BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c37384_g1_i1 len=772 path=[750:0-771]

Length=772
                                                                      Score     E

gb|ADD51186.1|  tumor-related protein                                   217   1e-66   Vitis cinerea var. helleri x Vitis riparia
emb|CAN81015.1|  hypothetical protein VITISV_025776                     214   1e-65   Vitis vinifera
emb|CAN65022.1|  hypothetical protein VITISV_027379                     208   3e-63   Vitis vinifera
emb|CBI35464.3|  unnamed protein product                                207   2e-62   
emb|CAN75396.1|  hypothetical protein VITISV_028636                     206   4e-62   Vitis vinifera
ref|XP_002266430.1|  PREDICTED: miraculin                               204   1e-61   Vitis vinifera
ref|XP_002270111.1|  PREDICTED: miraculin                               204   2e-61   Vitis vinifera
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...    202   4e-61   
gb|ADK62529.1|  miraculin-like protein                                  202   1e-60   
ref|XP_009792285.1|  PREDICTED: miraculin                               199   1e-59   
gb|AAC49969.1|  tumor-related protein                                   199   2e-59   Nicotiana tabacum [American tobacco]
ref|XP_002266302.2|  PREDICTED: miraculin-like                          197   2e-59   Vitis vinifera
ref|XP_009627067.1|  PREDICTED: miraculin                               195   6e-58   
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg             190   4e-56   
ref|XP_010663911.1|  PREDICTED: miraculin-like                          189   7e-56   
ref|XP_004235409.1|  PREDICTED: miraculin-like                          185   4e-54   
ref|XP_002265965.1|  PREDICTED: miraculin                               185   4e-54   Vitis vinifera
ref|XP_009614755.1|  PREDICTED: miraculin-like                          185   5e-54   
ref|XP_009782174.1|  PREDICTED: miraculin-like                          184   6e-54   
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...    183   2e-53   
ref|XP_008238584.1|  PREDICTED: miraculin-like                          183   2e-53   
ref|XP_004234331.1|  PREDICTED: miraculin                               183   3e-53   
emb|CBI35471.3|  unnamed protein product                                197   3e-53   
gb|AAQ96377.1|  miraculin-like protein                                  182   4e-53   Solanum palustre
ref|XP_006353931.1|  PREDICTED: miraculin-like                          182   4e-53   
ref|XP_011072079.1|  PREDICTED: miraculin                               182   5e-53   
ref|XP_006351546.1|  PREDICTED: miraculin-like                          181   2e-52   
emb|CAN63617.1|  hypothetical protein VITISV_041430                     179   1e-51   Vitis vinifera
ref|XP_010537532.1|  PREDICTED: miraculin                               178   1e-51   
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg                178   3e-51   
ref|XP_009782173.1|  PREDICTED: miraculin-like                          176   4e-50   
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg             174   5e-50   
ref|XP_010101167.1|  hypothetical protein L484_005403                   173   1e-49   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg             172   5e-49   
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg             171   9e-49   
ref|XP_009614754.1|  PREDICTED: miraculin-like                          172   1e-48   
ref|XP_006495064.1|  PREDICTED: miraculin-like                          171   1e-48   
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg             171   1e-48   
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg             172   2e-48   
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg             170   2e-48   
ref|XP_008778295.1|  PREDICTED: miraculin                               169   3e-48   
ref|XP_006495063.1|  PREDICTED: miraculin-like                          169   3e-48   
dbj|BAA82843.1|  miraculin homologue                                    168   3e-48   Solanum melongena [aubergine]
ref|XP_010279489.1|  PREDICTED: miraculin-like                          169   4e-48   
ref|XP_006493430.1|  PREDICTED: miraculin-like                          169   5e-48   
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg             169   8e-48   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg             168   1e-47   
ref|XP_009401850.1|  PREDICTED: miraculin-like                          167   3e-47   
ref|XP_006493432.1|  PREDICTED: miraculin-like                          171   3e-47   
emb|CDP20822.1|  unnamed protein product                                166   8e-47   
gb|AFL91227.1|  Kunitz-like protease inhibitor                          165   8e-47   
gb|AFL91226.1|  Kunitz-like protease inhibitor                          165   8e-47   
ref|XP_006493433.1|  PREDICTED: miraculin-like                          166   1e-46   
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg             166   1e-46   
gb|AFL91233.1|  Kunitz-like protease inhibitor                          164   1e-46   
gb|AFL91231.1|  Kunitz-like protease inhibitor                          164   2e-46   
gb|AFL91232.1|  Kunitz-like protease inhibitor                          163   4e-46   
ref|XP_009110379.1|  PREDICTED: miraculin-like                          163   8e-46   
ref|XP_009782172.1|  PREDICTED: miraculin-like                          164   2e-45   
gb|AFL91228.1|  Kunitz-like protease inhibitor                          161   3e-45   
ref|XP_006372633.1|  hypothetical protein POPTR_0017s03430g             162   3e-45   
gb|AFL91234.1|  Kunitz-like protease inhibitor                          159   9e-45   
dbj|BAA05474.1|  tumor-related protein                                  158   1e-44   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_010279465.1|  PREDICTED: miraculin-like                          160   1e-44   
ref|XP_006372654.1|  hypothetical protein POPTR_0017s03600g             160   1e-44   
ref|XP_010918417.1|  PREDICTED: miraculin-like                          160   2e-44   
emb|CDX83886.1|  BnaC08g17590D                                          160   2e-44   
ref|XP_006372632.1|  hypothetical protein POPTR_0017s03420g             160   2e-44   
emb|CDX96746.1|  BnaA08g22890D                                          159   3e-44   
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg             159   3e-44   
ref|XP_006441460.1|  hypothetical protein CICLE_v10024584mg             157   5e-44   
gb|AFL91229.1|  Kunitz-like protease inhibitor                          157   6e-44   
ref|XP_006495061.1|  PREDICTED: miraculin-like                          157   1e-43   
gb|ACS92516.1|  Kunitz-type protease inhibitor KPI-D12                  157   2e-43   Populus trichocarpa x Populus deltoides
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                        156   5e-43   
ref|NP_173228.1|  kunitz family trypsin and protease inhibitor pr...    155   7e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDO98552.1|  unnamed protein product                                155   8e-43   
gb|AFL91230.1|  Kunitz-like protease inhibitor                          154   9e-43   
ref|XP_011046091.1|  PREDICTED: miraculin-like                          155   9e-43   
ref|XP_010279488.1|  PREDICTED: miraculin-like                          155   1e-42   
dbj|BAA82840.1|  miraculin homologue                                    153   1e-42   Youngia japonica
ref|XP_004299457.1|  PREDICTED: miraculin-like                          155   1e-42   
ref|XP_002305032.2|  trypsin protein inhibitor 3                        155   2e-42   Populus trichocarpa [western balsam poplar]
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3                 155   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_004137534.1|  PREDICTED: miraculin-like                          154   3e-42   
ref|XP_008437058.1|  PREDICTED: miraculin-like                          154   3e-42   
ref|XP_010683193.1|  PREDICTED: miraculin-like                          154   5e-42   
ref|XP_009406658.1|  PREDICTED: miraculin-like                          153   6e-42   
ref|XP_002890252.1|  trypsin and protease inhibitor family protein      153   6e-42   
ref|XP_011035401.1|  PREDICTED: miraculin-like                          153   1e-41   
ref|XP_004301214.1|  PREDICTED: miraculin-like                          151   5e-41   
gb|KFK42292.1|  hypothetical protein AALP_AA2G236900                    150   7e-41   
ref|XP_009614753.1|  PREDICTED: miraculin-like                          152   8e-41   
ref|XP_006353919.1|  PREDICTED: miraculin-like                          150   3e-40   
ref|XP_004241479.1|  PREDICTED: miraculin-like                          148   5e-40   
ref|XP_006347376.1|  PREDICTED: miraculin-like                          148   5e-40   
ref|XP_006304577.1|  hypothetical protein CARUB_v10011616mg             148   6e-40   
gb|KFK42293.1|  hypothetical protein AALP_AA2G237000                    147   8e-40   
gb|KCW48670.1|  hypothetical protein EUGRSUZ_K02326                     147   9e-40   
ref|XP_010476950.1|  PREDICTED: miraculin-like                          147   1e-39   
ref|XP_010498164.1|  PREDICTED: miraculin-like                          147   1e-39   
ref|XP_006441436.1|  hypothetical protein CICLE_v10023581mg             146   2e-39   
ref|XP_010037029.1|  PREDICTED: miraculin-like                          148   2e-39   
ref|XP_010042449.1|  PREDICTED: miraculin-like                          148   3e-39   
ref|XP_010459406.1|  PREDICTED: miraculin-like                          146   3e-39   
ref|XP_010683194.1|  PREDICTED: miraculin-like                          146   5e-39   
ref|XP_010041215.1|  PREDICTED: miraculin-like                          145   6e-39   
ref|XP_004235412.1|  PREDICTED: miraculin-like                          146   1e-38   
ref|XP_006416660.1|  hypothetical protein EUTSA_v10008818mg             144   2e-38   
ref|XP_009608866.1|  PREDICTED: miraculin-like                          144   2e-38   
emb|CDP21024.1|  unnamed protein product                                142   8e-38   
emb|CDP21540.1|  unnamed protein product                                142   8e-38   
ref|XP_009793041.1|  PREDICTED: miraculin-like                          142   9e-38   
gb|ACL12055.1|  Kunitz trypsin inhibitor                                142   9e-38   Nicotiana tabacum [American tobacco]
emb|CDP22082.1|  unnamed protein product                                142   1e-37   
ref|XP_007152537.1|  hypothetical protein PHAVU_004G138500g             142   1e-37   
ref|XP_006847953.1|  hypothetical protein AMTR_s00029p00141480          142   1e-37   
gb|AFS33546.1|  Kunitz-type protease inhibitor                          139   4e-37   
ref|XP_009149240.1|  PREDICTED: miraculin                               140   4e-37   
emb|CDY19181.1|  BnaC05g13820D                                          140   8e-37   
emb|CDP20533.1|  unnamed protein product                                140   8e-37   
gb|AHJ25677.1|  Kunitz-type trypsin inhibitor                           140   1e-36   
emb|CDP21543.1|  unnamed protein product                                140   1e-36   
ref|XP_003620188.1|  Miraculin                                          140   1e-36   
ref|NP_001238098.1|  uncharacterized protein LOC100306134 precursor     140   1e-36   
ref|XP_009777240.1|  PREDICTED: miraculin-like                          139   2e-36   
emb|CDO98557.1|  unnamed protein product                                139   2e-36   
emb|CDP21544.1|  unnamed protein product                                139   3e-36   
gb|ACV52580.1|  endopeptidase inhibitor                                 135   4e-36   Nicotiana benthamiana
gb|AFK41478.1|  unknown                                                 138   4e-36   
emb|CDY26209.1|  BnaA06g12080D                                          137   4e-36   
emb|CDO98560.1|  unnamed protein product                                138   6e-36   
ref|XP_004137639.1|  PREDICTED: miraculin-like                          137   7e-36   
emb|CDO98554.1|  unnamed protein product                                137   1e-35   
ref|XP_008437082.1|  PREDICTED: miraculin                               136   2e-35   
ref|XP_010249125.1|  PREDICTED: miraculin-like                          135   5e-35   
ref|XP_009615974.1|  PREDICTED: miraculin-like                          135   8e-35   
ref|XP_003534101.1|  PREDICTED: 21 kDa seed protein-like                133   3e-34   
gb|AFK39812.1|  unknown                                                 133   3e-34   
ref|XP_004237191.1|  PREDICTED: miraculin-like                          134   3e-34   
emb|CDO98555.1|  unnamed protein product                                133   4e-34   
dbj|BAA82842.1|  miraculin homologue                                    130   5e-34   Taraxacum officinale [dandelion]
ref|XP_006347377.1|  PREDICTED: miraculin-like                          132   6e-34   
ref|XP_010683192.1|  PREDICTED: miraculin-like                          132   6e-34   
ref|XP_004515059.1|  PREDICTED: miraculin-like                          132   7e-34   
gb|KHN24496.1|  Miraculin                                               132   9e-34   
ref|XP_010683390.1|  PREDICTED: miraculin-like                          132   1e-33   
ref|XP_004241480.1|  PREDICTED: miraculin-like                          132   1e-33   
dbj|BAA82841.1|  miraculin homologue                                    129   2e-33   Youngia japonica
ref|XP_009803614.1|  PREDICTED: miraculin-like                          130   5e-33   
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...    130   6e-33   Synsepalum dulcificum [miracle fruit]
ref|NP_001237597.1|  uncharacterized protein LOC100527288 precursor     130   7e-33   
gb|KHM99741.1|  Miraculin                                               129   1e-32   
ref|XP_010536414.1|  PREDICTED: miraculin-like                          129   1e-32   
emb|CDO98558.1|  unnamed protein product                                129   1e-32   
ref|XP_002305034.2|  hypothetical protein POPTR_0004s06610g             129   2e-32   Populus trichocarpa [western balsam poplar]
gb|ADW95380.1|  Kunitz-type trypsin inhibitor                           129   2e-32   
ref|XP_003620169.1|  Kunitz-type trypsin inhibitor alpha chain          128   3e-32   
gb|AEK26927.1|  Kunitz-type trypsin inhibitor B4                        128   4e-32   
gb|KHM99743.1|  Miraculin                                               127   4e-32   
ref|XP_002265535.2|  PREDICTED: alpha-amylase/subtilisin inhibito...    127   6e-32   Vitis vinifera
ref|XP_003620172.1|  21 kDa seed protein                                127   6e-32   
ref|XP_003534079.1|  PREDICTED: miraculin-like                          126   1e-31   
gb|KHM99738.1|  Miraculin                                               126   1e-31   
ref|XP_006477858.1|  PREDICTED: 21 kDa seed protein-like isoform X1     126   1e-31   
ref|NP_001237312.1|  uncharacterized protein LOC100527782 precursor     125   2e-31   
ref|XP_008437071.1|  PREDICTED: miraculin-like                          126   2e-31   
ref|XP_003534078.1|  PREDICTED: miraculin-like                          125   2e-31   
ref|XP_006477860.1|  PREDICTED: 21 kDa seed protein-like                126   2e-31   
gb|AEK26936.1|  Kunitz-type trypsin inhibitor B3                        125   3e-31   
gb|KFK42291.1|  hypothetical protein AALP_AA2G236700                    125   3e-31   
ref|XP_003534080.1|  PREDICTED: miraculin-like                          124   7e-31   
ref|XP_003534083.1|  PREDICTED: miraculin-like                          124   7e-31   
ref|XP_006442410.1|  hypothetical protein CICLE_v10022211mg             124   9e-31   
ref|XP_004235492.2|  PREDICTED: kunitz-type trypsin inhibitor alp...    124   1e-30   
gb|KFK31885.1|  hypothetical protein AALP_AA6G171300                    123   1e-30   
gb|ADW95389.1|  Kunitz-type trypsin inhibitor                           123   2e-30   
ref|XP_006477857.1|  PREDICTED: 21 kDa seed protein-like                123   2e-30   
ref|XP_004294173.1|  PREDICTED: alpha-amylase/subtilisin inhibito...    122   3e-30   
ref|XP_006372631.1|  trypsin protein inhibitor 3                        122   4e-30   
emb|CBI35466.3|  unnamed protein product                                119   7e-30   
ref|XP_009758946.1|  PREDICTED: miraculin-like                          122   8e-30   
ref|NP_001241106.1|  uncharacterized protein LOC100790688 precursor     122   8e-30   
emb|CDP19136.1|  unnamed protein product                                122   9e-30   
ref|XP_011046090.1|  PREDICTED: miraculin-like                          121   1e-29   
emb|CBI35470.3|  unnamed protein product                                118   2e-29   
ref|XP_006353918.1|  PREDICTED: miraculin-like                          120   2e-29   
gb|KHN24493.1|  Miraculin                                               120   2e-29   
ref|XP_010673342.1|  PREDICTED: miraculin-like                          120   3e-29   
ref|XP_003548288.1|  PREDICTED: miraculin-like                          120   3e-29   
ref|XP_010673346.1|  PREDICTED: miraculin-like                          120   4e-29   
gb|KHM99744.1|  Miraculin                                               117   1e-28   
ref|XP_006351548.1|  PREDICTED: miraculin-like                          118   2e-28   
ref|XP_009601782.1|  PREDICTED: miraculin-like                          118   2e-28   
gb|AFK33359.1|  unknown                                                 117   2e-28   
gb|AAF15902.1|AF208022_1  biotic cell death-associated protein          118   3e-28   Nicotiana glutinosa
gb|ACF74332.1|  Kunitz trypsin inhibitor 4                              117   4e-28   Arachis hypogaea [goober]
ref|XP_006441457.1|  hypothetical protein CICLE_v10024528mg             114   5e-28   
emb|CDP21779.1|  unnamed protein product                                117   5e-28   
gb|KHM99732.1|  Miraculin                                               116   1e-27   
ref|XP_004295679.1|  PREDICTED: miraculin-like                          115   1e-27   
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor     116   1e-27   
ref|XP_010041216.1|  PREDICTED: miraculin-like                          115   1e-27   
ref|XP_008226352.1|  PREDICTED: alpha-amylase/subtilisin inhibito...    115   2e-27   
emb|CBK52316.1|  Nb cell deth marker                                    115   2e-27   Nicotiana benthamiana
ref|XP_003534100.1|  PREDICTED: miraculin-like                          115   3e-27   
ref|XP_011092684.1|  PREDICTED: miraculin-like                          114   5e-27   
gb|KGN60879.1|  hypothetical protein Csa_2G021500                       113   6e-27   
emb|CDP18338.1|  unnamed protein product                                114   9e-27   
ref|XP_004139192.1|  PREDICTED: miraculin-like                          113   9e-27   
ref|XP_011035408.1|  PREDICTED: miraculin-like                          113   1e-26   
ref|XP_006478228.1|  PREDICTED: uncharacterized protein LOC102606959    117   1e-26   
gb|KHM99735.1|  Miraculin                                               111   2e-26   
ref|XP_007212054.1|  hypothetical protein PRUPE_ppa011448mg             112   3e-26   
ref|XP_003622420.1|  Endopeptidase inhibitor                            112   3e-26   
gb|KDO40321.1|  hypothetical protein CISIN_1g028238mg                   112   4e-26   
ref|XP_006441440.1|  hypothetical protein CICLE_v10022156mg             112   5e-26   
ref|XP_003548289.1|  PREDICTED: miraculin-like                          111   6e-26   
emb|CDP21726.1|  unnamed protein product                                110   1e-25   
emb|CDP16462.1|  unnamed protein product                                110   1e-25   
gb|AFK34345.1|  unknown                                                 108   8e-25   
ref|XP_009344613.1|  PREDICTED: miraculin-like                          108   8e-25   
ref|XP_009344614.1|  PREDICTED: miraculin-like                          108   8e-25   
ref|XP_003620187.1|  Miraculin                                          108   9e-25   
gb|ACS37303.1|  trypsin inhibitor                                       108   1e-24   
ref|XP_010428237.1|  PREDICTED: miraculin-like                          108   1e-24   
gb|KCW48668.1|  hypothetical protein EUGRSUZ_K02323                     107   1e-24   
gb|KHM99737.1|  Miraculin                                               108   1e-24   
emb|CDP19138.1|  unnamed protein product                                107   2e-24   
gb|KHM99742.1|  Miraculin                                               105   2e-24   
ref|XP_006347379.1|  PREDICTED: miraculin-like                          107   3e-24   
ref|XP_004515058.1|  PREDICTED: miraculin-like                          106   3e-24   
gb|AEK31191.1|  miraculin-like protein 1                                105   3e-24   
gb|ABK01288.1|  miraculin-like protein                                  107   3e-24   Coffea arabica [arabica coffee]
ref|NP_565061.1|  kunitz trypsin inhibitor 1                            107   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52121.1|AC010556_3  putative trypsin inhibitor; 19671-20297       106   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KDO77364.1|  hypothetical protein CISIN_1g0437192mg                  105   4e-24   
ref|XP_002525871.1|  Alpha-amylase/subtilisin inhibitor precursor...    106   4e-24   Ricinus communis
ref|XP_003620185.1|  21 kDa seed protein                                106   5e-24   
gb|AEK26931.1|  Kunitz-type trypsin inhibitor C5                        106   5e-24   
gb|AAN15685.1|  putative trypsin inhibitor                              106   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006468645.1|  PREDICTED: alpha-amylase/subtilisin inhibito...    105   5e-24   
gb|AEK31190.1|  miraculin-like protein 1                                105   6e-24   
ref|XP_006448699.1|  hypothetical protein CICLE_v10016767mg             105   6e-24   
ref|XP_007036746.1|  21 kDa seed protein                                106   6e-24   
pdb|3IIR|A  Chain A, Crystal Structure Of Miraculin Like Protein ...    105   8e-24   
ref|XP_003534081.1|  PREDICTED: miraculin-like                          105   8e-24   
gb|ACS92521.1|  Kunitz-type protease inhibitor KPI-F4                   105   9e-24   Populus trichocarpa x Populus deltoides
ref|XP_010416116.1|  PREDICTED: miraculin-like                          105   9e-24   
ref|XP_006302823.1|  hypothetical protein CARUB_v10020954mg             105   1e-23   
gb|ABX76298.1|  sexual organ expressed protein                          105   1e-23   Nicotiana alata [flowering tobacco]
gb|KFK41765.1|  hypothetical protein AALP_AA2G169300                    104   2e-23   
ref|XP_011035403.1|  PREDICTED: 21 kDa seed protein-like                104   2e-23   
ref|XP_006383817.1|  truncated Kunitz trypsin inhibitor family pr...    104   2e-23   
ref|XP_003620174.1|  Pathogen-inducible trypsin-inhibitor-like pr...    104   2e-23   
gb|ACS92519.1|  Kunitz-type protease inhibitor KPI-D8                   104   2e-23   Populus trichocarpa x Populus nigra
gb|KHM99740.1|  Miraculin                                               102   2e-23   
ref|XP_003620175.1|  Pathogen-inducible trypsin-inhibitor-like pr...    104   3e-23   
gb|AAQ84217.1|  Kunitz trypsin inhibitor 4                              104   3e-23   Populus trichocarpa x Populus deltoides
ref|XP_007036750.1|  21 kDa seed protein                                104   3e-23   
emb|CAI77803.1|  kunitz trypsin inhibitor                               103   5e-23   Populus tremula [European aspen]
ref|XP_002305033.1|  trypsin protein inhibitor 3                        103   7e-23   Populus trichocarpa [western balsam poplar]
gb|AAV41233.1|  putative 21 kDa trypsin inhibitor                       103   7e-23   Theobroma bicolor
ref|XP_006441469.1|  hypothetical protein CICLE_v10024002mg             102   1e-22   
emb|CAI77772.1|  kunitz trypsin inhibitor                               102   1e-22   Populus tremula [European aspen]
ref|XP_002888920.1|  hypothetical protein ARALYDRAFT_476458             102   1e-22   
ref|XP_010471385.1|  PREDICTED: trypsin inhibitor BvTI-like             102   1e-22   
emb|CAI77795.1|  kunitz trypsin inhibitor                               102   1e-22   Populus tremula [European aspen]
emb|CAI77782.1|  kunitz trypsin inhibitor                               102   2e-22   Populus tremula [European aspen]
emb|CAI77777.1|  kunitz trypsin inhibitor                               102   2e-22   Populus tremula [European aspen]
ref|XP_008386287.1|  PREDICTED: miraculin-like                          101   3e-22   
emb|CAI77785.1|  kunitz trypsin inhibitor                               101   3e-22   Populus tremula [European aspen]
emb|CAI77798.1|  kunitz trypsin inhibitor                               101   3e-22   Populus tremula [European aspen]
gb|AEK26926.1|  Kunitz-type trypsin inhibitor B1                        101   3e-22   
emb|CAI77790.1|  kunitz trypsin inhibitor                               101   3e-22   Populus tremula [European aspen]
emb|CAI77770.1|  kunitz trypsin inhibitor                               101   3e-22   Populus tremula [European aspen]
emb|CAI77769.1|  kunitz trypsin inhibitor                               101   3e-22   Populus tremula [European aspen]
emb|CAI77771.1|  kunitz trypsin inhibitor                               101   4e-22   Populus tremula [European aspen]
emb|CAI77764.1|  kunitz trypsin inhibitor                               101   4e-22   Populus tremula [European aspen]
emb|CAI77765.1|  kunitz trypsin inhibitor                               101   4e-22   
emb|CDY11118.1|  BnaC06g23700D                                          100   4e-22   
dbj|BAE79511.1|  miraculin-like protein 2                               101   4e-22   
emb|CDQ51987.1|  alpha amylase/subtilisin inhibitor                     100   5e-22   
ref|XP_006847952.1|  hypothetical protein AMTR_s00029p00141300          100   5e-22   
emb|CAI77766.1|  kunitz trypsin inhibitor                               100   5e-22   
emb|CAI77773.1|  kunitz trypsin inhibitor                               100   5e-22   
emb|CAI77774.1|  kunitz trypsin inhibitor                               100   6e-22   
ref|XP_008386290.1|  PREDICTED: kunitz-type elastase inhibitor Br...    100   6e-22   
emb|CAI77775.1|  kunitz trypsin inhibitor                               100   6e-22   
emb|CAI77783.1|  kunitz trypsin inhibitor                               100   6e-22   
gb|ACS92500.1|  Kunitz-type protease inhibitor KPI-D9                   100   6e-22   
gb|AEK31192.1|  miraculin-like protein 1                              99.8    7e-22   
gb|AFR54471.1|  miraculin-like protein 2                                100   9e-22   
gb|AAL85644.1|  trypsin inhibitor                                     98.6    1e-21   
ref|XP_006441467.1|  hypothetical protein CICLE_v10022124mg             100   1e-21   
gb|ABK96521.1|  unknown                                                 100   1e-21   
ref|XP_007152529.1|  hypothetical protein PHAVU_004G138000g           99.0    1e-21   
gb|AAL85661.1|  trypsin inhibitor                                     98.6    1e-21   
emb|CAI77767.1|  kunitz trypsin inhibitor                               100   1e-21   
emb|CAI77786.1|  kunitz trypsin inhibitor                             99.8    1e-21   
emb|CAI77768.1|  kunitz trypsin inhibitor                             99.8    1e-21   
emb|CAI77793.1|  kunitz trypsin inhibitor                             99.8    2e-21   
prf||1802409A  albumin                                                99.8    2e-21
ref|XP_007036743.1|  21 kDa seed protein                              99.8    2e-21   
ref|XP_003534082.1|  PREDICTED: miraculin-like                        99.4    2e-21   
ref|XP_006478132.1|  PREDICTED: 21 kDa seed protein-like              99.4    2e-21   
ref|XP_006441465.1|  hypothetical protein CICLE_v10022129mg           99.4    2e-21   
ref|XP_011035402.1|  PREDICTED: 21 kDa seed protein-like              99.0    2e-21   
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     99.0    3e-21   
gb|KDO44067.1|  hypothetical protein CISIN_1g031474mg                 97.4    3e-21   
ref|XP_010539107.1|  PREDICTED: 21 kDa seed protein-like              98.6    4e-21   
gb|AAL85645.1|  trypsin inhibitor                                     97.1    5e-21   
ref|XP_007036748.1|  21 kDa seed protein, putative                    98.2    6e-21   
gb|AAL85652.1|  trypsin inhibitor                                     96.7    6e-21   
gb|AAL85651.1|  trypsin inhibitor                                     96.7    6e-21   
gb|AAL85648.1|  trypsin inhibitor                                     96.3    8e-21   
emb|CAI77800.1|  kunitz trypsin inhibitor                             97.4    8e-21   
gb|ABG47463.1|  vegetative storage protein                            97.8    9e-21   
ref|XP_002525873.1|  Miraculin precursor, putative                    97.1    9e-21   
gb|AAK96757.1|  putative trypsin inhibitor                            97.4    9e-21   
ref|XP_009789071.1|  PREDICTED: cysteine protease inhibitor 8-like    97.8    1e-20   
gb|AAL85650.1|  trypsin inhibitor                                     95.9    1e-20   
gb|AEK26922.1|  Kunitz-type trypsin inhibitor C1                      96.7    1e-20   
gb|ABX76297.1|  stigma expressed protein                              97.8    1e-20   
ref|XP_009376739.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  96.7    2e-20   
ref|XP_010098226.1|  Endogenous alpha-amylase/subtilisin inhibitor    96.3    2e-20   
gb|AAL85643.1|  trypsin inhibitor                                     95.1    2e-20   
gb|AEK31196.1|  miraculin-like protein 2                              95.5    2e-20   
gb|ACO40086.1|  kunitz trypsin inhibitor 4                            95.1    3e-20   
ref|XP_010098224.1|  Alpha-amylase/subtilisin inhibitor               95.9    3e-20   
ref|XP_003620184.1|  Pathogen-inducible trypsin-inhibitor-like pr...  95.5    4e-20   
gb|ACO40133.1|  kunitz trypsin inhibitor 4                            95.1    4e-20   
ref|XP_010098227.1|  Endogenous alpha-amylase/subtilisin inhibitor    95.1    5e-20   
gb|AAL85640.1|  trypsin inhibitor                                     94.0    5e-20   
gb|AFK41530.1|  unknown                                               95.5    5e-20   
gb|KDP27281.1|  hypothetical protein JCGZ_21012                       94.4    7e-20   
gb|AEK31197.1|  miraculin-like protein 2                              94.0    7e-20   
gb|AAL85660.1|  trypsin inhibitor                                     93.6    8e-20   
ref|XP_002300199.1|  truncated Kunitz trypsin inhibitor family pr...  94.0    1e-19   
gb|ACO40119.1|  kunitz trypsin inhibitor 4                            93.2    2e-19   
gb|ACO40082.1|  kunitz trypsin inhibitor 4                            93.2    2e-19   
gb|KDP27286.1|  hypothetical protein JCGZ_21017                       93.2    2e-19   
gb|ACO40104.1|  kunitz trypsin inhibitor 4                            92.8    2e-19   
gb|ABR17296.1|  unknown                                               93.6    2e-19   
gb|AEO27901.1|  miraculin-like protein 2                              92.4    3e-19   
gb|ACO40154.1|  kunitz trypsin inhibitor 4                            92.8    3e-19   
ref|XP_006442417.1|  hypothetical protein CICLE_v10022911mg           90.9    3e-19   
ref|XP_006442412.1|  hypothetical protein CICLE_v10023557mg           92.0    3e-19   
gb|ACO40093.1|  kunitz trypsin inhibitor 4                            92.4    3e-19   
gb|ACO40073.1|  kunitz trypsin inhibitor 4                            92.4    3e-19   
gb|ACO40153.1|  kunitz trypsin inhibitor 4                            92.4    3e-19   
gb|AAV41231.1|  putative 21 kDa trypsin inhibitor                     93.2    4e-19   
gb|ACO40145.1|  kunitz trypsin inhibitor 4                            92.0    4e-19   
gb|ACO40077.1|  kunitz trypsin inhibitor 4                            92.0    4e-19   
gb|ACO40080.1|  kunitz trypsin inhibitor 4                            92.0    5e-19   
ref|XP_002525872.1|  Miraculin precursor, putative                    92.4    5e-19   
gb|KDO37403.1|  hypothetical protein CISIN_1g035912mg                 90.5    7e-19   
gb|AAL85659.1|  trypsin inhibitor                                     90.9    7e-19   
gb|AAL85657.1|  trypsin inhibitor                                     90.9    7e-19   
gb|ACO40078.1|  kunitz trypsin inhibitor 4                            91.3    9e-19   
gb|ACO40144.1|  kunitz trypsin inhibitor 4                            91.3    9e-19   
ref|XP_011045717.1|  PREDICTED: miraculin-like                        91.3    1e-18   
gb|KDO40852.1|  hypothetical protein CISIN_1g046118mg                 91.3    1e-18   
gb|ACO40084.1|  kunitz trypsin inhibitor 4                            90.5    1e-18   
ref|XP_006465039.1|  PREDICTED: 21 kDa seed protein-like              91.3    1e-18   
emb|CAZ64526.1|  Kunitz trypsin inhibitor                             89.7    2e-18   
gb|KDP27284.1|  hypothetical protein JCGZ_21015                       90.5    2e-18   
gb|ACO40081.1|  kunitz trypsin inhibitor 4                            90.5    2e-18   
gb|ACO40074.1|  kunitz trypsin inhibitor 4                            90.5    2e-18   
ref|XP_010098221.1|  Alpha-amylase/subtilisin inhibitor               90.5    2e-18   
ref|XP_006432185.1|  hypothetical protein CICLE_v10002395mg           91.3    2e-18   
gb|AEO27899.1|  miraculin-like protein                                90.1    2e-18   
gb|ADL60120.1|  alpha-amylase inhibitor                               90.1    2e-18   
ref|XP_006441455.1|  hypothetical protein CICLE_v10023253mg           88.2    2e-18   
gb|AAL85653.1|  trypsin inhibitor                                     89.0    3e-18   
gb|ACO40100.1|  kunitz trypsin inhibitor 4                            89.4    4e-18   
gb|AAL85637.1|  trypsin inhibitor                                     88.6    5e-18   
ref|NP_001053363.1|  Os04g0526600                                     89.7    5e-18   
gb|AAL85654.1|  trypsin inhibitor                                     88.6    5e-18   
gb|AEK31202.1|  miraculin-like protein 2                              89.0    5e-18   
gb|ACV65034.1|  alpha-amylase inhibitor                               89.0    6e-18   
gb|AEK31201.1|  miraculin-like protein 2                              88.6    7e-18   
ref|XP_002888923.1|  trypsin and protease inhibitor family protein    89.4    8e-18   
gb|KDP27288.1|  hypothetical protein JCGZ_21019                       88.6    1e-17   
gb|KEH38529.1|  Kunitz type trypsin inhibitor                         88.2    1e-17   
gb|AFK44389.1|  unknown                                               88.2    1e-17   
gb|AEO27900.1|  miraculin-like protein 2                              87.4    2e-17   
gb|AAL85655.1|  trypsin inhibitor                                     86.7    3e-17   
gb|ACJ51124.1|  talisin                                               87.4    3e-17   
prf||1210227A  amylase subtilisin inhibitor alpha                     86.7    3e-17
gb|AEK26923.1|  Kunitz-type trypsin inhibitor C7                      86.7    4e-17   
gb|AEK31200.1|  miraculin-like protein 2                              86.3    4e-17   
ref|XP_009608941.1|  PREDICTED: serine protease inhibitor 4-like      85.9    4e-17   
sp|P16347.1|IAAS_WHEAT  RecName: Full=Endogenous alpha-amylase/su...  86.3    5e-17   
ref|XP_003638395.1|  Alpha-amylase/subtilisin inhibitor               87.4    5e-17   
ref|XP_006427451.1|  hypothetical protein CICLE_v10027262mg           87.4    5e-17   
pdb|1AVA|C  Chain C, Amy2BASI PROTEIN-Protein Complex From Barley...  86.3    5e-17   
ref|XP_010098225.1|  Endogenous alpha-amylase/subtilisin inhibitor    86.3    5e-17   
emb|CAA78305.1|  bifunctional alpha-amylase/subtilisin inhibitor      86.7    6e-17   
ref|XP_004242148.1|  PREDICTED: miraculin-like                        86.3    7e-17   
gb|ACS92520.1|  Kunitz-type protease inhibitor KPI-F9                 86.3    7e-17   
gb|AFR78144.1|  Isa                                                   85.9    7e-17   
ref|XP_006478136.1|  PREDICTED: 21 kDa seed protein-like              86.3    8e-17   
sp|P07596.2|IAAS_HORVU  RecName: Full=Alpha-amylase/subtilisin in...  86.3    8e-17   
gb|AAF15901.1|AF208020_1  putative proteinase inhibitor               86.7    9e-17   
ref|XP_010416131.1|  PREDICTED: bark lectin isoform 2-like isofor...  86.3    9e-17   
ref|XP_009775241.1|  PREDICTED: latex serine proteinase inhibitor...  86.3    1e-16   
ref|XP_007152428.1|  hypothetical protein PHAVU_004G129500g           85.9    1e-16   
ref|XP_010416130.1|  PREDICTED: bark lectin isoform 2-like isofor...  86.3    1e-16   
gb|AAL85642.1|  trypsin inhibitor                                     84.7    1e-16   
ref|XP_006390572.1|  hypothetical protein EUTSA_v10019151mg           85.5    1e-16   
ref|XP_004488980.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  85.5    1e-16   
gb|AGW24883.1|  alpha-amylase inhibitor                               85.1    2e-16   
gb|AAS75739.1|  thermoinhibition-associated THB-6 protein             82.8    2e-16   
gb|AFK34901.1|  unknown                                               85.1    2e-16   
ref|XP_002309884.2|  hypothetical protein POPTR_0007s03650g           85.1    2e-16   
ref|XP_006347378.1|  PREDICTED: miraculin-like                        84.7    2e-16   
emb|CBJ94877.1|  kunitz trypsin inhibitor                             83.6    2e-16   
gb|AAB23101.1|  bifunctional subtilisin/alpha-amylase inhibitor, ...  84.3    2e-16   
ref|XP_011023016.1|  PREDICTED: endogenous alpha-amylase/subtilis...  84.3    3e-16   
gb|KDP46945.1|  hypothetical protein JCGZ_07962                       84.0    3e-16   
ref|XP_011012012.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  84.0    4e-16   
ref|XP_006653614.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  84.3    4e-16   
ref|XP_009105983.1|  PREDICTED: kunitz-type serine protease inhib...  84.3    4e-16   
gb|KDO47404.1|  hypothetical protein CISIN_1g048141mg                 84.0    4e-16   
gb|ADW95376.1|  Kunitz-type trypsin inhibitor                         84.0    5e-16   
ref|NP_565062.1|  Kunitz family trypsin and protease inhibitor pr...  84.0    5e-16   
pdb|2IWT|B  Chain B, Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfid...  83.6    5e-16   
gb|AAK84063.1|AF401200_1  trypsin inhibitor                           82.8    7e-16   
ref|XP_004511146.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  83.6    7e-16   
ref|XP_003628506.1|  Alpha-amylase/subtilisin inhibitor               83.2    7e-16   
ref|XP_010540187.1|  PREDICTED: bark lectin isoform 2-like            83.6    7e-16   
emb|CDX72972.1|  BnaC06g34200D                                        83.6    7e-16   
ref|XP_011023019.1|  PREDICTED: endogenous alpha-amylase/subtilis...  83.2    7e-16   
gb|AEK31199.1|  miraculin-like protein 2                              82.8    8e-16   
gb|KEH16752.1|  Kunitz type trypsin inhibitor                         83.2    9e-16   
gb|KDO46146.1|  hypothetical protein CISIN_1g047893mg                 82.0    9e-16   
ref|XP_006441461.1|  hypothetical protein CICLE_v10022001mg           83.6    1e-15   
ref|XP_010253746.1|  PREDICTED: 21 kDa seed protein-like              83.6    1e-15   
gb|KEH16150.1|  Kunitz type trypsin inhibitor                         82.8    1e-15   
ref|XP_009105981.1|  PREDICTED: 21 kDa seed protein-like              82.8    1e-15   
gb|ACV41269.1|  alpha amylase inhibitor                               81.3    2e-15   
pdb|3S8J|A  Chain A, Crystal Structure Of A Papaya Latex Serine P...  82.0    2e-15   
gb|KDP27287.1|  hypothetical protein JCGZ_21018                       81.6    2e-15   
ref|XP_002309881.2|  hypothetical protein POPTR_0007s03620g           81.6    2e-15   
ref|XP_006371005.1|  truncated Kunitz trypsin inhibitor family pr...  82.0    2e-15   
gb|ADW95385.1|  Kunitz-type trypsin inhibitor                         81.6    2e-15   
ref|XP_007133320.1|  hypothetical protein PHAVU_011G169800g           81.6    2e-15   
ref|XP_009770904.1|  PREDICTED: miraculin-like                        82.0    3e-15   
ref|XP_009588833.1|  PREDICTED: latex serine proteinase inhibitor...  81.6    3e-15   
ref|XP_003548287.1|  PREDICTED: trypsin inhibitor A-like              81.6    3e-15   
gb|ACV41268.1|  alpha amylase inhibitor                               80.1    3e-15   
gb|ACV41265.1|  alpha amylase inhibitor                               80.1    4e-15   
ref|XP_006478135.1|  PREDICTED: miraculin-like                        81.6    4e-15   
ref|XP_006353924.1|  PREDICTED: miraculin-like                        80.9    4e-15   
gb|AAG38518.1|AF283533_1  miraculin-like protein 2                    81.6    4e-15   
ref|NP_001233769.1|  uncharacterized protein LOC544001 precursor      81.6    4e-15   
ref|XP_009600634.1|  PREDICTED: miraculin-like                        81.3    4e-15   
sp|P80691.1|LSPI_CARPA  RecName: Full=Latex serine proteinase inh...  80.5    6e-15   
ref|NP_001236241.1|  uncharacterized protein LOC100305754 precursor   80.5    6e-15   
ref|XP_010416122.1|  PREDICTED: trypsin inhibitor BvTI-like           80.5    7e-15   
ref|XP_006441443.1|  hypothetical protein CICLE_v10023590mg           77.4    7e-15   
ref|NP_001237751.1|  Kunitz trypsin protease inhibitor-like precu...  80.5    7e-15   
ref|XP_004976298.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  80.5    7e-15   
gb|AAL85656.1|  trypsin inhibitor                                     79.3    8e-15   
gb|ACV41266.1|  alpha amylase inhibitor                               79.3    8e-15   
gb|AEK26932.1|  Kunitz-type trypsin inhibitor C6                      80.1    8e-15   
gb|KHN19473.1|  Alpha-amylase/subtilisin inhibitor                    80.1    8e-15   
ref|XP_010098222.1|  hypothetical protein L484_010984                 80.1    8e-15   
ref|XP_009630289.1|  PREDICTED: miraculin-like                        80.5    1e-14   
gb|AIS71915.1|  hypothetical protein                                  80.5    1e-14   
ref|XP_006495062.1|  PREDICTED: miraculin-like                        78.6    1e-14   
ref|XP_010428253.1|  PREDICTED: bark lectin isoform 2 isoform X2      80.1    1e-14   
gb|KHN45554.1|  Miraculin                                             77.8    1e-14   
gb|ACV41272.1|  alpha amylase inhibitor                               78.6    1e-14   
gb|ACV41267.1|  alpha amylase inhibitor                               78.6    1e-14   
gb|ACV41264.1|  alpha amylase inhibitor                               78.6    1e-14   
gb|AEK26924.1|  Kunitz-type trypsin inhibitor C4                      79.3    1e-14   
ref|XP_010428252.1|  PREDICTED: bark lectin isoform 2 isoform X1      80.1    1e-14   
ref|XP_010253721.1|  PREDICTED: miraculin-like                        80.1    1e-14   
gb|KEH16370.1|  Kunitz type trypsin inhibitor                         79.3    2e-14   
ref|XP_003598537.1|  Alpha-amylase/subtilisin inhibitor               79.3    2e-14   
ref|XP_003628500.1|  Serine protease inhibitor                        79.3    2e-14   
ref|XP_006390569.1|  hypothetical protein EUTSA_v10019129mg           79.3    2e-14   
ref|XP_010428240.1|  PREDICTED: trypsin inhibitor BvTI-like           79.0    2e-14   
ref|XP_010428249.1|  PREDICTED: trypsin inhibitor BvTI-like           78.6    3e-14   
emb|CDY59714.1|  BnaC02g46470D                                        79.0    3e-14   
ref|XP_008455014.1|  PREDICTED: miraculin-like isoform X1             79.0    3e-14   
ref|XP_003598532.1|  Alpha-amylase/subtilisin inhibitor               78.6    3e-14   
ref|XP_010537526.1|  PREDICTED: bark lectin isoform 1-like            78.6    4e-14   
ref|XP_006441433.1|  hypothetical protein CICLE_v10023442mg           75.9    4e-14   
ref|XP_011023018.1|  PREDICTED: miraculin-like                        78.2    4e-14   
gb|ACU19069.1|  unknown                                               78.2    4e-14   
ref|XP_006441437.1|  hypothetical protein CICLE_v10023565mg           75.5    4e-14   
ref|XP_003532233.1|  PREDICTED: kunitz-type trypsin inhibitor KTI...  77.8    5e-14   
ref|XP_009105993.1|  PREDICTED: latex serine proteinase inhibitor...  78.2    5e-14   
sp|Q41015.2|PIP21_PEA  RecName: Full=Kunitz-type trypsin inhibito...  78.2    5e-14   
ref|XP_010471390.1|  PREDICTED: bark lectin isoform 2-like            78.2    6e-14   
emb|CDY11117.1|  BnaC06g23690D                                        77.8    6e-14   
ref|XP_007152437.1|  hypothetical protein PHAVU_004G130400g           77.4    8e-14   



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 140/207 (68%), Gaps = 4/207 (2%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK   + F L LIA ++K   + A+   + V D+ G+++ +GVDYYILP         GG
Sbjct  1    MKTTSLLFSLQLIALAVKPFSVAAESAPDPVLDTEGKKLRSGVDYYILPVFRGR----GG  56

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GLTLAS  N TCPL VVQ     SNG  + F+ VNP    ++ S DHNIKFSA +ICV S
Sbjct  57   GLTLASTGNETCPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTICVQS  116

Query  391  TLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCG  570
            TLW+L+  E +G+  V TGG EGNPGR+T+ NWFK+ + +D YKL +CPTVCD C+PVCG
Sbjct  117  TLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYDDDYKLVFCPTVCDFCKPVCG  176

Query  571  DLGILVVDGIRILAITDKPLRVVFKKA  651
            D+GI + +G R LA++D P +V+FKKA
Sbjct  177  DIGIYIQNGYRRLALSDVPFKVMFKKA  203



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 137/207 (66%), Gaps = 4/207 (2%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK     F L LIA ++K   + A+   + V D+ G+++ +GVDYYILP         GG
Sbjct  1    MKTTSFLFSLLLIALAVKPFPVAAESSPDPVLDTEGKQLRSGVDYYILPVIRGR----GG  56

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GLTLAS  N  CPL VVQ     SNG  + F+ VNP    ++ S DHNIKFSA +ICV S
Sbjct  57   GLTLASTGNENCPLDVVQEQHEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTICVQS  116

Query  391  TLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCG  570
            TLW+L+  E +G+  V TGG EGNPG +T+ NWFK+ + ED YKL +CPTVCD C+PVCG
Sbjct  117  TLWKLEYDESSGQRFVTTGGVEGNPGXETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCG  176

Query  571  DLGILVVDGIRILAITDKPLRVVFKKA  651
            D+GI + +G R LA++D P +V+FKKA
Sbjct  177  DIGIYIQNGYRRLALSDVPFKVMFKKA  203



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 132/191 (69%), Gaps = 4/191 (2%)
 Frame = +1

Query  79   IKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLV  258
            +K   + A+   + V D+ G+++ +GVDYYILP         GGGLTLAS  N +CPL V
Sbjct  17   VKPFSVAAESAPDPVLDTEGKKLRSGVDYYILPVFRGR----GGGLTLASTGNESCPLDV  72

Query  259  VQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVV  438
            VQ     SNG  + F+ VNP    ++ S DHNIKFSA +ICV STLW+L+  E +G++ V
Sbjct  73   VQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTICVQSTLWKLEYDESSGQWFV  132

Query  439  GTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAIT  618
             TGG EGNPGR+T+ NWFK+ + ED YKL +CPTVCD C+PVCGD+GI + +G R LA++
Sbjct  133  TTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALS  192

Query  619  DKPLRVVFKKA  651
            D P +V+FKKA
Sbjct  193  DVPFKVMFKKA  203



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = +1

Query  79   IKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLV  258
            +K   + A+   + V D+ G+++ +GVDYYILP         GGGLTLAS  N TCPL V
Sbjct  39   VKPFSVAAESAPDPVLDTEGKKLRSGVDYYILPVFRGR----GGGLTLASTGNETCPLDV  94

Query  259  VQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVV  438
            VQ     SNG  + F+ VNP    ++ S DHNIKFSA +ICV STLW+L+  E +G+  V
Sbjct  95   VQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTICVQSTLWKLEYDESSGQRFV  154

Query  439  GTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAIT  618
             TGG EGNPGR+T+ NWFK+ + ED YKL +CPTVCD C+PVCGD+GI + +  R LA++
Sbjct  155  TTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNEYRRLALS  214

Query  619  DKPLRVVFKKA  651
            D P +V+FKKA
Sbjct  215  DVPFKVMFKKA  225



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score =   206 bits (523),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = +1

Query  79   IKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLV  258
            +K   + A+   + V D+ G+++ +GVDYYILP         GGGLTLAS  N TCPL V
Sbjct  17   VKPFSVAAESAPDPVLDTEGKKLRSGVDYYILPVFRGR----GGGLTLASTGNETCPLDV  72

Query  259  VQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVV  438
            VQ     SNG  + F+ VNP    ++ S DHNIKFSA +ICV STLW+L+  E +G+  V
Sbjct  73   VQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTICVQSTLWKLEYDESSGQRFV  132

Query  439  GTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAIT  618
             TGG EGNPGR+T+ NWFK+ + ED YKL +CPTVCD C+PVCGD+GI + +  R LA++
Sbjct  133  TTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNXYRRLALS  192

Query  619  DKPLRVVFKKA  651
            D P +V+FKKA
Sbjct  193  DVPFKVMFKKA  203



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 129/191 (68%), Gaps = 4/191 (2%)
 Frame = +1

Query  79   IKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLV  258
            +K   + A+   + V D+ G+++ +GVDYYILP         GGGLTLAS  N TCPL V
Sbjct  17   VKPFSVAAESAPDPVLDTEGKKLRSGVDYYILPVFRGR----GGGLTLASTGNETCPLDV  72

Query  259  VQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVV  438
            VQ     SNG  + F+ VNP    ++ S DHNIKFSA +ICV STLW+L+  E +G+  V
Sbjct  73   VQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTICVQSTLWKLEYDESSGQRFV  132

Query  439  GTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAIT  618
             TGG EGNPGR+T+ NWFK+ + ED YKL +CPTVCD C+PVCGD+GI + +  R LA++
Sbjct  133  TTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNEYRRLALS  192

Query  619  DKPLRVVFKKA  651
            D P +V FKKA
Sbjct  193  DVPFKVKFKKA  203



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 129/191 (68%), Gaps = 4/191 (2%)
 Frame = +1

Query  79   IKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLV  258
            +K   + A+   + V D+ G+++ +GVDYYILP         GGGLTLAS  N  CPL V
Sbjct  17   VKPFPVAAESSPDPVLDTEGKQLWSGVDYYILPVIRGR----GGGLTLASTGNENCPLDV  72

Query  259  VQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVV  438
            VQ     SNG  + F+ VNP    ++ S DHNIKFSA +ICV STLW+L+  E +G+  V
Sbjct  73   VQEQHEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTICVQSTLWKLEYDESSGQRFV  132

Query  439  GTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAIT  618
             TGG EGNPG +T+ NWFK+ + ED YKL +CPTVCD C+PVCGD+GI + +G R LA++
Sbjct  133  TTGGVEGNPGHETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALS  192

Query  619  DKPLRVVFKKA  651
            D P +V+FKKA
Sbjct  193  DVPFKVMFKKA  203



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 124/177 (70%), Gaps = 4/177 (2%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D SG+E+ TG DYYILP    G    GGGLTLAS  N TCPL VVQ     SNG  + 
Sbjct  26   VLDISGEELRTGTDYYILPVIRGG----GGGLTLASTGNETCPLDVVQEQLEVSNGLPLT  81

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTI  480
            FS VN +   V+ S D NIKFSA +ICV ST+W+LD  E T K VV TGG EGNPG +T+
Sbjct  82   FSPVNITKGVVRVSTDLNIKFSAATICVQSTVWKLDNDEATQKMVVTTGGVEGNPGIETL  141

Query  481  SNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            SNWFK+ R ED YKL +CP VCD CRPVCGDLG+ +  GIR LA++D PL+V+FK+A
Sbjct  142  SNWFKIERYEDDYKLVFCPGVCDFCRPVCGDLGVFIDAGIRRLALSDVPLKVMFKRA  198



>gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana]
Length=205

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 132/209 (63%), Gaps = 6/209 (3%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK +++F    +   S       A      V D +G+++ TG+DYYILP         GG
Sbjct  1    MKTKQLFLPFLIFTXSFNSFLSSAAEAPPAVVDIAGKKLRTGIDYYILPVVRGR----GG  56

Query  211  GLTLASGPNTTCPL-LVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVM  387
            GLTL S  N +CPL  VVQ     +NGF + F+ VNP    ++ES D NIKFSA SICV 
Sbjct  57   GLTLDSTGNESCPLDAVVQEQKEINNGFPLTFTPVNPKKGVIRESTDLNIKFSAASICVQ  116

Query  388  STLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
            +TLW+LD   E TGKY +  GG EGNPGR+TISNWFK+ + E  YKL YCPTVC+ C+ +
Sbjct  117  TTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVI  176

Query  565  CGDLGILVVDGIRILAITDKPLRVVFKKA  651
            C D+GI + DG R LA++D P +V+FKKA
Sbjct  177  CKDIGIFIQDGTRRLALSDVPFKVMFKKA  205



>ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris]
Length=210

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 130/209 (62%), Gaps = 6/209 (3%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK  ++F    +   S       A      V D +G+++ TG+DYYILP         GG
Sbjct  1    MKTNQLFLPFLIFTISFNSFLSSAAEAPPAVVDIAGKKLRTGIDYYILPVVRGR----GG  56

Query  211  GLTLASGPNTTCPL-LVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVM  387
            GLTL S  N +CPL  VVQ      NG  + F+ VNP    ++ES D NIKFSA SICV 
Sbjct  57   GLTLDSTGNESCPLDAVVQEQQEIKNGLPLTFTPVNPKKGVIRESTDLNIKFSAASICVQ  116

Query  388  STLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
            +TLW+LD   E TGKY +  GG EGNPGR+TISNWFK+ + E  YKL YCPTVC+ C+ +
Sbjct  117  TTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVI  176

Query  565  CGDLGILVVDGIRILAITDKPLRVVFKKA  651
            C D+GI + DGIR LA++D P +V+FKKA
Sbjct  177  CKDVGIFIQDGIRRLALSDVPFKVMFKKA  205



>gb|AAC49969.1| tumor-related protein [Nicotiana tabacum]
Length=210

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 138/211 (65%), Gaps = 10/211 (5%)
 Frame = +1

Query  31   MKMEKVF--FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG  204
            MK  ++F  FL+F I+ +   L   A+    VV D +G+++ TG+DYYILP         
Sbjct  1    MKTNQLFLPFLIFTISFN-SFLSSSAEAPPAVV-DIAGKKLRTGIDYYILPVVRGR----  54

Query  205  GGGLTLASGPNTTCPL-LVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSIC  381
            GGGLTL S  N +CPL  VVQ      NG  + F+ VNP    ++ES D NIKFSA SIC
Sbjct  55   GGGLTLDSTGNESCPLDAVVQEQQEIKNGLPLTFTPVNPKKGVIRESTDLNIKFSAASIC  114

Query  382  VMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICR  558
            V +TLW+LD   E TGKY +  GG EGNPGR+TISNWFK+ + E  YKL YCPTVC+ C+
Sbjct  115  VQTTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEKFERDYKLVYCPTVCNFCK  174

Query  559  PVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
             +C D+GI + DGIR LA++D P +V+FKKA
Sbjct  175  VICKDVGIFIQDGIRRLALSDVPFKVMFKKA  205



>ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera]
Length=162

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 117/166 (70%), Gaps = 4/166 (2%)
 Frame = +1

Query  154  GVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNV  333
            GVDYYILP         GGGLTLAS  N TCPL VVQ     SNG  + F+ VNP    +
Sbjct  1    GVDYYILPVFRGR----GGGLTLASTGNETCPLDVVQEQQEVSNGLPLTFTPVNPKKGVI  56

Query  334  QESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDED  513
            + S DHNIKFSA +ICV STLW+L+  E +G+  V TGG EGNPGR+T+ NWFK+ + ED
Sbjct  57   RVSTDHNIKFSASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYED  116

Query  514  AYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
             YKL +CPTVCD C+PVCGD+GI + +G R LA++D P +V+FKKA
Sbjct  117  DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDVPFKVMFKKA  162



>ref|XP_009627067.1| PREDICTED: miraculin [Nicotiana tomentosiformis]
Length=205

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 128/209 (61%), Gaps = 6/209 (3%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK  ++F    +   S       A      V D +G+++ TGVDYYILP         GG
Sbjct  1    MKTNQLFLPFLIFTISFNSFLSSAAEAPPAVIDIAGKKLRTGVDYYILPVVRGR----GG  56

Query  211  GLTLASGPNTTCPL-LVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVM  387
            GLTL S  N +CPL  VVQ      NG  + F+ VNP    ++ES D NIKFSA SICV 
Sbjct  57   GLTLDSTGNESCPLDAVVQEHHEIKNGLPLTFTPVNPKKGVIRESTDLNIKFSAASICVQ  116

Query  388  STLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
            +TLW+LD   E TGKY +  GG EGNPGR+TISNWFK+ + E  YKL YCPTVC+ C+ +
Sbjct  117  TTLWKLDDFDEATGKYFITIGGNEGNPGRETISNWFKIDKFERDYKLVYCPTVCNFCKVI  176

Query  565  CGDLGILVVDGIRILAITDKPLRVVFKKA  651
            C D+GI + DG R LA++D P +V+FK A
Sbjct  177  CKDVGIFIQDGTRRLALSDVPFKVMFKNA  205



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 129/201 (64%), Gaps = 6/201 (3%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            F   L A S KL  + A    + V D +G ++ TGVDYYILP         GGGLTLAS 
Sbjct  11   FCFLLFAFSAKLRSVAADAAPSPVLDITGNKLQTGVDYYILPVIRGR----GGGLTLAST  66

Query  232  PN-TTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-  405
             N T+CPL VVQ  +  SNG  ++FS VN +   V+ S D NIKFSA +ICV ST+W+L 
Sbjct  67   SNKTSCPLDVVQEQNEVSNGLPLKFSPVNVTKGVVRVSTDLNIKFSATTICVQSTVWKLG  126

Query  406  DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
               E TG++ V +GG EGNPGR T SNWFK+ +  D YKL +CPTVC+ C+ +CGD+GI 
Sbjct  127  KFDEQTGQWFVTSGGVEGNPGRQTTSNWFKIEKFGDDYKLVFCPTVCNFCKVICGDVGIF  186

Query  586  VVDGIRILAITDKPLRVVFKK  648
              DG R LA++D P R +FKK
Sbjct  187  FQDGKRRLALSDVPFRAMFKK  207



>ref|XP_010663911.1| PREDICTED: miraculin-like [Vitis vinifera]
Length=209

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 123/190 (65%), Gaps = 3/190 (2%)
 Frame = +1

Query  82   KLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVV  261
            K   + A+   + V D  G+++ + VD YILP        GGGGLTLAS    TCPL VV
Sbjct  23   KPFPVAAEAAPDPVLDIEGKKLRSEVDCYILPVI---RRRGGGGLTLASTGKETCPLDVV  79

Query  262  QSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVG  441
            Q     SNG  + F  VNP    ++ S DHNI+FSA +IC+ ST+W+L+  E +G+  V 
Sbjct  80   QEQHEVSNGLPLMFIPVNPKKGVIRVSTDHNIEFSAATICIQSTVWKLEYDESSGQQFVT  139

Query  442  TGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITD  621
            TGG EGNPGR T+SNWFK+ + ED   L +CPTVCD C+PVCGD+ I + DG R LA++D
Sbjct  140  TGGVEGNPGRGTLSNWFKIEKYEDDNNLVFCPTVCDFCKPVCGDIVIYIQDGYRRLALSD  199

Query  622  KPLRVVFKKA  651
             P +V+FKKA
Sbjct  200  VPFKVMFKKA  209



>ref|XP_004235409.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=201

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 6/206 (3%)
 Frame = +1

Query  37   MEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGL  216
            M+ V FLL  +  +I  L + AQ +A  + D SG  V TGV+YYILPA   GN   GGGL
Sbjct  1    MKAVPFLLVALLSTIFFL-VNAQDVAEPILDVSGNAVRTGVNYYILPAGR-GN---GGGL  55

Query  217  TLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTL  396
             +AS  N T PL+V Q+ D S  G  VQFS V+P    ++ S D N+KF+++ I   ST+
Sbjct  56   QVASIKNRTNPLVVSQNVDDSVIGVNVQFSPVDPKENTIRLSTDMNVKFTSMEISDSSTV  115

Query  397  WRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDL  576
            WR++ + I  +Y+V  GG EGNPGR+T+ NWF + + EDAYKL YCP VC+ CRP CG++
Sbjct  116  WRINTELIPQRYLVTIGGVEGNPGRETLGNWFNIDKYEDAYKLVYCPVVCETCRPFCGEI  175

Query  577  GILVVDGIRILAI-TDKPLRVVFKKA  651
            GIL   G R+L +  D PL+V F KA
Sbjct  176  GILEESGKRVLFVGRDPPLKVTFHKA  201



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 126/196 (64%), Gaps = 5/196 (3%)
 Frame = +1

Query  67   IAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTC  246
            IA +   L   A+   + V D  G+++ +GVDYYILP         GGGLT+AS  N TC
Sbjct  14   IALAFNPLPGAAEAAPDPVLDIEGKQLRSGVDYYILPVIRGR----GGGLTVASVRNKTC  69

Query  247  PLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITG  426
            PL VVQ     S+G  + F+ VNP    ++ S DHNIKFSA +IC  ST+W+L+  E TG
Sbjct  70   PLDVVQDKLEVSHGLPLTFTPVNPKQDVIRVSTDHNIKFSAATICAQSTVWKLEYDESTG  129

Query  427  KYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRI  606
            +  + TGG EGNPGR T+SNWFK+ +  D YKL +CPTVC+ C+ +C D+G+ +  G R 
Sbjct  130  QRFITTGGVEGNPGRGTLSNWFKIEKYGDDYKLVFCPTVCNFCKVICRDVGVYIQKGYRR  189

Query  607  LAI-TDKPLRVVFKKA  651
            LA+ TD P RV+FKKA
Sbjct  190  LALTTDAPFRVMFKKA  205



>ref|XP_009614755.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=210

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 134/202 (66%), Gaps = 8/202 (4%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLL  ++ S  L  ++AQ + + V D SG  V TGV+YYILPA   GN   GGGL +AS 
Sbjct  13   FLLVTLSTSF-LFLVKAQDVPDPVLDVSGNAVRTGVNYYILPAG-QGN---GGGLQVASI  67

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             N T PL+V Q  D SS G  +QFS VNP+   +  S D N+KF+++ I   ST+WR++ 
Sbjct  68   RNRTNPLVVSQHADESSIGGYLQFSPVNPNENIIGISTDLNVKFTSIHISDSSTVWRINT  127

Query  412  KEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVV  591
            + I  +Y+V  GG EGNPGR+T+SNWF++ + EDAYKL YCP VC+ CRP CG++GILV 
Sbjct  128  ELIPQRYLVTVGGVEGNPGRETLSNWFRIDKYEDAYKLVYCPGVCETCRPFCGEIGILVE  187

Query  592  DGIRILAI---TDKPLRVVFKK  648
               R+L I   +D+PL+V F K
Sbjct  188  GSKRVLFIGSRSDQPLKVTFHK  209



>ref|XP_009782174.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=208

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 132/200 (66%), Gaps = 6/200 (3%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLL  ++ S   L ++AQ +   V D SG  V TGV+YYILPA   GN   GGGL +AS 
Sbjct  13   FLLVALSTSFSFL-VKAQDVPEPVLDVSGNAVRTGVNYYILPAGR-GN---GGGLQVASI  67

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             N T PL+V Q  D SS G  +QFS  NP+   +  S D N+KF+++ I   ST+WR++ 
Sbjct  68   RNRTNPLVVSQHADESSIGGYLQFSPANPNENIIGISTDLNVKFTSIHISDSSTVWRINT  127

Query  412  KEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVV  591
            + I  +Y+V  GG EGNPGR+T+SNWFK+ + EDAYKL YCP VC+ CRP CGD+GILV 
Sbjct  128  EIIPQRYLVTVGGVEGNPGRETLSNWFKIDKYEDAYKLVYCPGVCETCRPFCGDIGILVE  187

Query  592  DGIRILAI-TDKPLRVVFKK  648
               R+L + +D+PL+V F K
Sbjct  188  GSKRVLFVRSDQPLKVTFHK  207



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 124/190 (65%), Gaps = 7/190 (4%)
 Frame = +1

Query  85   LLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQ  264
            LLC  A    + V D SG+++ TG DYYILP         GGGLTLAS  N +CPL VVQ
Sbjct  12   LLC--ANAAPDPVLDISGKKLRTGTDYYILPVFRGR----GGGLTLASTGNESCPLDVVQ  65

Query  265  SPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVG  441
                 S+G  V FS VN     V+ S D NIKFSA +ICV  TLW+LD   + T ++ V 
Sbjct  66   EQLEVSDGLPVTFSPVNIKKGVVRVSTDQNIKFSAATICVQPTLWKLDSFDDSTRQWFVT  125

Query  442  TGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITD  621
            TGG EGNPGR+TI NWFK+ + ED YKL +CPTVCD C+ +C D+G+ +  G+R LA++D
Sbjct  126  TGGVEGNPGRETIDNWFKIEKYEDDYKLVFCPTVCDFCKVMCRDVGVFIDGGVRRLALSD  185

Query  622  KPLRVVFKKA  651
             P +V+FK+A
Sbjct  186  VPFKVMFKRA  195



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 128/202 (63%), Gaps = 6/202 (3%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            F   L A S K   + A    + V D +G ++ TGV+YYILP         GGGLTLAS 
Sbjct  11   FCFLLFACSAKQGSVAADAAPSPVLDITGNKLQTGVNYYILPVIRGR----GGGLTLAST  66

Query  232  PN-TTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-  405
             N T+CPL VVQ  +  SNG +++FS VN +   V  S D NIKFSA +ICV ST+W+L 
Sbjct  67   SNKTSCPLDVVQEQNEVSNGLSLKFSPVNVTKGVVLVSTDLNIKFSATTICVQSTVWKLG  126

Query  406  DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
               E TG++ V +GG EGNPGR T SNWFK+ +  D YKL +CPTVC+ C+ +C D+GI 
Sbjct  127  KFDEQTGQWFVTSGGVEGNPGRQTTSNWFKIEKFGDDYKLVFCPTVCNFCKVICRDVGIF  186

Query  586  VVDGIRILAITDKPLRVVFKKA  651
              DG R LA++D P R +FKKA
Sbjct  187  FQDGKRRLALSDVPFRAMFKKA  208



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 130/209 (62%), Gaps = 6/209 (3%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+ ++FF   ++A S   L   A      V D  G+ + TGVDYYILP         GG
Sbjct  1    MKINQLFFPFLILAISFNSLLSSAAESPPEVVDIDGKILRTGVDYYILPVVRGR----GG  56

Query  211  GLTLASGPNTTCPL-LVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVM  387
            GLT+ S  +  CPL  VVQ  +    G  + F+ V+P    ++ES D NI FSA SICV 
Sbjct  57   GLTMDSIGDKMCPLDAVVQEHNEIDQGLPLTFTPVDPKKGVIRESTDLNIIFSANSICVQ  116

Query  388  STLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
            +T W+LD   E TG+Y +  GG++GNPG +TISNWFK+ + +  YKL YCPTVCD C+ +
Sbjct  117  TTQWKLDDFDETTGQYFITLGGDQGNPGVETISNWFKIEKYDRDYKLLYCPTVCDFCKVI  176

Query  565  CGDLGILVVDGIRILAITDKPLRVVFKKA  651
            C D+GI + DG+R LA++D P +V+FKKA
Sbjct  177  CRDIGIFIQDGVRRLALSDVPFKVMFKKA  205



>emb|CBI35471.3| unnamed protein product [Vitis vinifera]
Length=2095

 Score =   197 bits (502),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 118/167 (71%), Gaps = 4/167 (2%)
 Frame = +1

Query  151   TGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTN  330
             +GVDYYILP         GGGLTLAS  N TCPL VVQ     SNG  + F+ VNP    
Sbjct  1933  SGVDYYILPVFRGR----GGGLTLASTGNETCPLDVVQEQQEVSNGLPLTFTPVNPKKGV  1988

Query  331   VQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDE  510
             ++ S DHNIKFSA +ICV STLW+L+  E +G+  V TGG EGNPGR+T+ NWFK+ + E
Sbjct  1989  IRVSTDHNIKFSASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYE  2048

Query  511   DAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
             D YKL +CPTVCD C+PVCGD+GI + +G R LA++D P +V+FKKA
Sbjct  2049  DDYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDVPFKVMFKKA  2095



>gb|AAQ96377.1| miraculin-like protein [Solanum palustre]
Length=209

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 130/211 (62%), Gaps = 8/211 (4%)
 Frame = +1

Query  28   KMKMEKVFF-LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG  204
            KMK  ++F   L L+  S   L   A+    VV D  G+ + TGVDYYILP         
Sbjct  4    KMKTNQLFLPFLILVISSNSFLSSAAESPPEVV-DIDGKILRTGVDYYILPVVRGR----  58

Query  205  GGGLTLASGPNTTCPL-LVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSIC  381
            GGGLT+ S  +  CPL  VVQ       G  + F+ VNP    ++ES D NI FSA SIC
Sbjct  59   GGGLTMDSIGDKICPLDAVVQEHQEIDQGLPLTFTPVNPKKGVIRESTDLNIIFSANSIC  118

Query  382  VMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICR  558
            V +T W+LD   E TG+Y +  GG +GNPGR+TISNWFK+ + +  YKL YCPTVCD C+
Sbjct  119  VQTTQWKLDDFDETTGQYFITLGGNQGNPGRETISNWFKIEKFDRDYKLLYCPTVCDFCK  178

Query  559  PVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
             +C ++GI + DG+R LA++D P +V+FKKA
Sbjct  179  VICKEIGIFIQDGVRRLALSDVPFKVMFKKA  209



>ref|XP_006353931.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=208

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 131/204 (64%), Gaps = 7/204 (3%)
 Frame = +1

Query  49   FFLLFLIAQ--SIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTL  222
            F + FL+    S     ++AQ +A  V D SG  V  GV+YYILPA   GN   GGGL +
Sbjct  9    FIVPFLLVTLLSTTFFLVKAQDVAEPVLDVSGNAVRRGVNYYILPAGR-GN---GGGLQV  64

Query  223  ASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWR  402
            AS  N T PL+V Q+ D S  G  VQFS V+P    V+ S+D N+KF+++ I   ST+WR
Sbjct  65   ASIRNRTNPLVVSQNADESVIGVNVQFSPVDPKENTVRLSIDMNVKFTSMVISDSSTVWR  124

Query  403  LDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGI  582
            ++ + I  +Y+V  GG EGNPGR+T+ NWF + + EDAYKL YCP VC+ICRP CG++GI
Sbjct  125  INTELIPERYLVTIGGVEGNPGRETLGNWFNIDKYEDAYKLVYCPVVCEICRPFCGEIGI  184

Query  583  LVVDGIRILAI-TDKPLRVVFKKA  651
            L  +G R+L +  D PL+V F K 
Sbjct  185  LEENGKRVLFVGRDPPLKVTFHKV  208



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 128/211 (61%), Gaps = 9/211 (4%)
 Frame = +1

Query  31   MKMEKVF--FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG  204
            MK  ++F  F LF I  +   L   A+  A V+ D+    V  GVDYYILP         
Sbjct  1    MKTTQLFLSFFLFTIFANRSPLSAAAEEPAPVL-DTDRNLVRAGVDYYILPVIRGR----  55

Query  205  GGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICV  384
            GGGLTLAS  N TCPL VVQ      NG  + F  VNP    V+ S D NIKFS  +ICV
Sbjct  56   GGGLTLASTGNETCPLDVVQEQLEVRNGLPLTFRPVNPKKGVVRVSTDQNIKFSGATICV  115

Query  385  MSTLWRLDLKEI-TGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRP  561
             ST+W+LD  +  TGKY + TGG EG PGR+TISNWFK+    D YKL +CPTVC+ C+ 
Sbjct  116  QSTVWKLDNYDASTGKYFITTGGVEGKPGRETISNWFKIETYGDDYKLVFCPTVCNYCKV  175

Query  562  VCGDLGILVVDGIRILAIT-DKPLRVVFKKA  651
            +C D+GI + DG R LA+T D P RV+ KKA
Sbjct  176  ICKDVGIFMQDGKRRLALTEDAPFRVMLKKA  206



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 127/209 (61%), Gaps = 6/209 (3%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+ ++F    ++A S       A      V D  G+ + TGVDYYILP         GG
Sbjct  1    MKINQLFLPFLILAISSNSFLSSAAESPPEVVDIDGKILRTGVDYYILPVVRGR----GG  56

Query  211  GLTLASGPNTTCPL-LVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVM  387
            GLT+ S  +  CPL  VVQ       G  + F+ VNP    ++ES D NI FSA SICV 
Sbjct  57   GLTMDSIGDKICPLDAVVQEHHEIDQGLPLTFTPVNPKKGVIRESTDLNIIFSANSICVQ  116

Query  388  STLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
            +T W+LD   E TG+Y +  GG +GNPGR+T+SNW K+ + +  YKL YCPTVCDIC+ +
Sbjct  117  TTQWKLDDFDETTGQYFITLGGTQGNPGRETVSNWIKIEKFDRDYKLLYCPTVCDICKVI  176

Query  565  CGDLGILVVDGIRILAITDKPLRVVFKKA  651
            C D+GI + DG+R LA++D P +V+FKKA
Sbjct  177  CKDIGIFIQDGVRRLALSDAPFKVMFKKA  205



>emb|CAN63617.1| hypothetical protein VITISV_041430 [Vitis vinifera]
Length=220

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 119/184 (65%), Gaps = 3/184 (2%)
 Frame = +1

Query  82   KLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVV  261
            K   + A+   + V D+ G+++ + VDYYIL         GGGGLTLAS  N TCPL VV
Sbjct  18   KPFPVAAEAAPDPVLDTEGKKLQSEVDYYILSVI---RRRGGGGLTLASTGNKTCPLDVV  74

Query  262  QSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVG  441
            Q  +  SNG  + FS VNP    ++ S DHNI+FSA +ICV ST+W+L+  E +G++   
Sbjct  75   QEQNEVSNGLTLMFSPVNPKKGVIRVSTDHNIEFSAATICVQSTVWKLEYDESSGQWFFT  134

Query  442  TGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITD  621
            TG  EGN GR T+SN FK+ + ED   L +CPTVCD C+PVCGD+GI + DG R LA++D
Sbjct  135  TGWVEGNLGRGTLSNQFKIEKYEDDNNLVFCPTVCDFCKPVCGDIGIYIQDGYRHLALSD  194

Query  622  KPLR  633
             P +
Sbjct  195  VPFQ  198



>ref|XP_010537532.1| PREDICTED: miraculin [Tarenaya hassleriana]
Length=202

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 132/208 (63%), Gaps = 7/208 (3%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+  +  LL L+  +  ++ +     +  V+D  G+ V  G+DYYILP         GG
Sbjct  1    MKLPTMAQLLSLLV-TFTVVSVAIDAASEPVRDIRGKPVRAGLDYYILPVVRGR----GG  55

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GLT+AS  N TCP+ VVQ     S GF + FS  + S   V  S D N+KFSA +ICV S
Sbjct  56   GLTMASAGNKTCPMSVVQDKFEVSPGFPLTFSPSDKSRI-VGISTDQNVKFSAATICVQS  114

Query  391  TLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
            T+W+L+   E T ++ V TGG EGNPGR+TISNWFK+ +  + YKL +CPTVC+ C+ +C
Sbjct  115  TVWKLESFDETTKQWFVTTGGVEGNPGRETISNWFKIEKLGNDYKLVFCPTVCNFCKVIC  174

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+G+ V DG R LA++D PL+V+FK+A
Sbjct  175  RDIGVFVQDGKRRLALSDVPLKVMFKRA  202



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 126/205 (61%), Gaps = 11/205 (5%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            F+LF I  +I LL   A+    V+ D SG+E+  GV+YYILP         GGGL+LAS 
Sbjct  12   FILFSI-HTIPLLSSAAEAPPPVL-DISGKELRAGVNYYILPVIRGR----GGGLSLAST  65

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             N TCPL VVQ       G  + F  V+P    V+ S DHNIKFSA +ICV ST+WRLD 
Sbjct  66   GNNTCPLSVVQEQSELKKGLPLTFHPVDPKKGVVRLSTDHNIKFSASTICVQSTVWRLDN  125

Query  412  KEITGKYVVGTGGEEGNPGRDTISNWFKVRR-DEDAYKLYYCPTVCDICRPVCGDLGILV  588
             E TGKY V TGG EGNPG  +ISNWFK+       YKL +CPTVC+ C+ +C D+GI+V
Sbjct  126  DESTGKYFVNTGGVEGNPGSGSISNWFKIEAYGSSDYKLLFCPTVCNFCKVICRDVGIVV  185

Query  589  VDGIRILAIT----DKPLRVVFKKA  651
             DG R L +T      P  ++FKKA
Sbjct  186  QDGKRRLGLTLTDDVTPFPIMFKKA  210



>ref|XP_009782173.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=252

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 135/212 (64%), Gaps = 12/212 (6%)
 Frame = +1

Query  31   MKME------KVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADG  192
            MKME       V FLLF ++ S+    ++AQ ++  V D SG  V  G +Y I+PA    
Sbjct  1    MKMEVNVRRFMVPFLLFALSTSLSFFLVKAQNVSEPVLDVSGNAVRKGANYLIVPAGRGS  60

Query  193  NTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAV  372
                 GGL ++S  NTT PL+V Q+  +SS G  VQF  VNP    ++ S D NIK++A+
Sbjct  61   ----PGGLDISSIRNTTNPLVVSQNTQNSS-GTDVQFIPVNPKENTIRISTDLNIKYTAM  115

Query  373  SICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDI  552
            +I   ST+WR++ + I  +Y+V  GG EGNPGR+T+SNWFK+ + EDAYK  YCP VC+ 
Sbjct  116  TISDSSTVWRINTELIPQRYLVTVGGVEGNPGRETLSNWFKIDKYEDAYKFAYCPGVCET  175

Query  553  CRPVCGDLGILVVDGIRILAI-TDKPLRVVFK  645
            CRP CGD+GILV    R+L + +++PL+V F+
Sbjct  176  CRPFCGDIGILVEGSKRVLFVGSNQPLKVKFE  207



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 124/201 (62%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLAS-  228
            L+ L A +   L ++     + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFTATPLPVKGNAQPDPVLDIAGKQLRAGSKYYILPV-----TKGRGGGLTLAGR  64

Query  229  GPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
            G N TCPL VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   GNNKTCPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                  G+++V TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI 
Sbjct  125  NFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D P +VVFKK
Sbjct  185  INGGVRRLALSDIPFKVVFKK  205



>ref|XP_010101167.1| hypothetical protein L484_005403 [Morus notabilis]
 gb|EXB87528.1| hypothetical protein L484_005403 [Morus notabilis]
Length=197

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 117/180 (65%), Gaps = 5/180 (3%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFA  294
            + V D SG+++  GVDYYILP         GGGL LA+  N T PL VVQ     S+GF 
Sbjct  22   SAVLDLSGKKLQKGVDYYILPVIRGR----GGGLKLANARNKTSPLDVVQDQFEVSSGFP  77

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGR  471
            + FS  N + + V  S D NIKFSA + C  ST+W+LD   E  G++ V +GG EGNPGR
Sbjct  78   LTFSPANQNQSFVCLSTDLNIKFSAATTCAQSTVWKLDSFDESLGQWFVTSGGVEGNPGR  137

Query  472  DTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
             TISNWFK+ +  D YKL +CPTVC+ C+ +C D+GI + DGIR LA++D+P  V FK+A
Sbjct  138  QTISNWFKIEKYNDDYKLVFCPTVCNFCKVLCRDVGIYIKDGIRRLALSDQPFIVGFKRA  197



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 123/201 (61%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLAS-  228
            L+ L A +   L ++     + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFTATPLPVKGNAQPDPVLDIAGKQLRAGSKYYILPV-----TKGRGGGLTLAGR  64

Query  229  GPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
            G N TCPL VVQ   S  NG  V FS VNP    V+ES D NIK  A + C  ST+W+LD
Sbjct  65   GNNKTCPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDINIKLDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                  G+++V TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI 
Sbjct  125  NFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D P +VVFKK
Sbjct  185  INGGVRRLALSDIPFKVVFKK  205



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score =   171 bits (433),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 122/201 (61%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLA-S  228
            L+ L A     L +      + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFIATPLPVRGNASPDPVLDIAGKQLRAGSKYYILPV-----TKGQGGGLTLAGR  64

Query  229  GPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
              N TCPL VVQ   S  NGF V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   SNNKTCPLDVVQEQHSLRNGFPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                  G+++V TGG EGNPG  T+ NWFK+ +    YKL +CP+VC+ CR +C D+GI 
Sbjct  125  NFDAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D P +VVFKK
Sbjct  185  INGGVRRLALSDVPFKVVFKK  205



>ref|XP_009614754.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=251

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 138/212 (65%), Gaps = 13/212 (6%)
 Frame = +1

Query  31   MKME------KVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADG  192
            MKME       V FLLF ++ S   L ++AQ ++  V D SG  V  G +Y I+PA   G
Sbjct  1    MKMEVNVRRFMVPFLLFALSTSFFFL-VKAQNVSEPVLDVSGNSVRKGANYLIVPAGR-G  58

Query  193  NTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAV  372
            N+   GGL +AS  NTT  LLVV     +S+G  +QFS VNP   N++ S D NIK++A+
Sbjct  59   NS---GGLDVASIRNTTN-LLVVSQNTQNSSGTYLQFSPVNPKENNIRTSTDLNIKYTAM  114

Query  373  SICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDI  552
             I  +ST+WR++ + I  + +V  GG EGNPGR+T+SNWFK+ + EDAYKL YCP VC+ 
Sbjct  115  IISDLSTVWRINTELIPQRNLVTVGGVEGNPGRETLSNWFKIDKYEDAYKLVYCPGVCET  174

Query  553  CRPVCGDLGILVVDGIRILAI-TDKPLRVVFK  645
            CRP CGD+GILV    R++ + +++PL+V F+
Sbjct  175  CRPFCGDIGILVEGSKRVMFVGSNQPLKVKFE  206



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 119/190 (63%), Gaps = 8/190 (4%)
 Frame = +1

Query  88   LCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLAS-GPNTTCPLLVV  261
            L ++     + V D SG+++  G  YYILP      T+G GGGLTLA    N TCP+ VV
Sbjct  21   LPVKGNAQPDPVLDISGKQLRAGSKYYILPV-----TKGRGGGLTLAGRSNNKTCPVDVV  75

Query  262  QSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVV  438
            Q   S  NGF V FS VNP    V+ES D NIKF A + C  ST+W+LD      G+++V
Sbjct  76   QEQHSFKNGFPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLDNFDAAFGQWLV  135

Query  439  GTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAIT  618
             TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI +  G+R LA++
Sbjct  136  TTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALS  195

Query  619  DKPLRVVFKK  648
            D P +VVFKK
Sbjct  196  DVPFKVVFKK  205



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 122/201 (61%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLASG  231
            L+ L A     L +      + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFIATPLPVRGNASPDPVLDVAGKKLRAGSKYYILPV-----TKGQGGGLTLAGR  64

Query  232  PNT-TCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
             N  TCPL VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   SNNKTCPLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDFNIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                  G+++V TGG EGNPG  T+ NWFK+ +    YKL +CP+VC+ CR +C D+GI 
Sbjct  125  NFDAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D PL+VVFKK
Sbjct  185  INGGVRRLALSDVPLKVVFKK  205



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 123/201 (61%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLA-S  228
            L+ L A     L +      + V D +G+++ TG  YYILP      T+G GGGLTLA  
Sbjct  53   LILLFAFIATPLPVNGNASPDPVLDIAGKQLRTGSKYYILPV-----TKGRGGGLTLAGR  107

Query  229  GPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
              N TCPL VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  108  SNNKTCPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD  167

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                + G++++ TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI 
Sbjct  168  NFDAVLGQWLLTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIF  227

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D P ++VFKK
Sbjct  228  INGGVRRLALSDVPFKIVFKK  248



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 122/201 (61%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLASG  231
            L+ L A     L +     A+ V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFIATPLPVRGNASADPVLDIAGKQLRAGSKYYILPV-----TKGRGGGLTLAGR  64

Query  232  PNT-TCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
             N  TCP+ VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   SNNKTCPVDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDINIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                  G+++V TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI 
Sbjct  125  NFDAAIGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D P +VVFKK
Sbjct  185  INGGVRRLALSDVPFKVVFKK  205



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 114/184 (62%), Gaps = 11/184 (6%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+  +F   FL++    L   E      VV D  G E+  GV+YYI P    G T+  G
Sbjct  9    MKLILLFSAFFLLSSLTTLAAAE------VVLDRDGNELRRGVEYYIYP----GITDVAG  58

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GLTLAS  N +CPL V  +   +SNG  + F   +P    +  S D NI FSAV+ICV S
Sbjct  59   GLTLASR-NHSCPLDVTLAISPTSNGLPLTFLPADPEEDTINTSTDLNIVFSAVTICVQS  117

Query  391  TLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCG  570
            T+W+LD  +  G++ V TGG  GNPGR+T++NWFK+  D  AYKL +CPTVCDIC+PVCG
Sbjct  118  TVWKLDFDDAAGRFYVTTGGVAGNPGRETLANWFKIENDRGAYKLVFCPTVCDICKPVCG  177

Query  571  DLGI  582
            +LG+
Sbjct  178  NLGV  181



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 122/201 (61%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLASG  231
            L+ L A     L +      + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFIATPLPVRGNASPDPVLDIAGKQLRAGSKYYILPV-----TKGRGGGLTLAGR  64

Query  232  PNT-TCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
             N  TCPL VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   SNNKTCPLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                  G+++V TGG EGNPG  T+ NWFK+ +    YKL +CP+VC+ CR +C D+GI 
Sbjct  125  NFDTAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D PL+VVFKK
Sbjct  185  INGGVRRLALSDVPLKVVFKK  205



>dbj|BAA82843.1| miraculin homologue [Solanum melongena]
Length=160

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 107/164 (65%), Gaps = 6/164 (4%)
 Frame = +1

Query  136  GQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPL-LVVQSPDSSSNGFAVQFSSV  312
            G+ + TG+DYYILP         GGGLT+ S  N TCPL  VVQ  +    G  + F+  
Sbjct  1    GKILRTGIDYYILPVVRGR----GGGLTMDSIGNKTCPLDAVVQEQEEVKQGLPLTFTPF  56

Query  313  NPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNW  489
            NP    ++ES D NI FSA SICV +T W+LD   E TGKY +  GG +GNPGR+TISNW
Sbjct  57   NPKKGVIRESTDLNIIFSANSICVQTTQWKLDNFDETTGKYFITLGGNQGNPGRETISNW  116

Query  490  FKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITD  621
            FK+ + E  YKL YCPTVCD C+ +C D+GI + DG+R LA++D
Sbjct  117  FKIEKFERDYKLVYCPTVCDFCKVICKDIGIFIQDGVRRLALSD  160



>ref|XP_010279489.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=208

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 115/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  100  AQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSS  279
            AQ     V D+ G+++ +   YYILPA    N+   GGL   S  N TCP +V+Q  D  
Sbjct  26   AQDEPEAVLDTMGRQLYSTATYYILPA----NSGMAGGLNFESTQNGTCPFVVIQDEDQE  81

Query  280  SNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEE  456
            S+G  + FS VNP+   +  S DHNI+F+  +     T+W L+ L E T  + V T G  
Sbjct  82   SDGLPLSFSPVNPTEEIIHVSTDHNIRFAIETSLPQPTVWSLEGLDESTNTFSVDTCGSI  141

Query  457  GNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITD--KPL  630
            GNPGR T+SNWF + R +D YKL +CPTVCD CRPVCG+LGI++ DGIR LA+    +PL
Sbjct  142  GNPGRGTLSNWFTIERYDDNYKLVFCPTVCDFCRPVCGELGIVIQDGIRHLAMRSGLEPL  201

Query  631  RVVFKKA  651
             + FK+A
Sbjct  202  EIKFKRA  208



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 118/190 (62%), Gaps = 8/190 (4%)
 Frame = +1

Query  88   LCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLA-SGPNTTCPLLVV  261
            L ++     + V D SG+++  G  YYILP      T+G GGGLTLA    N TCP+ VV
Sbjct  21   LPVKGNAQPDPVLDISGKQLRAGSKYYILPV-----TKGRGGGLTLAGRSNNKTCPVDVV  75

Query  262  QSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVV  438
            Q   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD      G++VV
Sbjct  76   QEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLDNFDAAFGQWVV  135

Query  439  GTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAIT  618
             TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI +  G+R LA++
Sbjct  136  TTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALS  195

Query  619  DKPLRVVFKK  648
            D P +VVFKK
Sbjct  196  DVPFKVVFKK  205



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 121/201 (60%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLA-S  228
            L+ L A     L +      + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFIATPLPVRGNASPDPVLDIAGKQLRAGSKYYILPV-----TKGRGGGLTLAGR  64

Query  229  GPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
              N TCP+ VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   SNNKTCPVDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                  G+++V TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI 
Sbjct  125  NFDAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGNYKLVYCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D P +VVFKK
Sbjct  185  INGGVRRLALSDVPFKVVFKK  205



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 122/202 (60%), Gaps = 8/202 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLA-S  228
            L+ L A     L +      + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFIATPLPVRGNASPDPVLDIAGKQLRAGSKYYILPV-----TKGRGGGLTLAGR  64

Query  229  GPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
              N TCPL VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   SNNKTCPLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDINIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                  G+++V TGG EGNPG  T+ NWFK+ +    YKL +CP+VC+I R +C D+GI 
Sbjct  125  NFDAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCPSVCNIFRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKKA  651
            +  G+R LA++D P +VVFKKA
Sbjct  185  INGGVRRLALSDVPFKVVFKKA  206



>ref|XP_009401850.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=203

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 122/200 (61%), Gaps = 6/200 (3%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGP  234
            LL L+   +  L  EA I A+V +D+  + +  G +YY+LP         GGGL+LA+  
Sbjct  3    LLILLPIFLYALSAEATIFASV-RDTDRRSLRPGHEYYVLPLIRGH----GGGLSLAARS  57

Query  235  NTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLK  414
            N TCPL V Q     S+G  + FS VNP    V+ S D N+ F+A +ICV ST+WRL   
Sbjct  58   NDTCPLAVAQESSEVSDGLPLTFSPVNPKDKYVKMSTDLNVWFAAETICVQSTVWRLGDA  117

Query  415  EITGKYVVGTGGEEGNPGRDTISNWFKVRR-DEDAYKLYYCPTVCDICRPVCGDLGILVV  591
            E TG+  V TGG +G+PG  T+SNWFK+ R  E  YKL +CP+VC  C+ VCGD+G+ V 
Sbjct  118  EATGRRYVVTGGLKGDPGLATVSNWFKIERYGESDYKLVHCPSVCRFCKVVCGDVGVFVE  177

Query  592  DGIRILAITDKPLRVVFKKA  651
             G R L ++D+P  V+FK A
Sbjct  178  GGKRWLGLSDEPFPVMFKNA  197



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 123/201 (61%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLASG  231
            L+ L A     L +      + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFIATPLPVNGNASPDPVVDIAGKQLRAGSKYYILPV-----TKGRGGGLTLAGR  64

Query  232  PNT-TCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
             N  TCPL VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   SNNKTCPLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                + G+++V TGG EGNPG  T+ NWFK+ +    YKL +CP+VC+ CR +C D+GI 
Sbjct  125  NFDAVLGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D PL+VVFKK
Sbjct  185  INGGVRRLALSDVPLKVVFKK  205


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 76/136 (56%), Gaps = 7/136 (5%)
 Frame = +1

Query  139  QEVLTGVDYYILPAAADGNTEGGGGLTLAS-GPNTTCPLLVVQSPDSSSNGFAVQFSSVN  315
            +++  G  +YIL AA  G    GGGLTL S G N T  L VVQ  +    G  + FS VN
Sbjct  204  KKLRVGSKHYIL-AAICGR---GGGLTLGSRGNNKTVLLHVVQEQNILKYGSPMTFSPVN  259

Query  316  PSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWF  492
            P +  ++ES+D NIKF  V   V ST+W+LD L +  G+ +   GG  GNPG  T  NWF
Sbjct  260  PKNGVIRESIDLNIKFEVVKTSVQSTVWKLDNLMQYWGR-ICAIGGVRGNPGPQTTRNWF  318

Query  493  KVRRDEDAYKLYYCPT  540
             + +    YKL + P+
Sbjct  319  MIEKFYGDYKLVFYPS  334



>emb|CDP20822.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   166 bits (420),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 114/184 (62%), Gaps = 4/184 (2%)
 Frame = +1

Query  100  AQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSS  279
            A+  +N V+D  G+EV+ G  YYILP            LTL S  N TCPL V+Q     
Sbjct  23   ARPASNAVRDIDGKEVIVGAHYYILPVIRGRGGG----LTLGSADNETCPLDVIQEQFEV  78

Query  280  SNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEG  459
              G  + F+ VN +   V  S D NIKF A +ICV ST+W+L+      +YV+ +GG EG
Sbjct  79   KRGLPLTFTPVNTTKGVVPVSTDLNIKFFAATICVQSTVWKLEFDADISQYVIVSGGIEG  138

Query  460  NPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVV  639
            NPGR+TISNWFK+ + +  YKL YCPTVC+ C+ +C D+GI V +G R LA++D P RVV
Sbjct  139  NPGRETISNWFKIEKYDQDYKLVYCPTVCNFCKVICRDVGIFVQNGRRRLALSDVPFRVV  198

Query  640  FKKA  651
             KKA
Sbjct  199  VKKA  202



>gb|AFL91227.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score =   165 bits (418),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 7/180 (4%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFA  294
            + V+D  G  V +G +YYILP         GGG+TLA   N +CPL VVQ      +G  
Sbjct  2    DAVRDXDGNLVXSGTEYYILPVFRGR----GGGVTLAPTRNESCPLDVVQEGFELDDGLP  57

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRD  474
            + F+ V+P    ++ES D NI FSA SIC+ S +W L+  E  G+ ++   G  GNPG +
Sbjct  58   LTFTPVDPKKGVIRESTDLNIIFSASSICIQSNVWMLE--EYEGQRIISGRGTAGNPGGE  115

Query  475  TISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
            TISNWFK+ + E+ YKL YCPTVCD+CRPVCGD+G++  + G R LAI+D P ++ F+KA
Sbjct  116  TISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  175



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score =   165 bits (417),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 7/180 (4%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFA  294
            + V+D  G  + +G +YYILP         GGG+TLA   N +CPL VVQ      NG  
Sbjct  2    DAVRDIDGNLLRSGTEYYILPVFRGR----GGGVTLAPTRNESCPLDVVQEGFELDNGLP  57

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRD  474
            + F+ V+P    ++ES D NI FSA SIC+ S +W L+  E  G+ ++   G  GNPG +
Sbjct  58   LTFTPVDPKKGVIRESTDLNIIFSASSICIQSNVWMLE--EYEGQRIISGRGTSGNPGGE  115

Query  475  TISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
            TISNWFK+ + E+ YKL YCPTVCD+CRPVCGD+G++  + G R LAI+D P ++ F+KA
Sbjct  116  TISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  175



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 121/201 (60%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLASG  231
            L+ L A +   L ++     + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFTATPLPVKGNAQPDPVLDIAGKQLRAGSKYYILPV-----TKGRGGGLTLAGR  64

Query  232  PNT-TCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
             N  TCPL VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   RNNKTCPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                  G+++V TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI 
Sbjct  125  NFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D P +VV  K
Sbjct  185  INGGVRRLALSDVPFKVVSSK  205



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 121/201 (60%), Gaps = 8/201 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLASG  231
            L+ L A     L +      + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFIATPLPVRGNASPDPVLDIAGKQLRAGSKYYILPV-----TKGRGGGLTLAGR  64

Query  232  PNT-TCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
             N  TC L VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   SNNKTCLLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                + G++++ TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI 
Sbjct  125  NFDAVLGQWLLTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITDKPLRVVFKK  648
            +  G+R LA++D P +VVFKK
Sbjct  185  INGGVRRLALSDVPFKVVFKK  205



>gb|AFL91233.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 7/180 (4%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFA  294
            + V+D  G  V +G +YYILP         GGG+TLA   N +CPL VVQ      +G  
Sbjct  2    DAVRDIDGNLVXSGTEYYILPVFRGX----GGGVTLAPTRNESCPLDVVQEGFELDDGLP  57

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRD  474
            + F+ V+P    ++ES D NI FSA SIC+ S +W L+  E  G+ ++   G  GNPG +
Sbjct  58   LTFTPVDPKKGVIRESTDLNIIFSASSICIQSNVWMLE--EYEGQRIISGRGTAGNPGGE  115

Query  475  TISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
            TISNWFK+ + E+ YKL YCPTVCD+CRPVCGD+G++  + G R LAI+D P ++ F+KA
Sbjct  116  TISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  175



>gb|AFL91231.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 7/180 (4%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFA  294
            + V+D  G  V +G +YYILP         GGG+TLA   N +CPL VVQ      +G  
Sbjct  2    DAVRDIDGNLVRSGTEYYILPVFRGR----GGGVTLAPTRNESCPLDVVQEGFELDDGLP  57

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRD  474
            + F+ V+P    ++ES D NI FSA SIC+ S +W L+  E  G+ ++   G  GNPG +
Sbjct  58   LTFTPVDPKKGVIRESTDLNIIFSASSICIQSNVWMLE--EYEGQRIISGRGTAGNPGGE  115

Query  475  TISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
            TISNWFK+ + E+ YKL YCPTVCD+CRPVCGD+G++  + G R LAI+D P ++ F+KA
Sbjct  116  TISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  175



>gb|AFL91232.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=172

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 113/178 (63%), Gaps = 7/178 (4%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V+D  G  V  G +YYILP         GGG+TLA   N +CPL VVQ      +G  + 
Sbjct  1    VRDIDGNLVXXGXEYYILPVFRGR----GGGVTLAPTRNESCPLDVVQEGFELDDGLPLT  56

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTI  480
            F+ V+P    ++ES D NI FSA SIC+ S +W L+  E  G+ ++   G  GNPG +TI
Sbjct  57   FTPVDPKKGVIRESTDLNIIFSASSICIQSNVWMLE--EYEGQRIISGRGTAGNPGGETI  114

Query  481  SNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
            SNWFK+ + E+ YKL YCPTVCD+CRPVCGD+G++  + G R LAI+D P ++ F+KA
Sbjct  115  SNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  172



>ref|XP_009110379.1| PREDICTED: miraculin-like [Brassica rapa]
Length=195

 Score =   163 bits (413),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 120/206 (58%), Gaps = 12/206 (6%)
 Frame = +1

Query  37   MEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGL  216
            M  +  +  L+A  I       + +  +V D  GQ + TG  YYILP         GGGL
Sbjct  1    MSSLLCIFLLVAVFISHRGATTEAVVELVTDIYGQRLRTGTKYYILPVVRGR----GGGL  56

Query  217  TLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTL  396
            T++   N TCP  V+Q     SNG  + FS  + S   ++ S D N KFSA S+      
Sbjct  57   TMSKAENKTCPKSVIQERFEVSNGMPLTFSPSDKSKV-IRVSTDLNFKFSATSV------  109

Query  397  WRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGD  573
            W LD + E T ++ +GT G EGNPGR T+ NWFK+ + ED YK+ +CP+VCDICR +C D
Sbjct  110  WNLDNVDEKTNQWFIGTCGVEGNPGRTTVGNWFKIDKYEDHYKIVFCPSVCDICRVMCRD  169

Query  574  LGILVVDGIRILAITDKPLRVVFKKA  651
            +G+ V DGIR L ++D PL+V+FK+A
Sbjct  170  VGVFVQDGIRRLVLSDVPLKVMFKRA  195



>ref|XP_009782172.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=252

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 133/213 (62%), Gaps = 16/213 (8%)
 Frame = +1

Query  31   MKME-----KVFFL-LFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADG  192
            MKME     ++F + L L+A S  L C+   + A  V D SG++V  G  Y I+PA   G
Sbjct  1    MKMEVNVRRRLFMVHLILVALSTSLFCL---VKAQDVLDVSGKDVRKGGYYRIIPAGR-G  56

Query  193  NTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKF-SA  369
            N   GGG+T+AS  N T PL+V Q  D S    + QFS  N +   ++ S D NIKF S 
Sbjct  57   N---GGGITVASIRNRTNPLVVSQHADESIISISTQFSPANSNENTIKISTDLNIKFTSE  113

Query  370  VSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCD  549
            +++   S +WR++ + I  +Y+V  GG EGNPGR+T+SNWFK+ + EDAYKL YCP VC+
Sbjct  114  ITLSNSSNVWRINTELIPQRYLVTVGGVEGNPGRETLSNWFKIDKYEDAYKLVYCPGVCE  173

Query  550  IC-RPVCGDLGILVVDGIRILAI-TDKPLRVVF  642
             C RP CGD+GILV    R+L + +DKPL+V F
Sbjct  174  TCSRPFCGDIGILVEGNERVLFVGSDKPLKVTF  206



>gb|AFL91228.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 112/180 (62%), Gaps = 7/180 (4%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFA  294
            + V+D  G  V  G +YYILP         GGG+TLA   N +CPL VVQ      +G  
Sbjct  2    DAVRDIDGNLVXXGXEYYILPXFRGR----GGGVTLAPTRNESCPLDVVQEGFELDDGLP  57

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRD  474
            + F+ V+P    ++ES D NI FSA SIC+ S +W L+  E  G+ ++   G  GNPG +
Sbjct  58   LTFTPVDPKKGVIRESTDLNIIFSASSICIQSNVWMLE--EYEGQRIISGRGTAGNPGGE  115

Query  475  TISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
            TISNWFK+ + E+ YKL YCPTVCD+CRPVCGD+G++  + G R L I D P ++ F+KA
Sbjct  116  TISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRXLXIXDVPFKIKFRKA  175



>ref|XP_006372633.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
 gb|ERP50430.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
Length=206

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 115/188 (61%), Gaps = 6/188 (3%)
 Frame = +1

Query  94   IEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPD  273
            + A      V D +G+ + TG  YYILP         GGGL +AS    TCPL VVQ   
Sbjct  23   VAATAAPEPVLDVTGKILRTGTSYYILPVIRGR----GGGLKMASTVRRTCPLDVVQDRY  78

Query  274  SSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGG  450
             +SNG  ++F+ VN     V+   D NI+FSA SIC  ST W+LD   E T ++ V T G
Sbjct  79   EASNGLPLKFTPVNTKKGVVRVHTDLNIRFSAASICHQSTAWKLDNYDEWTKQWFVTTDG  138

Query  451  EEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV-VDGIRILAITDKP  627
             EGNPG +T +NWFK+ + ED YKL +CPTVC  C+ +C D+GI V   G+R LA+T+ P
Sbjct  139  VEGNPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTNVP  198

Query  628  LRVVFKKA  651
            L+V+FKKA
Sbjct  199  LKVMFKKA  206



>gb|AFL91234.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=161

 Score =   159 bits (402),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 108/167 (65%), Gaps = 7/167 (4%)
 Frame = +1

Query  154  GVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNV  333
            G +YYILP         GGG+TLA   N +CPL VVQ      NG  + F+ V+P    +
Sbjct  1    GTEYYILPVFRGR----GGGVTLAPTRNESCPLDVVQEGFELDNGLPLTFTPVDPKKGVI  56

Query  334  QESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDED  513
            +ES D NI FSA SIC+ S +W L+  E  G+ ++   G  GNPG +TISNWFK+ + E+
Sbjct  57   RESTDLNIIFSASSICIQSNVWMLE--EYEGQRIISGRGTSGNPGGETISNWFKIEKYEN  114

Query  514  AYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
             YKL YCPTVCD+CRPVCGD+G++  + G R LAI+D P ++ F+KA
Sbjct  115  DYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  161



>dbj|BAA05474.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=125

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 91/125 (73%), Gaps = 1/125 (1%)
 Frame = +1

Query  280  SNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEE  456
             NG  + F+ VNP    ++ES D NIKFSA SICV +TLW+LD   E TGKY +  GG E
Sbjct  1    ENGLPLTFTPVNPKKGVIRESTDLNIKFSAASICVQTTLWKLDDFDETTGKYFITIGGNE  60

Query  457  GNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRV  636
            GNPGR+TISNWFK+ + E  YKL YCPTVC+ C+ +C D+GI + DGIR LA++D P +V
Sbjct  61   GNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDVGIFIQDGIRRLALSDVPFKV  120

Query  637  VFKKA  651
            +FKKA
Sbjct  121  MFKKA  125



>ref|XP_010279465.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=205

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 119/192 (62%), Gaps = 6/192 (3%)
 Frame = +1

Query  82   KLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVV  261
            KL  ++A      V+D++G ++ +GV YYI PA    N + GGG T  +  N  CP  VV
Sbjct  18   KLSPVKADASPPAVRDTAGHKLSSGVKYYIFPA----NPKKGGGFTFEATNNGKCPFGVV  73

Query  262  QSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFS-AVSICVMSTLWRL-DLKEITGKYV  435
            Q  +  S G  V+F  VNP    ++ S DHNIKF+  +S    S++W++ +  +  GK +
Sbjct  74   QDNNKLSKGLPVRFFPVNPKMDTIRVSTDHNIKFAIPISHPPSSSVWKVGEYSKWIGKQL  133

Query  436  VGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAI  615
            V T G  GNPGRDT+S+WFK+ + +D YKL +CP+VC  C+  C  +GI + DG+  LA+
Sbjct  134  VTTCGVLGNPGRDTLSSWFKIEKYDDDYKLVFCPSVCKSCKVFCKGVGIFIKDGVHHLAL  193

Query  616  TDKPLRVVFKKA  651
            TD PL+++FKKA
Sbjct  194  TDNPLKIMFKKA  205



>ref|XP_006372654.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
 gb|ERP50451.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
Length=206

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 115/188 (61%), Gaps = 6/188 (3%)
 Frame = +1

Query  94   IEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPD  273
            + A      V D +G+ + TG  YYILP         GGGL +AS    TCPL VVQ   
Sbjct  23   VAATAAPEPVLDVTGKILRTGTSYYILPVIRGR----GGGLKMASTVRRTCPLDVVQDRY  78

Query  274  SSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGG  450
             +SNG  ++F+ VN     V+   D NI+FSA SIC  ST W+LD   E T ++ V T G
Sbjct  79   EASNGLPLKFTPVNTKKGVVRVHTDLNIRFSAGSICHQSTAWKLDNYDEWTKQWFVTTDG  138

Query  451  EEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV-VDGIRILAITDKP  627
             EGNPG +T +NWFK+ + ED YKL +CPTVC  C+ +C D+GI V   G+R LA+T+ P
Sbjct  139  VEGNPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTNVP  198

Query  628  LRVVFKKA  651
            L+V+FKKA
Sbjct  199  LKVMFKKA  206



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 122/210 (58%), Gaps = 14/210 (7%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+  +    FL++    L   E      VV D+ G E+  GV+YYI P    G T+  G
Sbjct  1    MKLISLLSAFFLLSSLTTLAAGE------VVLDTDGNELRRGVEYYIYP----GITDVAG  50

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GLTLAS  N +CPL V  +   ++NG  V F   +P    +  S D NI FSA +IC+ S
Sbjct  51   GLTLASR-NHSCPLDVTLAISPTNNGLPVTFLPADPEEDTINTSTDLNIVFSAFTICLQS  109

Query  391  TLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVR--RDEDAYKLYYCPTVCDICRPV  564
            T W+LD    T ++ V TGG  GNPGR+T+ NWFK++       Y L +CP+VC+ICRPV
Sbjct  110  TAWKLDFDNTTRRFYVTTGGVTGNPGRETLDNWFKIQSASGRSGYNLVFCPSVCNICRPV  169

Query  565  CGDLGILVVDG-IRILAITDKPLRVVFKKA  651
            CG LG++  DG +R+   +D PL V F++A
Sbjct  170  CGSLGVVREDGRLRLGISSDAPLPVEFRRA  199



>emb|CDX83886.1| BnaC08g17590D [Brassica napus]
Length=195

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 118/201 (59%), Gaps = 14/201 (7%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLL  +  S +    EA +    V D  GQ +  G  YYILP         GGGLT++  
Sbjct  8    FLLLAVFISHRGATTEAAVEP--VTDIYGQRLRAGTKYYILPVVRGR----GGGLTMSKA  61

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-  408
             N TCP  V+Q     SNG  + FS  + S   ++ S D N KFSA SI      W LD 
Sbjct  62   ENKTCPKSVIQERFEVSNGMPLTFSPSDKSKV-IRVSTDLNFKFSATSI------WNLDN  114

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV  588
            + E T ++ +GT G EGNPGR T+ NWFK+ + ED YK+ +CP+VCDICR +C D+G+ V
Sbjct  115  VDEKTNQWFIGTCGVEGNPGRTTVGNWFKIDKYEDHYKILFCPSVCDICRVMCRDVGVFV  174

Query  589  VDGIRILAITDKPLRVVFKKA  651
             DGIR L ++D PL+V+FK+A
Sbjct  175  QDGIRRLVLSDVPLKVMFKRA  195



>ref|XP_006372632.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
 gb|ERP50429.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
Length=206

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 112/179 (63%), Gaps = 6/179 (3%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D +G+ +  G  YYILP         GGGL +AS    TCPL VVQ    +SNG  ++
Sbjct  32   VLDVTGKILRIGTSYYILPVIRGR----GGGLKMASTVRRTCPLDVVQDRYEASNGLPLK  87

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDT  477
            F+ VN     V+   D NI+FSA SIC  ST W+LD   E T ++ V T G EGNPG +T
Sbjct  88   FTPVNTKKGVVRVHTDLNIRFSAASICHQSTAWKLDNYDEWTKQWFVTTDGVEGNPGPET  147

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV-VDGIRILAITDKPLRVVFKKA  651
             +NWFK+ + ED YKL +CPTVC  C+ +C D+GI V   G+R LA+T+ PL+V+FKKA
Sbjct  148  TNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTNVPLKVMFKKA  206



>emb|CDX96746.1| BnaA08g22890D [Brassica napus]
Length=195

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 118/206 (57%), Gaps = 12/206 (6%)
 Frame = +1

Query  37   MEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGL  216
            M  +  +  L+A  I       +     V D  GQ + TG  YYILP         GGGL
Sbjct  1    MSSLLCIFVLVAVFISHRGATTEAAVEPVTDIYGQRLRTGTKYYILPVFRGR----GGGL  56

Query  217  TLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTL  396
            T++   N TCP  V+Q     SNG  + FS  + S   ++ S D N KFSA SI      
Sbjct  57   TMSKAENKTCPRSVIQERFEVSNGLPLTFSPSDKSKV-IRVSTDLNFKFSATSI------  109

Query  397  WRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGD  573
            W LD + E T ++ +GT G EGNPGR T+ NWFK+ + ED YK+ +CP+VCDIC+ +C D
Sbjct  110  WNLDNVDEKTNQWFIGTCGVEGNPGRTTVGNWFKIDKYEDHYKIVFCPSVCDICKVMCRD  169

Query  574  LGILVVDGIRILAITDKPLRVVFKKA  651
            +G+ V DGIR L ++D PL+V+FK+A
Sbjct  170  VGVFVQDGIRRLVLSDVPLKVMFKRA  195



>ref|XP_007210537.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
 gb|EMJ11736.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
Length=202

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 105/163 (64%), Gaps = 6/163 (4%)
 Frame = +1

Query  76   SIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTT-CPL  252
            S K   + A    + V D +G+++ TG DYYILP         GGGLTLAS  NTT CPL
Sbjct  15   SAKPWSVAADAAPSPVLDITGKKLRTGTDYYILPVIRGR----GGGLTLASTSNTTSCPL  70

Query  253  LVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGK  429
             VVQ     SNG  + FS VNP    V+ S DHNIKFSA +ICV ST+W+LD   E TG+
Sbjct  71   DVVQEQHEVSNGLPLTFSPVNPKKGVVRVSTDHNIKFSAATICVQSTMWKLDKFDEQTGQ  130

Query  430  YVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICR  558
            + V +GG EGNPGR T SNWFK+ + ++ YKL +CPTVC+ C+
Sbjct  131  WFVTSGGVEGNPGRQTTSNWFKIEKYDEDYKLVFCPTVCNFCK  173



>ref|XP_006441460.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
 gb|ESR54700.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
Length=153

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 99/150 (66%), Gaps = 2/150 (1%)
 Frame = +1

Query  205  GGGLTLA-SGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSIC  381
            GGGLTLA    N TCPL VVQ   S  NGF V FS VNP    V+ES D NIKF A + C
Sbjct  3    GGGLTLAGRSNNKTCPLDVVQEQHSFKNGFPVTFSPVNPKKGVVRESTDLNIKFDAATSC  62

Query  382  VMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICR  558
              ST+W+LD      G+++V TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR
Sbjct  63   AQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCR  122

Query  559  PVCGDLGILVVDGIRILAITDKPLRVVFKK  648
             +C D+GI +  G+R LA++D P +VVFKK
Sbjct  123  GLCRDVGIFINGGVRRLALSDVPFKVVFKK  152



>gb|AFL91229.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=164

 Score =   157 bits (397),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 109/170 (64%), Gaps = 7/170 (4%)
 Frame = +1

Query  145  VLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSS  324
            V +G +YY LP         GGG+TLA   N +CPL VVQ      +G  + F+ V+P  
Sbjct  1    VRSGXEYYXLPVFXGR----GGGVTLAPTRNESCPLDVVQEGFELDDGLPLTFTPVDPKK  56

Query  325  TNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRR  504
              ++ES D NI FSA SIC+ S +W L+  E  G+ ++   G  GNPG +TISNWFK+ +
Sbjct  57   GVIRESTDLNIIFSASSICIQSNVWMLE--EYEGQRIISGRGTAGNPGGETISNWFKIEK  114

Query  505  DEDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
             E+ YKL YCPTVCD+CRPVCGD+G++  + G R LAI+D P ++ F+KA
Sbjct  115  YENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  164



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 114/192 (59%), Gaps = 8/192 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLA-S  228
            L+ L A     L +      + V D +G+++  G  YYILP      T+G GGGLTLA  
Sbjct  10   LILLFAFIATPLPVRGNASPDPVLDIAGKQLRAGSKYYILPV-----TKGRGGGLTLAGR  64

Query  229  GPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
              N TCPL VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD
Sbjct  65   SNNKTCPLDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD  124

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                  G+++V TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI 
Sbjct  125  NFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIF  184

Query  586  VVDGIRILAITD  621
            +  G+R LA++D
Sbjct  185  INGGVRRLALSD  196



>gb|ACS92516.1| Kunitz-type protease inhibitor KPI-D12 [Populus trichocarpa x 
Populus deltoides]
Length=206

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 113/188 (60%), Gaps = 6/188 (3%)
 Frame = +1

Query  94   IEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPD  273
            + A      V D +G+ + TG  YYILP         GGGL +AS    TCPL VVQ   
Sbjct  23   VAATAAPEPVLDVTGKILRTGTGYYILPVIRGR----GGGLKMASTGRRTCPLDVVQDRY  78

Query  274  SSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGG  450
             +SNG  ++F+ VN     V+   D NI+FSA SIC  ST W+L    E T ++ V T G
Sbjct  79   EASNGLPLKFTPVNTKKGVVRVHTDLNIRFSAASICHQSTAWKLGSYDEWTKQWFVTTNG  138

Query  451  EEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV-VDGIRILAITDKP  627
             EGNPG +T +NWFK+ + ED YKL +CPTVC  C+ +C D+GI V   G+R LA++  P
Sbjct  139  VEGNPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALSSVP  198

Query  628  LRVVFKKA  651
            L+V+FKKA
Sbjct  199  LKVMFKKA  206



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 127/204 (62%), Gaps = 12/204 (6%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FL+F +A +   +  +      V+ D+ G+++  G +YYILP         GGGLT+AS 
Sbjct  11   FLVFALASTRPSIAGDLDATEAVL-DTDGEKLRAGTEYYILPVFRGR----GGGLTMAST  65

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             + TCPL VVQ P   S G  + F+ VNP    ++ S D NIKFSA SICV ST+W++  
Sbjct  66   RDETCPLDVVQDPLEISKGLPLTFTPVNPKKGVIRVSTDLNIKFSASSICVQSTVWKIQ-  124

Query  412  KEITG--KYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
            K +    ++ V TGG EGNPG +TI+NWFK+ + +D YKL +CPTVCD C  +C D+GI 
Sbjct  125  KSVNSEIQWFVTTGGVEGNPGIETITNWFKIEKADDDYKLVFCPTVCD-CGALCRDVGIY  183

Query  586  VVD-GIRILAITD--KPLRVVFKK  648
            + D G+R L+++D  +P  V FKK
Sbjct  184  IHDNGVRTLSLSDALQPFLVNFKK  207



>ref|NP_173228.1| kunitz family trypsin and protease inhibitor protein [Arabidopsis 
thaliana]
 gb|AAF97266.1|AC034106_9 Contains similarity to a tumor-related protein from Nicotiana 
tabacum gb|U66263 and contains a trypsin and protease inhibitor 
PF|00197 domain. ESTs gb|AV561824, gb|T44961, gb|H36186, 
gb|T45060, gb|N38006, gb|F19847 come from this gene [Arabidopsis 
thaliana]
 gb|AAG48779.1|AF332416_1 putative lemir (miraculin) protein [Arabidopsis thaliana]
 gb|AAK48962.1|AF370535_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK95260.1|AF410274_1 At1g17860/F2H15_8 [Arabidopsis thaliana]
 gb|AAM10091.1| unknown protein [Arabidopsis thaliana]
 gb|AAM19885.1| At1g17860/F2H15_8 [Arabidopsis thaliana]
 gb|AEE29645.1| kunitz type trypsin and protease inhibitor domain-containing 
protein [Arabidopsis thaliana]
Length=196

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 121/206 (59%), Gaps = 12/206 (6%)
 Frame = +1

Query  37   MEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGL  216
            M  + ++  L+A  I    +  +     VKD +G+ +LTGV+YYILP         GGGL
Sbjct  1    MSSLLYIFLLLAVFISHRGVTTEAAVEPVKDINGKSLLTGVNYYILPVIRGR----GGGL  56

Query  217  TLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTL  396
            T+++    TCP  V+Q     S G  V+FS  + S T +  S D NIKFS  SI      
Sbjct  57   TMSNLKTETCPTSVIQDQFEVSQGLPVKFSPYDKSRT-IPVSTDVNIKFSPTSI------  109

Query  397  WRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGD  573
            W L +  E T ++ + T G EGNPG+ T+ NWFK+ + E  YK+ +CPTVC+ C+ +C D
Sbjct  110  WELANFDETTKQWFISTCGVEGNPGQKTVDNWFKIDKFEKDYKIRFCPTVCNFCKVICRD  169

Query  574  LGILVVDGIRILAITDKPLRVVFKKA  651
            +G+ V DG R LA++D PL+V+FK+A
Sbjct  170  VGVFVQDGKRRLALSDVPLKVMFKRA  195



>emb|CDO98552.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 130/209 (62%), Gaps = 6/209 (3%)
 Frame = +1

Query  28   KMKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGG  207
            K K     FL F+I  ++ + C  A      V D +G+ +  GV+YYILPA   GN  GG
Sbjct  2    KNKFPLTSFLFFMIHTNL-VFCSAAPEPLPPVLDVAGKLLRAGVNYYILPAIIIGNDIGG  60

Query  208  GGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVM  387
            G LTLA+G   TCP  V+Q     ++G  + FS ++P    V+ S D N+KFS+ S C  
Sbjct  61   G-LTLANG---TCPPEVIQDNYEFTDGIPLIFSPLDPKKGIVRVSSDTNVKFSSTSKCAQ  116

Query  388  STLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
            S++W+L +L  +TGKY VG GG EGNPG  T+S+WFK+   + +YKL +CP+VC  C+ +
Sbjct  117  SSVWKLSELDALTGKYFVGIGGVEGNPGPKTLSSWFKIETFDRSYKLKFCPSVCKFCKVI  176

Query  565  CGDLGILVVDGIRILAITDKPLRVVFKKA  651
            C D+GI+  +G R LA++D P +V+FK+ 
Sbjct  177  CKDIGIVFQNGKRRLALSDDPFKVIFKRT  205



>gb|AFL91230.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=159

 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 106/165 (64%), Gaps = 7/165 (4%)
 Frame = +1

Query  160  DYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQE  339
            +YY LP         GGG+TLA   N +CPL VVQ      +G  + F+ V+P    ++E
Sbjct  1    EYYXLPVFXGR----GGGVTLAPTRNESCPLDVVQEGFELDDGLPLTFTPVDPKKGVIRE  56

Query  340  SVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAY  519
            S D NI FSA SIC+ S +W L+  E  G+ ++   G  GNPG +TISNWFK+ + E+ Y
Sbjct  57   STDLNIIFSASSICIQSNVWMLE--EYEGQRIISGRGTAGNPGGETISNWFKIEKYENGY  114

Query  520  KLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
            KL YCPTVCD+CRPVCGD+G++  + G R LAI+D P ++ F+KA
Sbjct  115  KLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  159



>ref|XP_011046091.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 119/202 (59%), Gaps = 7/202 (3%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLLF  A + +L  + A      V + +G+ + TG  YYIL          GGGL +AS 
Sbjct  10   FLLFAFAAN-QLPRVAATAAPEPVLNVTGKILRTGTGYYILLVIRGR----GGGLKMAST  64

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-  408
               TCPL VVQ    +SNG  ++F+ VN     V+   D NI+FSA SIC  ST W+LD 
Sbjct  65   VRRTCPLDVVQERYEASNGLPLKFTPVNTKKGVVRVHTDLNIRFSAASICQQSTAWKLDS  124

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV  588
              E T ++ V T G EGNPG +T +NWFK+ + ED YKL  CPTVC  C+ +C D+GI V
Sbjct  125  YDEWTKQWFVTTNGVEGNPGSETTNNWFKIEKLEDKYKLVVCPTVCQHCKVMCKDIGIYV  184

Query  589  -VDGIRILAITDKPLRVVFKKA  651
               G+R LA+   PL+V+FKKA
Sbjct  185  DAIGVRRLALGGVPLKVMFKKA  206



>ref|XP_010279488.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=208

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 111/187 (59%), Gaps = 7/187 (4%)
 Frame = +1

Query  100  AQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSS  279
            AQ     V D+ G+++ +   Y+ILPA +      GGGL   S  N TCP  VVQ  D  
Sbjct  26   AQDEPEAVLDTMGRQLCSTATYFILPAISGM----GGGLNFESTKNGTCPFDVVQDEDEE  81

Query  280  SNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEE  456
            SNG  + FS VNP    ++   D NI+F+  ++    T+W L D  E    ++V T G  
Sbjct  82   SNGLPLAFSPVNPKEEIIRVLTDQNIRFAIDTLLPQPTVWNLGDFNESARTFLVETCGSI  141

Query  457  GNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITD--KPL  630
            GNPG +T+SNWF++   +D YKL +CPTVC+ CRPVCGDLGI + DG+R LA+    +PL
Sbjct  142  GNPGIETLSNWFRIEPFDDDYKLVFCPTVCNFCRPVCGDLGIAIQDGVRHLALGSGLEPL  201

Query  631  RVVFKKA  651
            ++ FKK 
Sbjct  202  KIKFKKG  208



>dbj|BAA82840.1| miraculin homologue [Youngia japonica]
Length=142

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = +1

Query  151  TGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTN  330
            +G +YYILP         GGGLTLAS  N TCPL VVQ+     NG  + F+ V+P    
Sbjct  3    SGTEYYILPVFRGM----GGGLTLASTRNDTCPLDVVQADLEVDNGLPLTFTPVDPKKGV  58

Query  331  VQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDE  510
            ++ES D NI FSA SIC+ S +W  +L+E  G+ +V   G  GNPGR+TISNWFK+ + E
Sbjct  59   IRESTDLNIIFSASSICIQSNVW--NLEEYDGQLIVSAHGVAGNPGRETISNWFKIEKYE  116

Query  511  DAYKLYYCPTVCDICRPVCGDLGILV  588
            D YK+ +CPTVCD CRPVCGD+G+L+
Sbjct  117  DDYKIVFCPTVCDFCRPVCGDIGVLI  142



>ref|XP_004299457.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=218

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 116/185 (63%), Gaps = 12/185 (6%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPN---TTCPLLVVQSPDSSSNGF  291
            V D  G  + TGV+Y+ILP         GGGLTLA+  N   + CPL VVQ     SNG 
Sbjct  38   VLDIKGHNIQTGVEYWILPVIRGR----GGGLTLATTGNRNRSICPLDVVQEQQEVSNGL  93

Query  292  AVQFSSVNPSSTNVQESVDHNIKFS---AVSICV-MSTLWRLD-LKEITGKYVVGTGGEE  456
             + FS VN     V+ S D NIKFS   AV+IC+  S +W+LD L E TG+  V TGG E
Sbjct  94   PLTFSPVNLKIGVVRLSTDLNIKFSTSAAVTICLNTSKVWKLDNLDESTGQRFVTTGGVE  153

Query  457  GNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRV  636
            GNPG  TISNWFK+ + +  YKL +CPTVC+ C+ +CGD+GI +  G+R L ++  PL+V
Sbjct  154  GNPGPKTISNWFKIEKYDKDYKLVFCPTVCNFCKVICGDVGIYLEGGVRRLVLSKVPLKV  213

Query  637  VFKKA  651
            +FK+ 
Sbjct  214  MFKRV  218



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 126/204 (62%), Gaps = 12/204 (6%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FL+F +A +   +  +      V+ D+ G+++  G +YYILP         GGGLT+AS 
Sbjct  11   FLVFALASTRPSIAGDLDATEAVL-DTDGEKLRAGTEYYILPVFRGR----GGGLTMAST  65

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             + TCPL VVQ P   S G  + F+ VNP    ++ S D NIKFSA SICV ST+W++  
Sbjct  66   RDETCPLDVVQDPLEISKGLPLTFTPVNPKKGVIRVSTDLNIKFSASSICVQSTVWKIQ-  124

Query  412  KEITG--KYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
            K +    ++ V TGG EGNPG +TI+NWFK+ +  D YKL +CPTVCD C  +C D+GI 
Sbjct  125  KSVNSEIQWFVTTGGVEGNPGIETITNWFKIEKAGDDYKLVFCPTVCD-CGALCRDVGIY  183

Query  586  VVD-GIRILAITD--KPLRVVFKK  648
            + D G+R L+++D  +P  V FKK
Sbjct  184  IHDNGVRTLSLSDALQPFLVNFKK  207



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 126/204 (62%), Gaps = 12/204 (6%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FL+F +A +   +  +      V+ D+ G+++  G +YYILP         GGGLT+AS 
Sbjct  11   FLVFALASTRPSIAGDLDATEAVL-DTDGEKLRAGTEYYILPVFRGR----GGGLTMAST  65

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             + TCPL VVQ P   S G  + F+ VNP    ++ S D NIKFSA SICV ST+W++  
Sbjct  66   RDETCPLDVVQDPLEISKGLPLTFTPVNPKKGVIRVSTDLNIKFSASSICVQSTVWKIQ-  124

Query  412  KEITG--KYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
            K +    ++ V TGG EGNPG +TI+NWFK+ +  D YKL +CPTVCD C  +C D+GI 
Sbjct  125  KSVNSEIQWFVTTGGVEGNPGIETITNWFKIEKAGDDYKLVFCPTVCD-CGALCRDVGIY  183

Query  586  VVD-GIRILAITD--KPLRVVFKK  648
            + D G+R L+++D  +P  V FKK
Sbjct  184  IHDNGVRTLSLSDALQPFLVNFKK  207



>ref|XP_004137534.1| PREDICTED: miraculin-like [Cucumis sativus]
 ref|XP_004165460.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64217.1| Tumor-related protein [Cucumis sativus]
Length=206

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 118/203 (58%), Gaps = 6/203 (3%)
 Frame = +1

Query  46   VFFLLFLIAQSIKLLCIE-AQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTL  222
            +F+ LF++  S +L+    A      V D  G+++  GV+YYILP            LTL
Sbjct  7    LFYFLFILLASTQLIRFSTADASPEAVLDIDGKKLRAGVNYYILPVFRGRGGG----LTL  62

Query  223  ASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWR  402
             +  +  CPL VVQ      NGF   F  VNP    V+ S D N++F A +ICV ST+W+
Sbjct  63   GNLQSEKCPLNVVQEQLEVMNGFPTTFHPVNPKKGVVRVSTDLNVQFEASTICVTSTVWK  122

Query  403  LD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLG  579
            LD   E TG+++V  GG  GNPG +T+ NWFK+ +    YKL +CPTVC+ C+ +C D+G
Sbjct  123  LDKFDESTGQWLVTIGGSRGNPGVETVDNWFKIEKHGKDYKLVFCPTVCNFCKVMCRDIG  182

Query  580  ILVVDGIRILAITDKPLRVVFKK  648
            I   +G R LA++D P  V+FKK
Sbjct  183  IFFKNGERALALSDTPFPVMFKK  205



>ref|XP_008437058.1| PREDICTED: miraculin-like [Cucumis melo]
Length=205

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 116/202 (57%), Gaps = 5/202 (2%)
 Frame = +1

Query  46   VFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLA  225
            +F+ +F++  S +L    A      V D  G+++  GV+YYILP            LTL 
Sbjct  7    IFYFIFILLASTELRFSTADASPEAVLDIDGKKLRAGVNYYILPVFRGRGGG----LTLG  62

Query  226  SGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL  405
            +  +  CP+ VVQ      NGF   F  VNP    V+ S D N++F A +ICV ST+W+L
Sbjct  63   NLQSEICPVNVVQEQFELMNGFPTTFHPVNPKKGVVRVSTDLNVQFDASTICVTSTVWKL  122

Query  406  D-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGI  582
            D   E TG++ V  GG  GNPG +T+ NWFK+ +    YKL +CPTVC+ C+ +C D+GI
Sbjct  123  DKFDESTGQWFVTIGGSRGNPGVETVDNWFKIEKHGKDYKLVFCPTVCNFCKVMCRDIGI  182

Query  583  LVVDGIRILAITDKPLRVVFKK  648
               +G R LA++D P  V+FKK
Sbjct  183  FFKNGKRALALSDTPFPVMFKK  204



>ref|XP_010683193.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=206

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 109/182 (60%), Gaps = 9/182 (5%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTT-CPLLVVQSPDSSSNGFAV  297
            V D +G+ +  G +YYILP         GGGLT+AS   T  CPL V Q     SNG  +
Sbjct  29   VLDINGRPLQAGYNYYILPVIRGR----GGGLTMASKNATELCPLYVAQEDHEVSNGLPL  84

Query  298  QFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDT  477
            +F  VNP    +  S D N  F A + CV ST W L ++  TG+  VGTGGE GNPG +T
Sbjct  85   KFYPVNPKDKRISLSSDLNFVFDAATTCVQSTGWSLTIEMETGRRYVGTGGEIGNPGVET  144

Query  478  ISNWFKVRRDEDA---YKLYYCPTVCDICRPVCGDLGILV-VDGIRILAITDKPLRVVFK  645
            + NWFK+ +D      YK+ YCP VC+ C+ +CGD+G+ +  DG R+L  +D+PL V+FK
Sbjct  145  VDNWFKIEKDGSGKYDYKIVYCPGVCNFCKVMCGDVGVFIEKDGRRLLGFSDQPLLVMFK  204

Query  646  KA  651
            KA
Sbjct  205  KA  206



>ref|XP_009406658.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=200

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 117/206 (57%), Gaps = 7/206 (3%)
 Frame = +1

Query  37   MEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGL  216
            M+   F+L  I      L + A      V+D+ G  +  GVDYYI P      T+ GGGL
Sbjct  1    MKPTRFVLSAIFLVFSALALPAS-ADEPVRDTDGNVLQRGVDYYIRPTV----TDIGGGL  55

Query  217  TLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTL  396
            TL +  N +CPL V  +   + NG  +QFS  +     V+ S D N+ FSA + C+ ST+
Sbjct  56   TLEAR-NGSCPLSVALASLPADNGLPLQFSPEDDDDDTVELSTDTNVIFSAFTTCLQSTV  114

Query  397  WRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDL  576
            W+L+L E  G+Y V  GG  GNPG++T+SNWFK+   +  YKL +CPTVCD CRPVCG L
Sbjct  115  WKLELDEGEGRYYVVIGGVAGNPGKETLSNWFKIESYQGVYKLVFCPTVCDYCRPVCGSL  174

Query  577  GILVVDGIRILAITDK-PLRVVFKKA  651
            G+    G + L I D  P    FK+A
Sbjct  175  GVYEQGGRQWLGIRDDTPFPFEFKRA  200



>ref|XP_002890252.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66511.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=196

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 119/201 (59%), Gaps = 14/201 (7%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLLF +  S +    EA +    VKD +G+ +LT  +YYILP         GGGLT+++ 
Sbjct  8    FLLFAVFTSHRGATTEAAVEP--VKDINGKPLLTKYNYYILPVVRGR----GGGLTMSNF  61

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-D  408
             N TCP  V+Q     S G  V+FS  + S   V+ S D NIKFS  SI      W L +
Sbjct  62   KNETCPRSVIQDQFEVSQGLPVKFSPYDKSRI-VRVSTDQNIKFSPTSI------WELAN  114

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV  588
              E T ++ + T G EGNPG+ T+ NWFK+   E  YK+ +CPTVC+ C+ +C D+G+ V
Sbjct  115  FDERTSQWFISTCGVEGNPGQKTVGNWFKIDEFEKDYKIRFCPTVCNFCKVICRDVGVFV  174

Query  589  VDGIRILAITDKPLRVVFKKA  651
             DG R LA+++ PL+V+FKKA
Sbjct  175  QDGKRRLALSEVPLKVMFKKA  195



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 125/204 (61%), Gaps = 12/204 (6%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FL+F +A +   +  +      V+ D+ G+++  G +YYILP         GGGLT+AS 
Sbjct  11   FLVFALASARPSIAGDLDATEAVL-DTDGEKLRAGTEYYILPVFRGR----GGGLTMAST  65

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             +  CPL VVQ P   S G  + F+ VNP    ++ S D NIKFSA SICV ST+W++  
Sbjct  66   GDEACPLDVVQDPLEISKGLPLTFTPVNPKKGVIRVSTDLNIKFSASSICVQSTVWKIQ-  124

Query  412  KEITG--KYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
            K +    ++ V TGG EGNPG +TI+NWFK+ +  D YKL +CPTVCD C  +C D+GI 
Sbjct  125  KSVNSEIQWFVTTGGVEGNPGIETITNWFKIEKAGDDYKLVFCPTVCD-CGALCRDIGIY  183

Query  586  VVD-GIRILAITD--KPLRVVFKK  648
            + D G+R L+++D  +P  V FKK
Sbjct  184  IHDNGVRTLSLSDALQPFLVNFKK  207



>ref|XP_004301214.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=226

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 116/185 (63%), Gaps = 13/185 (7%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTT--CPLLVVQSPDSSSNGFA  294
            V+D  G  + TGV+Y+ILP         GGGLTLAS  N T  CPL VVQ     SNG  
Sbjct  45   VRDIKGDNLQTGVEYWILPVIRGK----GGGLTLASNRNKTIGCPLDVVQEQSEVSNGLP  100

Query  295  VQFSSVNPSSTNVQESVDHNIKFS---AVSICVM-STLWRLD-LKEITGKYVVGTGGEEG  459
            + FS VN +   V+ S D NIKFS   AV++C   S +W+LD + E TG+  V TGG EG
Sbjct  101  LTFSPVNLTKGVVRLSTDLNIKFSTSAAVTLCPQTSKVWKLDEVDESTGQRSVTTGGVEG  160

Query  460  NPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITD--KPLR  633
            NP   T+ NWFK+ + +D YKL +CP VC  CR +CGD+G+ +  G+R LA++D   PL+
Sbjct  161  NPSPKTLMNWFKIEKYDDDYKLVFCPKVCRFCRVICGDVGVHLESGVRRLALSDVIVPLK  220

Query  634  VVFKK  648
            V+FK+
Sbjct  221  VMFKR  225



>gb|KFK42292.1| hypothetical protein AALP_AA2G236900 [Arabis alpina]
Length=194

 Score =   150 bits (379),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 117/200 (59%), Gaps = 13/200 (7%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLLF +  S +    EA I +  V D +G+ + T   YYILP         GGGLT++  
Sbjct  8    FLLFAVFISYRGATTEAAIES--VTDINGRPLQTDTAYYILPVVRGR----GGGLTISKT  61

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             N TCP  V+Q     SNG  ++FS  + SS  ++ S D N  FS  SI      W+LD 
Sbjct  62   HNKTCPNNVIQDRYEVSNGLPLKFSPAD-SSKIIRVSADLNFIFSPTSI------WKLDS  114

Query  412  KEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVV  591
             E T +  V T G  GNPGR+T+SNWF++ + E+ YK+ +CP+VC+ICR +CGD+G+ V 
Sbjct  115  DETTNQRFVSTCGRAGNPGRETVSNWFRIDKFENDYKIVFCPSVCNICRVICGDVGVFVQ  174

Query  592  DGIRILAITDKPLRVVFKKA  651
             G R L ++  P RV+FK+A
Sbjct  175  GGKRSLVLSKVPFRVMFKRA  194



>ref|XP_009614753.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=251

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 129/209 (62%), Gaps = 11/209 (5%)
 Frame = +1

Query  28   KMKMEKVFFL-LFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEG  204
            ++ + ++F + L L+A S     +   + A  V D SG++V  G  Y I+PA   GN   
Sbjct  4    EVNVRRLFIVPLILVALSTSFFFL---VKAQDVLDVSGKDVRKGGYYRIIPAGR-GN---  56

Query  205  GGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKF-SAVSIC  381
            GGG+T+AS  N T PL+V Q  D S    + QFS  N +   ++ S D NIKF S +++ 
Sbjct  57   GGGITVASIRNRTNPLVVSQHADESILSVSTQFSPANSNENTIKISSDLNIKFTSEITLS  116

Query  382  VMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDIC-R  558
              S +WR++ + I  +Y+V  GG EGNPGR+T+SNWF++ + EDAYKL YCP VC+ C R
Sbjct  117  NSSNVWRINTELIPQRYLVTVGGVEGNPGRETLSNWFRIDKYEDAYKLVYCPGVCETCSR  176

Query  559  PVCGDLGILVVDGIRILAI-TDKPLRVVF  642
              CGD+GILV    R+L + +DKPL+V F
Sbjct  177  TFCGDIGILVEGNERVLFVGSDKPLKVTF  205



>ref|XP_006353919.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=245

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 126/201 (63%), Gaps = 7/201 (3%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FL+ +I  +  +  ++AQ ++  V D SG+ +  G  Y+I+P +   N    GGL ++S 
Sbjct  6    FLVAIILSTSFIFLVKAQNISEPVLDISGKALEKGSQYFIVPVSGRSNE---GGLAVSSI  62

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICV-MSTLWRLD  408
             NT   L+V Q   SS  G +++F+ V+ + T ++ S D N+KF ++     MST+W ++
Sbjct  63   RNTVDTLVVTQYAQSSM-GSSLRFTPVDSNETIIRLSTDLNVKFMSIVFTYNMSTVWTIN  121

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV  588
               I  +Y+V  GG EGNPGRDT+ NWFK+ + EDAYK  YCP VC+ CRP CGD+GI+V
Sbjct  122  TTLIPQRYLVAVGGVEGNPGRDTLGNWFKIDKYEDAYKFVYCPGVCETCRPFCGDIGIIV  181

Query  589  -VDGIRILAI-TDKPLRVVFK  645
              +  R+L + +DKPL+V F+
Sbjct  182  EPNNKRVLFVGSDKPLKVKFE  202



>ref|XP_004241479.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=200

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 113/199 (57%), Gaps = 6/199 (3%)
 Frame = +1

Query  64   LIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLT-LASGPNT  240
            L+  SI    + +    + V D +G EV  G +Y+ILP        GGGGL+      N 
Sbjct  4    LLLLSIIPFTLASSSSLSPVLDVNGDEVQAGPNYFILPVI---RGRGGGGLSPFNVKNNN  60

Query  241  TCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKE  417
            TCP  ++Q  D    G  V F+ ++   + V+ S D N++F   +IC   T+W+L D  +
Sbjct  61   TCPRDIIQWDDEEQEGLPVVFTRIDAKKSVVRVSTDVNVRFYTPTICARETIWKLGDYDD  120

Query  418  ITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVV-D  594
               KY V TGG EGNPG  T+ NWFK+ R    YKL YCP+VC  C+ +C D+GI +  D
Sbjct  121  KLKKYFVVTGGVEGNPGLKTVGNWFKIERFGSGYKLVYCPSVCKFCKVICKDVGIFITND  180

Query  595  GIRILAITDKPLRVVFKKA  651
            G+R+LA++D P +V+FKK 
Sbjct  181  GVRLLALSDTPYKVMFKKT  199



>ref|XP_006347376.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=202

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 107/180 (59%), Gaps = 6/180 (3%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLT-LASGPNTTCPLLVVQSPDSSSNGFAV  297
            V D +G EV  G +Y+ILP        GGGGL+      N TCP  ++Q  D    G  V
Sbjct  25   VLDVNGNEVEAGPNYFILPVI---RGRGGGGLSPFNVKQNNTCPRDIIQWDDEEQEGLPV  81

Query  298  QFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRD  474
             F+ ++   + V+ S D N++F   +IC   T+W+L +  E   +Y V TGG EGNPG  
Sbjct  82   VFTRIDAKKSVVRVSTDVNVRFYTPTICARETIWKLGEYDENLKQYFVVTGGVEGNPGLK  141

Query  475  TISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVV-DGIRILAITDKPLRVVFKKA  651
            T+ NWFK+ + E  YK  YCP+VC  C+ +C D+GIL+  DG+R+LA++D P +V+FKK 
Sbjct  142  TVGNWFKIEKFESGYKFVYCPSVCKFCKVICKDVGILITKDGVRLLALSDTPYKVMFKKT  201



>ref|XP_006304577.1| hypothetical protein CARUB_v10011616mg [Capsella rubella]
 gb|EOA37475.1| hypothetical protein CARUB_v10011616mg [Capsella rubella]
Length=195

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 119/201 (59%), Gaps = 14/201 (7%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLLF +  S      EA + A  VKD +G+ +L G +YYILP         GGGLT++  
Sbjct  8    FLLFAVFISHCGATTEAAVEA--VKDINGKPLLAGYNYYILPVVRGR----GGGLTMSKP  61

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-D  408
             N TC   V+Q+    S G  ++FS  + S   V+ S D NIKFS  SI      W L +
Sbjct  62   ENKTCRTSVIQARFEVSQGLPLKFSPFDKSRI-VRVSTDQNIKFSQTSI------WELAN  114

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV  588
              E T +  + T G EGNPG  T+SNWFK+ + +  YK+ +CPTVC+ C+ +C D+G+ V
Sbjct  115  FDETTSQSFISTCGVEGNPGLTTVSNWFKIDKFDKDYKIRFCPTVCNFCKVICRDVGVFV  174

Query  589  VDGIRILAITDKPLRVVFKKA  651
             DG+R LA+++ PL+V+FK+A
Sbjct  175  QDGMRRLALSEVPLKVMFKRA  195



>gb|KFK42293.1| hypothetical protein AALP_AA2G237000 [Arabis alpina]
Length=194

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 115/205 (56%), Gaps = 11/205 (5%)
 Frame = +1

Query  37   MEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGL  216
            M   F+L  L A  I       +     V D +GQ + +G++YYILP         GGGL
Sbjct  1    MSSPFYLFLLFAVFISHRGATTEAAVESVTDINGQRLRSGINYYILPVVRGR----GGGL  56

Query  217  TLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTL  396
            T++   N TC   V+Q     SNG A++FS  + S   ++ S D N  FS  SI      
Sbjct  57   TISKTHNKTCLNSVIQDRYGVSNGLALKFSPSDNSKI-IRVSTDLNFIFSKTSI------  109

Query  397  WRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDL  576
            W+LD  +   ++ V T G  GNPGR T+ NWFK+ + E+ YK+ +CP+VC+ C+ +CGD+
Sbjct  110  WKLDRDDTANQWFVSTCGVAGNPGRTTVDNWFKIDKFENDYKIVFCPSVCNFCKVMCGDI  169

Query  577  GILVVDGIRILAITDKPLRVVFKKA  651
            G+ V  G R L ++D PL+V+FK+A
Sbjct  170  GVFVQGGKRSLVLSDVPLKVMFKRA  194



>gb|KCW48670.1| hypothetical protein EUGRSUZ_K02326 [Eucalyptus grandis]
Length=203

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 108/178 (61%), Gaps = 6/178 (3%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D+ G E+ TGV+Y+ILP           G + +      CPL VVQ     S+G   +
Sbjct  31   VLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRSGN----CPLAVVQEQQELSDGLPAK  86

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDT  477
            FS V+ +ST ++ S D N+ F A +ICV ST+WRL    E   +Y V +GG  GNPGR+T
Sbjct  87   FSPVDGNST-IRLSTDLNVWFDAATICVQSTVWRLAAFDEEVKQYFVESGGVLGNPGRET  145

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            +SNWFK+ + ++ Y   +CPTVCD CR +C D+GI V    R LA++D+P RV F+KA
Sbjct  146  VSNWFKIEKVDEDYNFRFCPTVCDTCRVICRDVGIYVDGSTRRLALSDEPFRVKFRKA  203



>ref|XP_010476950.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 116/201 (58%), Gaps = 14/201 (7%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLLF +  S      E  + A  VKD +G+ + T   YYILP         GGGLT++  
Sbjct  8    FLLFAVFISHGGAATEPPVEA--VKDINGKPLQTRFYYYILPVVRGR----GGGLTMSKA  61

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-D  408
             N TCP  V+Q     S G  V FS  + S   V+ S D NIKFS+ SI      W L D
Sbjct  62   ENKTCPRSVIQDQFEVSQGLPVSFSPYDKSRI-VRVSTDQNIKFSSTSI------WELAD  114

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV  588
              E T +  + T G EGNPG+ T+ NWFK+ + ++ YK+ +CPTVC+ C+ +C D+G+ V
Sbjct  115  FDEATRQNFISTCGVEGNPGQTTVDNWFKIDKFDNDYKIRFCPTVCNFCKVICRDVGVFV  174

Query  589  VDGIRILAITDKPLRVVFKKA  651
             DG R LA++D PL+V+FK+A
Sbjct  175  QDGKRRLALSDVPLKVMFKRA  195



>ref|XP_010498164.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 118/201 (59%), Gaps = 14/201 (7%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLLF +  S      EA + A  VKD +G+ + T   YYILP         GGGLT++  
Sbjct  8    FLLFAVFISHGGAATEAPVEA--VKDINGKPLQTRFYYYILPVVRGR----GGGLTMSKP  61

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-D  408
             N TCP  V+Q     S+G  V FS  + S   V+ S D NIKFS  SI      W L +
Sbjct  62   ENKTCPRSVIQDQFEVSHGLPVSFSPYDRSRI-VRVSTDQNIKFSPTSI------WELAN  114

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV  588
              E T + ++ T G EGNPG+ T+ NWFK+ + ++ YK+ +CPTVC+ C+ +C D+G+ V
Sbjct  115  FDEATSQNLISTCGVEGNPGQTTVDNWFKIDKFDNDYKIRFCPTVCNFCKVICRDVGVFV  174

Query  589  VDGIRILAITDKPLRVVFKKA  651
             DG R LA++D PL+V+FK+A
Sbjct  175  QDGKRRLALSDVPLKVMFKRA  195



>ref|XP_006441436.1| hypothetical protein CICLE_v10023581mg [Citrus clementina]
 gb|ESR54676.1| hypothetical protein CICLE_v10023581mg [Citrus clementina]
Length=187

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 91/139 (65%), Gaps = 1/139 (1%)
 Frame = +1

Query  235  NTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-L  411
            N  CPL VVQ   S  NG  V FS VNP    V+ES D NIKF A + C  ST+W+LD  
Sbjct  48   NKKCPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLDNF  107

Query  412  KEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVV  591
              + G++++ TGG EGNPG  T+ NWFK+ +    YKL YCP+VC+ CR +C D+GI + 
Sbjct  108  DAVLGQWLLTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFIN  167

Query  592  DGIRILAITDKPLRVVFKK  648
             G+R LA++D P +VVFKK
Sbjct  168  GGVRRLALSDVPFKVVFKK  186



>ref|XP_010037029.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 108/178 (61%), Gaps = 6/178 (3%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D+ G E+ TGV+Y+ILP           G + +      CPL VVQ     S+G   +
Sbjct  90   VLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRSGN----CPLAVVQEQQELSDGLPAK  145

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDT  477
            FS V+ +ST ++ S D N+ F A +ICV ST+WRL    E   +Y V +GG  GNPGR+T
Sbjct  146  FSPVDGNST-IRLSTDLNVWFDAATICVQSTVWRLAAFDEEVKQYFVESGGVLGNPGRET  204

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            +SNWFK+ + ++ Y   +CPTVCD CR +C D+GI V    R LA++D+P RV F+KA
Sbjct  205  VSNWFKIEKVDEDYNFRFCPTVCDTCRVICRDVGIYVDGSTRRLALSDEPFRVKFRKA  262



>ref|XP_010042449.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 108/178 (61%), Gaps = 6/178 (3%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D+ G E+ TGV+Y+ILP           G + +      CPL VVQ     S+G   +
Sbjct  90   VLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRSGN----CPLAVVQEQQELSDGLPAK  145

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDT  477
            FS V+ +ST ++ S D N+ F A +ICV ST+WRL    E   +Y + +GG  GNPGR+T
Sbjct  146  FSPVDGNST-IRLSTDLNVWFDAATICVQSTVWRLAAFDEEVKQYFIESGGVLGNPGRET  204

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            +SNWFK+ + ++ Y   +CPTVCD CR +C D+GI V    R LA++D+P RV F+KA
Sbjct  205  VSNWFKIEKVDEDYNFRFCPTVCDTCRVICRDVGIYVDGSTRRLALSDEPFRVKFRKA  262



>ref|XP_010459406.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 116/201 (58%), Gaps = 14/201 (7%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLLF +  S      EA + A  VKD +G+ + T   YYILP         GGGLT++  
Sbjct  8    FLLFAVFISHGGAATEAPVEA--VKDINGKPLQTRFYYYILPVVRGR----GGGLTMSKP  61

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-D  408
             N TCP  V+Q     S G  V FS  + S   V+ S D NIKFS  SI      W L +
Sbjct  62   ENKTCPRSVIQDRFEVSQGLPVSFSPYDKSRI-VRVSTDQNIKFSPTSI------WELAN  114

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV  588
              E T +  + T G EGNPG+ T+ NWFK+ + ++ YK+ +CPTVC+ C+ +C D+G+ V
Sbjct  115  FDEATSQNFISTCGVEGNPGQTTVDNWFKIDKFDNDYKIRFCPTVCNFCKVICRDVGVFV  174

Query  589  VDGIRILAITDKPLRVVFKKA  651
             DG R LA++D PL+V+FK+A
Sbjct  175  QDGKRRLALSDVPLKVMFKRA  195



>ref|XP_010683194.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=208

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 109/197 (55%), Gaps = 11/197 (6%)
 Frame = +1

Query  85   LLCIE--AQIMANV-VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPL-  252
             LC+       AN+ V D +G+ +    +YYILP        GGG           CPL 
Sbjct  15   FLCLSPLTSTAANIAVLDINGRPLQARSNYYILPVI---RGRGGGLRMTPKNATQLCPLA  71

Query  253  LVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKY  432
             V Q     +NG  ++F  VNP    +  S D N  F A +ICV ST WRL   E+TG+ 
Sbjct  72   YVAQEGSELANGLPLKFYPVNPKDKTISLSTDLNFVFDAATICVQSTQWRLAFDEVTGRR  131

Query  433  VVGTGGEEGNPGRDTISNWFKVRRDEDA---YKLYYCPTVCDICRPVCGDLGILV-VDGI  600
             VG GGE GNPG +T+SNWFK+ + E     YK+ +CP VC+ C+  CG++G+ V  DG 
Sbjct  132  YVGFGGEIGNPGGNTVSNWFKIEKAETGKYDYKIVFCPGVCNFCKVACGEIGVFVEKDGR  191

Query  601  RILAITDKPLRVVFKKA  651
            R+L I ++PL V+FKKA
Sbjct  192  RLLGINNQPLLVMFKKA  208



>ref|XP_010041215.1| PREDICTED: miraculin-like [Eucalyptus grandis]
 gb|KCW44534.1| hypothetical protein EUGRSUZ_L01961 [Eucalyptus grandis]
Length=203

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 107/178 (60%), Gaps = 6/178 (3%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D+ G ++ TGV+Y+ILP           G + +      CPL VVQ     S+G   +
Sbjct  31   VLDTDGHKLQTGVNYHILPVLRGRGGGLTLGASRSGN----CPLAVVQEQQELSDGLPAK  86

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDT  477
            FS V+  ST ++ S D N+ F A +ICV ST+WRL    E   +Y V +GG  GNPGR+T
Sbjct  87   FSPVDGRST-IRLSTDLNVWFDAATICVQSTVWRLAAFDEEVKQYFVESGGVLGNPGRET  145

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            +SNWFK+ + ++ Y   +CPTVCD C+ +C D+GI V    R LA++D+P RV FKKA
Sbjct  146  VSNWFKIEKMDEDYNFRFCPTVCDTCKVICRDVGIYVDGATRRLALSDEPFRVKFKKA  203



>ref|XP_004235412.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=246

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 125/203 (62%), Gaps = 7/203 (3%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FL+ +I  +  L  ++AQ ++  V D SG  ++ G  Y+I+P +   N    GGL ++S 
Sbjct  6    FLVAIILSTSFLFLVKAQNISEPVLDISGNPLVKGSQYFIVPVSGRSNE---GGLDVSSI  62

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSIC-VMSTLWRLD  408
             NT   L+V Q+  SS  G +++F+ V+ +   V+ S D N+KF  +     MST+W ++
Sbjct  63   RNTVDTLVVTQNAQSSV-GKSLRFTPVDANENIVRLSTDLNVKFMNIIFSDNMSTVWTIN  121

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV  588
             + I  + +V  GG EGNPGRDT+ NWFK+ + E+AYK  YCP VC+ CRP CGD+GILV
Sbjct  122  TRLIPQRNLVSVGGVEGNPGRDTLGNWFKIDKYEEAYKFVYCPGVCETCRPFCGDIGILV  181

Query  589  -VDGIRILAI-TDKPLRVVFKKA  651
              +  R+L + +DKPL+V F+  
Sbjct  182  EPNNKRVLFVGSDKPLKVTFENT  204



>ref|XP_006416660.1| hypothetical protein EUTSA_v10008818mg [Eutrema salsugineum]
 gb|ESQ35013.1| hypothetical protein EUTSA_v10008818mg [Eutrema salsugineum]
Length=198

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 121/208 (58%), Gaps = 13/208 (6%)
 Frame = +1

Query  37   MEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDY--YILPAAADGNTEGGG  210
            M  + ++   +   I  L    +     V D++G+ + +G++Y  YILP A      GGG
Sbjct  1    MSSLLYIFLFLTVFISHLGATTEATVEPVIDTTGKRLRSGINYKYYILPVA---RGGGGG  57

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GLT++   NTTC   V+Q     S G  + FS    S+T +  S D N KFSA SI    
Sbjct  58   GLTISKSENTTCKKSVIQENYEVSQGLPLSFSPAEKSNT-IGVSADLNFKFSATSI----  112

Query  391  TLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
              W+LD   E T ++ V   G  GNPG+ T+SNWFK+ + EDAYK+ +CP+VC+IC+ +C
Sbjct  113  --WKLDYFDEATNQWYVSACGVAGNPGQKTVSNWFKIDKFEDAYKIVFCPSVCNICKVMC  170

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+G+ V DG R L ++D PL+VVFK+A
Sbjct  171  RDIGVFVQDGKRKLVLSDVPLKVVFKRA  198



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 116/209 (56%), Gaps = 10/209 (5%)
 Frame = +1

Query  46   VFFLLFLIAQSIKL-LCIEAQIMA-----NVVKDSSGQEVLTGVDYYILPAAADGNTEGG  207
            +  L F++ QS    L   +++++     + V D++G ++ TG +Y++LP        GG
Sbjct  3    ILLLSFILLQSFAFSLANPSELLSAGPSPSPVLDTNGDKIRTGSNYFVLPVI---RGRGG  59

Query  208  GGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVM  387
            G        N TCP  ++Q       G  V F+ V+P    ++ S D N++F   +IC  
Sbjct  60   GLFPSNVKQNNTCPRDIIQESLDVQQGLPVVFTPVDPKKGVIRLSSDLNVRFFTPTICAR  119

Query  388  STLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
             T+W++ D  E   +Y V TGG EGNPG  T+SNWFK+ +    YK  +CP+VC  C+ +
Sbjct  120  ETIWKVGDFDEKLKQYFVVTGGVEGNPGPQTVSNWFKIEKLGTDYKFVFCPSVCSFCKVI  179

Query  565  CGDLGILVVDGIRILAITDKPLRVVFKKA  651
            C D+GI   +G+R LA++D P RV+FKK 
Sbjct  180  CKDVGIFTKNGVRFLALSDTPFRVMFKKT  208



>emb|CDP21024.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 114/208 (55%), Gaps = 2/208 (1%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+  +F + FL      +    +      V D +G  + T + YYILPA   G   GGG
Sbjct  1    MKISLLFLISFLPFFISTVSSFASAAEPEPVLDVAGNVLRTDLYYYILPANVRGRF-GGG  59

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GLTL+S  N TCP+ V Q   +  NG  V FS V P +  V+ S D NI+F+    C  S
Sbjct  60   GLTLSSIGNDTCPVGVFQELSAQRNGIPVTFSPVKPRNGVVRISTDLNIEFAYPETCGES  119

Query  391  TLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
             +WR+D   + +    V  GG  GNPG  T+ +WFK+++    YKL YCPTVC  C  +C
Sbjct  120  PVWRVDNYLDPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYKLVYCPTVCSYCDVIC  179

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+GIL  +G R L + D PLRVVFK A
Sbjct  180  KDVGILYQNGERRLFLIDYPLRVVFKLA  207



>emb|CDP21540.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 114/208 (55%), Gaps = 2/208 (1%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+  +F + FL      +    +      V D +G  + T + YYILPA   G   GGG
Sbjct  1    MKISLLFLISFLPFFFSTVSSFASAAEPEPVLDVAGNVLRTDLYYYILPANVRGRFRGGG  60

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
             LTL+S  N TCP+ V Q   +  NG  V FS V P +  V+ S D NI+F+    C  S
Sbjct  61   -LTLSSIGNDTCPVGVFQELSAQRNGIPVTFSPVKPRNGVVRISTDLNIEFAYPETCGES  119

Query  391  TLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
             +WR+D   + +    V  GG  GNPG  T+ +WFK+++    YKL YCPTVC  C  +C
Sbjct  120  PVWRVDNYVDPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYKLVYCPTVCSYCDVIC  179

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+GIL  +G R L + D PLRVVFK+A
Sbjct  180  KDVGILYQNGERRLFLIDYPLRVVFKQA  207



>ref|XP_009793041.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score =   142 bits (359),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 4/178 (2%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D +G +V  G++Y++LP        GGG L      N TCP  ++Q+ D    G  V 
Sbjct  34   VLDINGDKVKVGLNYFVLPVIRG---RGGGLLPSNVKQNNTCPRDIIQNSDEVQEGLPVV  90

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDT  477
            F+  N     V+ S+D N++F   +IC   T+W+L    +   +Y + TGG EGNPG  T
Sbjct  91   FTPFNTKKGVVRLSIDLNVRFFTPTICARETIWKLGTYDDKLKQYFIVTGGVEGNPGPQT  150

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            +S+WFK+ +    YK  +CP+VC IC+ +C D+GI   DG+R LA++D PLRV+FKK 
Sbjct  151  LSSWFKIEKLGTDYKFVFCPSVCKICKVICKDVGIYTKDGVRFLALSDTPLRVMFKKT  208



>gb|ACL12055.1| Kunitz trypsin inhibitor [Nicotiana tabacum]
Length=209

 Score =   142 bits (359),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 4/178 (2%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D +G +V  G++Y++LP        GGG L      N TCP  ++Q+ D    G  V 
Sbjct  34   VLDINGDKVKVGLNYFVLPVIRG---RGGGLLPSNVKQNNTCPRDIIQNSDEVQEGLPVV  90

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDT  477
            F+  N     V+ S+D N++F   +IC   T+W+L    +   +Y + TGG EGNPG  T
Sbjct  91   FAPFNTKKGVVRLSIDLNVRFFTPTICARETIWKLGTYDDKLKQYFIVTGGVEGNPGPQT  150

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            +S+WFK+ +    YK  +CP+VC IC+ +C D+GI   DG+R LA++D PLRV+FKK 
Sbjct  151  LSSWFKIEKLGTDYKFVFCPSVCKICKVICKDVGIYTKDGVRFLALSDTPLRVMFKKT  208



>emb|CDP22082.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 114/208 (55%), Gaps = 2/208 (1%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+  +F + FL      +    +      V D +G  + T + YYILPA   G   GGG
Sbjct  1    MKISLLFLISFLPFFISTVSSFASAAEPEPVLDVAGNVLRTDLYYYILPANVRGRFRGGG  60

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
             LTL+S  N TCP+ V Q   +  NG  V FS V P +  V+ S D NI+F+    C  S
Sbjct  61   -LTLSSIGNDTCPVGVFQELSAQRNGIPVTFSPVKPRNGVVRISTDLNIEFAYPETCGES  119

Query  391  TLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
             +WR+D   + +    V  GG  GNPG  T+ +WFK+++    YKL YCPTVC  C  +C
Sbjct  120  PVWRVDNYVDPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYKLVYCPTVCSYCDVIC  179

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+GIL  +G R L + D PLRVVFK+A
Sbjct  180  KDVGILYQNGERRLFLIDYPLRVVFKQA  207



>ref|XP_007152537.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
 gb|ESW24531.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
Length=205

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 121/211 (57%), Gaps = 10/211 (5%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK   + F +   A +I+L    A      V D+SGQ++ TGV YYILP         GG
Sbjct  1    MKASLLPFSILFFAFTIQLFIGIAVAAPEPVVDTSGQKLRTGVKYYILPVFRGR----GG  56

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIK-FSAVSICVM  387
            GLT++S  N TCPL VVQ      NG  V F+  N  S  +  S D NIK +   + C  
Sbjct  57   GLTVSSSGNNTCPLFVVQEKPEVLNGTPVTFTPYNAKSGVILTSTDLNIKSYGTTTSCDK  116

Query  388  STLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
              +W+L LK +TG + + TGG EGNPG DTI NWFK+ + E  Y + +CP+VC  C+ +C
Sbjct  117  PPVWKL-LKVLTGVWFLSTGGVEGNPGIDTIVNWFKIEKAEKDYVISFCPSVCK-CQTLC  174

Query  568  GDLGILVV-DGIRILAITDK--PLRVVFKKA  651
             +LG+ V  DG + L+++DK    RV+FK+A
Sbjct  175  RELGLYVGDDGNKHLSLSDKVPSFRVMFKRA  205



>ref|XP_006847953.1| hypothetical protein AMTR_s00029p00141480 [Amborella trichopoda]
 gb|ERN09534.1| hypothetical protein AMTR_s00029p00141480 [Amborella trichopoda]
Length=196

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 116/204 (57%), Gaps = 15/204 (7%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGP  234
            +  LI QS  +    AQ   + V D  G  + T   YYILP     N +   GLT+A+  
Sbjct  1    MAVLITQSPPI----AQAATDFVLDLDGHPLRTDSQYYILPVL---NQKITSGLTVATR-  52

Query  235  NTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DL  411
            N +CPL V  S   S+ G  V FS VN     V+ SVD NI+F A++IC+ ST+WR  + 
Sbjct  53   NGSCPLNVALSTGIST-GLPVTFSPVNAGDKVVRLSVDQNIQFEAITICIQSTVWRRSNF  111

Query  412  KEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDA-----YKLYYCPTVCDICRPVCGDL  576
             ++TG   V TGG  GNPGR T+SNWF V R+ +      YKL +CP VCDICR  CG+L
Sbjct  112  DQVTGIQFVITGGVTGNPGRATVSNWFTVERESEVVNNGRYKLVFCPGVCDICRINCGNL  171

Query  577  GILVVDGIRILAITDKPLRVVFKK  648
            G+   +G + LA  D  L +VFKK
Sbjct  172  GVYEENGNKWLAQVDPALSLVFKK  195



>gb|AFS33546.1| Kunitz-type protease inhibitor, partial [Nicotiana tabacum]
Length=133

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 3/132 (2%)
 Frame = +1

Query  262  QSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVG  441
            Q  D SS G  +QFS VNP+   +  S D N+KF+++ I   ST+WR++ + I  +Y+V 
Sbjct  1    QHADESSIGGYLQFSPVNPNENIIGISTDLNVKFTSIHISDSSTVWRINTELIPQRYLVT  60

Query  442  TGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAI--  615
             GG EGNPGR+T+SNWF++ + EDAYKL YCP VC+ CRP CG++GILV    R+L I  
Sbjct  61   VGGVEGNPGRETLSNWFRIDKYEDAYKLVYCPGVCETCRPFCGEIGILVEGSKRVLFIGS  120

Query  616  -TDKPLRVVFKK  648
             +D+PL+V F K
Sbjct  121  RSDQPLKVTFHK  132



>ref|XP_009149240.1| PREDICTED: miraculin [Brassica rapa]
Length=192

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 104/178 (58%), Gaps = 12/178 (7%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D  G  + +G  YYILP         GGGLT++   N TCP  V+Q P   S G  V+
Sbjct  26   VTDIDGGRLTSGTKYYILPVLRGR----GGGLTMSKPENKTCPKSVIQDPYEVSKGLPVE  81

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDT  477
            FS  + +S  ++ S D N KF A S+      W LD   E T ++ V   G  GNPG+ T
Sbjct  82   FSPSD-NSRIIRVSTDLNFKFCAASV------WNLDNYDETTNQWFVTACGVAGNPGQAT  134

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            + NWFK+ + ED YK+ +CPTVC+ C+ +C D+G+ V DG R L ++D PL+V+FKKA
Sbjct  135  VDNWFKIEKYEDDYKIVFCPTVCNFCKVMCRDVGVFVQDGKRRLVLSDVPLKVMFKKA  192



>emb|CDY19181.1| BnaC05g13820D [Brassica napus]
Length=192

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 104/178 (58%), Gaps = 12/178 (7%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D  G  + +G  YYILP         GGGLT++   N TCP  V+Q     S G  ++
Sbjct  26   VTDIDGGRLTSGTKYYILPVLRGR----GGGLTMSKPENKTCPKSVIQDQYEISQGLPLE  81

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDT  477
            FS  + S   ++ S D N KF A S+      W LD   E T ++ V   G EGNPG+ T
Sbjct  82   FSPSDNSRI-IRVSTDLNFKFCAASV------WNLDNYDEKTNQWFVTACGVEGNPGQAT  134

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            + NWFK+ + ED YK+ +CPTVC+ C+ +C D+G+ V DG+R L ++D PL+V+FKKA
Sbjct  135  VDNWFKIEKYEDDYKIVFCPTVCNFCKVMCRDVGVFVQDGMRRLVLSDVPLKVMFKKA  192



>emb|CDP20533.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 112/213 (53%), Gaps = 6/213 (3%)
 Frame = +1

Query  31   MKMEKVF---FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTE  201
            MK   +F   FL+F I+ S       A      V+D +G+ + T   YYILPAA   +  
Sbjct  2    MKASLLFILSFLVFSISVSTNSSFTSAAEAPEPVRDVAGKMLRTDRHYYILPAANVFDKF  61

Query  202  GGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSIC  381
             GGGLTL+     TCP  V Q      NG  + F  VNP    V+ S D NIKF+    C
Sbjct  62   RGGGLTLSGIGKNTCPAAVFQETSEQKNGIPLAFLPVNPKKGVVRVSTDLNIKFAYPETC  121

Query  382  VMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRR-DEDAYKLYYCPTVCDIC  555
              S +W +D     +G   V  GG  GNPG  T+S+WFK+ +     YKL YCP VC  C
Sbjct  122  GQSPVWSIDNYVYPSGDSFVNIGGVVGNPGPKTLSSWFKIEKFGYQDYKLVYCPAVCSYC  181

Query  556  RPVCGDLGILVVDGIRILAI-TDKPLRVVFKKA  651
            + +C D+GI   +G R L + TD PLRVVFKKA
Sbjct  182  KVICKDVGIEYQNGKRRLHLTTDYPLRVVFKKA  214



>gb|AHJ25677.1| Kunitz-type trypsin inhibitor [Curcuma longa]
Length=213

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 117/210 (56%), Gaps = 14/210 (7%)
 Frame = +1

Query  37   MEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGL  216
            M+ +  L FL+      L  EA   A+V +D+ G+ +  G +YYILP         GGGL
Sbjct  7    MKFLVVLCFLLCS----LSAEATSFASV-RDTDGRSLRPGHEYYILPLIRGR----GGGL  57

Query  217  TLASGPNTT---CPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVM  387
            TLA+  N +   CPL V Q      +G  V FS     S  V+ S D N++FSA +ICV 
Sbjct  58   TLAARSNDSSFACPLAVAQEGLEVDSGLPVIFSPAPEGSEFVKMSTDLNVRFSAATICVQ  117

Query  388  STLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRR-DEDAYKLYYCPTVCDICRP  561
            ST+WRL D+   TG+  V +GG EG+PG  T SNWFK+ R  E  YKL +CP+VC  C+ 
Sbjct  118  STVWRLGDVDASTGRRYVISGGVEGSPGAGTASNWFKIERYGERDYKLVHCPSVCQDCKV  177

Query  562  VCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            VCGDLG+ V    R L +   P  V+F  A
Sbjct  178  VCGDLGVFVEGENRWLGLDGDPFPVMFTNA  207



>emb|CDP21543.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 112/213 (53%), Gaps = 6/213 (3%)
 Frame = +1

Query  31   MKMEKVF---FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTE  201
            MK   +F   FL+F I+ S       A      V+D +G+ + T   YYILPAA   +  
Sbjct  2    MKASLLFILSFLVFSISVSTNSSFTSAAEAPEPVRDVAGKILRTDRHYYILPAANVFDKF  61

Query  202  GGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSIC  381
             GGGLTL+     TCP  V Q      NG  + F  VNP    V+ S D NIKF+    C
Sbjct  62   RGGGLTLSGIGKNTCPAAVFQETSEQKNGIPLAFLPVNPKKGVVRVSTDLNIKFAYPETC  121

Query  382  VMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRR-DEDAYKLYYCPTVCDIC  555
              S +W +D     +G   V  GG  GNPG  T+S+WFK+ +     YKL YCP VC  C
Sbjct  122  GQSPVWSIDNYVYPSGDSFVNIGGVVGNPGPKTLSSWFKIEKFGYQDYKLVYCPAVCSYC  181

Query  556  RPVCGDLGILVVDGIRILAI-TDKPLRVVFKKA  651
            R +C D+GI   +G R L + TD PLRVVFK+A
Sbjct  182  RVICKDVGIEYQNGKRRLHLTTDYPLRVVFKQA  214



>ref|XP_003620188.1| Miraculin [Medicago truncatula]
 gb|AES76406.1| Lipid transfer protein [Medicago truncatula]
Length=213

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 115/208 (55%), Gaps = 10/208 (5%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAA---DGNTE---GGGG  213
             L  L A S + L  EA      V D+ G++V  GVDYYI P      DG      G G 
Sbjct  7    LLAVLFALSTQPLLGEADASPEQVVDTEGKKVRAGVDYYIRPVPTTPCDGRGPCVVGSGF  66

Query  214  LTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMST  393
            + +A  PN TCPL VV        G  V F+ VNP    ++ S D NIK S  + C  ST
Sbjct  67   VLIARSPNETCPLNVVVV--EGFRGQGVTFTPVNPKKGVIRVSTDLNIKTSLNTSCEEST  124

Query  394  LWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCG  570
            +W LD     TG++ V TGG  GNPG+DT+ NWFK+ + ED YK  +CPTVC+ C+ +C 
Sbjct  125  IWTLDDFDSSTGQWFVTTGGVLGNPGKDTVDNWFKIEKYEDDYKFVFCPTVCNFCKVMCR  184

Query  571  DLGILV-VDGIRILAITDKPLRVVFKKA  651
            ++GI    +G + +A+TD P +V F+ +
Sbjct  185  NVGIFRDSNGNQRVALTDVPYKVRFQPS  212



>ref|NP_001238098.1| uncharacterized protein LOC100306134 precursor [Glycine max]
 gb|ACU14169.1| unknown [Glycine max]
 gb|KHN24495.1| Miraculin [Glycine soja]
Length=214

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 120/216 (56%), Gaps = 12/216 (6%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAA---DGNTE  201
            MK   + FLL  +  S + L   A      V D+ G++V  GVDYYI P      DG   
Sbjct  1    MKFMYLAFLLLFVFSS-QFLLGGADASPRQVIDTEGKKVRAGVDYYIRPVPTTPCDGRGP  59

Query  202  ---GGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAV  372
               G G + +A   N TCPL V         G AV F  VNP    ++ S D NIK S  
Sbjct  60   CVVGSGYVLIARSSNHTCPLSVAVV--EGFRGLAVTFKLVNPKKGVIRVSTDLNIKTSLT  117

Query  373  SI-CVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVC  546
            +  C  ST+W+LD   + TG++ V TGG  GNPG+DTI NWFK+   +D YKL +CPTVC
Sbjct  118  NTSCSESTVWKLDAFDDSTGQWFVTTGGVLGNPGKDTIDNWFKIEEYDDDYKLVFCPTVC  177

Query  547  DICRPVCGDLGILV-VDGIRILAITDKPLRVVFKKA  651
            + C+P+C ++G+    +G + +A+TD+P +V F+ +
Sbjct  178  NFCKPLCRNVGVFRDSNGNQRVALTDEPYKVRFQPS  213



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 103/178 (58%), Gaps = 4/178 (2%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D++G ++  G +Y++LP        GGG L      N +CP  ++Q+ +    G  V 
Sbjct  34   VLDTNGDKIRAGSNYFVLPVIRG---RGGGLLPSNVKQNNSCPRDIIQNSNEVQEGLPVV  90

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDT  477
            F+ V+P    ++ S D N++F   +IC   T+W+L    E   +Y + TGG EGNPG  T
Sbjct  91   FTPVDPKKGVIRLSTDLNVRFFTPTICARETIWKLGTYDEKLKQYFIVTGGVEGNPGPLT  150

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            +SNWFK+ +    YK  +CP+VC  C+ +C D+GI   DG+R LA++D P RV+FK+ 
Sbjct  151  VSNWFKIEKLGTDYKFVFCPSVCTFCKVICKDVGIYNKDGVRFLALSDTPFRVMFKRT  208



>emb|CDO98557.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 111/209 (53%), Gaps = 4/209 (2%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+  +F + FL+     +    +      V D  G  + T   YYILPA   G   GGG
Sbjct  1    MKISLLFMISFLLFFISTVSSFSSAAEPEPVLDIDGNVLRTNHYYYILPAKVRGRFRGGG  60

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
             L L+S  N TCP+ V Q      NG  + FS V P    V+ S D NI+F+    C  S
Sbjct  61   -LALSSIGNDTCPVGVFQELSEQRNGIPLTFSPVKPRHGVVRTSTDLNIQFAYPETCGES  119

Query  391  TLWRLD--LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
             +WR+D  L  +   +V   GG  GNPG  T+ +WFK+++    YKL YCPTVC  C  +
Sbjct  120  PVWRVDNYLDPLVDSFV-SIGGVVGNPGPATLGSWFKIQKFGYDYKLVYCPTVCSNCDVI  178

Query  565  CGDLGILVVDGIRILAITDKPLRVVFKKA  651
            C D+GIL  +G R L + D PLRVVFK+A
Sbjct  179  CKDVGILYQNGERRLFLNDYPLRVVFKQA  207



>emb|CDP21544.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 112/208 (54%), Gaps = 2/208 (1%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+  +F + FL      +    +      V D +G  + T + YYILPA   G   GGG
Sbjct  1    MKISLLFLISFLPFFISTVSSFASAAEPEPVLDVAGNVLRTDLYYYILPANVRGRFRGGG  60

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
             LTL+S  N TCP+ V Q      NG  + FS + P    V+ S D NI+F+    C  S
Sbjct  61   -LTLSSIGNDTCPVGVFQELSEQRNGIPLTFSPLKPKDGVVRISTDLNIQFAYPETCGES  119

Query  391  TLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
             +WR+D   + +   +V  GG  GNPG  T+ +WFK+++    YKL YCP VC  C  +C
Sbjct  120  PVWRVDNYLDPSADSIVSIGGVVGNPGPATLGSWFKIQKLGYDYKLVYCPAVCSYCDVIC  179

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+GIL  +G R L + D PLRVVFK+A
Sbjct  180  KDVGILYQNGERRLFLIDYPLRVVFKQA  207



>gb|ACV52580.1| endopeptidase inhibitor [Nicotiana benthamiana]
Length=102

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = +1

Query  331  VQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRD  507
            ++ES D NIKFSA SICV +TLW+LD   E TGKY +  GG EGNPGR+TISNWFK+ + 
Sbjct  1    IRESTDLNIKFSAASICVQTTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEKF  60

Query  508  EDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLR  633
            E  YKL YCPTVC+ C+ +C D+GI + DG R LA++D P +
Sbjct  61   ERDYKLVYCPTVCNFCKVICKDIGIFIQDGTRRLALSDVPFK  102



>gb|AFK41478.1| unknown [Medicago truncatula]
Length=213

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 114/208 (55%), Gaps = 10/208 (5%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAA---DGNTE---GGGG  213
             L  L   S + L  EA      V D+ G++V  GVDYYI P      DG      G G 
Sbjct  7    LLAILFVLSTQPLLGEADASPEQVVDTEGKKVRAGVDYYIRPVPTTPCDGRGPCVVGSGF  66

Query  214  LTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMST  393
            + +A  PN TCPL VV        G  V F+ VNP    ++ S D NIK S  + C  ST
Sbjct  67   VLIARSPNETCPLNVVVV--EGFRGQGVTFTPVNPKKGVIRVSTDLNIKTSLNTSCEEST  124

Query  394  LWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCG  570
            +W LD     TG++ V TGG  GNPG+DT+ NWFK+ + ED YK  +CPTVC+ C+ +C 
Sbjct  125  IWTLDDFDSSTGQWFVTTGGVLGNPGKDTVDNWFKIEKYEDDYKFVFCPTVCNFCKVMCR  184

Query  571  DLGILV-VDGIRILAITDKPLRVVFKKA  651
            ++GI    +G + +A+TD P +V F+ +
Sbjct  185  NVGIFRDSNGNQRVALTDVPYKVRFQPS  212



>emb|CDY26209.1| BnaA06g12080D [Brassica napus]
Length=192

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 104/178 (58%), Gaps = 12/178 (7%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D  G  + +G  YYILP         GGGLT++   N TCP  V+Q     S G  ++
Sbjct  26   VTDIDGGRLTSGTKYYILPVLRGR----GGGLTMSKPENKTCPKSVIQDQYEVSKGLPLE  81

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDT  477
            FS  + S   ++ S D N KF A S+      W LD   E+T ++ V   G  GNPG+ T
Sbjct  82   FSPSDNSRI-IRVSTDLNFKFCAASV------WNLDNYDEMTNQWFVTACGVAGNPGQAT  134

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            + NWFK+ + +D YK+ +CPTVC+ C+ +C D+G+ V DG+R L ++D PL+V+FKKA
Sbjct  135  VDNWFKIEKYQDDYKIVFCPTVCNFCKVMCRDVGVFVQDGMRRLVLSDVPLKVMFKKA  192



>emb|CDO98560.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 121/215 (56%), Gaps = 9/215 (4%)
 Frame = +1

Query  31   MKMEKVFFLLFLIA-QSIKLLCIEA--QIMANVVKDSSGQEVLTGVDYYILPAAADGNTE  201
            MK   V F L LI+  +  L C  A   +    V    G+EV T + YYI PA   G  +
Sbjct  1    MKAPLVLFPLVLISIYTNSLFCQAAAESVQPAAVFGVDGKEVRTDLFYYIRPANNRGK-D  59

Query  202  GGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFS-SVNPSSTNVQESVDHNIKFSAVSI  378
             GGGL L S  N +CPL+V+Q  +   +G  + FS +V P    V+ S D NI+ +    
Sbjct  60   RGGGLGLRSIGNDSCPLVVIQETNELRDGLPLTFSPAVAPKDNVVRVSTDLNIQVAFPDT  119

Query  379  CVMSTLWRLDLKEIT-GKYVVGTGGEEGNPGRDTISNWFKVRRDED---AYKLYYCPTVC  546
            C   T+WR+D+ + + G+  V  GG  GNPG +T+ NWFK+ +  D    YKL YCPTVC
Sbjct  120  CNQPTVWRVDVSDKSEGRKFVNLGGVIGNPGPETLGNWFKIEKVGDHGNKYKLVYCPTVC  179

Query  547  DICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
              C+  C +LGI+  +G+R LA++ +P +V+F +A
Sbjct  180  SYCKVNCKNLGIVYQNGLRRLALSHRPFKVIFTRA  214



>ref|XP_004137639.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64219.1| hypothetical protein Csa_1G043220 [Cucumis sativus]
Length=205

 Score =   137 bits (346),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 109/201 (54%), Gaps = 7/201 (3%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLAS-  228
            FL  +IA S    C  A    + V D+ G+++  G  YYIL       +   GGL++   
Sbjct  9    FLFIVIASSEVRFC-RADASPDAVLDTDGKKLRAGDQYYILSVY----SRNSGGLSIGGI  63

Query  229  GPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-  405
                 CP+ ++       +G    FS +NP    V+ S D NI+F A + C +ST+W++ 
Sbjct  64   YGYEKCPINILPESYDYLHGLPATFSPINPKKGVVRVSTDLNIQFEANTRCGISTVWKVG  123

Query  406  DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
               E   +Y V  GG +GNPGR+TI NWFKV +    YKL YCPTVC  C+ VC D+G+ 
Sbjct  124  KFDEYLKQYFVTMGGMKGNPGRETIENWFKVEKYGKNYKLVYCPTVCKYCKVVCKDVGLF  183

Query  586  VVDGIRILAITDKPLRVVFKK  648
              +G R++A+ D P  V+FKK
Sbjct  184  YKNGRRVIALNDAPFPVMFKK  204



>emb|CDO98554.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 102/185 (55%), Gaps = 2/185 (1%)
 Frame = +1

Query  100  AQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSS  279
             ++    V D++G  + T  DYYILPA   G   GGG LTL+S  N TCP+ V Q     
Sbjct  26   GELAPEPVLDTAGNVLRTDRDYYILPAKVRGRFRGGG-LTLSSIGNDTCPVGVFQEMSEQ  84

Query  280  SNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEE  456
             NG  + FS V      V+ S D NI+F+    C  S +WR+D   + +    V  GG  
Sbjct  85   RNGIPLTFSPVKQRYGVVRTSTDLNIQFAYPETCGESPVWRVDNYLDPSADSFVSIGGVV  144

Query  457  GNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRV  636
            GNPG  T+ +WFK+++    YKL YCP VC  C  +C D+GIL  +G R L + D PLRV
Sbjct  145  GNPGPATLGSWFKIQKFGYDYKLVYCPAVCSYCDAICKDVGILYQNGERRLFLNDYPLRV  204

Query  637  VFKKA  651
            VFK A
Sbjct  205  VFKLA  209



>ref|XP_008437082.1| PREDICTED: miraculin [Cucumis melo]
Length=207

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 107/201 (53%), Gaps = 7/201 (3%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLAS-  228
            FL  +IA S    C  A    + V D+ G+++  G  YYIL       +   GGL++   
Sbjct  9    FLFIVIASSEVRFC-RADASPDAVLDTDGKKLRAGDQYYILSVY----SRNSGGLSIGGI  63

Query  229  GPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-  405
                 CP+ ++       +G    FS VNP    V+ S D NI+F A + C +ST+W++ 
Sbjct  64   YGYEKCPINILPESYDYLDGLPATFSPVNPKKGVVRVSTDLNIEFEASTRCGISTVWKVG  123

Query  406  DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
               +   +Y V  GG +GNPGR+TI NWFKV +    YK  YCPTVC  C+ +C D+G+ 
Sbjct  124  KFDQYLKQYFVTMGGTKGNPGRETIGNWFKVEKHGKNYKFVYCPTVCKYCKVMCKDVGLF  183

Query  586  VVDGIRILAITDKPLRVVFKK  648
              +G RI A+ D P  V+FKK
Sbjct  184  YKNGRRIFALNDAPFPVMFKK  204



>ref|XP_010249125.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=211

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 107/183 (58%), Gaps = 13/183 (7%)
 Frame = +1

Query  124  KDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTT-CPLLVVQSPDSSSNGFAVQ  300
            +D+ G+ + + V YYILPA      E  GG   AS  N++ CP  VVQ  ++ SNG  + 
Sbjct  33   RDTMGRPLHSRVRYYILPA-----DESAGGFGFASTKNSSSCPFGVVQHEENQSNGLPLW  87

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDT  477
            F  V+P    ++ S D NI+F+ +++    T+W+L +    T ++ V T G  GNPG +T
Sbjct  88   FYPVDPKKGIIRVSTDLNIRFAILTLLPQPTVWKLGEFDPSTQQWFVNTCGALGNPGPET  147

Query  478  ISNWFKVRRDEDAYKLYYCPTVCD------ICRPVCGDLGILVVDGIRILAITDKPLRVV  639
            +S+WFK+   E+ YKL +CP VC        C+ +C DLGI   +GIR LA++D PL++ 
Sbjct  148  LSSWFKIEPYEEDYKLVFCPNVCSFSSPRRFCKVICRDLGIFFKNGIRYLALSDHPLKIK  207

Query  640  FKK  648
            F K
Sbjct  208  FNK  210



>ref|XP_009615974.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 100/178 (56%), Gaps = 4/178 (2%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D +G +V  G +Y++LP        GGG L        TCP  ++Q+ D    G  V 
Sbjct  34   VLDINGDKVRVGSNYFVLPVI---RGRGGGLLPSNVKQINTCPRDIIQNSDEVQQGLPVV  90

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDT  477
            F+  +     V+ S D N++F   +IC   T+W+L    +   +Y + TGG EGNPG  T
Sbjct  91   FTPFDAKKGVVRLSTDLNVRFYTPTICARETIWKLGTYDDKLKQYFIVTGGVEGNPGPQT  150

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            +S+WFK+ +    YK  +CP+VC IC+ +C D+GI   DG+R LA++D P RV+FKK 
Sbjct  151  VSSWFKIEKLGTDYKFLFCPSVCKICKVICKDVGIYTKDGVRFLALSDTPFRVMFKKT  208



>ref|XP_003534101.1| PREDICTED: 21 kDa seed protein-like [Glycine max]
 gb|KHM99730.1| Miraculin [Glycine soja]
Length=203

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 120/211 (57%), Gaps = 12/211 (6%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+  + F +  ++ +I+L    A      V D+SGQ++ TGV YYILP         GG
Sbjct  1    MKVSPLAFSILFLSFTIELFIGIASAAQEPVLDTSGQKLRTGVKYYILPVFRGR----GG  56

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIK-FSAVSICVM  387
            GLT++S  N TCPL VVQ     S G  V F+  N  S  +  S D NIK +   + C  
Sbjct  57   GLTVSSSGNNTCPLFVVQEKLEVSKGTPVTFTPYNAESGVILTSTDLNIKSYVKSTTCDK  116

Query  388  STLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
              +W+L LK +TG + + TGG EGNPG +T+ NWFK+ + E  Y L +CP+     + +C
Sbjct  117  PPVWKL-LKVLTGVWFLSTGGVEGNPGVNTVVNWFKIEKAEKDYVLSFCPS---FAQTLC  172

Query  568  GDLGILVV-DGIRILAITDK--PLRVVFKKA  651
             +LG+ V  DG + L+++DK    RV+FK+A
Sbjct  173  RELGLYVGDDGNKHLSLSDKVPSFRVIFKRA  203



>gb|AFK39812.1| unknown [Lotus japonicus]
 gb|AFK45182.1| unknown [Lotus japonicus]
Length=208

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 119/214 (56%), Gaps = 13/214 (6%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLC-IEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGG  207
            MK  ++ F +   A + + L  I +      V D SGQ++ TGV YYILP         G
Sbjct  1    MKTSQLAFSIICFAFTTEFLIGIASAAAPEPVLDISGQKLRTGVKYYILPVLRGK----G  56

Query  208  GGLTLASG---PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAV-S  375
            GGLTL S     N TCPL VVQ       G +V F+  N     +  S D NIK S   +
Sbjct  57   GGLTLTSSGNINNNTCPLHVVQEKLEVLKGQSVTFTPYNAKGGVILTSTDLNIKSSLTNT  116

Query  376  ICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDIC  555
             C  + +W+L LKE++G + + TGG EGNPG  TISNWFK+ + +  Y   +CP+VC  C
Sbjct  117  TCAKAPVWKL-LKELSGVWFLATGGVEGNPGMATISNWFKIEKADKDYVFSFCPSVCK-C  174

Query  556  RPVCGDLGILVVDGIRILAITDK--PLRVVFKKA  651
            + +C +LGI    G + L+++D+  P R++FK+A
Sbjct  175  QTLCRELGIYDYGGDKHLSLSDQVPPFRIMFKQA  208



>ref|XP_004237191.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=221

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 104/181 (57%), Gaps = 4/181 (2%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D  G E+  G+ Y ILP   +G++ GG G+      N  CP  V+Q    SSNG   +
Sbjct  39   VLDIGGHELQIGLKYTILPINQNGSSSGGVGVLALEAKNRPCPFYVIQKNIESSNGLPTR  98

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDT  477
            F  ++ +   +  S D NI F A +ICV ST W++    E TG+  V +GG  G PG +T
Sbjct  99   FIPIDNNQQVINLSTDLNIVFVASTICVQSTAWKVGGADERTGRRYVMSGGTIGRPGIET  158

Query  478  ISNWFKVRR--DEDAYKLYYCPTVCDI-CRPVCGDLGILVVDGIRILAITDKPLRVVFKK  648
            ISNWFK+ R  + ++YK+ +CP VC   C+ VCG++G+   +G + L + D+PL V FKK
Sbjct  159  ISNWFKIERYGNNESYKIVFCPRVCSSNCKIVCGNVGVFNENGKKWLGLIDEPLVVRFKK  218

Query  649  A  651
             
Sbjct  219  V  219



>emb|CDO98555.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 109/213 (51%), Gaps = 6/213 (3%)
 Frame = +1

Query  31   MKMEKVF---FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTE  201
            MK   +F   F +F I+ S       A      V D +G+ + T   YYILPAA   +  
Sbjct  2    MKASLLFILSFRVFSISVSTNSSFTSAAEAPEPVSDVAGKMLRTDRHYYILPAANVFDKF  61

Query  202  GGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSIC  381
             GGGLTL+     TCP  V Q      NG  + F  VN     VQ S D NIKF+    C
Sbjct  62   RGGGLTLSGIGKNTCPTAVFQEMSEQENGIPLAFLPVNRKKGVVQVSTDLNIKFAYPQTC  121

Query  382  VMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRR-DEDAYKLYYCPTVCDIC  555
              S +W +D     +G   V  GG  GNPG  T+S+WFK+ +     YKL YCP VC  C
Sbjct  122  GQSPVWSIDNYVYPSGDSFVNIGGVVGNPGPKTLSSWFKIEKFGYQDYKLVYCPAVCSYC  181

Query  556  RPVCGDLGILVVDGIRILAI-TDKPLRVVFKKA  651
            + +C D+GI   +G R L + TD PLRVVFK+A
Sbjct  182  KVICKDVGIEYQNGKRRLHLTTDYPLRVVFKQA  214



>dbj|BAA82842.1| miraculin homologue [Taraxacum officinale]
Length=136

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 85/128 (66%), Gaps = 2/128 (2%)
 Frame = +1

Query  205  GGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICV  384
            GGG+TLA      CPL VVQ+     NG  + F+ V+P    ++ES D NI FSA SIC+
Sbjct  5    GGGVTLAPTRTELCPLDVVQANQELDNGLPLTFTPVDPKKGVIRESTDLNIIFSASSICI  64

Query  385  MSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
             S +W ++  E  G  +V   G +GNPG++T+SNWFK+ + +D YK+ +CP VCD+CRP+
Sbjct  65   QSNVWMIE--EYDGSLIVSAHGVQGNPGQETLSNWFKIEKFDDDYKIVFCPAVCDVCRPL  122

Query  565  CGDLGILV  588
            CGD+G+ +
Sbjct  123  CGDIGVEI  130



>ref|XP_006347377.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=210

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 103/180 (57%), Gaps = 7/180 (4%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLAS--GPNTTCPLLVVQSPDSSSNGFA  294
            V D +G +V  G +Y+ILP         GGGL  ++    N+TCP  +VQ  D    G  
Sbjct  34   VLDINGDKVQAGPNYFILPVIRGK----GGGLYPSNVKQHNSTCPRDIVQETDEVQQGLP  89

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGR  471
            V F+ ++     V+ S D N++F   +IC   T+W+L    +   +Y V TGG EGNPG 
Sbjct  90   VVFTRLDAKKGVVRVSTDVNVRFYTPTICARETIWKLGAYDDKLKQYFVVTGGVEGNPGP  149

Query  472  DTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
             T+ NWFK+ +    YK  +CP+VC+  + +C D+G+ + DG+R LA++D P +V+FKK 
Sbjct  150  QTVGNWFKIEKFGSDYKFVFCPSVCEFYKVICKDVGVFMKDGVRFLALSDTPFKVMFKKT  209



>ref|XP_010683192.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=211

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 102/183 (56%), Gaps = 10/183 (5%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNT-TCPLLVVQSPDSSSNGFAV  297
            V D +G+ + T   YYILP +       GGGL +A    T +CPL V Q     SNG  +
Sbjct  33   VLDINGRPLKTDSTYYILPVSRGR----GGGLAMAPKNATESCPLYVAQENHEVSNGLPL  88

Query  298  QFSSVNPSSTN-VQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRD  474
            +F   NP+  + +    D NI F A +ICV  T W L   E +G   VG GG  GNPG D
Sbjct  89   KFFPTNPNDHDKIPLGYDVNIVFDAATICVQPTGWMLAFDEASGTRYVGIGGTIGNPGVD  148

Query  475  TISNWFKVRRDEDA---YKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVF  642
            T+SNWF + +       YK+ +CP VC  C  +CGD+G+ + + G R LA+TD+PL V F
Sbjct  149  TLSNWFAIEKAGSGLYDYKIRFCPAVCIFCTVMCGDVGVFIGEGGTRFLALTDRPLLVRF  208

Query  643  KKA  651
            KKA
Sbjct  209  KKA  211



>ref|XP_004515059.1| PREDICTED: miraculin-like [Cicer arietinum]
Length=204

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 118/207 (57%), Gaps = 16/207 (8%)
 Frame = +1

Query  61   FLIAQSIKLLCIEAQIMA--NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLT---LA  225
            FL+A SI       + +A    V D SG++V TGV YYILP    GN   GGGLT   +A
Sbjct  4    FLLAFSIICFVFICKTIAAPQPVLDISGKKVTTGVKYYILPVIV-GN---GGGLTVTSIA  59

Query  226  SGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIK--FSAVSICVMSTLW  399
               N TCPL VVQ      NG  V F+  N +   +  S D NIK  F+  + C    +W
Sbjct  60   DNNNNTCPLYVVQEKQEVQNGQPVTFTPYNATKGVILTSTDLNIKSSFTKKTTCAQPPVW  119

Query  400  RLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLG  579
            +L LK ++G + + TGG EGNPG  TI NW+K+ +    Y L +CP+VC+ C  +C +LG
Sbjct  120  KL-LKVLSGVWFLSTGGVEGNPGFQTIGNWYKIEKAGKDYVLSFCPSVCN-CHTLCRELG  177

Query  580  ILVVD-GIRILAITDK--PLRVVFKKA  651
            +   D GI+ LA++D+    RVVF++A
Sbjct  178  LYTDDKGIKHLALSDQVPSFRVVFQRA  204



>gb|KHN24496.1| Miraculin [Glycine soja]
Length=204

 Score =   132 bits (331),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 118/210 (56%), Gaps = 12/210 (6%)
 Frame = +1

Query  34   KMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGG  213
            K+  + F +  +A +I+     A      V D+SGQ++ TGV YYILP         GGG
Sbjct  3    KVSPLVFSILFLAFTIEPFIGIAAAAPEAVLDTSGQKLRTGVKYYILPVFRGK----GGG  58

Query  214  LTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIK-FSAVSICVMS  390
            LT++S  N TCPL VVQ     S G  V F+  N  S  +  S D NIK +   + C   
Sbjct  59   LTVSSSGNNTCPLFVVQEKLEVSKGTPVTFTPYNAKSGVILTSTDLNIKSYGKTTTCDKP  118

Query  391  TLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCG  570
             +W+L LK +TG + + TGG EGNPG +T+ NWFK+ + E  Y L +CP+     R +C 
Sbjct  119  PVWKL-LKVLTGVWFLSTGGVEGNPGVNTVVNWFKIEKAEKDYVLSFCPS---FARTLCR  174

Query  571  DLGILVV-DGIRILAITDK--PLRVVFKKA  651
            +LG+ V  DG + L+++DK    +V+FK+A
Sbjct  175  ELGLYVGDDGNKHLSLSDKVPSFKVMFKRA  204



>ref|XP_010683390.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=224

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 103/186 (55%), Gaps = 13/186 (7%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTT-CPLLVVQSPDSSSNGFAV  297
            V D+ G+ +     YYILPA+       GGG+T++    TT CPL V Q       G +V
Sbjct  29   VLDTEGRPLRAKSRYYILPASQGQ----GGGITVSQKNQTTLCPLYVSQESQEIYLGLSV  84

Query  298  QFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGRDT  477
             F     +   +  S D NI F+ V+IC+ S  W+L +   T +  V TGG  GNPG +T
Sbjct  85   WFLPSKHNQRLIYISSDINILFNMVNICLQSAAWKLSIDHTTWRKYVATGGAIGNPGEET  144

Query  478  ISNWFKVRRDEDA-------YKLYYCPTVCDICRPVCGDLGILVV-DGIRILAITDKPLR  633
            +S+WFK+ + +         YK+ YCP VC  C  +CGD+G+ V  DG R+L ++D+P  
Sbjct  145  VSSWFKIEKVKSGSYEYDYNYKIMYCPNVCSFCMVMCGDVGVFVQDDGTRLLGLSDRPFY  204

Query  634  VVFKKA  651
            V+FKKA
Sbjct  205  VMFKKA  210



>ref|XP_004241480.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=211

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 101/180 (56%), Gaps = 7/180 (4%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLAS--GPNTTCPLLVVQSPDSSSNGFA  294
            V D +G +V  G +Y+ILP         GGGL  ++    N+TCP  ++Q  D    G  
Sbjct  35   VLDINGDKVKAGPNYFILPVIQGK----GGGLYPSNVKQHNSTCPRDIIQETDDVQEGLP  90

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGR  471
            V F+ ++     V+ S D N++F   +IC   T+W+L    +   +Y V TGG EGNPG 
Sbjct  91   VVFTRLDAKKGVVRVSTDVNVRFFTPTICARETIWKLGAYDDKLKQYFVVTGGVEGNPGP  150

Query  472  DTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
             T+ NWFK+ +    YK  +CP+VC  C+ +C D+G+ + DG+R LA++D P  V FKK 
Sbjct  151  KTVGNWFKIVKFGSGYKFVFCPSVCKFCKVICKDVGVFMKDGVRFLALSDTPFEVKFKKT  210



>dbj|BAA82841.1| miraculin homologue [Youngia japonica]
Length=136

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 81/128 (63%), Gaps = 2/128 (2%)
 Frame = +1

Query  205  GGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICV  384
            GGG+ L    N  CP  VVQ+     NG  + F+ V+P    ++ES D NI F A SIC+
Sbjct  5    GGGVRLVPTRNELCPPDVVQADQELDNGLPLTFTPVDPKKGVIRESTDLNIIFRAYSICI  64

Query  385  MSTLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
             S +W L+  E  G  +V   G  GNPG++TISNWFK+ + ED YKL +CPTVCD CRP+
Sbjct  65   QSNVWMLE--EYDGSLIVSGHGVAGNPGQETISNWFKIEKYEDDYKLVFCPTVCDTCRPI  122

Query  565  CGDLGILV  588
            CGD+G+ +
Sbjct  123  CGDIGVEI  130



>ref|XP_009803614.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=210

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 100/179 (56%), Gaps = 5/179 (3%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D +G +V  G++Y++LP        GGG        N TCP  ++Q  D    G  V 
Sbjct  34   VLDINGDKVQVGLNYFVLPVI---RGRGGGLYPSNVKQNNTCPRDIIQEVDEVQQGLPVV  90

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDT  477
            F+  +     V+ S D N++F   +IC   T+W+L    +   +Y + TGG EGNPG  T
Sbjct  91   FTPFDAKKGVVRLSTDLNVRFFTPTICARETIWKLGTYDDKLKQYFMVTGGVEGNPGPQT  150

Query  478  ISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVV-DGIRILAITDKPLRVVFKKA  651
            +S+WFK+ +    YK  +CP+VC IC+ +C D+GI    DG+R +A++D P RV+FKK 
Sbjct  151  LSSWFKIEKLGTDYKFVFCPSVCKICKVICKDVGIYSTKDGVRFMALSDTPFRVMFKKT  209



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 106/188 (56%), Gaps = 13/188 (7%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTL-ASGPNTT--CPLLVVQSPDSSSN  285
            N V D  G+++ TG +YYI+P   D     GGGLT+ A+ PN T  CP  VVQ+     +
Sbjct  34   NPVLDIDGEKLRTGTNYYIVPVLRDH----GGGLTVSATTPNGTFVCPPRVVQTRKEVDH  89

Query  286  GFAVQFSSVNPSSTNVQESVDHNIKFSAVSIC--VMSTLWRLD-LKEITGKYVVGTGGEE  456
               + F   NP    V+ S D NI FSA   C    ST+WRLD   E TG+Y V  GG +
Sbjct  90   DRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVK  149

Query  457  GNPGRDTISNWFKVRR--DEDAYKLYYCPTVCDICRPVCGDLGILV-VDGIRILAITDKP  627
            GNPG +TIS+WFK+        YKL +CPTVC  C+  CGD+GI +   G R LA++DKP
Sbjct  150  GNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKP  209

Query  628  LRVVFKKA  651
                F K 
Sbjct  210  FAFEFNKT  217



>ref|NP_001237597.1| uncharacterized protein LOC100527288 precursor [Glycine max]
 gb|ACU16359.1| unknown [Glycine max]
Length=204

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 118/210 (56%), Gaps = 12/210 (6%)
 Frame = +1

Query  34   KMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGG  213
            K+  + F +  +A +I+     A      V D+SGQ++ TGV YYILP         GGG
Sbjct  3    KVSPLAFSILFLAFTIEPFIGIAAAAPEAVLDTSGQKLRTGVKYYILPVFRGK----GGG  58

Query  214  LTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIK-FSAVSICVMS  390
            LT++S  N TCPL VVQ     S G  V F+  N  S  +  S D NIK +   + C   
Sbjct  59   LTVSSSGNNTCPLFVVQEKLEVSKGTPVTFTPYNAKSGVILTSTDLNIKSYGKTTTCDKP  118

Query  391  TLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCG  570
             +W+L LK +TG + + TGG EGNPG +T+ NWFK+ + E  Y L +CP+     + +C 
Sbjct  119  PVWKL-LKVLTGVWFLSTGGVEGNPGVNTVVNWFKIEKAEKDYVLSFCPS---FAQTLCR  174

Query  571  DLGILVV-DGIRILAITDK--PLRVVFKKA  651
            +LG+ V  DG + L+++DK    +V+FK+A
Sbjct  175  ELGLYVGDDGNKHLSLSDKVPSFKVMFKRA  204



>gb|KHM99741.1| Miraculin [Glycine soja]
Length=199

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 117/208 (56%), Gaps = 10/208 (5%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MKM  V  +L ++A S K L   A      V D+SG+ V     YYI+PA+ D      G
Sbjct  1    MKMTLVTLVL-IVALSTKALLGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDL-----G  54

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GL +AS     CPL VV        G  + F+ VN +   ++ S D NI F   + C  +
Sbjct  55   GLDMAST-GADCPLDVVVV--DGYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVATSCPQT  111

Query  391  TLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
            T+W+L D    T ++ V TGG+ GNPG  T++NWFK+ + EDAYKL YCP+VC+ C   C
Sbjct  112  TVWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCPSVCNDCSYPC  171

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
            GD+GI   +  + LA++ +P +V F++A
Sbjct  172  GDIGIYQDEYGKRLALSSEPYKVKFQRA  199



>ref|XP_010536414.1| PREDICTED: miraculin-like [Tarenaya hassleriana]
Length=212

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 109/202 (54%), Gaps = 9/202 (4%)
 Frame = +1

Query  55   LLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGP  234
            L F  A ++  L   A      V+D  G  +  GV YY+LP         GGGLTLA   
Sbjct  6    LYFAFALAVAFLI--AHATGTAVRDVDGDLLRPGVGYYVLPVLRGH----GGGLTLAGRG  59

Query  235  NTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFS-AVSICVMSTLWRLD-  408
            +  CPL +VQ      +G  V+FS        V ES D NIK   A +IC+ ST W +D 
Sbjct  60   SELCPLDIVQENSEVDDGIPVKFSGWTSRVGFVPESEDLNIKTDVAATICIQSTYWWIDE  119

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV  588
              +   ++ V TG      G++++ ++FK+ +  + YK  +CP  C+ CRP+CGD+GI V
Sbjct  120  FDKQRKQWFVTTGNALRRSGKESLRSFFKIVKSRNDYKFVFCPRDCEFCRPICGDVGIFV  179

Query  589  -VDGIRILAITDKPLRVVFKKA  651
              +GIR LA++D+P  V+FKKA
Sbjct  180  DENGIRRLALSDQPFVVMFKKA  201



>emb|CDO98558.1| unnamed protein product [Coffea canephora]
 emb|CDO98559.1| unnamed protein product [Coffea canephora]
Length=212

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 110/206 (53%), Gaps = 4/206 (2%)
 Frame = +1

Query  46   VFFLLFLIAQSIKLLCIEAQIMA-NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTL  222
            +F L FL+  SI      +   A   V D +G+ + T ++YYILPA        GGGLTL
Sbjct  7    LFILSFLVIFSISTNFFSSAAEAPEPVLDVAGKMLRTYLNYYILPANVFRGRYRGGGLTL  66

Query  223  ASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWR  402
            +   N TCP  V Q      NG  + F  VNP    V+ S D NIKF     C  S +W 
Sbjct  67   SGIGNDTCPAGVFQETSQQINGIPLTFFPVNPKKGVVRVSTDLNIKFDYPDTCDESPVWS  126

Query  403  LD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRR-DEDAYKLYYCPTVCDICRPVCGDL  576
            +D     +    V  GG  GNPG +T+S+WFK+++     YKL +CPTVC  C  +C D+
Sbjct  127  VDNYVYPSDDSFVNIGGVVGNPGPETLSSWFKIQKFGYRDYKLVFCPTVCSYCDVICKDV  186

Query  577  GILVVDGIRILAI-TDKPLRVVFKKA  651
            GI   DG R L++ TD P RVVF++A
Sbjct  187  GITYQDGKRRLSLTTDYPHRVVFQQA  212



>ref|XP_002305034.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
 gb|EEE85545.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
Length=207

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 113/202 (56%), Gaps = 8/202 (4%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLLF +A    L  + A      V D +G+ + TG  Y ILP         GGG+T A  
Sbjct  10   FLLFALAAK-PLPRVAAGAAPEPVLDIAGKVLRTGTYYDILPV----ERGRGGGITFACT  64

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-  408
             + +CP+ V+      S+G  +QF   N     ++ S D NIKF   + C  + +W+++ 
Sbjct  65   GHKSCPVDVMLEDYEDSDGLPLQFIPANRKKGVIRLSTDLNIKFPGPASCAATAVWKVEK  124

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVC-DICRPVCGDLGIL  585
              E+T +  + T G EGNPG +T+ NWFK+ +  + YKL +CPTVC D C+ +C D+GI 
Sbjct  125  YDELTSQMFISTSGVEGNPGPETVDNWFKIEKYGNDYKLVFCPTVCNDHCKVLCKDIGIY  184

Query  586  V-VDGIRILAITDKPLRVVFKK  648
            V  +G + LA++D PL+V FKK
Sbjct  185  VDKEGFKRLALSDVPLKVKFKK  206



>gb|ADW95380.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=210

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 113/202 (56%), Gaps = 8/202 (4%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FLLF +A    L  + A      V D +G+ + TG  Y ILP         GGG+T A  
Sbjct  13   FLLFALAAK-PLPRVAAGAAPEPVLDIAGKVLRTGTYYDILPV----ERGRGGGITFACT  67

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-  408
             + +CP+ V+      S+G  +QF   N     ++ S D NIKF   + C  + +W+++ 
Sbjct  68   GHKSCPVDVMLEDYEDSDGLPLQFIPANRKKGVIRLSTDLNIKFPGPASCAATAVWKVEK  127

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVC-DICRPVCGDLGIL  585
              E+T +  + T G EGNPG +T+ NWFK+ +  + YKL +CPTVC D C+ +C D+GI 
Sbjct  128  YDELTSQMFISTSGVEGNPGPETVDNWFKIEKYGNDYKLVFCPTVCNDHCKVLCKDIGIY  187

Query  586  V-VDGIRILAITDKPLRVVFKK  648
            V  +G + LA++D PL+V FKK
Sbjct  188  VDKEGFKRLALSDVPLKVKFKK  209



>ref|XP_003620169.1| Kunitz-type trypsin inhibitor alpha chain [Medicago truncatula]
 gb|AES76387.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
 gb|AFK40758.1| unknown [Medicago truncatula]
 gb|AFK41434.1| unknown [Medicago truncatula]
Length=203

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 106/183 (58%), Gaps = 11/183 (6%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG--PNTTCPLLVVQSPDSSSNGFA  294
            V D SG+++ TGV YYILP         GGGLT+A+    N TCPL VVQ      NG A
Sbjct  26   VLDISGKQLTTGVKYYILPVIRGK----GGGLTVANHGENNQTCPLYVVQEKLEVKNGEA  81

Query  295  VQFSSVNPSSTNVQESVDHNIK-FSAVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGR  471
            V F+  N     +  S D NIK F   + C  + +W+L LKE+TG + + TGG EGNP  
Sbjct  82   VTFTPYNAKQGVILTSTDLNIKSFVTKTKCPQTQVWKL-LKELTGVWFLATGGVEGNPSM  140

Query  472  DTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDK--PLRVVF  642
             T+ NWFK+ + +  Y L +CP     C+ +C +LG+ V D G + LA++D+    RVVF
Sbjct  141  ATVGNWFKIEKADKDYVLSFCPAEACKCQTLCRELGLFVDDKGNKHLALSDQIPSFRVVF  200

Query  643  KKA  651
            K+A
Sbjct  201  KRA  203



>gb|AEK26927.1| Kunitz-type trypsin inhibitor B4 [Populus nigra]
Length=211

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 115/203 (57%), Gaps = 9/203 (4%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYY-ILPAAADGNTEGGGGLTLAS  228
            FLLF +A    L  + A      V D +G+ + TG +YY ILP         GGG+T A 
Sbjct  13   FLLFALAAK-PLPRVAAGAAPEPVLDIAGKVLRTGTNYYDILPV----ERGRGGGITFAI  67

Query  229  GPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD  408
              + +CP+ V+      S+G  +QF   N     ++ S D NIKF   + C  + +W+++
Sbjct  68   TGHKSCPVDVMLEDYEDSDGLPLQFIPANRKKGVIRLSTDLNIKFPGPASCAATAVWKVE  127

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVC-DICRPVCGDLGI  582
               ++T +  + T G EGNPG +T+ NWFK+ +  + YKL +CPTVC D C+ +C D+GI
Sbjct  128  KYDKLTSQMFISTSGVEGNPGPETVDNWFKIEKYGNDYKLVFCPTVCNDHCKVLCKDIGI  187

Query  583  LV-VDGIRILAITDKPLRVVFKK  648
             V  +G + LA++D PL+V FKK
Sbjct  188  YVDKEGFKRLALSDVPLKVKFKK  210



>gb|KHM99743.1| Miraculin [Glycine soja]
Length=199

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 116/208 (56%), Gaps = 10/208 (5%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MKM  V  +L ++A S K L   A      V D+SG+ V     YYI+PA+ D      G
Sbjct  1    MKMTLVTLVL-IVALSTKALLGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDL-----G  54

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GL +AS     CPL VV        G  + F+ VN +   ++ S D NI F   + C  +
Sbjct  55   GLDMAST-GADCPLDVVAV--DGYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVATSCPQT  111

Query  391  TLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
            T+W+L D    T ++ V TGG+ GNPG  T++NWFK+ + EDAYKL YCP+VC+ C   C
Sbjct  112  TVWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCPSVCNDCSYPC  171

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+GI   +  + LA++ +P +V F++A
Sbjct  172  SDIGIYQDEYGKRLALSSEPYKVKFQRA  199



>ref|XP_002265535.2| PREDICTED: alpha-amylase/subtilisin inhibitor-like [Vitis vinifera]
Length=195

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 107/179 (60%), Gaps = 16/179 (9%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D+SGQ +  GV+YYILP+        GGGLTL +  N +CPL V Q   +SS G+ V 
Sbjct  31   VLDTSGQALQRGVEYYILPS----TNSSGGGLTLIN-RNGSCPLYVGQEDQASSQGYPVT  85

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEI-TGKYVVGTGGEEGNPGRDT  477
            F+      T ++ES D +++F A +IC+ ST WRL  ++  T + ++ TGGE G      
Sbjct  86   FAPFFEQETIIRESRDFSVQFVAFTICIQSTAWRLGERDPETQRRLIVTGGETG------  139

Query  478  ISNWFKVRRDEDAYKLYYCPT-VCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
               +F++ R+ + Y L +CPT VC IC+  CG  GILV +G R+LA+    L VVFK+A
Sbjct  140  ---YFRIERNGEGYYLAWCPTDVCPICKFDCGSAGILVENGKRLLALDGPVLSVVFKRA  195



>ref|XP_003620172.1| 21 kDa seed protein [Medicago truncatula]
 gb|AES76390.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=205

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 115/207 (56%), Gaps = 17/207 (8%)
 Frame = +1

Query  64   LIAQSIKLLCIEAQIMA--NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPN  237
             +A SI  L    +  A    V D SG++V TGV YYILP         GGGLT+ +  N
Sbjct  5    FLAFSIIFLAFICKTFAAPEPVLDISGKKVTTGVKYYILPVIRGK----GGGLTVVNENN  60

Query  238  T-----TCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIK-FSAVSICVMSTLW  399
                  TCPL V+Q      NG AV F+  N     +  S D NIK +   + C  S +W
Sbjct  61   LNGNNNTCPLYVLQEKLEVKNGQAVTFTPYNAKKGVILTSTDLNIKSYVTKTTCAQSQVW  120

Query  400  RLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLG  579
            +L+ K ++G + + TGG EGNPG DTI NWFK+ + +  Y   +CP+VC  C+ +C +LG
Sbjct  121  KLN-KVLSGVWFLATGGVEGNPGFDTIFNWFKIEKADKDYVFSFCPSVCK-CQTLCRELG  178

Query  580  ILVVD-GIRILAITDK--PLRVVFKKA  651
            + V D G + LA++D+    RVVFK+A
Sbjct  179  LYVYDHGKKHLALSDQVPSFRVVFKRA  205



>ref|XP_003534079.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 116/208 (56%), Gaps = 10/208 (5%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MKM  V  +L ++A S K L   A      V D+SG+ V     YYI+PA+ D      G
Sbjct  1    MKMTLVTLVL-IVALSTKALLGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDL-----G  54

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GL +A+     CPL VV        G  + F+ VN +   ++ S D NI F   + C  +
Sbjct  55   GLDMATT-GADCPLDVVVV--DGYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVATSCPQT  111

Query  391  TLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
            T+W+L D    T +  V TGG+ GNPG  T++NWFK+ + EDAYKL YCP+VC+ C   C
Sbjct  112  TVWKLKDYDYSTSQRFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCPSVCNDCSYPC  171

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
            GD+GI   +  + LA++ +P +V F++A
Sbjct  172  GDIGIYQDEYGKRLALSSEPYKVKFQRA  199



>gb|KHM99738.1| Miraculin [Glycine soja]
Length=199

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 115/208 (55%), Gaps = 10/208 (5%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MKM  V  +L ++A S K L   A      V D+SG+ V     YYI+PA+ D      G
Sbjct  1    MKMTLVILVL-IVALSTKALLGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDL-----G  54

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GL +AS     CPL VV        G  + F+ VN +   ++ S D NI F   + C  +
Sbjct  55   GLDMAST-GADCPLDVVAV--DGYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVGTSCPQT  111

Query  391  TLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
            T W+L D    T ++ V TGG+ GNPG  T++NWFK+ + EDAYKL YCP+VC+ C   C
Sbjct  112  TAWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCPSVCNDCSYPC  171

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+GI   +  + LA++ +P +V F++A
Sbjct  172  SDIGIYQDEYGKRLALSSEPYKVKFQRA  199



>ref|XP_006477858.1| PREDICTED: 21 kDa seed protein-like isoform X1 [Citrus sinensis]
 ref|XP_006477859.1| PREDICTED: 21 kDa seed protein-like isoform X2 [Citrus sinensis]
Length=213

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 111/204 (54%), Gaps = 11/204 (5%)
 Frame = +1

Query  61   FLIAQSIKLLCIEAQIMA---NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            F+ A S  LL    + +    + + D +G EV    DYY++   +     GGGGLTL  G
Sbjct  5    FVTAISFLLLSFATKPLVAHPDPLVDVNGNEVEASRDYYVVSLISGA---GGGGLTLFRG  61

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             N  CPL V+Q       G  ++F++ N +   + E+VD N++FS  + C   T+W++D 
Sbjct  62   RNELCPLDVIQLSSDLRRGTRLRFATYNNTRI-IHENVDLNVRFSTATRCNEPTVWKVDN  120

Query  412  KEIT-GKYVVGTGGEEGNPGRDTISNWFKVRR---DEDAYKLYYCPTVCDICRPVCGDLG  579
             + + GK+ + TGG EGNPG  T+ NWFK  R   D DAYK+ +CP+VC+ C  +C D+G
Sbjct  121  YDPSRGKWFITTGGIEGNPGAQTLKNWFKFERIGRDRDAYKIVHCPSVCESCVSLCNDVG  180

Query  580  ILVVDGIRILAITDKPLRVVFKKA  651
            +   D  R+    ++   VV   A
Sbjct  181  VSYDDNRRLALTKERAFAVVLFPA  204



>ref|NP_001237312.1| uncharacterized protein LOC100527782 precursor [Glycine max]
 gb|ACU16955.1| unknown [Glycine max]
Length=199

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 116/208 (56%), Gaps = 10/208 (5%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MKM  V  +L ++A S K L   A      V D++G+ V     YYI+PA+ D      G
Sbjct  1    MKMTLVILVL-IVALSTKALLGAAGPAPEQVLDTAGKIVRARSSYYIVPASPDL-----G  54

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GL +AS     CPL VV        G  + F+ VN +   ++ S D NI F   + C  +
Sbjct  55   GLDMAST-GADCPLDVVAV--DGYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVGTSCPQT  111

Query  391  TLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
            T+W+L D    T ++ V TGG+ GNPG  T++NWFK+ + EDAYKL YCP+VC+ C   C
Sbjct  112  TVWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCPSVCNDCSYPC  171

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+GI   +  + LA++ +P +V F++A
Sbjct  172  SDIGIYQDEYGKRLALSSEPYKVKFQRA  199



>ref|XP_008437071.1| PREDICTED: miraculin-like [Cucumis melo]
Length=212

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 110/213 (52%), Gaps = 12/213 (6%)
 Frame = +1

Query  28   KMKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGG  207
            K  +    F+  +IA S    C  A    + V D+ G+++     YYILPA      EG 
Sbjct  3    KFALLSFLFIAIVIASSELRFC-RADASPDAVLDTDGKKLRVSNKYYILPAF-----EGS  56

Query  208  GGLTLASG----PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVS  375
            GG  LA G        C + VVQ     S+G    F  +NP    V+ S D NI+F A +
Sbjct  57   GGGGLAIGNIRKEYDRCGINVVQERYEQSDGDPTTFLPINPKKGVVRVSTDLNIEFDATT  116

Query  376  ICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRR-DEDAYKLYYCPTVCD  549
             C  ST+W+L        +Y V  GG +GNPGR+T  NWFK+ +  +  YKL YCP VC 
Sbjct  117  RCRKSTVWKLGTFDRYLRQYFVTIGGTKGNPGRETTENWFKIEKYGKGNYKLVYCPRVCK  176

Query  550  ICRPVCGDLGILVVDGIRILAITDKPLRVVFKK  648
             C+ +C D+GI   +GIR L ++D P  V+FKK
Sbjct  177  YCKVMCKDIGIFENNGIRGLVLSDTPFPVIFKK  209



>ref|XP_003534078.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 115/208 (55%), Gaps = 10/208 (5%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MKM  V  +L ++A S K L   A      V D+SG+ V     YYI+PA+ D      G
Sbjct  1    MKMTLVTLVL-IVALSTKALLGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDL-----G  54

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GL +AS     CPL VV        G  + F+ VN +   ++ S D NI F   + C  +
Sbjct  55   GLDMAST-GADCPLDVVAV--DGYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVGTSCPQT  111

Query  391  TLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
            T W+L D    T ++ V TGG+ GNPG  T++NWFK+ + EDAYKL YCP+VC+ C   C
Sbjct  112  TAWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYKLVYCPSVCNDCSYPC  171

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+GI   +  + LA++ +P +V F++A
Sbjct  172  SDIGIYQDEYGKRLALSSEPYKVKFQRA  199



>ref|XP_006477860.1| PREDICTED: 21 kDa seed protein-like [Citrus sinensis]
Length=212

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 112/193 (58%), Gaps = 11/193 (6%)
 Frame = +1

Query  61   FLIAQSIKLLCIEAQI--MANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGP  234
            F+ A S  LL ++  +  +A+ + D +G +V    DYY++ A       GGGGLTL  G 
Sbjct  5    FVTAVSFLLLALQKPLVGLADPLVDVNGNKVEASRDYYLVSAIRGA---GGGGLTLFRGR  61

Query  235  NTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLK  414
            N  CPL VVQ       G  ++F++ + +S  + E VD N++FS  + C   T+WR+D  
Sbjct  62   NELCPLDVVQLSSDLQKGTRLRFATYDNTSI-INEEVDLNVRFSTGTRCNEPTVWRVDSY  120

Query  415  EIT-GKYVVGTGGEEGNPGRDTISNWFK---VRRDEDAYKLYYCPTVCDICRPVCGDLGI  582
            + + GK+ + TGG EGNPG  T+ NWFK   + RD   YK+ +CP+VC+ C  +C D+G+
Sbjct  121  DASRGKWFISTGGVEGNPGAQTLKNWFKFERIGRDRATYKIVHCPSVCESCVSLCNDVGV  180

Query  583  LVVDGIRILAITD  621
               D  R LA+T+
Sbjct  181  -SNDHARRLALTN  192



>gb|AEK26936.1| Kunitz-type trypsin inhibitor B3 [Populus nigra]
Length=209

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 111/187 (59%), Gaps = 14/187 (7%)
 Frame = +1

Query  112  ANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGF  291
            A  V D  G++++ G  YYILP         GGG+T+AS   T+CPL VVQ     SNG 
Sbjct  25   AEPVLDIDGEKLVAGTKYYILPVFRGR----GGGITMASN-KTSCPLAVVQDRLEVSNGL  79

Query  292  AVQFSSVNPSSTNV-QESVDHNIKFSAVSICVMSTLWRLDLKEITGK--YVVGTGGEEGN  462
             + F+        V   S D NIKF A + C  ST+W++ +K    K  + V TGG EGN
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKFLAKTTCPQSTVWKI-IKSSNSKVQWFVSTGGVEGN  138

Query  463  PGRDTISNWFKVRRDEDAYKLYYCPT-VCDICRPVCGDLGILVVD-GIRILAITD--KPL  630
            PG +T++NWF++ + +D YKL +CPT VC+ C  +C D+GI + D G R L+++D  +P 
Sbjct  139  PGFNTVTNWFQIEKADDDYKLVFCPTKVCN-CGVLCRDIGIYIEDNGTRTLSLSDALQPF  197

Query  631  RVVFKKA  651
            +V FKKA
Sbjct  198  KVQFKKA  204



>gb|KFK42291.1| hypothetical protein AALP_AA2G236700 [Arabis alpina]
Length=192

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 117/210 (56%), Gaps = 23/210 (11%)
 Frame = +1

Query  37   MEKVFFLLFLIAQSI--KLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            M   F+L+ L A  I  +    EA +  +V  D +G+ + T   Y+ILP         GG
Sbjct  1    MSSPFYLILLFAVFISHRGATTEAAVEESVT-DINGKPLRTDTAYFILPVVRGR----GG  55

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPS--STNVQESVDHNIKFSAVSICV  384
            GLT++      CP  V Q  +  S G  + FS   PS  S  ++ S D N  FS      
Sbjct  56   GLTISK----LCPNTVHQDQNEVSEGIPLNFS---PSVKSRFIRVSTDLNFMFS------  102

Query  385  MSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRP  561
            ++T+W+L+ + + T +  + T G  GNPG+ TISNWFK+ + ED YK+ +CPTVCD CR 
Sbjct  103  LATIWKLENMDQRTNQTFISTCGVGGNPGQTTISNWFKIDKFEDDYKIRFCPTVCDFCRV  162

Query  562  VCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            +C ++G+ V  G R L ++D PL+V+FK+A
Sbjct  163  ICRNIGVFVEGGKRSLVLSDVPLKVMFKRA  192



>ref|XP_003534080.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 114/208 (55%), Gaps = 10/208 (5%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MKM  V  +L ++A S K L   A      V D+SG+ V     YYI+PA+ D      G
Sbjct  1    MKMTLVTLVL-IVALSTKALLGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDL-----G  54

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMS  390
            GL +AS     CPL VV        G  + F+ VN +   ++ S D NI F   + C  +
Sbjct  55   GLDMAST-GADCPLDVVAI--DGYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVATSCPQT  111

Query  391  TLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVC  567
            T+W+L D    T ++ V TGG+ GNPG  T++NWFK+ + EDAYKL YCP+VC+ C   C
Sbjct  112  TVWKLKDYDYSTSQWFVTTGGDFGNPGSQTMANWFKIEKYEDAYKLVYCPSVCNDCSYPC  171

Query  568  GDLGILVVDGIRILAITDKPLRVVFKKA  651
             D+GI      + LA++ +P +V F +A
Sbjct  172  SDIGIYQDQYGKRLALSSEPYKVKFLRA  199



>ref|XP_003534083.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 114/189 (60%), Gaps = 15/189 (8%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAAD---GNTE---GGGGLTLASGPNTTCPLLVVQSPDSSS  282
            V D+SG+++  G+ YYI+PA      G  E   GGGGL+LAS    +CPL VV  P   S
Sbjct  30   VVDTSGKKLRAGLSYYIVPAVPLTRCGRYERCMGGGGLSLAS-IGESCPLDVVVVP--RS  86

Query  283  NGFAVQFSSVNPSSTNVQESVDHNIKFSA--VSICVMSTLWRLDLKEIT-GKYVVGTGGE  453
            +G  +QFS V+P    V+ S D NI FS    S    S +W+LD  +++ GK+ V TGG 
Sbjct  87   HGLPLQFSPVDPKKGVVRVSTDLNIMFSTDHTSCAEYSPVWKLDHFDVSKGKWFVSTGGS  146

Query  454  EGNPGRDTISNWFKVRRDEDAYKLYYCPTV--CDICRPVCGDLGILV-VDGIRILAITDK  624
             GNP  +TI NWFK+ + + AYK+ YCP+V      + +C D+G+ V  +G R LA+++ 
Sbjct  147  MGNPSWETIRNWFKIEKCDGAYKIVYCPSVFPSSSSKHMCKDIGVFVDENGFRRLALSNV  206

Query  625  PLRVVFKKA  651
            P +V F++A
Sbjct  207  PFKVKFQRA  215



>ref|XP_006442410.1| hypothetical protein CICLE_v10022211mg [Citrus clementina]
 gb|ABL67650.1| putative miraculin-like protein 2 [Citrus hybrid cultivar]
 gb|ESR55650.1| hypothetical protein CICLE_v10022211mg [Citrus clementina]
Length=213

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 114/202 (56%), Gaps = 13/202 (6%)
 Frame = +1

Query  61   FLIAQSIKLLCIEAQIM---ANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            F+ A S  LL    + +   A+ + D +G +V    DYY++ A       GGGGLTL  G
Sbjct  5    FVTAISFLLLTFATKPLVGLADPLVDVNGNKVEASRDYYLVSAIRGA---GGGGLTLFRG  61

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             N  CPL VVQ    S  G  ++FS  + +S  + E VD N++FS  + C   T+WR+D 
Sbjct  62   RNELCPLDVVQLSSDSERGTRLRFSMSDKTSI-INEDVDLNVRFSTETRCNEPTVWRVDS  120

Query  412  KEIT-GKYVVGTGGEEGNPGRDTISNWFK---VRRDEDAYKLYYCPTVCDICRPVCGDLG  579
             + + GK+ + TGG EGNPG  T+ NWFK   + RD   YK+ +CP+VC+ C  +C D+G
Sbjct  121  YDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRATYKIVHCPSVCESCVSLCNDVG  180

Query  580  ILVVDGIRILAITD-KPLRVVF  642
            +   D  R LA+T+ + L VV 
Sbjct  181  V-SNDHARRLALTNGRALAVVL  201



>ref|XP_004235492.2| PREDICTED: kunitz-type trypsin inhibitor alpha chain-like [Solanum 
lycopersicum]
Length=199

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 123/209 (59%), Gaps = 27/209 (13%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FL F + Q+IK         +  V D++ ++V  G  YYILPAA+ G+   GGGLTLA G
Sbjct  9    FLYFTLFQTIK---------SEPVLDTNNEQVRPGYTYYILPAASAGS---GGGLTLAKG  56

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNV-QESVDHNIKFSA---VSICVMSTLW  399
             N +CPL V Q+ +S S G  ++F  VN S+  V  E+ D NIKF+A   VSIC +ST+W
Sbjct  57   ENGSCPLDVFQARNSQSLGIPLKFLMVNSSAGLVIDENEDINIKFAAQRYVSICNVSTVW  116

Query  400  RLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCP--TVCD-IC-RPVC  567
            +++        +V TGG +G     T ++ F +++ EDAY L YCP  T C  IC R +C
Sbjct  117  KIE------DGIVTTGGIKGGSENGTSTSLFTIQKYEDAYALQYCPRATGCSFICPRLLC  170

Query  568  GDLGILVVD-GIRILAITDKPLRVVFKKA  651
            G +GIL  + G R LA+     ++VF+KA
Sbjct  171  GYIGILTAENGSRHLAVNRPVFKIVFRKA  199



>gb|KFK31885.1| hypothetical protein AALP_AA6G171300 [Arabis alpina]
Length=192

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 103/180 (57%), Gaps = 20/180 (11%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D +GQ + T   Y+ILP         GGGLT++      CP  V Q  +  S G  + 
Sbjct  30   VTDINGQRLRTDTAYFILPVVRGR----GGGLTISK----LCPNTVHQDQNEVSEGKPLN  81

Query  301  FSSVNPS--STNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGR  471
            FS   PS  S  ++ S D N  FS      ++T+W+L+ + E T +  + T G  GNPG+
Sbjct  82   FS---PSVKSRFIRVSTDLNFMFS------LATIWKLENMDERTNQTFISTCGVAGNPGQ  132

Query  472  DTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
             TISNW K+ + E AYK+ +CPTVCD CR +C ++G+ V  G R L ++D PL+V+FK+A
Sbjct  133  TTISNWIKIDKFEGAYKIRFCPTVCDFCRVICRNIGVFVEGGKRSLVLSDVPLKVIFKRA  192



>gb|ADW95389.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=209

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 112/187 (60%), Gaps = 14/187 (7%)
 Frame = +1

Query  112  ANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGF  291
            A  V D  G++++ G  YYILP         GGG+T+AS   T+CPL VVQ     S G 
Sbjct  25   AEPVLDIDGEKLVAGTKYYILPVFRGR----GGGITMASN-KTSCPLAVVQDRLEVSKGL  79

Query  292  AVQFS-SVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGK--YVVGTGGEEGN  462
             + F+ + +     +  S D NIKF A + C  ST+W++ +K    K  + V TGG EGN
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKFLAKTTCPQSTVWKI-IKSSNSKVQWFVSTGGVEGN  138

Query  463  PGRDTISNWFKVRRDEDAYKLYYCPT-VCDICRPVCGDLGILVVD-GIRILAITD--KPL  630
            PG +T++NWF++ + +D YKL +CPT VC+ C  +C D+GI + D G R L+++D  +P 
Sbjct  139  PGFNTVTNWFQIEKADDDYKLVFCPTKVCN-CGVLCRDIGIYIEDNGTRTLSLSDALQPF  197

Query  631  RVVFKKA  651
            +V FKKA
Sbjct  198  KVQFKKA  204



>ref|XP_006477857.1| PREDICTED: 21 kDa seed protein-like [Citrus sinensis]
Length=213

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 106/183 (58%), Gaps = 10/183 (5%)
 Frame = +1

Query  109  MANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNG  288
            +A+ + D +G +V    DYY++ A       GGGGLTL  G N  CPL VVQ    S  G
Sbjct  24   LADPLVDVNGNKVEASRDYYLVSAIRGA---GGGGLTLFRGRNELCPLDVVQLSSDSERG  80

Query  289  FAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEIT-GKYVVGTGGEEGNP  465
              ++FS  + +S  + E VD N++FS  + C   T+WR+D  + + GK+ + TGG EGNP
Sbjct  81   TRLRFSMYDKTSI-INEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNP  139

Query  466  GRDTISNWFKVRR---DEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITD-KPLR  633
            G  T+ NWFK  R   D   YK+ +CP+VC+ C  +C D+G+   D  R LA+T+ + L 
Sbjct  140  GAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVGV-SNDHARRLALTNGRALA  198

Query  634  VVF  642
            VV 
Sbjct  199  VVL  201



>ref|XP_004294173.1| PREDICTED: alpha-amylase/subtilisin inhibitor-like [Fragaria 
vesca subsp. vesca]
Length=203

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 104/189 (55%), Gaps = 10/189 (5%)
 Frame = +1

Query  100  AQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSS  279
            AQ     V D++GQ + +GVDYYI PA  D     GG  TL    N +CPL V Q   S 
Sbjct  20   AQADNAAVLDTTGQALQSGVDYYIKPAITDN----GGRFTLID-RNNSCPLYVGQENTSG  74

Query  280  SNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEI-TGKYVVGTGGEE  456
              GF V F+      T V+E  D  I FSA + CV ST W+L  K+  T + ++ TG +E
Sbjct  75   PEGFPVIFAPFEEGETVVREGRDQKITFSASTTCVQSTTWKLGEKQAETQRRLIVTGSDE  134

Query  457  GNPGRDTISNWFKVRRDED---AYKLYYCPT-VCDICRPVCGDLGILVVDGIRILAITDK  624
                R   SN+FK+ +  D    Y L +CPT VC IC+ +CG++G LV +  R+LA+   
Sbjct  135  VESPRGATSNYFKINKQADFDGIYYLQWCPTEVCPICKFICGNVGALVENDKRLLALDGS  194

Query  625  PLRVVFKKA  651
             L VVF++A
Sbjct  195  VLPVVFERA  203



>ref|XP_006372631.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ERP50428.1| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=209

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 110/186 (59%), Gaps = 12/186 (6%)
 Frame = +1

Query  112  ANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGF  291
            A  V D  G++++ G +YYILP         GGG+T+AS   T+CPL VVQ     S G 
Sbjct  25   AEPVLDIDGEKLVAGTEYYILPVFRGR----GGGITMASN-KTSCPLAVVQDRLEVSKGL  79

Query  292  AVQFSSVNPSSTNV-QESVDHNIKFSAVSICVMSTLWRLDLKEITG-KYVVGTGGEEGNP  465
             + F+        V   S D NIKF A + C  ST+W++     +  ++ V TGG EGNP
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKFLAKTTCPQSTVWKITKSSNSKVQWFVSTGGVEGNP  139

Query  466  GRDTISNWFKVRRDEDAYKLYYCPT-VCDICRPVCGDLGILVVD-GIRILAITD--KPLR  633
            G +T++NWF++ + +D YK+ +CPT VC+ C  +C D+GI + D G R L+++D  +P +
Sbjct  140  GFNTVTNWFQIEKADDDYKIVFCPTKVCN-CGVLCRDIGIYIEDNGTRTLSLSDALQPFK  198

Query  634  VVFKKA  651
            V FKKA
Sbjct  199  VQFKKA  204



>emb|CBI35466.3| unnamed protein product [Vitis vinifera]
Length=119

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +1

Query  346  DHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYK  522
            DH IKFS  + CV ST+W+LD   + T K  V TGG E NP    +SNWF++ + ED YK
Sbjct  3    DHKIKFSTTTTCVQSTVWKLDEYDQSTRKLFVTTGGVERNPSIQNLSNWFRIEKYEDDYK  62

Query  523  LYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            L + PT CD CRP+CGD+ I + DG + LA++D PL+V+FK+A
Sbjct  63   LVFYPTTCDFCRPICGDIDIYIQDGYKRLALSDVPLKVMFKRA  105



>ref|XP_009758946.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=221

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 97/184 (53%), Gaps = 12/184 (7%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D  G E+  G  Y ILP+               +  +  CP  V+Q    SSNG   +
Sbjct  39   VLDIDGHELQIGSKYTILPSQNGTGGG----GLALAAKDRPCPFYVMQENLESSNGLPTR  94

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDT  477
            F +V+     +  S D NI F A +ICV ST W+L    EITG+  V +GG  G PG +T
Sbjct  95   FMTVDNKQNVINLSTDLNIVFFAATICVQSTAWKLGGADEITGRRYVMSGGMTGRPGLET  154

Query  478  ISNWFKVRR-------DEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRV  636
            +SNWF++ R       +   YK+ +CP VC+ C+ VCG++G+   +G R L + D+PL V
Sbjct  155  VSNWFRIERIANGSSINNGYYKIVFCPGVCNNCKVVCGNVGVFNENGKRWLGLNDEPLVV  214

Query  637  VFKK  648
             FKK
Sbjct  215  RFKK  218



>ref|NP_001241106.1| uncharacterized protein LOC100790688 precursor [Glycine max]
 gb|ACU23857.1| unknown [Glycine max]
 gb|KHM99731.1| Miraculin [Glycine soja]
Length=209

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 109/188 (58%), Gaps = 6/188 (3%)
 Frame = +1

Query  100  AQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSS  279
            A+     V D+ G+++  G +YYI+P+          GL LAS     CPL VV    + 
Sbjct  24   AEASPEQVVDTLGKKLRVGTNYYIVPSLPYTKIRTTRGLGLASVGKPYCPLDVVVV--NG  81

Query  280  SNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICV--MSTLWRLDLKEITGK-YVVGTGG  450
             +G  V FS VNP    ++ S D NIKFSA + C    ST+W+LD  + + + + V TGG
Sbjct  82   YHGLPVTFSPVNPKKGVIRVSTDLNIKFSARTSCPRQYSTVWKLDDFDFSKRQWFVTTGG  141

Query  451  EEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKP  627
              GNP  +TI NWFK+ + + AYKL YCP+V    + +C ++G+ V + G + LA+TD P
Sbjct  142  VVGNPSLETIHNWFKIEKYDGAYKLVYCPSVVKCPKHLCKNVGLFVDEKGNKRLALTDVP  201

Query  628  LRVVFKKA  651
            L+V F++A
Sbjct  202  LKVQFQQA  209



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 103/190 (54%), Gaps = 10/190 (5%)
 Frame = +1

Query  100  AQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGP-NTTCPLLVVQSPDS  276
            A    N V D +G+E+  GVDYY++     G    G G+T   GP N  CPL VVQ+   
Sbjct  20   ATEKPNPVVDFNGEEIRPGVDYYVVSVFPGGR---GSGVTYGKGPGNEICPLAVVQARPD  76

Query  277  SSNGFAVQFSSVNPSSTNVQESVDHNIKFSA---VSICVMSTLWRLDLKEITGKYVVGTG  447
             + G  V F+ VNP  + V+ S D NIKFS    ++ C  S +W++   E   ++ V T 
Sbjct  77   FNRGHPVTFTPVNPEESVVRVSTDLNIKFSEPPFINFCRGSNVWKVHFNEALKQHFVLTD  136

Query  448  GEEGNPGRDTISNWFKVRRDED-AYKLYYCPTVCD-ICRPVCGDLGILV-VDGIRILAIT  618
            G EGN G +T +NWFK+    +  YK  +CP VCD     +C D+GI    DG R LA++
Sbjct  137  GVEGNSGCETEANWFKIELTGNVGYKFVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALS  196

Query  619  DKPLRVVFKK  648
            D+P  V F K
Sbjct  197  DQPFVVFFIK  206



>ref|XP_011046090.1| PREDICTED: miraculin-like [Populus euphratica]
Length=209

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 108/186 (58%), Gaps = 12/186 (6%)
 Frame = +1

Query  112  ANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGF  291
            A  V D  G++++ G  YYILP         GGG+T+AS   T+CPL VVQ    +S G 
Sbjct  25   AEPVLDIDGEKLVAGTKYYILPVFRGR----GGGITMASN-QTSCPLAVVQDRLEASKGL  79

Query  292  AVQFS-SVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEITGK--YVVGTGGEEGN  462
             + F+ + +     +  S D NIKF   + C  ST+W++ +K    K  + V TGG EGN
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKFLDKTTCPHSTVWKI-IKSSNSKVQWFVSTGGVEGN  138

Query  463  PGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITD--KPLR  633
            PG +T+ NWF++ + +D YKL +CPT    C  +C D+GI + D G R L+++D  +P +
Sbjct  139  PGFNTVGNWFQIEKADDDYKLVFCPTKVCKCGVLCRDIGIYIEDNGTRTLSLSDALQPFK  198

Query  634  VVFKKA  651
            V FKKA
Sbjct  199  VQFKKA  204



>emb|CBI35470.3| unnamed protein product [Vitis vinifera]
Length=119

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +1

Query  346  DHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYK  522
            DH IKFS  + CV ST+W+L +  + T K  V TGG E NP    +SNWF++ + ED YK
Sbjct  3    DHKIKFSTTTTCVQSTVWKLNEYDQSTRKLFVTTGGFERNPSIQNLSNWFRIEKYEDDYK  62

Query  523  LYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            L + PT CD CRP+CGD+ I + DG + LA++D PL+V+FK+A
Sbjct  63   LVFYPTTCDFCRPICGDIDIYIQDGYKRLALSDVPLKVMFKRA  105



>ref|XP_006353918.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=198

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 122/209 (58%), Gaps = 28/209 (13%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FL F + Q IK         +  V D+S ++V  G  YYILPA+A GN   GGGLTLA G
Sbjct  9    FLYFTLFQIIK---------SEPVLDTSNEQVRPGYTYYILPASA-GN---GGGLTLAKG  55

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNV-QESVDHNIKFSA---VSICVMSTLW  399
             N +CPL V Q+ +S S G  ++F  VN S+  V  E+ D NIKF+A   VSIC +ST+W
Sbjct  56   ENGSCPLDVFQARNSQSVGIPLKFLMVNSSAGLVIDENEDINIKFAARRYVSICNVSTVW  115

Query  400  RLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCP--TVCD-IC-RPVC  567
            +++        +V TGG +G     T ++ F +++ EDAY L YCP  T C  IC R +C
Sbjct  116  KIE------DGIVTTGGIKGGSENGTSTSLFTIQKYEDAYALQYCPRATGCSFICPRLLC  169

Query  568  GDLGILVVD-GIRILAITDKPLRVVFKKA  651
            G +GIL  + G R LA+     ++VF+KA
Sbjct  170  GYIGILPAENGSRHLAVNRPVFKIVFRKA  198



>gb|KHN24493.1| Miraculin [Glycine soja]
Length=200

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 107/196 (55%), Gaps = 15/196 (8%)
 Frame = +1

Query  76   SIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLL  255
            S K L   A      V D+SG+ V     YYI+PA+ D      GGL +AS     CPL 
Sbjct  15   STKALLGAAGPAPEQVLDTSGKMVRARTSYYIVPASPDV-----GGLAMAST-GEDCPLD  68

Query  256  VVQSPDSSSNGFAVQ---FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEIT  423
            VV     + +G+  Q   F+ VN +   ++ S D NI F   + C ++  W+L D    T
Sbjct  69   VV-----AVDGYQGQPLIFTPVNVNKGVIRVSTDLNIYFPIDTSCPLTKAWKLKDYDNST  123

Query  424  GKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIR  603
             ++ V TGG+ GNPG  T++NWFK+ + EDAYKL YCP+VC  C   C D+GI      +
Sbjct  124  SQWFVTTGGDFGNPGSQTLANWFKIEKYEDAYKLVYCPSVCKDCSYPCSDIGIYQDQYGK  183

Query  604  ILAITDKPLRVVFKKA  651
             LA++ +P RV F++A
Sbjct  184  RLALSSEPYRVKFQRA  199



>ref|XP_010673342.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=212

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 104/206 (50%), Gaps = 13/206 (6%)
 Frame = +1

Query  64   LIAQSIKLLCIEAQIMANVVK--DSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPN  237
            L+  +  L       +A V+   D   + V  G  YYILP       +GGG  T     N
Sbjct  10   LVLATFLLFVSPPAAVAQVINIFDMDAEPVQAGKLYYILPVV---QRQGGGISTAPKNAN  66

Query  238  -TTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLK  414
             ++CPL VVQ  D++S G AV F+   P++TNV  S D NI F     CV S +W L L 
Sbjct  67   ESSCPLYVVQEKDTTSLGLAVTFNLALPNTTNVTFSADMNIVFGQAINCVESPVWTLALD  126

Query  415  EITGKYVVGTGGEEGNPGRDTISNWFKVR----RDEDAYKLYYCPT--VCDICRPVCGDL  576
            E TG+  V  GG     G   ++NWF++     R    YK  +CPT  +C  C+  CGDL
Sbjct  127  EPTGRRYVALGGLGMARGPKAVNNWFRIERFFPRFHFDYKFVFCPTRVICPTCQNSCGDL  186

Query  577  GILVV-DGIRILAITDKPLRVVFKKA  651
            G+ V  DG  +L +   PLR+ FKKA
Sbjct  187  GVFVRDDGTWVLGVGAPPLRIKFKKA  212



>ref|XP_003548288.1| PREDICTED: miraculin-like [Glycine max]
Length=200

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 107/196 (55%), Gaps = 15/196 (8%)
 Frame = +1

Query  76   SIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLL  255
            S K L   A      V D+SG+ V     YYI+PA+ D      GGL +AS     CPL 
Sbjct  15   STKALLGAAGPAPEQVLDTSGKMVRARTSYYIVPASPDV-----GGLAMAST-GEDCPLD  68

Query  256  VVQSPDSSSNGFAVQ---FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEIT  423
            VV     + +G+  Q   F+ VN +   ++ S D NI F   + C ++  W+L D    T
Sbjct  69   VV-----AVDGYQGQPLIFTPVNVNKGVIRVSTDLNIYFPIDTSCPLTKAWKLKDYDYST  123

Query  424  GKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIR  603
             ++ V TGG+ GNPG  T++NWFK+ + EDAYKL YCP+VC  C   C D+GI      +
Sbjct  124  SQWFVTTGGDFGNPGSQTLANWFKIEKYEDAYKLVYCPSVCKDCSYPCSDIGIYQDQYGK  183

Query  604  ILAITDKPLRVVFKKA  651
             LA++ +P RV F++A
Sbjct  184  RLALSSEPYRVKFQRA  199



>ref|XP_010673346.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=212

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 104/206 (50%), Gaps = 13/206 (6%)
 Frame = +1

Query  64   LIAQSIKLLCIEAQIMANVVK--DSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPN  237
            L+  +  L       +A V+   D   + V  G  YYILP       +GGG  T     N
Sbjct  10   LVLATFLLFVSPPAAVAQVINIFDMDAEPVQAGKLYYILPVV---QRQGGGISTAPKNAN  66

Query  238  -TTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLK  414
             ++CPL VVQ  D++S G AV F+   P++TNV  S D NI F     CV S +W L + 
Sbjct  67   ESSCPLYVVQEKDTTSFGLAVTFNLALPNTTNVTFSADMNIVFGQAINCVESPVWTLAID  126

Query  415  EITGKYVVGTGGEEGNPGRDTISNWFKVR----RDEDAYKLYYCPT--VCDICRPVCGDL  576
            E TG+  V  GG     G   ++NWF++     R    YK  +CPT  +C  C+  CGDL
Sbjct  127  EPTGRRYVALGGLGMARGPKAVNNWFRIERFFPRFHFDYKFVFCPTRVICPTCQNSCGDL  186

Query  577  GILVV-DGIRILAITDKPLRVVFKKA  651
            G+ V  DG  +L +   PLR+ FKKA
Sbjct  187  GVFVRDDGTWVLGVGAPPLRIKFKKA  212



>gb|KHM99744.1| Miraculin [Glycine soja]
Length=174

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 101/176 (57%), Gaps = 9/176 (5%)
 Frame = +1

Query  127  DSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFS  306
            D+SG+ V     YYI+PA+ D      GGL +AS     CPL VV        G  + F+
Sbjct  7    DTSGKIVRARSSYYIVPASPDL-----GGLDMAST-GADCPLDVVAV--DGYQGQPLIFT  58

Query  307  SVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDTIS  483
             VN +   ++ S D NI F   + C  +T W+L D    T ++ V TGG+ GNPG  T++
Sbjct  59   PVNFNKGVIRVSTDLNIYFPVGTSCPQTTAWKLKDYDYSTSQWFVTTGGDFGNPGSQTVA  118

Query  484  NWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            NWFK+ + EDAYKL YCP+VC+ C   C D+GI   +  + LA++ +P +V F++A
Sbjct  119  NWFKIEKYEDAYKLVYCPSVCNDCSYPCSDIGIYQDEYGKRLALSSEPYKVKFQRA  174



>ref|XP_006351548.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=208

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 113/204 (55%), Gaps = 9/204 (4%)
 Frame = +1

Query  52   FLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            FL+ LI      L  EA    N V D++G+ +    DY ++P   D     GG L LA  
Sbjct  10   FLITLIVFIKNSLLSEATSAPNSVLDTTGKMIRVESDYMVVPVRKDL----GGDLGLAFI  65

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAV-SICVM-STLWRL  405
                CPL +    ++ S G ++ F  VN     ++ES+D N++F+   +IC   S +WRL
Sbjct  66   GTQVCPLGIGPRLNNDS-GLSINFFPVNSKKGVIRESIDLNVEFTETYTICQHHSNVWRL  124

Query  406  DLKEITGK-YVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGI  582
            D      + +++  GG +GNPGRDTISNWFK+ +    YK  +CP+VC+ C  +C ++G+
Sbjct  125  DHYNPQKEDHMITNGGVKGNPGRDTISNWFKIVKYGVGYKFVFCPSVCNYCDVICKNVGV  184

Query  583  LVV-DGIRILAITDKPLRVVFKKA  651
             V  +G  +L ++++PL V FKK 
Sbjct  185  FVQNNGQTLLTLSNEPLEVRFKKV  208



>ref|XP_009601782.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=221

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 95/184 (52%), Gaps = 12/184 (7%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D  G E+  G  Y ILP+               +  +  CP  V+Q    SSNG   +
Sbjct  39   VLDIDGHELQIGSKYTILPSQNGTGGG----GLALAAKDRPCPFYVMQENLESSNGLPTR  94

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDT  477
            F  V+     +  S D NI F   +ICV ST W+L    EITG+  V +GG  G PG +T
Sbjct  95   FMPVDNKQNVINLSTDLNIVFLTATICVQSTAWKLGGTDEITGRRYVMSGGMTGRPGLET  154

Query  478  ISNWFKVRR-------DEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRV  636
            +SNWF++ R       +   YK+ +CP VC+ C+ VCG++G+   +G R L + D+PL V
Sbjct  155  VSNWFRIERIGNVSSINNGYYKIVFCPGVCNNCKVVCGNVGVFNENGKRWLGLNDEPLVV  214

Query  637  VFKK  648
             FKK
Sbjct  215  RFKK  218



>gb|AFK33359.1| unknown [Medicago truncatula]
Length=202

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 107/196 (55%), Gaps = 15/196 (8%)
 Frame = +1

Query  64   LIAQSIKLLCIEAQIMA--NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPN  237
             +A SI  L    +  A    V D SG++V TGV YYILP         GGGLT+ +  N
Sbjct  5    FLAFSIIFLAFICKTFAAPEPVLDISGKKVTTGVKYYILPVIRGK----GGGLTVVNENN  60

Query  238  T-----TCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIK-FSAVSICVMSTLW  399
                  TCPL V+Q      NG AV F+  N     +  S D NIK +   + C  S +W
Sbjct  61   LNGNNNTCPLYVLQEKLEVKNGQAVTFTPYNAKKGVILTSTDLNIKSYVTKTTCAQSQVW  120

Query  400  RLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLG  579
            +L+ K ++G + + TG  EGNPG DTI NWFK+ + +  Y   +CP+VC  C+ +C +LG
Sbjct  121  KLN-KVLSGVWFLATGSVEGNPGFDTIFNWFKIEKADKDYVFSFCPSVCK-CQTLCRELG  178

Query  580  ILVVD-GIRILAITDK  624
            + V D G + LA++D+
Sbjct  179  LYVYDHGKKHLALSDQ  194



>gb|AAF15902.1|AF208022_1 biotic cell death-associated protein [Nicotiana glutinosa]
Length=229

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 108/192 (56%), Gaps = 18/192 (9%)
 Frame = +1

Query  103  QIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSS  282
            Q+    V D++ QE+  G  YYILPA    N   GGGLTLA G N +CPL V Q+ +S S
Sbjct  20   QVKTEPVLDTNKQEIRPGYTYYILPATTGAN---GGGLTLAKGENGSCPLDVFQAQNSQS  76

Query  283  NGFAVQFSSVNPSSTNV-QESVDHNIKFSA---VSICVMSTLWRLDLKEITGKYVVGTGG  450
             G  ++F  VN S+  V  E+ D NIKF+A   VSIC  ST+W+++   +T      TGG
Sbjct  77   RGLPLKFLMVNSSAGLVIDENEDINIKFAAPRYVSICNKSTVWKIEDGFVT------TGG  130

Query  451  EEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCD---IC-RPVCGDLGIL-VVDGIRILAI  615
             +G     T ++ F +++ EDAY L YCP       IC R +CG +GI    +G R LA+
Sbjct  131  IKGGSENGTATSLFTIQKYEDAYALQYCPRAAGCSFICPRLLCGYIGIAPAANGSRRLAV  190

Query  616  TDKPLRVVFKKA  651
                 ++ FKKA
Sbjct  191  NRPIFKIEFKKA  202



>gb|ACF74332.1| Kunitz trypsin inhibitor 4 [Arachis hypogaea]
Length=203

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 101/177 (57%), Gaps = 8/177 (5%)
 Frame = +1

Query  100  AQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSS  279
            A   A  V D +GQ++ +GV Y+ILP         GGGLT+ S  N+TCP+ V+Q     
Sbjct  21   AASAAEPVLDVTGQKLRSGVKYFILPVLRGR----GGGLTVGSSVNSTCPIYVLQDKLEV  76

Query  280  SNGFAVQFSSVNPSSTNV-QESVDHNIKFSAVSICVMSTLWRLDLKEITGKYVVGTGGEE  456
            + G  V F+   P+   V   S D NI  ++   C  S++WRL LK ++G + + T G  
Sbjct  77   TRGTPVTFTPSTPNKDGVILTSTDLNINSTSAPKCKESSVWRL-LKVLSGVWFISTDGVA  135

Query  457  GNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV-VDGIRILAITDK  624
            GNPG +T+ NWFK+ +D   Y L +CP+VC+ C  +C  LGI    DG + LA++D+
Sbjct  136  GNPGVNTVVNWFKIEKDGKDYNLSFCPSVCN-CSTLCRALGIFTDSDGTKHLALSDQ  191



>ref|XP_006441457.1| hypothetical protein CICLE_v10024528mg, partial [Citrus clementina]
 gb|ESR54697.1| hypothetical protein CICLE_v10024528mg, partial [Citrus clementina]
Length=105

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 1/104 (1%)
 Frame = +1

Query  340  SVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDA  516
            S D NIKF A + C  ST+W+LD      G+++V TGG EGNPG  T+ NWFK+ +    
Sbjct  1    STDLNIKFDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGD  60

Query  517  YKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKK  648
            YKL YCP+VC+ CR +C D+GI +  G+R LA++D P +VVFKK
Sbjct  61   YKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDIPFKVVFKK  104



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 101/184 (55%), Gaps = 13/184 (7%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGP-NTTCPLLVVQSPDSSSNGF  291
            N V D++G+E+  GV+YY+           GGG+T   GP N  CPL VVQ+      G 
Sbjct  25   NPVLDTNGEEIRPGVEYYMGTIF-----RPGGGVTYGKGPGNEICPLAVVQA--WLQRGD  77

Query  292  AVQFSSVNPSSTNVQESVDHNIKFSA---VSICVMSTLWRLDLKEITGKYVVGTGGEEGN  462
             V F+ VNP    V+ S D NIKF+    ++ C  S +W++   E   ++ V T G EGN
Sbjct  78   PVTFTPVNPEEGVVRVSTDLNIKFAEPPIINFCRGSNVWKVHFNEALKQHFVLTDGVEGN  137

Query  463  PGRDTISNWFKVRRDEDA-YKLYYCPTVCD-ICRPVCGDLGILVVDGIRILAITDKPLRV  636
             G +T +NWFK+    D  YK  +CPTVCD     +C D+GI + DG R LA+  +P  V
Sbjct  138  SGCETTANWFKIEAVSDRDYKFVFCPTVCDSSSEAICKDVGIYMDDGTRRLALGGQPYAV  197

Query  637  VFKK  648
            VF K
Sbjct  198  VFIK  201



>gb|KHM99732.1| Miraculin [Glycine soja]
Length=207

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 109/184 (59%), Gaps = 12/184 (7%)
 Frame = +1

Query  127  DSSGQEVLTGVDYYILPAAADG-----NTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGF  291
            D+SG+++    +Y+I+PA         +   GGGL+L S  + +CPL V+   + ++ G 
Sbjct  27   DTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDS-IDESCPLDVII--EKANEGL  83

Query  292  AVQFSSVNPSSTNVQESVDHNIKFS-AVSIC-VMSTLWRLDLKEIT-GKYVVGTGGEEGN  462
             ++FS VN     ++ S D NI FS +   C   ST+W LD  + + G+  V TGG  GN
Sbjct  84   PLRFSPVNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWMLDQFDASIGQTYVTTGGVVGN  143

Query  463  PGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRI-LAITDKPLRVV  639
            PG  TI NWFK+++ EDAYKL YCP VC  C  +C D+G+ V    R+ LA++D P ++ 
Sbjct  144  PGEHTILNWFKIQKYEDAYKLVYCPRVCPSCHHLCKDIGMFVDANRRMHLALSDDPFKIK  203

Query  640  FKKA  651
            FK+A
Sbjct  204  FKEA  207



>ref|XP_004295679.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=189

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 103/182 (57%), Gaps = 10/182 (5%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D+SGQ + +GVDY+I PA     T+ GG  TL    N +CPL V Q   S S  F V 
Sbjct  13   VLDTSGQALQSGVDYFIKPAI----TDIGGRFTLID-RNDSCPLYVGQKNTSGSEDFPVT  67

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEI-TGKYVVGTGGEEGNPGRDT  477
            F+      T V+E  D  I FSAV+ CV ST W++  K+  T + ++ TG ++       
Sbjct  68   FAPFVEGETVVREGRDQKITFSAVTTCVQSTTWKVGEKQSETQRRLIVTGIDQNEGIAGP  127

Query  478  ISNWFKVRRDED---AYKLYYCPT-VCDICRPVCGDLGILVVDGIRILAITDKPLRVVFK  645
              N+F++ +D D    Y L +CPT +C  CR +CGD+G L+ +G R+LA+    L VVF+
Sbjct  128  AGNYFRINKDADIDGVYSLQWCPTELCPTCRFICGDVGALLENGKRLLALDGSALPVVFE  187

Query  646  KA  651
            +A
Sbjct  188  RA  189



>ref|NP_001237333.1| uncharacterized protein LOC100500648 precursor [Glycine max]
 gb|ACU15788.1| unknown [Glycine max]
Length=213

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 113/198 (57%), Gaps = 12/198 (6%)
 Frame = +1

Query  85   LLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADG-----NTEGGGGLTLASGPNTTCP  249
            LL   A      V D+SG+++    +Y+I+PA         +   GGGL+L S  + +CP
Sbjct  19   LLLGAAGAAPEPVIDTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDS-IDESCP  77

Query  250  LLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFS-AVSICVM-STLWRLDLKEIT  423
            L V+   + ++ G  ++FS VN     ++ S D NI FS +   C   ST+W LD  + +
Sbjct  78   LDVII--EKANEGLPLRFSPVNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWMLDQFDAS  135

Query  424  -GKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGI  600
             G+  V TGG  GNPG  TI NWFK+++ EDAYKL YCP VC  C  +C D+G+ V    
Sbjct  136  IGQTYVTTGGVVGNPGEHTILNWFKIQKYEDAYKLVYCPRVCPSCHHLCKDIGMFVDANR  195

Query  601  RI-LAITDKPLRVVFKKA  651
            R+ LA++D P ++ FK+A
Sbjct  196  RMHLALSDDPFKIKFKEA  213



>ref|XP_010041216.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=175

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = +1

Query  331  VQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRD  507
            ++ S D N+   A  IC+ ST+WRL    E   +Y V +GG  GNPGR+TISNWFK+ + 
Sbjct  53   IRLSTDLNVWLDAAKICMHSTVWRLGAYNEEVKQYFVESGGVLGNPGRETISNWFKIEKV  112

Query  508  EDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            ++ YKL +CPTVCD C+ +C D+G+ V    R LA++D+P RV+FKKA
Sbjct  113  DEDYKLVFCPTVCDTCKVICRDVGVYVDGATRRLALSDEPFRVMFKKA  160



>ref|XP_008226352.1| PREDICTED: alpha-amylase/subtilisin inhibitor-like [Prunus mume]
Length=210

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 102/182 (56%), Gaps = 10/182 (5%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D+SGQ +  GVDYYI PA     T+ GG  TL    N +CPL V Q   S   G+ V 
Sbjct  34   VLDTSGQALQAGVDYYIKPAI----TDSGGRFTLID-RNGSCPLYVGQENVSGPEGYPVT  88

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDT  477
            F+      T V+E+ D  I FSA +ICV ST W+L +  ++T + ++ TG ++       
Sbjct  89   FAPFVEGETVVREARDQKITFSAATICVQSTAWKLGETDQVTQRRLIVTGEDQNQGIAGP  148

Query  478  ISNWFKVRRD---EDAYKLYYCPT-VCDICRPVCGDLGILVVDGIRILAITDKPLRVVFK  645
              N+F+V +    +  Y L +CPT +C  CR +CG +G LV +G R+LA+    L VVF+
Sbjct  149  ARNYFRVNKQAALDGVYNLRWCPTELCPTCRFICGSVGALVENGKRLLALDGSVLPVVFE  208

Query  646  KA  651
            +A
Sbjct  209  RA  210



>emb|CBK52316.1| Nb cell deth marker [Nicotiana benthamiana]
Length=201

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 108/191 (57%), Gaps = 19/191 (10%)
 Frame = +1

Query  103  QIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSS  282
            Q+ A  V D++ QE+  G  YYILPA     T  GGGLTLA G N +CPL V Q+ +  S
Sbjct  20   QVKAEPVLDTNKQEIRPGYTYYILPAT----TANGGGLTLAKGENGSCPLDVFQAKNVQS  75

Query  283  NGFAVQFSSVNPSSTNV-QESVDHNIKFSA---VSICVMSTLWRLDLKEITGKYVVGTGG  450
             G  ++F  VN S+  V  E+ D NIKF+A   VSIC  ST+W+++         V TGG
Sbjct  76   TGLPLKFLMVNSSAGLVIDENEDINIKFAAPRYVSICNKSTVWKIE------DGFVSTGG  129

Query  451  EEGNPGRDTISNWFKVRRDEDAYKLYYCP--TVCD-IC-RPVCGDLGIL-VVDGIRILAI  615
             +G     T ++ F +++ ED Y L YCP  T C  IC R +CG +GI    +G R LA+
Sbjct  130  IKGGSENGTATSLFTIQKYEDVYALQYCPRATGCSFICPRLLCGYIGISPAANGSRRLAV  189

Query  616  TDKPLRVVFKK  648
                 ++VFKK
Sbjct  190  NRPVFKIVFKK  200



>ref|XP_003534100.1| PREDICTED: miraculin-like [Glycine max]
 gb|KHM99733.1| Miraculin [Glycine soja]
Length=216

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 110/193 (57%), Gaps = 15/193 (8%)
 Frame = +1

Query  109  MANVVKDSSGQEVLTGVDYYILPAAADGNTEG------GGGLTLASGPNTTCPLLVVQSP  270
            +   V D+SG E+  G+ YY++PA       G        GL+LAS    +CPL VV   
Sbjct  26   LPEAVIDTSGTELQPGLSYYVVPAMRSFTRCGKFECLNAEGLSLAS-IGESCPLDVVV--  82

Query  271  DSSSNGFAVQFSSVNPSSTNVQESVDHNIKF----SAVSICVMSTLWRLDLKEIT-GKYV  435
            +  S G  + FS ++ + + V+ S D NI F    ++ S    S +W+LD  +++ GK+ 
Sbjct  83   EQRSFGLPLSFSPLDTNESVVRVSTDLNIMFCTDRTSYSCAEYSPVWKLDHFDVSKGKWF  142

Query  436  VGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILV-VDGIRILA  612
            V TGG  GNP  +TI NWFK+ + + AY++ YCP+VC   + +C D+G+ V  +G R LA
Sbjct  143  VTTGGSMGNPSWETIRNWFKIEKCDSAYRIVYCPSVCPSSKHMCKDVGVFVDENGYRRLA  202

Query  613  ITDKPLRVVFKKA  651
            ++D P +V F+ A
Sbjct  203  LSDVPFKVKFQLA  215



>ref|XP_011092684.1| PREDICTED: miraculin-like [Sesamum indicum]
Length=214

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 98/180 (54%), Gaps = 7/180 (4%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D  G  +     YYILP   DG   GG  L++   P   CP  VVQ  D  S G +++
Sbjct  36   VLDLDGNLLQINTKYYILPL--DGGGGGGFALSVRD-PRDPCPPNVVQENDEGSAGLSLK  92

Query  301  FSSVN---PSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKE-ITGKYVVGTGGEEGNPG  468
            F  ++     +T+V  S D NI F A + CV  T+WR  + +  TG+  V TGG  G PG
Sbjct  93   FFPLDREQQQATSVSLSSDMNIAFMAATTCVQRTVWRTGVADGTTGRRYVRTGGVLGRPG  152

Query  469  RDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKK  648
             +T+  WFK+ +    YK+ YCP+VC  CR  CG++G+ V DG R + +  +P+ + FKK
Sbjct  153  AETVGEWFKIDKYGKGYKIGYCPSVCSACRVECGEMGVFVEDGRRWVGLGGQPIVIAFKK  212



>gb|KGN60879.1| hypothetical protein Csa_2G021500 [Cucumis sativus]
Length=178

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 95/179 (53%), Gaps = 14/179 (8%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSN-GFAV  297
            V D++GQ +  GV+YYI PA     T+ GG LTL S  N  CPL V Q P +S+N G  V
Sbjct  12   VLDTNGQPLQRGVEYYISPAI----TDVGGNLTLKSRSNAPCPLFVGQEPVTSTNIGLPV  67

Query  298  QFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEI-TGKYVVGTGGEEGNPGRD  474
             F         + E    NI F A+S CV ST WR+D  E  TG+  VG G E+G  G  
Sbjct  68   TFRPTEEGIDIIDEGTSLNIVFQALSTCVTSTQWRVDATESDTGRRFVGIGDEDGPAG--  125

Query  475  TISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
                 F + RD  AY + +CP +  + RP CG  GILV +G+R++A+        F KA
Sbjct  126  ----IFGISRDNGAYNIVWCPAM--MGRPRCGRAGILVENGVRLVALDGDAFPFEFIKA  178



>emb|CDP18338.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 98/181 (54%), Gaps = 5/181 (3%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFA  294
            N V D +G+E+  GV+Y+I+ A   G   G          N  CPL VVQ+    + G  
Sbjct  25   NPVLDINGEEIRPGVEYHIVSAIFGGGGGGVTYGKGPG--NQICPLAVVQALSDLNRGHP  82

Query  295  VQFSSVNPSSTNVQESVDHNIKFSA-VSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGR  471
            V F+ VNP    V+ S D NIKFS  ++ C  S +W++   E   ++ V T G EGN G 
Sbjct  83   VSFTPVNPEEGVVRVSTDLNIKFSPFINFCRGSNVWKVHFNEALEQHFVLTDGVEGNSGC  142

Query  472  DTISNWFKVRRDEDAYKLYYCPTVCD-ICRPVCGDLGILV-VDGIRILAITDKPLRVVFK  645
            +T +NWFK+  +   YKL +CP VCD     +C D+GI    DG R LA++D+P  V F 
Sbjct  143  ETEANWFKIEGNYPFYKLVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALSDRPFVVFFS  202

Query  646  K  648
            K
Sbjct  203  K  203



>ref|XP_004139192.1| PREDICTED: miraculin-like [Cucumis sativus]
Length=195

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/200 (38%), Positives = 101/200 (51%), Gaps = 14/200 (7%)
 Frame = +1

Query  58   LFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPN  237
            L +   +   + I +      V D++GQ +  GV+YYI PA     T+ GG LTL S  N
Sbjct  8    LAIFGYACLFMAITSTAQLPPVLDTNGQPLQRGVEYYISPAI----TDVGGNLTLKSRSN  63

Query  238  TTCPLLVVQSPDSSSN-GFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLK  414
              CPL V Q P +S+N G  V F         + E    NI F A+S CV ST WR+D  
Sbjct  64   APCPLFVGQEPVTSTNIGLPVTFRPTEEGIDIIDEGTSLNIVFQALSTCVTSTQWRVDAT  123

Query  415  EI-TGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVV  591
            E  TG+  VG G E+G  G       F + RD  AY + +CP +  + RP CG  GILV 
Sbjct  124  ESDTGRRFVGIGDEDGPAG------IFGISRDNGAYNIVWCPAM--MGRPRCGRAGILVE  175

Query  592  DGIRILAITDKPLRVVFKKA  651
            +G+R++A+        F KA
Sbjct  176  NGVRLVALDGDAFPFEFIKA  195



>ref|XP_011035408.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 95/165 (58%), Gaps = 6/165 (4%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D +G+ + TG  Y ILP         G G+T A   + +CP+ V+Q     S+G  +Q
Sbjct  32   VLDIAGKVLRTGTYYDILPVVRGR----GSGITFAITGHKSCPVDVMQEDYEDSDGLPLQ  87

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDT  477
            F   N     ++ S D NIKF   + C  + +W+++   E+TG+  + T G EGNPG +T
Sbjct  88   FIPANRKKGVIRLSTDLNIKFPGTASCAPTAVWKVEKYDELTGQMFISTSGVEGNPGPET  147

Query  478  ISNWFKVRRDEDAYKLYYCPTVC-DICRPVCGDLGILVVDGIRIL  609
            + NWFK+ +  + YKL +CPTVC D C+ +C D+GI V + ++I+
Sbjct  148  VDNWFKIEKYGNDYKLVFCPTVCNDHCKVLCKDIGIYVQEVLKII  192



>ref|XP_006478228.1| PREDICTED: uncharacterized protein LOC102606959 [Citrus sinensis]
Length=533

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 103/186 (55%), Gaps = 11/186 (6%)
 Frame = +1

Query  61   FLIAQSIKLLCIEAQIMA---NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            F+ A S  LL   A+ +    + + D +G EV    DYY++ A       GGGGL+L  G
Sbjct  48   FVTAISFLLLAFAAKPLVGRPDPLLDINGNEVEATRDYYVVSAIRGA---GGGGLSLFKG  104

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-  408
             N  CP  V+Q       G  ++F++   +S  + E++D  +KFSA + C   T+W++D 
Sbjct  105  RNGLCPFDVIQESSDLQKGTPLRFATYKNTSI-IHEAMDLTVKFSAQTRCNEPTVWKVDD  163

Query  409  LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRD---EDAYKLYYCPTVCDICRPVCGDLG  579
              E  GK+ + TGG EGNPG  T+ NWFK +R     D YK+ +CP+VC+ C  +C ++G
Sbjct  164  YDEPRGKWFITTGGVEGNPGPQTLKNWFKFQRSGTFPDTYKIVHCPSVCNSCVSLCKNVG  223

Query  580  ILVVDG  597
            +   DG
Sbjct  224  VSHEDG  229



>gb|KHM99735.1| Miraculin [Glycine soja]
Length=154

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 96/156 (62%), Gaps = 9/156 (6%)
 Frame = +1

Query  202  GGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSA--VS  375
            GGGGL+LAS    +CPL VV  P   S+G  +QFS V+P    V+ S D NI FS    S
Sbjct  2    GGGGLSLAS-IGESCPLDVVVVP--RSHGLPLQFSPVDPKKGVVRVSTDLNIMFSTDHTS  58

Query  376  ICVMSTLWRLDLKEIT-GKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTV--C  546
                S +W+LD  +++ GK+ V TGG  GNP  +TI NWFK+ + + AYK+ YCP+V   
Sbjct  59   CAEYSPVWKLDHFDVSKGKWFVSTGGSMGNPSWETIRNWFKIEKCDGAYKIVYCPSVFPS  118

Query  547  DICRPVCGDLGILV-VDGIRILAITDKPLRVVFKKA  651
               + +C D+G+ V  +G R LA+++ P +V F++A
Sbjct  119  SSSKHMCKDIGVFVDENGFRRLALSNVPFKVKFQRA  154



>ref|XP_007212054.1| hypothetical protein PRUPE_ppa011448mg [Prunus persica]
 gb|EMJ13253.1| hypothetical protein PRUPE_ppa011448mg [Prunus persica]
Length=210

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 101/182 (55%), Gaps = 10/182 (5%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V D+SGQ +  GVDYYI PA     T+ GG  TL    N +CPL V Q   S   G  V 
Sbjct  34   VLDTSGQALQAGVDYYIKPAI----TDSGGRFTLID-RNDSCPLYVGQENVSGPKGLPVT  88

Query  301  FSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDT  477
            F+      T V+E+ D  I FSA +ICV ST W+L ++ ++T + ++  G ++       
Sbjct  89   FAPFAEGETVVRETRDQKITFSASTICVQSTAWKLGEIDQVTQRRLIVAGVDQNQGIAGP  148

Query  478  ISNWFKVRRD---EDAYKLYYCPT-VCDICRPVCGDLGILVVDGIRILAITDKPLRVVFK  645
              N+F++ +    +  Y L +CPT +C  CR +CG +G LV +G R+LA+    L VVF+
Sbjct  149  ARNYFRINKQAALDGVYNLQWCPTELCPTCRFLCGSVGALVENGKRLLALDGSVLPVVFE  208

Query  646  KA  651
            +A
Sbjct  209  RA  210



>ref|XP_003622420.1| Endopeptidase inhibitor [Medicago truncatula]
 gb|AES78638.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=205

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 101/183 (55%), Gaps = 15/183 (8%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQ  300
            V+D+SG  V   ++Y+ILP++    T     L      N TCPL VV+  +      A+Q
Sbjct  29   VRDTSGNLVRNSINYFILPSSIQCGTRCEMALL---NTNKTCPLDVVEEEE------AMQ  79

Query  301  FSSV--NPSSTNVQESVDHNIKFSAVSICVMS--TLWRLDLKEI-TGKYVVGTGGEEGNP  465
            FS V  N     ++ S D N+  S  + C  S  T+W++D  ++ T +  V TGG +GNP
Sbjct  80   FSFVPFNFKKGVIRVSTDLNVIHSFPTNCSTSSVTVWKVDKVDVATSQRFVTTGGVQGNP  139

Query  466  GRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRI-LAITDKPLRVVF  642
            GR+T+ NWFK+ R E  YKL +CPTVC  C  VC D+GI + +       ++D P  V F
Sbjct  140  GRETVDNWFKIERFESGYKLVFCPTVCRECEVVCKDIGIFLDENRNTRFVLSDFPFGVKF  199

Query  643  KKA  651
            ++A
Sbjct  200  QRA  202



>gb|KDO40321.1| hypothetical protein CISIN_1g028238mg [Citrus sinensis]
Length=211

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 104/191 (54%), Gaps = 13/191 (7%)
 Frame = +1

Query  61   FLIAQSIKLLCIEAQ-IMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPN  237
            F++A S  LL   A+ ++ + + D +G +V    +YY+L +   GN   G GLT      
Sbjct  5    FVMAISFLLLAFAAKPLVGSRLHDINGDDVRADQEYYVLES---GN---GRGLTTLRHRG  58

Query  238  TTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LK  414
             +CPL V Q   +   G  ++F + N SS  + E+VD N+KFS V  C  S +W++D   
Sbjct  59   DSCPLDVAQVTSAPRTGKPLKFKAYN-SSRFIYEAVDLNVKFSIVDSCSDSLVWKVDNYD  117

Query  415  EITGKYVVGTGGEEGNPGRDTISNWFKVRR----DEDAYKLYYCPTVCDICRPVCGDLGI  582
            E  GK+ + TGG EG+PG  T+ NWFK  R    D   Y++ YCP+VC  C  +C ++G+
Sbjct  118  EERGKWFITTGGNEGDPGAKTLLNWFKFERIGTSDPATYRIVYCPSVCASCLFLCQNVGV  177

Query  583  LVVDGIRILAI  615
               D  R L +
Sbjct  178  SFEDSARRLVL  188



>ref|XP_006441440.1| hypothetical protein CICLE_v10022156mg [Citrus clementina]
 gb|ESR54680.1| hypothetical protein CICLE_v10022156mg [Citrus clementina]
Length=219

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 104/191 (54%), Gaps = 13/191 (7%)
 Frame = +1

Query  61   FLIAQSIKLLCIEAQ-IMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPN  237
            F++A S  LL   A+ ++ + + D +G +V    +YY+L +   GN   G GLT      
Sbjct  5    FVMAISFLLLAFAAKPLVGSRLHDINGDDVRADQEYYVLES---GN---GRGLTTLRHRG  58

Query  238  TTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLD-LK  414
             +CPL V Q   +   G  ++F + N SS  + E+VD N+KFS V  C  S +W++D   
Sbjct  59   DSCPLDVAQVTSAPRTGKPLKFKAYN-SSRFIYEAVDLNVKFSIVDSCSDSLVWKVDNYD  117

Query  415  EITGKYVVGTGGEEGNPGRDTISNWFKVRR----DEDAYKLYYCPTVCDICRPVCGDLGI  582
            E  GK+ + TGG EG+PG  T+ NWFK  R    D   Y++ YCP+VC  C  +C ++G+
Sbjct  118  EERGKWFITTGGNEGDPGAKTLLNWFKFERIGTSDPATYRIVYCPSVCASCLFLCQNVGV  177

Query  583  LVVDGIRILAI  615
               D  R L +
Sbjct  178  SFEDSARRLVL  188



>ref|XP_003548289.1| PREDICTED: miraculin-like [Glycine max]
Length=201

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 113/209 (54%), Gaps = 16/209 (8%)
 Frame = +1

Query  28   KMKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGG  207
            KM +  +  +  LI +++      A   +  V D+ G++V     YYI+PA++D      
Sbjct  2    KMTLVTLVLVFALITKAL------AGPASEPVLDALGKKVRADSIYYIVPASSDI-----  50

Query  208  GGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSI-CV  384
            GGL  A   +  CPL VV        G  + F+ VN     ++ S D NI F++ +I C 
Sbjct  51   GGLASART-DVDCPLDVVAV--DGDLGLPLSFTPVNDKKGIIRVSSDLNIYFTSYTIFCP  107

Query  385  MSTLWRLDL-KEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRP  561
             +T+W+L    + T ++ V TGGE G+P   T++NWFK+ + EDAYKL YCP+VC  C  
Sbjct  108  QTTVWKLKYYDDSTSQWFVTTGGELGHPSSQTVANWFKIEKYEDAYKLVYCPSVCSDCNH  167

Query  562  VCGDLGILVVDGIRILAITDKPLRVVFKK  648
             C D+GI      + LA++ +P +V F++
Sbjct  168  QCSDIGIYQDQYGKRLALSSEPYKVQFER  196



>emb|CDP21726.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 97/181 (54%), Gaps = 5/181 (3%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFA  294
            N V D +G+E+  GV+Y+I  A   G   G          N  CPL VVQ+    + G  
Sbjct  25   NPVLDINGEEIRPGVEYHIESAIFGGGGGGVTYGKGPG--NEICPLAVVQALSDVNRGHP  82

Query  295  VQFSSVNPSSTNVQESVDHNIKFSA-VSICVMSTLWRLDLKEITGKYVVGTGGEEGNPGR  471
            V F+ VNP    ++ S D NIKFS  ++ C  S +W++   E   ++ V T G EGN G 
Sbjct  83   VTFTPVNPEEGVIRVSTDLNIKFSPFINFCRGSNVWKVHFNEALEQHFVLTDGVEGNSGC  142

Query  472  DTISNWFKVRRDEDAYKLYYCPTVCD-ICRPVCGDLGILV-VDGIRILAITDKPLRVVFK  645
            +T +NWFK+  +   Y+L +CP VCD     +C D+GI    DG R LA++D+P  V F 
Sbjct  143  ETEANWFKIEGNYPFYRLVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALSDRPFGVYFS  202

Query  646  K  648
            K
Sbjct  203  K  203



>emb|CDP16462.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 88/160 (55%), Gaps = 6/160 (4%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEG-GGGLTLASGPNTTCPLLVVQSPDSSSNGF  291
            N V D  G E+  GV+YYI+ +       G   G ++    N +CPL VVQ       G 
Sbjct  25   NPVLDHDGDEIRAGVEYYIVSSIRGAGGGGVTYGRSIG---NESCPLPVVQEKLDLLRGH  81

Query  292  AVQFSSVNPSSTNVQESVDHNIKFS-AVSICVMSTLWRLDLKEITGKYVVGTGGEEGNPG  468
             V F+ VN     V+ S D NIKFS A  +C  S +W+LD  E  G++ + T G EGNPG
Sbjct  82   PVTFTPVNSKEGVVRVSTDLNIKFSKAAPVCNESNVWKLDFDEELGQHFILTNGVEGNPG  141

Query  469  RDTISNWFKVRRD-EDAYKLYYCPTVCDICRPVCGDLGIL  585
              TI NWFK+      +Y+L +CPTVC+IC  +C D+G+ 
Sbjct  142  CGTIHNWFKIEGPYHKSYRLVFCPTVCNICNVICKDVGVF  181



>gb|AFK34345.1| unknown [Medicago truncatula]
Length=212

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 107/196 (55%), Gaps = 18/196 (9%)
 Frame = +1

Query  100  AQIMANVVKDSSGQEVLTGVDYYILPAAADG-----NTEGGGGLTLASGPNTTCPLLVVQ  264
            A+   + V D+SG+++    +YYI+PA         +    GG+ L +    +CPL VV 
Sbjct  23   AEASPDQVIDTSGKKLRADTNYYIIPAKPFTTCGFVSCFNSGGIALETV-GESCPLDVVV  81

Query  265  SPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAV---SICVMSTL-WRLDL--KEITG  426
                 + G  ++F+ VN     V+ S D NIKFS     S C   +L W++D   KE T 
Sbjct  82   V--KHNQGLPLRFTPVNNKKGAVRVSTDLNIKFSNDAYDSRCPNHSLVWKIDPFSKEET-  138

Query  427  KYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRI  606
               V T G  GNPG +TI NWF++ + EDAYKL YCP VC  C+ VC D+GI V     +
Sbjct  139  --FVTTNGVLGNPGFNTIHNWFQIEKYEDAYKLVYCPNVCPSCKHVCKDIGIYVYKYREM  196

Query  607  -LAITDKPLRVVFKKA  651
             LA+T+ P +V F+KA
Sbjct  197  RLALTNVPFKVKFQKA  212



>ref|XP_009344613.1| PREDICTED: miraculin-like [Pyrus x bretschneideri]
Length=207

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 100/185 (54%), Gaps = 11/185 (6%)
 Frame = +1

Query  112  ANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGF  291
            +N V D++GQ + +GVDYYI PA  D     GG  TL +   T CPL V Q   S   G 
Sbjct  29   SNAVLDTAGQALQSGVDYYINPAITDS----GGRFTLIN--RTGCPLNVGQENVSGPKGL  82

Query  292  AVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPG  468
             V FS      T V+E  D  I FSA +ICV ST W++ +  + T + ++ TG +E    
Sbjct  83   PVTFSPFVEGETVVREGRDQKITFSASTICVQSTAWKVGETDQDTQRRLIITGEDENQGL  142

Query  469  RDTISNWFKVRRD---EDAYKLYYCPT-VCDICRPVCGDLGILVVDGIRILAITDKPLRV  636
                 N+F++ +    +  Y L +CPT VC  CR +CG +G +V +  R+LA+    L V
Sbjct  143  PGPARNYFRITKQATPDGVYNLEWCPTEVCPTCRFICGSVGAIVENDKRLLALDGSALPV  202

Query  637  VFKKA  651
            VF++A
Sbjct  203  VFERA  207



>ref|XP_009344614.1| PREDICTED: miraculin-like [Pyrus x bretschneideri]
Length=210

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 100/185 (54%), Gaps = 11/185 (6%)
 Frame = +1

Query  112  ANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGF  291
            +N V D++GQ + +GVDYYI PA  D     GG  TL +   T CPL V Q   S   G 
Sbjct  32   SNAVLDTTGQALQSGVDYYINPAITDS----GGRFTLIN--RTGCPLNVGQENVSGPEGL  85

Query  292  AVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPG  468
             V FS      T V+E  D  I FSA +ICV ST W++ +  + T + ++ TG +E    
Sbjct  86   PVTFSPFVEGETVVREGRDQKITFSASTICVQSTAWKVGETDQDTQRRLIITGEDENQGL  145

Query  469  RDTISNWFKVRRD---EDAYKLYYCPT-VCDICRPVCGDLGILVVDGIRILAITDKPLRV  636
                 N+F++ +    +  Y L +CPT VC  CR +CG +G +V +  R+LA+    L V
Sbjct  146  PGPARNYFRITKQATPDGVYNLEWCPTEVCPTCRFICGSVGAIVENDKRLLALDGSALPV  205

Query  637  VFKKA  651
            VF++A
Sbjct  206  VFERA  210



>ref|XP_003620187.1| Miraculin [Medicago truncatula]
 gb|AES76405.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=212

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 107/196 (55%), Gaps = 18/196 (9%)
 Frame = +1

Query  100  AQIMANVVKDSSGQEVLTGVDYYILPAAADG-----NTEGGGGLTLASGPNTTCPLLVVQ  264
            A+   + V D+SG+++    +YYI+PA         +    GG+ L +    +CPL VV 
Sbjct  23   AEASPDQVIDTSGKKLRADTNYYIIPAKPFTTCGFVSCFNSGGIALETV-GESCPLDVVV  81

Query  265  SPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAV---SICVMSTL-WRLDL--KEITG  426
                 + G  ++F+ VN     V+ S D NIKFS     S C   +L W++D   KE T 
Sbjct  82   V--KHNQGLPLRFTPVNNKKGVVRVSTDLNIKFSNDAYDSRCPNHSLVWKIDPFSKEET-  138

Query  427  KYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRI  606
               V T G  GNPG +TI NWF++ + EDAYKL YCP VC  C+ VC D+GI V     +
Sbjct  139  --FVTTNGVLGNPGSNTIHNWFQIEKYEDAYKLVYCPNVCPSCKHVCKDIGIYVYKYREM  196

Query  607  -LAITDKPLRVVFKKA  651
             LA+T+ P +V F+KA
Sbjct  197  RLALTNVPFKVKFQKA  212



>gb|ACS37303.1| trypsin inhibitor [Murraya koenigii]
 gb|ACS37304.1| trypsin inhibitor [Murraya koenigii]
Length=215

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 110/199 (55%), Gaps = 12/199 (6%)
 Frame = +1

Query  61   FLIAQSIKLLCIEAQIMA---NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASG  231
            F+IA S  LL    + +    + + D +G  V    DYY++         GGGGLTL  G
Sbjct  5    FVIAISFLLLAFATKPLVGRPDPLLDINGNVVEASRDYYLVSVIG---GAGGGGLTLYRG  61

Query  232  PNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDL  411
             N  CPL V+Q       G  ++F++ N +S  + E+VD N+KFS  + C   T+WR+D 
Sbjct  62   RNELCPLDVIQLSPDLHKGTRLRFAAYNNTSI-IHEAVDLNVKFSTETSCNEPTVWRVDN  120

Query  412  KEIT-GKYVVGTGGEEGNPGRDTISNWFKVRR---DEDAYKLYYCPTVCDICRPVCGDLG  579
             + + GK+ + TGG EGNPG  T+ NWFK+ R   D+  Y++ +CP+VC  C  +C D+G
Sbjct  121  YDPSRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQGTYEIVHCPSVCKSCVFLCNDVG  180

Query  580  ILVVDGIRILAITDKPLRV  636
            +   D  R LA+T    RV
Sbjct  181  V-SYDYRRRLALTAGNERV  198



>ref|XP_010428237.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 100/195 (51%), Gaps = 9/195 (5%)
 Frame = +1

Query  79   IKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLV  258
            + L  + A      V D  G  +  G  YY+LP         GGGLTL+      CPL +
Sbjct  9    LALTAVLATNAYGAVLDIDGNIIFRG-SYYVLPVIRGR----GGGLTLSGRGGELCPLDI  63

Query  259  VQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSA-VSICVMSTLWRL-DLKEITGKY  432
            VQ       G  V+FS+  P    V ES D NIK     +IC  ST WR+ +  E   +Y
Sbjct  64   VQESQEVDEGNPVKFSNWRPRVAFVPESQDLNIKTDVEATICFQSTYWRVGEFDEERKQY  123

Query  433  VVGTGGEEGNPGRDTISNWFKVRRD-EDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRI  606
             +  G +    G+D+  ++FK+ +  +DAYK  +CP+ CD   P C D+GI V + G+R 
Sbjct  124  FIVAGLKPEGFGQDSSKSFFKIEKSGDDAYKFVFCPSTCDSDCPKCSDVGIFVDELGVRR  183

Query  607  LAITDKPLRVVFKKA  651
            LA++D P  V+FKKA
Sbjct  184  LALSDDPFLVMFKKA  198



>gb|KCW48668.1| hypothetical protein EUGRSUZ_K02323 [Eucalyptus grandis]
Length=179

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +1

Query  370  VSICVMSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVC  546
            ++IC+ ST+WRL    E   +Y V +GG  G+PGR+TISNWFK+ + ++ YKL +CPTVC
Sbjct  70   LAICMHSTVWRLGAYNEEVKQYFVESGGVLGSPGRETISNWFKIEKVDEDYKLVFCPTVC  129

Query  547  DICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
            D C+ +C D+G+ V    R LA++D+P RV+FKKA
Sbjct  130  DTCKVICRDVGVYVDGATRRLALSDEPFRVMFKKA  164



>gb|KHM99737.1| Miraculin [Glycine soja]
Length=215

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 105/203 (52%), Gaps = 15/203 (7%)
 Frame = +1

Query  79   IKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAAD-----GNTEGGGGLTLAS-GPNT  240
            IK L   A    + V D+SG  +  G +YYI+P          N +G  GL LA    N 
Sbjct  16   IKSLLEGAYDSPHQVVDTSGNILRVGANYYIIPNPTTKCSIFSNYKGNNGLVLAKVAANK  75

Query  241  TCPL--LVVQSPDSSSNGFAVQFSSVNPSSTN--VQESVDHNIKFSAVSICVMSTLWRLD  408
            T PL  LVV+       G  + F+ ++       V+ S D NI+FS  + C  S +W++D
Sbjct  76   TFPLDVLVVEG---QQLGQPLTFTPIHDQKKGAPVRVSTDLNIEFSMQTSCSQSNVWKID  132

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                 T K+ V TGG  G+P   TISNWFK+ + +  YKL  CPT C  C+  C D+G+ 
Sbjct  133  HFDRATRKWFVTTGGVVGHPSWRTISNWFKIEKYDGDYKLVSCPTFCAYCKVQCRDIGVY  192

Query  586  V-VDGIRILAITDKPLRVVFKKA  651
               +G + LA+TD P +V F+KA
Sbjct  193  EDQNGNKRLALTDAPYKVRFQKA  215



>emb|CDP19138.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 95/184 (52%), Gaps = 8/184 (4%)
 Frame = +1

Query  115  NVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFA  294
            N V D +G+E+  GV+Y+++         G          N  CPL VVQ P   + G  
Sbjct  25   NPVLDINGEEIRPGVEYHVVSLFWGAGGGGVTYGKGPG--NEICPLAVVQEPSDRNRGHP  82

Query  295  VQFSSVNPSSTNVQESVDHNIKFSA---VSICVMSTLWRLDLKEITGKYVVGTGGEEGNP  465
            V F+ VNP    V+ S D NIKF+    ++ C  S +W++   E   ++ V T G EGN 
Sbjct  83   VTFTPVNPEEGVVRVSTDLNIKFAEPPIINFCRGSNVWKVHFNEALEQHFVLTDGVEGNS  142

Query  466  GRDTISNWFKVRR-DEDAYKLYYCPTVCD-ICRPVCGDLGILVVDG-IRILAITDKPLRV  636
            G +T +NWFK+       YKL YCP VCD     +C D+GI   D   R LA++D+P  V
Sbjct  143  GCETEANWFKIEAIGSLGYKLVYCPAVCDSSSEAICKDVGIYYDDDRTRRLALSDQPFLV  202

Query  637  VFKK  648
            VF K
Sbjct  203  VFIK  206



>gb|KHM99742.1| Miraculin, partial [Glycine soja]
Length=146

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 87/149 (58%), Gaps = 4/149 (3%)
 Frame = +1

Query  208  GGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVM  387
            GGL +AS     CPL VV        G  + F+ VN +   ++ S D NI F   + C  
Sbjct  1    GGLDMAST-GADCPLDVVAV--DGYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVGTSCPQ  57

Query  388  STLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
            +T+W+L D      ++ V TGG+ GNPG  T++NWFK+ + EDAYKL YCP+VC+ C   
Sbjct  58   TTVWKLKDYDYSASQWFVTTGGDFGNPGSQTMANWFKIEKYEDAYKLVYCPSVCNDCSYP  117

Query  565  CGDLGILVVDGIRILAITDKPLRVVFKKA  651
            C D+GI   +  + LA++ +P +V F++A
Sbjct  118  CSDIGIYQDEYGKRLALSSEPYKVKFQRA  146



>ref|XP_006347379.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=204

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 94/176 (53%), Gaps = 8/176 (5%)
 Frame = +1

Query  127  DSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFS  306
            D +G+ + T   Y+++P          GG++L +  N  C L VVQ       G +V   
Sbjct  30   DINGKILRTHTTYFVVPV-----NHKYGGISLETTGNEKCQLGVVQEIYDVHGG-SVALL  83

Query  307  SVNPSSTNVQESVDHNIK-FSAVSICVMSTLWRLDLKE-ITGKYVVGTGGEEGNPGRDTI  480
             +NP    ++ S D NI  FS       ST+W+L+  +  TGKY +  GG EGNP   TI
Sbjct  84   PLNPKEGVIRVSTDLNIAIFSTHGCGDQSTVWQLETYDSKTGKYFIKDGGVEGNPDPKTI  143

Query  481  SNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRVVFKK  648
             NWFK+ +    YK  YCP+VC  C+ +C D+G+ + +G R LA+++ PL   FKK
Sbjct  144  RNWFKIEKYGHGYKFVYCPSVCSKCKVICKDVGVYMKNGQRRLALSNVPLVFNFKK  199



>ref|XP_004515058.1| PREDICTED: miraculin-like [Cicer arietinum]
Length=196

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 108/209 (52%), Gaps = 17/209 (8%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK+  +     L A S + L   A+   + V D+SG+++    DYYI+PA        GG
Sbjct  1    MKITTILAFFLLFALSSQPLLGSAKASPDHVLDTSGKKLRVDADYYIIPA-------NGG  53

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAV-SICVM  387
             + L +    +CPL VV   D  S G  ++F+   P    ++ S+D NI  +   S C  
Sbjct  54   FIDLETN-GESCPLHVVV--DKHSQGLPLRFA---PIKGVIRVSIDLNIMLANYDSRCPH  107

Query  388  -STLWRLDLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPV  564
             S +W++D       +V   GG  G P   TI +WFK+ + EDAYKL YCP VC  C+ V
Sbjct  108  HSIVWKIDPSSKEETFVT-LGGVLGYPSSKTIQSWFKIEKYEDAYKLVYCPYVCPSCKHV  166

Query  565  CGDLGILVV-DGIRILAITDKPLRVVFKK  648
            C D+GI V  D    LA+T+ P +V FK+
Sbjct  167  CKDIGIYVYKDREMRLALTNIPFKVKFKE  195



>gb|AEK31191.1| miraculin-like protein 1 [Citrus aurantiifolia]
 gb|AEK31193.1| miraculin-like protein 1 [Citrus sinensis]
 gb|AEK31194.1| miraculin-like protein 1 [Citrus reticulata]
 gb|AEK31195.1| miraculin-like protein 1 [Murraya paniculata]
Length=172

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 97/168 (58%), Gaps = 9/168 (5%)
 Frame = +1

Query  127  DSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFS  306
            D +G  V    DYY++         GGGGLTL  G N  CPL V+Q       G  ++F+
Sbjct  5    DINGNVVEASRDYYLVSVIG---GAGGGGLTLYRGRNELCPLDVIQLSSDLHKGTRLRFA  61

Query  307  SVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEIT-GKYVVGTGGEEGNPGRDTIS  483
            + N +S  + E+VD N+KFS  + C   T+WR+D  + + GK+ + TGG EGNPG  T+ 
Sbjct  62   AYNNTSI-IHEAVDLNVKFSTETSCNEPTVWRVDNYDPSRGKWFITTGGVEGNPGAQTLK  120

Query  484  NWFKVRR---DEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAIT  618
            NWFK+ R   D+  Y++ +CP+VC  C  +C D+G+   D  R LA+T
Sbjct  121  NWFKLERVGTDQGTYEIVHCPSVCKSCVFLCNDVGV-SYDYRRRLALT  167



>gb|ABK01288.1| miraculin-like protein [Coffea arabica]
Length=214

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 97/184 (53%), Gaps = 16/184 (9%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNT-EGGGGLTLASGP-NTTCPLLVVQSPDSSSNGFA  294
            V D +G+E+  GV+YYI      G T   GGG+T   GP N  CPL V Q+      G  
Sbjct  27   VLDINGEEIRPGVEYYI------GTTFRPGGGVTYGKGPGNEICPLAVAQA--WLQRGLP  78

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAV---SICVMSTLWRLDLKEITGKYVVGTGGEEGNP  465
            V F+ VNP    V+ S D NIKF+      IC  S +W++   ++  K+ V T G EGN 
Sbjct  79   VTFTPVNPEEGVVRVSTDLNIKFAEPPVGRICSGSNVWKVHFNDLFEKHFVLTDGVEGNS  138

Query  466  GRDTISNWFKVRRDED-AYKLYYCPTVCD-ICRPVCGDLGILV-VDGIRILAITDKPLRV  636
            G  T +NWFK+    D  YKL +CPTVCD     +C  +GI    DG R LA+  +P  V
Sbjct  139  GCGTTANWFKIEAVGDRGYKLVFCPTVCDSSSEAICKYVGIYHDDDGTRRLALGGQPFVV  198

Query  637  VFKK  648
             F K
Sbjct  199  FFSK  202



>ref|NP_565061.1| kunitz trypsin inhibitor 1 [Arabidopsis thaliana]
 gb|AAL91212.1| putative trypsin inhibitor [Arabidopsis thaliana]
 gb|AAO00908.1| putative trypsin inhibitor [Arabidopsis thaliana]
 dbj|BAF02103.1| putative trypsin inhibitor [Arabidopsis thaliana]
 gb|AEE35435.1| kunitz trypsin inhibitor 1 [Arabidopsis thaliana]
Length=215

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 90/167 (54%), Gaps = 8/167 (5%)
 Frame = +1

Query  163  YYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQES  342
            YY+LP         GGGLTLA      CP  +VQ       G  V+FS+       V ES
Sbjct  43   YYVLPVIRGR----GGGLTLAGRGGQPCPYDIVQESSEVDEGIPVKFSNWRLKVAFVPES  98

Query  343  VDHNIKFS-AVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRD-ED  513
             + NI+     +IC+ ST WR+ +      +Y V  G +    G+D++ ++FK+ +  ED
Sbjct  99   QNLNIETDVGATICIQSTYWRVGEFDHERKQYFVVAGPKPEGFGQDSLKSFFKIEKSGED  158

Query  514  AYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
            AYK  +CP  CD   P C D+GI + + G+R LA++DKP  V+FKKA
Sbjct  159  AYKFVFCPRTCDSGNPKCSDVGIFIDELGVRRLALSDKPFLVMFKKA  205



>gb|AAG52121.1|AC010556_3 putative trypsin inhibitor; 19671-20297 [Arabidopsis thaliana]
Length=208

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 90/167 (54%), Gaps = 8/167 (5%)
 Frame = +1

Query  163  YYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQES  342
            YY+LP         GGGLTLA      CP  +VQ       G  V+FS+       V ES
Sbjct  36   YYVLPVIRGR----GGGLTLAGRGGQPCPYDIVQESSEVDEGIPVKFSNWRLKVAFVPES  91

Query  343  VDHNIKFS-AVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRD-ED  513
             + NI+     +IC+ ST WR+ +      +Y V  G +    G+D++ ++FK+ +  ED
Sbjct  92   QNLNIETDVGATICIQSTYWRVGEFDHERKQYFVVAGPKPEGFGQDSLKSFFKIEKSGED  151

Query  514  AYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
            AYK  +CP  CD   P C D+GI + + G+R LA++DKP  V+FKKA
Sbjct  152  AYKFVFCPRTCDSGNPKCSDVGIFIDELGVRRLALSDKPFLVMFKKA  198



>gb|KDO77364.1| hypothetical protein CISIN_1g0437192mg, partial [Citrus sinensis]
Length=175

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 100/184 (54%), Gaps = 17/184 (9%)
 Frame = +1

Query  109  MANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNG  288
            ++  V D++GQ +  G++YYILP     +   GGGLTL    N +CPL V Q   S S G
Sbjct  6    LSPPVLDTNGQALQRGLEYYILPE----DNATGGGLTLVER-NDSCPLYVGQKETSGSEG  60

Query  289  -FAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYVVGTGGEEGN  462
             F V FS        V+ES D  + FSA + C+ ST WR+ +    TG+  + TGG    
Sbjct  61   LFPVTFSPFVGEENIVRESHDFIVTFSAFTTCIQSTAWRVGESDPKTGRRFIVTGG----  116

Query  463  PGRDTISNWFKVRRDEDAYKLYYCPTV-CDICRPVCGDLGILVVDGIRILAITDKPLRVV  639
                 +  +F++ R+  +Y L +CP++ C  CR  CG  GIL+ +G R+LA+    L  V
Sbjct  117  -----VPGFFRIDRNGTSYNLGWCPSMACPNCRLRCGFAGILIENGKRLLALDGPALPFV  171

Query  640  FKKA  651
            FK+A
Sbjct  172  FKRA  175



>ref|XP_002525871.1| Alpha-amylase/subtilisin inhibitor precursor, putative [Ricinus 
communis]
 gb|EEF36475.1| Alpha-amylase/subtilisin inhibitor precursor, putative [Ricinus 
communis]
Length=194

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 103/194 (53%), Gaps = 19/194 (10%)
 Frame = +1

Query  85   LLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQ  264
            L+ +        V DSSGQ + +GV+YY+LPAA    T+  GGLTL +    +CP  V Q
Sbjct  15   LMAVSTIAQTPAVLDSSGQPLTSGVEYYVLPAA----TDTAGGLTLVNR-TGSCPFYVGQ  69

Query  265  SP--DSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRL-DLKEITGKYV  435
             P    +  GF V F+ +    + ++E +D  + FSAV+ CV ST W + D    T +  
Sbjct  70   EPLPTVAKTGFPVIFTPLAAGESIIREGMDFRVAFSAVTNCVQSTTWSIGDEDAETSRRF  129

Query  436  VGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDI-C-RPVCGDLGILVVDGIRIL  609
            + TGGEE         ++F++ ++E  Y L +CP    I C RP CG  GIL+ +G R+L
Sbjct  130  IVTGGEE---------DYFRIDKNEGLYNLGWCPNCNSINCPRPRCGFAGILIENGNRLL  180

Query  610  AITDKPLRVVFKKA  651
            A+        F++A
Sbjct  181  ALDGAAFPFQFRRA  194



>ref|XP_003620185.1| 21 kDa seed protein [Medicago truncatula]
 gb|AES76403.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=199

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 100/191 (52%), Gaps = 14/191 (7%)
 Frame = +1

Query  88   LCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQS  267
            L + ++   N V D SG+++ T  DYYI+PA        GG ++L S    +CPL VV  
Sbjct  20   LFVSSKTSLNQVLDISGKKLRTDSDYYIIPA-------NGGDISLESSIGESCPLHVVVV  72

Query  268  PDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVS--ICVMSTLWRLDLKEITGKYVVG  441
                  GF ++ +   P   +++ S D NI            S +W++D       +V  
Sbjct  73   KHRQGLGFPLRLA---PVKGDIRVSTDLNIMLGNYDDRCPNYSVVWKIDPYSKEATFVT-  128

Query  442  TGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRI-LAIT  618
            T G  G+PG ++I +WFK+ + EDAYKL YCP VC  C  VC D+GI       + LA+T
Sbjct  129  TNGILGHPGSNSIHSWFKIEKYEDAYKLVYCPNVCPSCNHVCKDIGIYKYKNREMRLALT  188

Query  619  DKPLRVVFKKA  651
            + PL++ F++A
Sbjct  189  NVPLKIKFQQA  199



>gb|AEK26931.1| Kunitz-type trypsin inhibitor C5 [Populus nigra]
Length=199

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 101/182 (55%), Gaps = 18/182 (10%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSS--NGFA  294
            V D+SGQ + TGV+YYILP    G T+  GGLTL +     CP  V Q P +S+  NG +
Sbjct  31   VLDTSGQPLETGVEYYILP----GITDIAGGLTLVNRNGIRCPFYVGQEPLASAEPNGTS  86

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEI-TGKYVVGTGGEEGNPGR  471
            V F+      T ++ES D +++F A++IC+ ST WR+  ++  TG+  + T G++     
Sbjct  87   VIFTPYTSGETIIRESRDLSVQFQALTICIQSTAWRVGEEDPETGRRFIVTAGDK-----  141

Query  472  DTISNWFKVRRDEDAYKLYYCPT-VCDIC-RPVCGDLGILVVDGIRILAITDKPLRVVFK  645
                ++F++  +   Y   +CPT  C  C RP CG  GIL+ D  R+LA+       VF 
Sbjct  142  ----SYFRIDNNGGVYNFSWCPTESCPTCDRPRCGSAGILIEDDKRLLALDGPAFPFVFT  197

Query  646  KA  651
            +A
Sbjct  198  RA  199



>gb|AAN15685.1| putative trypsin inhibitor [Arabidopsis thaliana]
Length=215

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 90/167 (54%), Gaps = 8/167 (5%)
 Frame = +1

Query  163  YYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQES  342
            YY+LP         GGGLTLA      CP  +VQ       G  V+FS+       V ES
Sbjct  43   YYVLPVIRGR----GGGLTLAGRGGQPCPYDIVQESSEVDEGIPVKFSNWRLKVAFVPES  98

Query  343  VDHNIKFS-AVSICVMSTLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRD-ED  513
             + NI+     +IC+ ST WR+ +      +Y V  G +    G+D++ ++FK+ +  ED
Sbjct  99   QNLNIETDVGATICIQSTYWRVGEFDHERRQYFVVAGPKPEGFGQDSLKSFFKIEKSGED  158

Query  514  AYKLYYCPTVCDICRPVCGDLGILVVD-GIRILAITDKPLRVVFKKA  651
            AYK  +CP  CD   P C D+GI + + G+R LA++DKP  V+FKKA
Sbjct  159  AYKFVFCPRTCDSGNPKCSDVGIFIDELGVRRLALSDKPFLVMFKKA  205



>ref|XP_006468645.1| PREDICTED: alpha-amylase/subtilisin inhibitor-like [Citrus sinensis]
Length=195

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 109/210 (52%), Gaps = 22/210 (10%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            +K    F L+  I Q+       +  ++  V D++GQ +  G++YYILP     +   GG
Sbjct  5    IKSRSFFCLVLAITQAQP-----SDDLSPPVLDTNGQALQRGLEYYILPE----DNATGG  55

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNG-FAVQFSSVNPSSTNVQESVDHNIKFSAVSICVM  387
            GLTL    N +CPL V Q   S S G F V FS        V+ES D  + FSA + C+ 
Sbjct  56   GLTLVER-NDSCPLYVGQKETSGSEGLFPVTFSPFVGEENIVRESHDFIVTFSAFTTCIQ  114

Query  388  STLWRL-DLKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTV-CDICRP  561
            ST WR+ +    TG+  + TGG  G         +F++ R+  +Y L +CP++ C  CR 
Sbjct  115  STAWRVGESDPKTGRRFIVTGGVPG---------FFRIDRNGTSYNLGWCPSMACPNCRL  165

Query  562  VCGDLGILVVDGIRILAITDKPLRVVFKKA  651
             CG  GIL+ +G R+LA+    L  VFK+A
Sbjct  166  RCGFAGILIENGKRLLALDGPALPFVFKRA  195



>gb|AEK31190.1| miraculin-like protein 1 [Citrus limonia]
Length=172

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 96/168 (57%), Gaps = 9/168 (5%)
 Frame = +1

Query  127  DSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFS  306
            D +G  V    DYY++         GGGGLTL  G N  CPL V+Q       G  ++F+
Sbjct  5    DINGNVVEASRDYYLVSVIG---GAGGGGLTLYRGRNELCPLDVIQLSSDLHKGTRLRFA  61

Query  307  SVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEIT-GKYVVGTGGEEGNPGRDTIS  483
            + N +S  + E+VD N+KFS  + C   T+WR+D  + + GK+ + TGG EGNPG  T+ 
Sbjct  62   AYNNTSI-IHEAVDLNVKFSTETSCNEPTVWRVDNYDPSRGKWFITTGGVEGNPGAQTLK  120

Query  484  NWFKVRR---DEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAIT  618
            NWFK+ R   D+  Y++ +CP+VC  C  +C D+G+   D  R LA T
Sbjct  121  NWFKLERVGTDQGTYEIVHCPSVCKSCVFLCNDVGV-SYDYRRRLAFT  167



>ref|XP_006448699.1| hypothetical protein CICLE_v10016767mg [Citrus clementina]
 gb|ESR61939.1| hypothetical protein CICLE_v10016767mg [Citrus clementina]
Length=200

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 107/206 (52%), Gaps = 25/206 (12%)
 Frame = +1

Query  67   IAQSIKLLCIEAQI--------MANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTL  222
            + +S+   C+   I        ++  V D++GQ +  G++YYILP     +   GGGLTL
Sbjct  9    LVKSLSFFCLVLAITQAQPSDDLSPPVLDTNGQALQRGLEYYILPE----DNATGGGLTL  64

Query  223  ASGPNTTCPLLVVQSPDSSSNG-FAVQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLW  399
                N +CPL V Q   S S G F V FS        V+ES D  + FSA + C+ ST W
Sbjct  65   VDR-NDSCPLYVGQKETSGSEGLFPVTFSPFVGEENIVRESHDFIVTFSAFTTCIQSTAW  123

Query  400  RLDLKEI-TGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTV-CDICRPVCGD  573
            R+   +  TG+  + TGG  G         +F++ R+  +Y L +CP++ C  CR  CG 
Sbjct  124  RVGESDPETGRRFIVTGGVPG---------FFRIDRNGTSYNLGWCPSMACPNCRLRCGF  174

Query  574  LGILVVDGIRILAITDKPLRVVFKKA  651
             GIL+ +G R+LA+    L  VFK+A
Sbjct  175  AGILIENGKRLLALDGPALPFVFKRA  200



>ref|XP_007036746.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21247.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 109/214 (51%), Gaps = 14/214 (7%)
 Frame = +1

Query  31   MKMEKVFFLLFLIAQSIKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGG  210
            MK      LL     S       A+   + V DS G E+ TGV+YY++ A       G  
Sbjct  1    MKTATAVVLLLFAFTSKSYFFGVARADESPVLDSDGDELRTGVEYYVVSAIWGAGGGGLA  60

Query  211  GLTLASGPNTTCPLLVVQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSAVS--ICV  384
               +      +CP +VVQ   S  +G  V FS+ +     V+ S D NI+F  +   +C+
Sbjct  61   LGRVT---GQSCPEIVVQR-GSDDDGLPVIFSNADGKDGVVRLSTDVNIEFVPIRDRLCL  116

Query  385  MSTLWRLD-LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDA----YKLYYCPTVCD  549
             ST+W+LD     TGK+ V T G +G+PG +T+++WFK+   EDA    YK  +CP+VCD
Sbjct  117  TSTVWKLDDYDPSTGKWWVTTDGVKGDPGHNTLTSWFKI---EDAGALGYKFRFCPSVCD  173

Query  550  ICRPVCGDLGILVVDGIRILAITDKPLRVVFKKA  651
             C  +C D G    DG   LA+++     +FKKA
Sbjct  174  SCIHLCNDFGRHGHDGQVRLALSENGWPWIFKKA  207



>pdb|3IIR|A Chain A, Crystal Structure Of Miraculin Like Protein From Seeds 
Of Mu Koenigii
 pdb|3IIR|B Chain B, Crystal Structure Of Miraculin Like Protein From Seeds 
Of Mu Koenigii
 pdb|3ZC8|A Chain A, Crystal Structure Of Murraya Koenigii Miraculin-like 
Protein At 2.2 A Resolution At Ph 7.0
 pdb|3ZC9|A Chain A, Crystal Structure Of Murraya Koenigii Miraculin-like 
Protein At 2.2 A Resolution At Ph 4.6
Length=190

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 99/174 (57%), Gaps = 9/174 (5%)
 Frame = +1

Query  127  DSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSSNGFAVQFS  306
            D +G  V    DYY++         GGGGLTL  G N  CPL V+Q       G  ++F+
Sbjct  5    DINGNVVEASRDYYLVSVIG---GAGGGGLTLYRGRNELCPLDVIQLSPDLHKGTRLRFA  61

Query  307  SVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEIT-GKYVVGTGGEEGNPGRDTIS  483
            + N +S  + E+VD N+KFS  + C   T+WR+D  + + GK+ + TGG EGNPG  T+ 
Sbjct  62   AYNNTSI-IHEAVDLNVKFSTETSCNEPTVWRVDNYDPSRGKWFITTGGVEGNPGAQTLK  120

Query  484  NWFKVRR---DEDAYKLYYCPTVCDICRPVCGDLGILVVDGIRILAITDKPLRV  636
            NWFK+ R   D+  Y++ +CP+VC  C  +C D+G+   D  R LA+T    RV
Sbjct  121  NWFKLERVGTDQGTYEIVHCPSVCKSCVFLCNDVGV-SYDYRRRLALTAGNERV  173



>ref|XP_003534081.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 104/203 (51%), Gaps = 15/203 (7%)
 Frame = +1

Query  79   IKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAAD-----GNTEGGGGLTLAS-GPNT  240
            IK L   A    + V D+SG  +  G +YYI+P            +G  GL LA    N 
Sbjct  16   IKSLLEGAYDSPHQVVDTSGNILRVGANYYIIPNPTTKCSIFSKYKGNNGLVLAKVAANK  75

Query  241  TCPL--LVVQSPDSSSNGFAVQFSSVNPSSTN--VQESVDHNIKFSAVSICVMSTLWRLD  408
            T PL  LVV+       G  + F+ ++       V+ S D NI+FS  + C  S +W++D
Sbjct  76   TFPLDVLVVEG---QQLGQPLTFTPIHDQKKGAPVRVSTDLNIEFSMQTSCSQSNVWKID  132

Query  409  -LKEITGKYVVGTGGEEGNPGRDTISNWFKVRRDEDAYKLYYCPTVCDICRPVCGDLGIL  585
                 T K+ V TGG  G+P   TISNWFK+ + +  YKL  CPT C  C+  C D+G+ 
Sbjct  133  HFDRATRKWFVTTGGVVGHPSWRTISNWFKIEKYDGDYKLVSCPTFCAYCKVQCRDIGVY  192

Query  586  V-VDGIRILAITDKPLRVVFKKA  651
               +G + LA+TD P +V F+KA
Sbjct  193  EDQNGNKRLALTDAPYKVRFQKA  215



>gb|ACS92521.1| Kunitz-type protease inhibitor KPI-F4 [Populus trichocarpa x 
Populus deltoides]
 gb|ACS92522.1| Kunitz-type protease inhibitor KPI-F4 [Populus trichocarpa x 
Populus nigra]
Length=199

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 101/182 (55%), Gaps = 18/182 (10%)
 Frame = +1

Query  121  VKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLVVQSPDSSS--NGFA  294
            V D+SGQ + TGV+YYILP    G T+  GGLTL +     CP  V Q P +S+  NG +
Sbjct  31   VLDTSGQPLETGVEYYILP----GITDVAGGLTLVNRNGIRCPFYVGQEPLASAEPNGTS  86

Query  295  VQFSSVNPSSTNVQESVDHNIKFSAVSICVMSTLWRLDLKEI-TGKYVVGTGGEEGNPGR  471
            V F+      T ++ES D +++F A++IC+ ST WR+  ++  TG+  + T G++     
Sbjct  87   VIFTPYTSGETIIRESRDLSVQFQALTICIQSTAWRVGEEDPETGRRFIVTAGDK-----  141

Query  472  DTISNWFKVRRDEDAYKLYYCPT-VCDIC-RPVCGDLGILVVDGIRILAITDKPLRVVFK  645
                ++F++  +   Y   +CPT  C  C RP CG  GIL+ D  R+LA+       VF 
Sbjct  142  ----SYFRIDNNGGVYNFSWCPTESCPNCARPRCGSAGILIEDDKRLLALDGPAFPFVFT  197

Query  646  KA  651
            +A
Sbjct  198  RA  199



>ref|XP_010416116.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 100/195 (51%), Gaps = 9/195 (5%)
 Frame = +1

Query  79   IKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLV  258
            + L  + A      V D  G  +  G  YY+LP         GGGLTL+      CPL +
Sbjct  9    LALTAVLATNAYGAVLDIDGNIIFRG-SYYVLPVIRGR----GGGLTLSGRGGELCPLDI  63

Query  259  VQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFSA-VSICVMSTLWRL-DLKEITGKY  432
            VQ       G  V+FS+  P    V ES D NI+     +IC  ST WR+ +  E   +Y
Sbjct  64   VQESQELDEGNPVKFSNWRPRVAFVPESQDLNIQTDVEATICFQSTYWRVGEFDEERKQY  123

Query  433  VVGTGGEEGNPGRDTISNWFKVRRD-EDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRI  606
             +  G +    G+D+  ++FK+ +  +DAYK  +CP+ CD   P C D+GI   + G+R 
Sbjct  124  FIVAGLKPEGFGQDSSKSFFKIEKSGDDAYKFVFCPSTCDSGCPKCSDVGIFEDELGVRR  183

Query  607  LAITDKPLRVVFKKA  651
            LA++D+P  V+FKKA
Sbjct  184  LALSDEPFLVMFKKA  198



>ref|XP_006302823.1| hypothetical protein CARUB_v10020954mg [Capsella rubella]
 gb|EOA35721.1| hypothetical protein CARUB_v10020954mg [Capsella rubella]
Length=208

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 100/195 (51%), Gaps = 9/195 (5%)
 Frame = +1

Query  79   IKLLCIEAQIMANVVKDSSGQEVLTGVDYYILPAAADGNTEGGGGLTLASGPNTTCPLLV  258
            + L  + A      V D  G  +  G  YY+LP         GGGLTLA      CPL +
Sbjct  9    LALTAVLATNAYGAVLDIDGNIIFRG-SYYVLPLIRGR----GGGLTLAGRGGELCPLDI  63

Query  259  VQSPDSSSNGFAVQFSSVNPSSTNVQESVDHNIKFS-AVSICVMSTLWRL-DLKEITGKY  432
            VQ       G  V+FS+  P    V ES D NI+     +ICV ST WR+ +  E   +Y
Sbjct  64   VQESSEVDEGIPVKFSNWRPRVGFVPESEDLNIETDVGATICVQSTYWRVGEFDEERKQY  123

Query  433  VVGTGGEEGNPGRDTISNWFKVRRD-EDAYKLYYCPTVCDICRPVCGDLGILVVD-GIRI  606
             V  G +    G+D++ ++FK+ +  +DAYK  +CP   D   P C D+G+ V + G+  
Sbjct  124  FVVAGPKPEGFGQDSLKSFFKIEKSGDDAYKFVFCPRTWDSSCPKCSDVGVFVDELGVWR  183

Query  607  LAITDKPLRVVFKKA  651
            LA++D+P  V+FKKA
Sbjct  184  LALSDEPFLVMFKKA  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1364606714424