512.1| Os04g0554600 [Oryza sativa Japonica Group]
 emb|CAD41235.2| OSJNBa0010H02.23 [Oryza sativa Japonica Group]
 dbj|BAF15426.1| Os04g0554600 [Oryza sativa Japonica Group]
 gb|EAZ31583.1| hypothetical protein OsJ_15725 [Oryza sativa Japonica Group]
Length=131

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L+G+ +LEAA CLCTAIK ++L G+ + +P
Sbjct  52   DALKLGVCANVLGLIKAKVGVPPAEPCCPLLEGLVDLEAAVCLCTAIKGNIL-GINLNLP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK+VP GF C
Sbjct  111  VDLSLILNYCGKRVPTGFKC  130



>ref|XP_008445235.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Cucumis melo]
Length=145

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC D LG+   VIG+P S+ECC++L G+ ++EAAACLCTAIKA+VL G+ ++IP
Sbjct  66   DTLKLGVCADILGIGSVVIGSPVSNECCALLSGLTDVEAAACLCTAIKANVL-GINLDIP  124

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V++SL+++SC K +P G+ C
Sbjct  125  VSLSLLISSCQKTLPAGYQC  144



>ref|XP_008378389.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=133

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK G C D LGLV+  IG PP+S CC++L+G+A+LEAA CLCT  KA+  G + +E+P
Sbjct  53   DTLKLGACVDLLGLVNLKIGTPPTSGCCALLEGLADLEAAICLCTVTKANAQGLVNLEVP  112

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++++C K VP GF C
Sbjct  113  VALSLLVSACQKTVPPGFEC  132



>ref|XP_004976456.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=129

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   IG PP+  CC +L+G+ +L+AA CLCTAIK ++L G+ + +P
Sbjct  50   DALKLGVCANVLGLIKAKIGVPPTEPCCPLLEGLVDLQAAVCLCTAIKGNIL-GINLNLP  108

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GF C
Sbjct  109  IDVSLILNHCGKTVPTGFKC  128



>ref|XP_003572782.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brachypodium 
distachyon]
Length=123

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            + LK   C D LGLV   +G PP+  CCS+L G+A+LEAA CLCTAIKA+VL G+ ++IP
Sbjct  44   NALKLAACADVLGLVSAEVGHPPAEPCCSILGGLADLEAAVCLCTAIKANVL-GISLDIP  102

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL++N CGK +P+GF+C
Sbjct  103  VKLSLLVNYCGKSLPSGFIC  122



>ref|XP_008238562.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=142

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK G C D L GLVH V+G PP   CCS+++G+ +L+AA CLCTAIKA+VL G+ + I
Sbjct  63   DTLKLGACADLLNGLVHLVVG-PPKFPCCSLIEGLVDLDAAVCLCTAIKANVL-GIHLNI  120

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK+VP+G+ C
Sbjct  121  PVSLSLLLNYCGKQVPSGYEC  141



>ref|XP_004291440.1| PREDICTED: putative lipid-binding protein At4g00165-like [Fragaria 
vesca subsp. vesca]
Length=164

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK GVC + LGLV+  IG+P +S CC++L+G+A+ EAA CLCTA+KA+VL G+ +++P
Sbjct  85   DTLKLGVCANLLGLVNLQIGSPATSPCCALLEGLADSEAALCLCTALKANVL-GVNLDVP  143

Query  387  VAISLVLNSCGKKVPNGFVC  446
            +A+SL++++C K VP GF C
Sbjct  144  IALSLLVSACEKTVPPGFQC  163



>ref|XP_006289733.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
 gb|EOA22631.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
Length=135

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+   +G PP   CCS++KG+ +LEAAACLCTAIKA+VLG + + +
Sbjct  55   DTLKLGVCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLG-INLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGKKVP+GFVC
Sbjct  114  PISLSLLLNVCGKKVPSGFVC  134



>ref|NP_001053511.1| Os04g0554500 [Oryza sativa Japonica Group]
 emb|CAE01698.2| OSJNBa0010H02.22 [Oryza sativa Japonica Group]
 gb|AAR30140.1| lipid transfer protein-like protein [Oryza sativa Japonica Group]
 dbj|BAF15425.1| Os04g0554500 [Oryza sativa Japonica Group]
 gb|EAY95109.1| hypothetical protein OsI_16926 [Oryza sativa Indica Group]
Length=130

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L+G+ +LEAA CLCTAI+ ++L G+ + +P
Sbjct  52   DALKLGVCANVLGLIKAKVGVPPAEPCCPLLEGLVDLEAAVCLCTAIRGNIL-GINLNLP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK+VP GF C
Sbjct  111  VDLSLILNYCGKRVPTGFKC  130



>ref|XP_008786991.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            +TLK GVC D L  +   IG PP   CC++L+G+ +LEAA CLCTA+KA++L G+K+ IP
Sbjct  47   NTLKLGVCADVLKALIVNIGKPPKKPCCTLLEGLVDLEAAVCLCTALKANIL-GIKLNIP  105

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGKKVP GF C
Sbjct  106  VDLSLLLNYCGKKVPKGFQC  125



>ref|XP_010695114.1| PREDICTED: lipid transfer protein EARLI 1-like [Beta vulgaris 
subsp. vulgaris]
Length=172

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK G C + LG L+  VIG PP S CCS+L+G+ +L AA CLCTAIKA+VL G+ + +
Sbjct  92   DVLKLGACANVLGNLLGLVIGTPPQSSCCSLLQGLTDLNAAVCLCTAIKANVL-GINLNV  150

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN+CGK  P+GF C
Sbjct  151  PVSLSLLLNNCGKGAPSGFQC  171



>gb|ABG91752.1| HyPRP2 [Gossypium hirsutum]
Length=137

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D LG L++  IG PP   CCS+++G+A+LEAA CLCTAIKA++LG + + +
Sbjct  57   DALKLGVCADLLGGLLNVTIGTPPVQPCCSLIQGLADLEAAVCLCTAIKANILG-INLNV  115

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN C KKVP+GF C
Sbjct  116  PLSLSLLLNVCSKKVPSGFQC  136



>gb|EAY95110.1| hypothetical protein OsI_16927 [Oryza sativa Indica Group]
Length=131

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L+G+ +LEAA CLCTAI+ ++L G+ + +P
Sbjct  52   DALKLGVCANVLGLIKAKVGVPPAEPCCPLLEGLVDLEAAVCLCTAIRGNIL-GINLNLP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            V +SL+LN CGK+VP GF C
Sbjct  111  VDLSLILNYCGKRVPTGFKC  130



>ref|XP_010919519.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=143

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L GL++  +G PP   CCS++KG+A+LEAA CLCTA+KA++LG   + I
Sbjct  63   DTLKLGVCANVLNGLINLTLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILGA-NLNI  121

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+ +SL++N CGKKVP GF C
Sbjct  122  PIDLSLLINYCGKKVPTGFQC  142



>ref|XP_011018291.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=131

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   L G +  V+G+PP + CC+VL+G+ +LEAA CLCTAIKA++LG + ++I
Sbjct  51   DALKLGVCAKLLNGAIGGVVGSPPDTPCCTVLQGLVDLEAAVCLCTAIKANILG-INIDI  109

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N+CGKK+P+ F+C
Sbjct  110  PISLSLLINTCGKKLPSDFIC  130



>ref|XP_009796139.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC + LG LV  VIG PP+  CCS++ G+A+LEAA CLCTAI+A+VL G+ + +
Sbjct  79   DALKLGVCANLLGGLVGAVIGTPPTMPCCSLIAGLADLEAAVCLCTAIRANVL-GINLNV  137

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SLVLN+CG+  P GF C
Sbjct  138  PLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_009795762.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=149

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D L FGVC + +G LV  VIG+PP+  CCS++ G+A+LEAA CLCTAI+A+VL GL + +
Sbjct  70   DALMFGVCANLVGGLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVL-GLNLNV  128

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SLVLN+CG+  P GF C
Sbjct  129  PLSLSLVLNNCGRSPPTGFTC  149



>ref|XP_010093708.1| hypothetical protein L484_019049 [Morus notabilis]
 gb|EXB54488.1| hypothetical protein L484_019049 [Morus notabilis]
Length=129

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            +TLK GVC + L  LVH V+G PP   CCS++ G+A+LEAA CLCTA+KA+VLG + + I
Sbjct  48   NTLKLGVCANVLDDLVHLVVGVPPKEPCCSLINGLADLEAAVCLCTALKANVLGVVNLNI  107

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+ +SL+LN CG  VP+GF C
Sbjct  108  PIQLSLLLNYCGTGVPSGFQC  128



>ref|XP_010053450.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW77748.1| hypothetical protein EUGRSUZ_D02042 [Eucalyptus grandis]
Length=121

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            + LK GVC D LG LV+  +G PP   CCS+++G+A+LEAA CLCTAI+ADVL GL +++
Sbjct  41   NALKLGVCLDLLGSLVNVTVGTPPKEPCCSLIQGLADLEAAVCLCTAIRADVL-GLHLDV  99

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN C KKVP GF C
Sbjct  100  PLSLSLLLNVCSKKVPPGFQC  120



>ref|XP_010433379.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+   +G PP   CCS+L G+ +LEAAACLCTA+KA+V+G +K+ +
Sbjct  55   DTLKLGVCANLLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVIG-IKLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CG+KVP+GFVC
Sbjct  114  PVSLSLLLNVCGRKVPSGFVC  134



>ref|XP_010919520.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=140

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LKFGVC + L GL++  +G PP   CCS+L+G+A+LEAA CLCTAIKA++LG   + +
Sbjct  60   DALKFGVCANVLQGLINVQLGNPPKKPCCSLLEGLADLEAAVCLCTAIKANILGT-NLNV  118

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV +SL+LN CGKKVP G+ C
Sbjct  119  PVDLSLLLNYCGKKVPAGYKC  139



>ref|XP_009346182.1| PREDICTED: putative lipid-binding protein AIR1 [Pyrus x bretschneideri]
Length=128

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            DTLK G C D LGL++   G+PP+S CC++L+G+ +LEAA CLCT IKA+  G + +E+P
Sbjct  48   DTLKLGACVDLLGLINLQNGSPPTSGCCALLEGLTDLEAAICLCTVIKANAAGLVNLEVP  107

Query  387  VAISLVLNSCGKKVPNGFVC  446
            VA+SL++++C K VP GF C
Sbjct  108  VALSLLVSACQKTVPPGFKC  127



>ref|XP_006306558.1| hypothetical protein CARUB_v10012658mg [Capsella rubella]
 gb|EOA39456.1| hypothetical protein CARUB_v10012658mg [Capsella rubella]
Length=132

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D L+ GVC   L G V  VIG PP + CCSVLKG+ +LEAA CLCTAIKA+VL G+ ++I
Sbjct  52   DALQLGVCAKILDGAVGTVIGNPPDTPCCSVLKGLVDLEAAVCLCTAIKANVL-GINIDI  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N+CGK +P+ F+C
Sbjct  111  PISLSLLINTCGKTLPSNFIC  131



>ref|XP_002874778.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51037.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+   +G PP   CCS+LKG+ +LEAAACLCTA+KA+VLG  K+ +
Sbjct  49   DTLKLGVCANVLKDLLKIQLGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGT-KLNV  107

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CG+KVP+ FVC
Sbjct  108  PVSLSLLLNVCGRKVPSKFVC  128



>ref|XP_008437103.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=138

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   LG LV   IG PP + CC+++KG+A+LEAAACLCTAIKA VLG  K++I
Sbjct  59   DALKIGVCAKLLGGLVDITIGKPPVTPCCTLVKGLADLEAAACLCTAIKASVLGN-KIKI  117

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV +SL+LN C KK+PNGF C
Sbjct  118  PVHLSLLLNVCNKKLPNGFQC  138



>emb|CDY21275.1| BnaC03g29590D [Brassica napus]
Length=135

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
             TLK GVC + L  L+   +G+PP   CCS+LKG+ +LEAAACLCTA+KA+VLG +K+ +
Sbjct  55   KTLKLGVCANVLKDLLKIELGSPPVKPCCSLLKGLVDLEAAACLCTALKANVLG-IKLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN+CG+K P GF+C
Sbjct  114  PVSLSLLLNACGRKTPRGFIC  134



>ref|XP_008232631.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=146

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVCGD L  LVH V+G    + CCS++ G+A+++AA CLCTAIKA+VLG + + +
Sbjct  66   DTLKLGVCGDLLNDLVHVVVGTSQKTPCCSLITGLADVDAAVCLCTAIKANVLG-VNLNV  124

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK VP  F C
Sbjct  125  PVSLSLLLNYCGKSVPTNFQC  145



>ref|XP_006368193.1| hypothetical protein POPTR_0001s00400g [Populus trichocarpa]
 gb|ERP64762.1| hypothetical protein POPTR_0001s00400g [Populus trichocarpa]
Length=128

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   L G +  V+G+PP + CC+VL+G+ +LEAA CLCTAIKA++LG + ++I
Sbjct  48   DALKLGVCAKLLNGAIGGVVGSPPDTPCCTVLQGLVDLEAAVCLCTAIKANILG-INIDI  106

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N+CGKK+P+ F+C
Sbjct  107  PISLSLLINTCGKKLPSDFIC  127



>ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa]
 gb|ABK92650.1| unknown [Populus trichocarpa]
 gb|ERP64763.1| HyPRP family protein [Populus trichocarpa]
Length=140

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D LG L++  IG+PP   CCSV++G+ +LEAA CLCTAIKA++LG + + I
Sbjct  60   DALKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAICLCTAIKANILG-INLNI  118

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N CGKKVP  F C
Sbjct  119  PISLSLLINVCGKKVPKDFQC  139



>emb|CDY61290.1| BnaCnng37610D [Brassica napus]
Length=135

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
             TLK GVC + L  L+   +G+PP   CCS+LKG+ ++EAAACLCTA+KA+VLG +K+ +
Sbjct  55   KTLKLGVCANVLKDLLKIELGSPPVKPCCSLLKGLVDIEAAACLCTALKANVLG-IKLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN+CG+K P GF+C
Sbjct  114  PVSLSLLLNACGRKTPRGFIC  134



>emb|CDY21034.1| BnaA08g24910D [Brassica napus]
Length=134

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   L G V  VIG PP + CCS L+G+ +LEAA CLCTAIKA++LG + ++I
Sbjct  54   DALKLGVCAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILG-IDIDI  112

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N+CGKK+P+ F+C
Sbjct  113  PISLSLLINTCGKKLPSDFIC  133



>ref|XP_009373377.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009373378.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009346904.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=140

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 3/81 (4%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK G C D L GLVH V+G PP   CCS+++G+ +L+AA CLCTAIKA+V+ G+ + I
Sbjct  61   DTLKLGACADVLNGLVHLVVG-PPKFPCCSLIEGLVDLDAAVCLCTAIKANVM-GINLNI  118

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGK+VP G+ C
Sbjct  119  PISLSLLLNYCGKQVPTGYEC  139



>gb|EYU30301.1| hypothetical protein MIMGU_mgv1a018370mg [Erythranthe guttata]
Length=119

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC D L GL++  +G PP + CCS+++G+ +LEAA CLCTAIKA+VL G+ +++
Sbjct  39   DTLKLGVCADLLNGLLNVTVGTPPKTPCCSLIEGLVDLEAAVCLCTAIKANVL-GINIDV  97

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P++++L+LN C K VP  FVC
Sbjct  98   PISLTLLLNVCTKSVPKDFVC  118



>ref|XP_009110670.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
Length=134

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   L G V  VIG PP + CCS L+G+ +LEAA CLCTAIKA++LG + ++I
Sbjct  54   DALKLGVCAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILG-IDIDI  112

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N+CGKK+P+ F+C
Sbjct  113  PISLSLLINTCGKKLPSDFIC  133



>ref|XP_004976454.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=127

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L+G+ +LEAA CLCTAIK ++L G+ + +P
Sbjct  48   DALKLGVCANVLGLIKAKVGVPPTEPCCPLLEGLVDLEAAVCLCTAIKGNIL-GINLNLP  106

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GF C
Sbjct  107  IDVSLILNHCGKTVPTGFKC  126



>ref|XP_010695113.1| PREDICTED: lipid transfer protein EARLI 1-like [Beta vulgaris 
subsp. vulgaris]
Length=185

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK G C + LG L+  VIG PP S CCS+L+G+ +L AA CLCTAIKA+VL G+ + +
Sbjct  105  DVLKLGACANVLGNLLGLVIGTPPQSSCCSLLQGLTDLNAAVCLCTAIKANVL-GINLNV  163

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN+CGK  P+GF C
Sbjct  164  PISLSLLLNNCGKGAPSGFQC  184



>ref|XP_009134274.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
Length=133

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
             TLK GVC + L  L+   +G PP   CCS+LKG+ +LEAAACLCTA+KA+VLG +K+ +
Sbjct  53   KTLKLGVCANVLKDLLKIELGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLG-IKLNV  111

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN+CG+K P GF+C
Sbjct  112  PVSLSLLLNACGRKTPRGFIC  132



>emb|CDX90834.1| BnaA03g25140D [Brassica napus]
Length=133

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
             TLK GVC + L  L+   +G+PP   CCS+LKG+ +LEAAACLCTA+KA+VLG +K+ +
Sbjct  53   KTLKLGVCANVLKDLLKIELGSPPVKPCCSLLKGLVDLEAAACLCTALKANVLG-VKLNV  111

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN+CG+K P GF+C
Sbjct  112  PVSLSLLLNACGRKTPRGFIC  132



>ref|XP_002446914.1| hypothetical protein SORBIDRAFT_06g024780 [Sorghum bicolor]
 gb|EES11242.1| hypothetical protein SORBIDRAFT_06g024780 [Sorghum bicolor]
Length=129

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L+G+ +LEAA CLCTAIK ++L G+ + +P
Sbjct  50   DALKLGVCANVLGLIKAKVGVPPTEPCCPLLEGLVDLEAALCLCTAIKGNIL-GINLNLP  108

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GF C
Sbjct  109  IDLSLILNHCGKSVPTGFKC  128



>ref|XP_002446915.1| hypothetical protein SORBIDRAFT_06g024790 [Sorghum bicolor]
 gb|EES11243.1| hypothetical protein SORBIDRAFT_06g024790 [Sorghum bicolor]
Length=132

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L+G+ +LEAA CLCTAIK ++L G+ + +P
Sbjct  53   DALKLGVCANVLGLIKAKVGVPPTEPCCPLLEGLVDLEAALCLCTAIKGNIL-GINLNLP  111

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GF C
Sbjct  112  IDLSLILNHCGKSVPTGFKC  131



>dbj|BAA11854.1| extensin like protein [Populus nigra]
 dbj|BAA11855.1| extensin like protein [Populus nigra]
Length=141

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D LG L++  +G PP   CCSV++G+ +LEAA CLCTAIKA++LG + + I
Sbjct  61   DALKLGVCADLLGSLLNVTVGTPPVKPCCSVIQGLLDLEAAVCLCTAIKANILG-INLNI  119

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGKKVP  F C
Sbjct  120  PLSLSLLLNVCGKKVPKDFQC  140



>ref|XP_009346906.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Pyrus x bretschneideri]
Length=140

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 3/81 (4%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC D L GLVH V+G PP   CCS+++G+ +L+AA CLCTAIKA+VL G+ + +
Sbjct  61   DTLKLGVCADVLNGLVHLVVG-PPKFPCCSLIEGLVDLDAAVCLCTAIKANVL-GIHLNV  118

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK+ P G+ C
Sbjct  119  PVSLSLLLNYCGKQAPTGYEC  139



>ref|XP_011018292.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=140

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC D LG L++  IG+PP   CCSV++G+ +LEAA CLCTAIKA++L G+ + I
Sbjct  60   DALKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAVCLCTAIKANIL-GINLNI  118

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N CGKKVP  F C
Sbjct  119  PLSLSLLVNVCGKKVPKDFQC  139



>gb|KGN50240.1| hypothetical protein Csa_5G161890 [Cucumis sativus]
Length=136

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC   LG LV   IG PP + CC+++KG+A+LEAA CLCTAIKA VLG  K++I
Sbjct  57   DTLKIGVCAKLLGGLVDLTIGKPPVTPCCTLVKGLADLEAAVCLCTAIKASVLGN-KIKI  115

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+ +SL+LN C K +PNGF C
Sbjct  116  PLHLSLLLNVCNKNLPNGFQC  136



>gb|KHN04353.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=132

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGV-CGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            +T+KF V C D LGL++  +G PP + CC++++G+A+LEAA CLCTA+KA+VL G+ + +
Sbjct  52   ETIKFSVVCADVLGLINVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVL-GINLNV  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV +SL+LN CGK VP GFVC
Sbjct  111  PVNLSLLLNYCGKGVPKGFVC  131



>ref|XP_009346905.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Pyrus x bretschneideri]
Length=142

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 3/81 (4%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC D L GLVH V+G PP   CCS+++G+ +L+AA CLCTAIKA+VL G+ + +
Sbjct  63   DTLKLGVCADVLNGLVHLVVG-PPKFPCCSLIEGLVDLDAAVCLCTAIKANVL-GIHLNV  120

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGK+ P G+ C
Sbjct  121  PVSLSLLLNYCGKQAPTGYEC  141



>ref|XP_010493734.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   L G V  VIG PP + CCSVL+G+ +LEAA CLCTAIKA++L G+ ++I
Sbjct  52   DALKLGVCAKILDGAVGTVIGNPPDTPCCSVLQGLVDLEAAVCLCTAIKANIL-GINIDI  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++++CGKK+P+ F+C
Sbjct  111  PISLSLLISTCGKKLPSDFIC  131



>emb|CDY31241.1| BnaC08g15360D [Brassica napus]
Length=132

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC   L G V  VIG PP + CCS L+G+ +LEAA CLCTAIKA++LG + + I
Sbjct  52   DALKLGVCAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILG-IDINI  110

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL++N+CGKK+P+ F+C
Sbjct  111  PISLSLLINTCGKKLPSDFIC  131



>ref|XP_010422224.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+   +G PP   CCS+L G+ +LEAAACLCTA+KA+VLG + + +
Sbjct  55   DTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLG-INLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGKKVP+GFVC
Sbjct  114  PISLSLLLNVCGKKVPSGFVC  134



>ref|NP_567391.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_567392.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 emb|CAB41721.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB41722.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78294.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78295.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AAO23622.1| At4g12520 [Arabidopsis thaliana]
 dbj|BAE99415.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AEE83141.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE83142.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=129

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+   +G PP   CCS+L G+ +LEAAACLCTA+KA VLG + + +
Sbjct  49   DTLKLGVCANVLKDLLKIQLGTPPVKPCCSLLNGLVDLEAAACLCTALKAKVLG-INLNV  107

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN CGKKVP+GFVC
Sbjct  108  PVSLSLLLNVCGKKVPSGFVC  128



>ref|XP_010455699.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
 ref|XP_010455700.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+   +G PP   CCS+L G+ +LEAAACLCTA+KA+VLG + + +
Sbjct  55   DTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLG-INLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGKKVP+GFVC
Sbjct  114  PISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010455698.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+   +G PP   CCS+L G+ +LEAAACLCTA+KA+VLG + + +
Sbjct  55   DTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLG-INLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGKKVP+GFVC
Sbjct  114  PISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010422222.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X1 [Camelina 
sativa]
Length=135

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWL-GLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC + L  L+   +G PP   CCS+L G+ +LEAAACLCTA+KA+VLG + + +
Sbjct  55   DTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLG-INLNV  113

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SL+LN CGKKVP+GFVC
Sbjct  114  PISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010695178.1| PREDICTED: pEARLI1-like lipid transfer protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK G C + LG L+  VIG PP S CCS+L+G+ +L AA CLCTAIKA++L G+ + +
Sbjct  144  DVLKLGACANVLGNLLGLVIGTPPQSSCCSLLQGLTDLNAAVCLCTAIKANIL-GINLNV  202

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN+CGK  P+GF C
Sbjct  203  PVSLSLLLNNCGKGAPSGFQC  223



>ref|XP_009796138.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
 ref|XP_009796140.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=152

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            D LK GVC + +G LV  VIG+PP+  CCS++ G+A+LEAA CLCTAI+A+VL G+ + +
Sbjct  73   DALKLGVCANLVGGLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVL-GINLNV  131

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            P+++SLVLN+CG+  P GF C
Sbjct  132  PLSLSLVLNNCGRNPPTGFTC  152



>ref|XP_004976453.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=131

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  207  DTLKFGVCGDWLGLVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEIP  386
            D LK GVC + LGL+   +G PP+  CC +L+G+ +L+AA CLCTAIK ++L G+ + +P
Sbjct  52   DALKLGVCTNVLGLIKAKVGVPPTEPCCPLLEGLVDLQAAVCLCTAIKGNIL-GINLNLP  110

Query  387  VAISLVLNSCGKKVPNGFVC  446
            + +SL+LN CGK VP GF C
Sbjct  111  IDVSLILNHCGKTVPTGFKC  130



>ref|XP_008437101.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=140

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  207  DTLKFGVCGDWLG-LVHEVIGAPPSSECCSVLKGVaeleaaaclcTAIKADVLGGLKMEI  383
            DTLK GVC   LG LV   IG PP + CCS+++G+A+LEAA CLCTAIKA++L GL + I
Sbjct  61   DTLKLGVCAKLLGGLVDVTIGKPPVTPCCSLIEGLADLEAAVCLCTAIKANLL-GLNLNI  119

Query  384  PVAISLVLNSCGKKVPNGFVC  446
            PV++SL+LN C K VP GF C
Sbjct  120  PVSLSLLLNVCQKNVPKGFQC  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672942001784