BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3728_g1_i1 len=1021 path=[1:0-1020]

Length=1021
                                                                      Score     E

ref|XP_009782196.1|  PREDICTED: cyclin-U1-1                             251   2e-78   
ref|XP_002515728.1|  Nuc-1 negative regulatory protein preg, puta...    248   3e-77   Ricinus communis
ref|XP_007043344.1|  Cyclin p2,1 isoform 1                              248   4e-77   
ref|XP_009601525.1|  PREDICTED: cyclin-U1-1                             248   6e-77   
ref|XP_004243454.1|  PREDICTED: cyclin-U1-1                             246   2e-76   
emb|CDP11817.1|  unnamed protein product                                246   2e-76   
gb|KHG13275.1|  Cyclin-U1-1 -like protein                               244   7e-76   
gb|KDP25867.1|  hypothetical protein JCGZ_22897                         243   3e-75   
ref|XP_006447491.1|  hypothetical protein CICLE_v10016515mg             241   3e-74   
ref|XP_010109538.1|  hypothetical protein L484_018273                   237   5e-73   
ref|XP_010035608.1|  PREDICTED: cyclin-U1-1-like                        236   2e-72   
ref|XP_002310464.1|  cyclin family protein                              234   8e-72   Populus trichocarpa [western balsam poplar]
ref|XP_011003213.1|  PREDICTED: cyclin-U1-1                             232   4e-71   
ref|XP_008230100.1|  PREDICTED: cyclin-U1-1                             232   7e-71   
ref|XP_003540320.1|  PREDICTED: cyclin-U1-1-like                        232   8e-71   
ref|XP_007215945.1|  hypothetical protein PRUPE_ppa011252mg             230   2e-70   
gb|ABX10779.1|  putative cyclin-dependent protein kinase                229   2e-70   Glycine max [soybeans]
ref|NP_001235448.1|  uncharacterized protein LOC100527137               230   3e-70   
ref|XP_011079017.1|  PREDICTED: cyclin-U1-1                             229   4e-70   
ref|XP_004487375.1|  PREDICTED: cyclin-U1-1-like                        228   1e-69   
ref|XP_010510760.1|  PREDICTED: cyclin-U1-1                             227   2e-69   
ref|XP_006298586.1|  hypothetical protein CARUB_v10014669mg             227   2e-69   
ref|XP_007043345.1|  Cyclin p2,1 isoform 2                              229   2e-69   
ref|XP_010488211.1|  PREDICTED: cyclin-U1-1-like                        226   5e-69   
ref|XP_010466452.1|  PREDICTED: cyclin-U1-1-like                        226   5e-69   
ref|XP_002885474.1|  CYCP2_1                                            226   8e-69   
ref|XP_010240959.1|  PREDICTED: cyclin-U1-1                             226   9e-69   
ref|XP_007149955.1|  hypothetical protein PHAVU_005G113500g             226   1e-68   
ref|XP_006851148.1|  hypothetical protein AMTR_s00043p00103760          225   1e-68   
ref|NP_188825.1|  cyclin p2;1                                           225   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002280596.1|  PREDICTED: cyclin-U1-1                             225   3e-68   Vitis vinifera
ref|XP_004289157.1|  PREDICTED: cyclin-U1-1-like                        224   4e-68   
gb|EYU43110.1|  hypothetical protein MIMGU_mgv1a013764mg                224   5e-68   
ref|XP_010532486.1|  PREDICTED: cyclin-U1-1                             220   1e-66   
ref|XP_003597030.1|  Cyclin-U1-1                                        221   2e-66   
gb|KFK39504.1|  hypothetical protein AALP_AA3G252300                    220   2e-66   
ref|XP_006406231.1|  hypothetical protein EUTSA_v10021524mg             219   3e-66   
ref|XP_008379611.1|  PREDICTED: cyclin-U1-1                             219   5e-66   
ref|XP_009353246.1|  PREDICTED: cyclin-U1-1                             219   1e-65   
emb|CDY38647.1|  BnaA05g19400D                                          218   1e-65   
emb|CDY54190.1|  BnaCnng26370D                                          218   1e-65   
ref|XP_009342256.1|  PREDICTED: cyclin-U1-1-like                        218   1e-65   
ref|XP_004151930.1|  PREDICTED: cyclin-U1-1-like                        216   8e-65   
ref|XP_008455834.1|  PREDICTED: cyclin-U1-1                             216   1e-64   
ref|XP_004172662.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U1-1-...    215   2e-64   
ref|XP_009145444.1|  PREDICTED: cyclin-U1-1                             212   1e-63   
gb|KHN36553.1|  Cyclin-U1-1                                             209   1e-62   
ref|XP_001784037.1|  predicted protein                                  192   2e-56   
ref|XP_010906680.1|  PREDICTED: cyclin-U1-1                             193   8e-56   
ref|XP_001784038.1|  predicted protein                                  189   3e-55   
gb|ABK22429.1|  unknown                                                 191   5e-55   Picea sitchensis
ref|XP_001763676.1|  predicted protein                                  187   1e-54   
ref|XP_001760666.1|  predicted protein                                  181   4e-52   
gb|AAC32127.1|  PREG-like protein                                       183   2e-51   Picea mariana [black spruce]
ref|XP_001753286.1|  predicted protein                                  179   3e-51   
ref|XP_002976722.1|  hypothetical protein SELMODRAFT_416667             177   2e-49   
ref|XP_002973135.1|  hypothetical protein SELMODRAFT_413599             177   2e-49   
ref|XP_010666788.1|  PREDICTED: cyclin-U1-1                             175   3e-49   
ref|XP_002985239.1|  hypothetical protein SELMODRAFT_48560              172   1e-48   
gb|EPS61803.1|  hypothetical protein M569_12990                         169   1e-47   
ref|XP_009385065.1|  PREDICTED: cyclin-U1-1                             169   2e-46   
ref|XP_002994358.1|  hypothetical protein SELMODRAFT_48686              164   1e-45   
ref|XP_002966846.1|  hypothetical protein SELMODRAFT_68732              163   2e-45   
gb|AFK42393.1|  unknown                                                 163   2e-45   
gb|ABA27005.1|  TO51-3                                                  150   5e-41   Taraxacum officinale [dandelion]
gb|KHG00595.1|  Cyclin-P3-1                                             148   6e-39   
ref|XP_002512374.1|  cyclin-dependent protein kinase, putative          147   2e-38   Ricinus communis
ref|XP_007134401.1|  hypothetical protein PHAVU_010G044800g             145   6e-38   
ref|XP_006375171.1|  cyclin family protein                              144   1e-37   
ref|XP_011032483.1|  PREDICTED: cyclin-U4-1                             144   1e-37   
ref|XP_010056382.1|  PREDICTED: cyclin-U4-1                             144   1e-37   
ref|XP_010546693.1|  PREDICTED: cyclin-P3-1                             145   1e-37   
ref|XP_007139676.1|  hypothetical protein PHAVU_008G049600g             144   2e-37   
gb|KDP22483.1|  hypothetical protein JCGZ_26314                         144   2e-37   
ref|XP_004515319.1|  PREDICTED: cyclin-U4-1-like                        144   3e-37   
gb|AFK41945.1|  unknown                                                 144   3e-37   
ref|XP_008777890.1|  PREDICTED: cyclin-U1-1                             140   4e-37   
emb|CDP15519.1|  unnamed protein product                                143   8e-37   
ref|XP_006397655.1|  hypothetical protein EUTSA_v10001641mg             142   8e-37   
ref|XP_011085729.1|  PREDICTED: cyclin-U4-1                             142   9e-37   
gb|KDP21459.1|  hypothetical protein JCGZ_21930                         142   1e-36   
ref|XP_006490025.1|  PREDICTED: cyclin-U4-1-like                        142   1e-36   
ref|XP_010246095.1|  PREDICTED: cyclin-U4-1-like                        141   2e-36   
ref|XP_006851092.1|  hypothetical protein AMTR_s00025p00245040          142   2e-36   
gb|KDP23522.1|  hypothetical protein JCGZ_23355                         142   2e-36   
ref|XP_009600659.1|  PREDICTED: cyclin-P3-1-like                        142   2e-36   
ref|XP_007218421.1|  hypothetical protein PRUPE_ppa011572mg             141   2e-36   
gb|KFK37277.1|  hypothetical protein AALP_AA4G236200                    141   2e-36   
ref|XP_008343752.1|  PREDICTED: cyclin-U4-1-like                        141   3e-36   
gb|KHN31107.1|  Cyclin-U4-1                                             140   4e-36   
ref|XP_006444072.1|  hypothetical protein CICLE_v10021982mg             141   4e-36   
gb|KHN12243.1|  Cyclin-U4-1                                             140   4e-36   
ref|XP_004307245.1|  PREDICTED: cyclin-U4-1-like                        140   5e-36   
ref|XP_002520742.1|  cyclin-dependent protein kinase, putative          140   5e-36   Ricinus communis
ref|NP_001235331.1|  uncharacterized protein LOC100305689               140   5e-36   
ref|XP_006444071.1|  hypothetical protein CICLE_v10021982mg             141   6e-36   
ref|XP_002511026.1|  cyclin-dependent protein kinase, putative          140   6e-36   Ricinus communis
ref|XP_003529016.1|  PREDICTED: cyclin-U4-1-like                        140   7e-36   
ref|XP_009800863.1|  PREDICTED: cyclin-U4-1                             139   1e-35   
ref|XP_009387832.1|  PREDICTED: cyclin-P3-1-like                        140   1e-35   
ref|XP_009760207.1|  PREDICTED: cyclin-P3-1-like isoform X5             140   1e-35   
ref|XP_010684268.1|  PREDICTED: cyclin-P3-1-like                        140   1e-35   
ref|XP_006445448.1|  hypothetical protein CICLE_v10022279mg             139   1e-35   
ref|XP_002526473.1|  cyclin-dependent protein kinase, putative          139   1e-35   Ricinus communis
ref|XP_006838523.1|  hypothetical protein AMTR_s00002p00190080          139   1e-35   
ref|XP_010258734.1|  PREDICTED: cyclin-U4-1-like                        138   2e-35   
gb|ACU24636.1|  unknown                                                 138   2e-35   Glycine max [soybeans]
ref|XP_009760205.1|  PREDICTED: cyclin-P3-1-like isoform X4             140   2e-35   
gb|KHN22156.1|  Cyclin-U4-1                                             138   2e-35   
ref|XP_009760204.1|  PREDICTED: cyclin-P3-1-like isoform X3             140   3e-35   
ref|XP_006295023.1|  hypothetical protein CARUB_v10024094mg             138   3e-35   
gb|EYU46584.1|  hypothetical protein MIMGU_mgv1a013898mg                138   3e-35   
gb|KCW58844.1|  hypothetical protein EUGRSUZ_H01477                     139   3e-35   
gb|KDP28881.1|  hypothetical protein JCGZ_14652                         138   3e-35   
ref|XP_006349678.1|  PREDICTED: cyclin-P3-1-like isoform X2             138   3e-35   
ref|XP_010109140.1|  hypothetical protein L484_017079                   138   3e-35   
ref|XP_004304998.1|  PREDICTED: cyclin-P3-1-like                        139   4e-35   
ref|XP_006376963.1|  hypothetical protein POPTR_0012s11610g             138   4e-35   
ref|XP_006349677.1|  PREDICTED: cyclin-P3-1-like isoform X1             138   4e-35   
emb|CDX83419.1|  BnaA03g20870D                                          137   4e-35   
ref|XP_009133684.1|  PREDICTED: cyclin-U4-1-like                        137   4e-35   
emb|CDY48257.1|  BnaC04g05160D                                          137   4e-35   
ref|XP_010938790.1|  PREDICTED: cyclin-P3-1-like isoform X1             139   4e-35   
ref|XP_003552477.1|  PREDICTED: cyclin-U4-1-like                        137   4e-35   
ref|XP_008246475.1|  PREDICTED: cyclin-P3-1                             137   4e-35   
ref|XP_009143062.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U4-1        137   4e-35   
ref|XP_007050616.1|  Cyclin p1,1 isoform 1                              138   4e-35   
ref|XP_010938791.1|  PREDICTED: cyclin-P3-1-like isoform X2             138   4e-35   
ref|XP_010089785.1|  hypothetical protein L484_008035                   138   4e-35   
ref|XP_009760202.1|  PREDICTED: cyclin-P3-1-like isoform X1             139   4e-35   
gb|KHN40524.1|  Cyclin-U4-1                                             137   5e-35   
ref|XP_006421507.1|  hypothetical protein CICLE_v10005725mg             139   5e-35   
ref|XP_010070213.1|  PREDICTED: cyclin-P3-1 isoform X2                  138   5e-35   
ref|XP_009760203.1|  PREDICTED: cyclin-P3-1-like isoform X2             139   5e-35   
ref|XP_004290653.1|  PREDICTED: cyclin-P3-1-like                        137   6e-35   
ref|XP_003636176.1|  Cyclin-U4-1                                        137   6e-35   
ref|XP_003624270.1|  Cyclin-dependent protein kinase regulator Pho80    137   6e-35   
ref|XP_010070212.1|  PREDICTED: cyclin-P3-1 isoform X1                  138   6e-35   
emb|CDY30482.1|  BnaA04g25830D                                          137   6e-35   
ref|XP_011003554.1|  PREDICTED: cyclin-U4-1-like                        138   7e-35   
ref|XP_008453846.1|  PREDICTED: cyclin-U4-1-like                        137   7e-35   
ref|XP_010524444.1|  PREDICTED: cyclin-U4-1                             137   7e-35   
ref|XP_010508257.1|  PREDICTED: cyclin-U4-1                             137   7e-35   
ref|XP_010506407.1|  PREDICTED: cyclin-U4-1-like                        137   7e-35   
emb|CDX74684.1|  BnaA05g04300D                                          137   7e-35   
ref|XP_010518078.1|  PREDICTED: cyclin-U4-1-like                        137   8e-35   
ref|NP_182002.1|  cyclin p4;1                                           137   8e-35   Arabidopsis thaliana [mouse-ear cress]
sp|Q0J9W0.2|CCP11_ORYSJ  RecName: Full=Cyclin-P1-1; Short=CycP1;1       139   9e-35   Oryza sativa Japonica Group [Japonica rice]
gb|EYU40342.1|  hypothetical protein MIMGU_mgv1a013920mg                137   9e-35   
ref|XP_009142278.1|  PREDICTED: cyclin-U4-1                             137   9e-35   
ref|XP_009355462.1|  PREDICTED: cyclin-P3-1-like                        137   1e-34   
ref|XP_004492903.1|  PREDICTED: cyclin-U4-1-like                        137   1e-34   
emb|CDX95612.1|  BnaC03g24930D                                          136   1e-34   
ref|XP_007030853.1|  Cyclin family protein, putative isoform 2          137   1e-34   
ref|XP_007200546.1|  hypothetical protein PRUPE_ppa011715mg             136   1e-34   
ref|XP_010552777.1|  PREDICTED: cyclin-U3-1                             137   1e-34   
ref|XP_010674760.1|  PREDICTED: cyclin-P3-1 isoform X2                  137   1e-34   
ref|XP_010674759.1|  PREDICTED: cyclin-P3-1 isoform X1                  137   1e-34   
ref|XP_002274682.1|  PREDICTED: cyclin-P3-1 isoform X1                  137   1e-34   Vitis vinifera
gb|EEC78069.1|  hypothetical protein OsI_17535                          138   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_010652114.1|  PREDICTED: cyclin-P3-1 isoform X2                  137   2e-34   
ref|XP_007218436.1|  hypothetical protein PRUPE_ppa011642mg             136   2e-34   
ref|XP_002278426.1|  PREDICTED: cyclin-U4-1                             135   2e-34   Vitis vinifera
ref|XP_002881978.1|  CYCP4_1                                            136   2e-34   
ref|XP_004148894.1|  PREDICTED: cyclin-P3-1-like                        136   2e-34   
ref|XP_007038242.1|  Cyclin p4,1                                        136   2e-34   
ref|XP_004145018.1|  PREDICTED: cyclin-U4-1-like                        136   2e-34   
ref|XP_010255964.1|  PREDICTED: cyclin-P3-1-like isoform X2             136   2e-34   
ref|XP_004160682.1|  PREDICTED: cyclin-U4-1-like                        136   2e-34   
ref|XP_009370411.1|  PREDICTED: cyclin-U4-1                             136   2e-34   
ref|XP_009592904.1|  PREDICTED: cyclin-U4-1                             135   2e-34   
ref|XP_011023596.1|  PREDICTED: cyclin-P3-1-like                        135   2e-34   
ref|XP_009389264.1|  PREDICTED: cyclin-P4-1                             135   3e-34   
ref|XP_008235285.1|  PREDICTED: cyclin-P3-1                             136   3e-34   
ref|XP_010255963.1|  PREDICTED: cyclin-P3-1-like isoform X1             136   3e-34   
emb|CDP09417.1|  unnamed protein product                                135   4e-34   
ref|XP_004158916.1|  PREDICTED: cyclin-P3-1-like isoform 1              136   4e-34   
ref|XP_011082555.1|  PREDICTED: cyclin-P3-1                             135   4e-34   
ref|XP_010942426.1|  PREDICTED: cyclin-P3-1-like                        135   4e-34   
ref|XP_004230189.1|  PREDICTED: cyclin-P3-1 isoform X1                  135   4e-34   
ref|XP_008368850.1|  PREDICTED: cyclin-P3-1-like                        135   4e-34   
ref|XP_008386497.1|  PREDICTED: cyclin-P3-1-like                        135   5e-34   
ref|XP_006386267.1|  hypothetical protein POPTR_0002s05370g             135   5e-34   
gb|KHG11686.1|  Cyclin-U4-1 -like protein                               135   6e-34   
ref|XP_004229728.1|  PREDICTED: cyclin-U4-1                             135   6e-34   
gb|EYU20163.1|  hypothetical protein MIMGU_mgv1a024090mg                134   6e-34   
ref|XP_006375761.1|  hypothetical protein POPTR_0013s02390g             134   6e-34   
ref|XP_010692026.1|  PREDICTED: cyclin-U4-1                             135   7e-34   
ref|XP_007052360.1|  Cyclin p4,1                                        134   8e-34   
ref|XP_006347995.1|  PREDICTED: cyclin-U4-1-like                        134   8e-34   
gb|KHG19596.1|  Cyclin-U4-1 -like protein                               134   9e-34   
gb|KHG18521.1|  Cyclin-U4-1 -like protein                               134   9e-34   
ref|XP_008232383.1|  PREDICTED: cyclin-U4-1-like                        134   1e-33   
ref|XP_006386269.1|  hypothetical protein POPTR_0002s05370g             135   1e-33   
ref|XP_006361848.1|  PREDICTED: cyclin-P3-1-like                        134   1e-33   
ref|XP_007208184.1|  hypothetical protein PRUPE_ppa020960mg             133   1e-33   
ref|XP_008343655.1|  PREDICTED: cyclin-U4-1-like                        134   1e-33   
gb|KHG14991.1|  Cyclin-U4-1 -like protein                               134   1e-33   
ref|XP_002302113.2|  hypothetical protein POPTR_0002s05370g             135   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_009627788.1|  PREDICTED: cyclin-P3-1                             134   1e-33   
ref|XP_009375368.1|  PREDICTED: cyclin-U4-1                             134   1e-33   
ref|XP_004493668.1|  PREDICTED: cyclin-P3-1-like                        134   1e-33   
ref|XP_006433309.1|  hypothetical protein CICLE_v10002472mg             134   1e-33   
ref|XP_008451358.1|  PREDICTED: cyclin-P3-1                             134   1e-33   
ref|XP_008362758.1|  PREDICTED: cyclin-U4-1-like                        134   2e-33   
ref|XP_010485974.1|  PREDICTED: cyclin-P3-1-like isoform X2             134   2e-33   
ref|XP_008375750.1|  PREDICTED: cyclin-U4-1                             133   2e-33   
ref|XP_004247165.1|  PREDICTED: cyclin-P3-1                             133   3e-33   
ref|XP_008245770.1|  PREDICTED: cyclin-U4-1-like                        133   3e-33   
ref|XP_004307773.1|  PREDICTED: cyclin-U4-1-like                        133   3e-33   
ref|XP_009760376.1|  PREDICTED: cyclin-U4-1-like                        133   3e-33   
ref|XP_010464054.1|  PREDICTED: cyclin-P3-1-like                        133   3e-33   
ref|XP_009804077.1|  PREDICTED: cyclin-P3-1                             133   3e-33   
ref|XP_010919767.1|  PREDICTED: cyclin-P4-1                             132   3e-33   
ref|XP_010277841.1|  PREDICTED: cyclin-P3-1-like                        133   4e-33   
ref|XP_009613666.1|  PREDICTED: cyclin-U4-1-like                        132   5e-33   
ref|XP_011079855.1|  PREDICTED: cyclin-P3-1-like                        132   5e-33   
ref|XP_006653792.1|  PREDICTED: cyclin-P1-1-like                        134   5e-33   
ref|XP_009363720.1|  PREDICTED: cyclin-U4-1-like                        132   7e-33   
ref|XP_007205921.1|  hypothetical protein PRUPE_ppa011614mg             131   8e-33   
ref|XP_007030852.1|  Cyclin family protein, putative isoform 1          133   9e-33   
ref|XP_006388184.1|  hypothetical protein POPTR_0296s00210g             131   1e-32   
ref|XP_006654367.1|  PREDICTED: cyclin-P3-1-like                        132   1e-32   
ref|XP_007162425.1|  hypothetical protein PHAVU_001G151100g             131   1e-32   
emb|CDY18791.1|  BnaAnng02560D                                          131   1e-32   
ref|XP_004962162.1|  PREDICTED: cyclin-P3-1-like                        132   2e-32   
gb|KHF97746.1|  Cyclin-P3-1                                             132   2e-32   
ref|XP_004976902.1|  PREDICTED: cyclin-P1-1-like                        132   2e-32   
ref|XP_006408089.1|  hypothetical protein EUTSA_v10021509mg             130   2e-32   
emb|CDY18769.1|  BnaAnng02340D                                          130   4e-32   
ref|XP_004167894.1|  PREDICTED: cyclin-U4-1-like                        129   4e-32   
ref|XP_009147251.1|  PREDICTED: cyclin-P3-1-like                        130   4e-32   
ref|XP_011076450.1|  PREDICTED: cyclin-U4-1-like                        129   4e-32   
ref|XP_002306774.1|  cyclin family protein                              130   5e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011084761.1|  PREDICTED: cyclin-U4-1-like isoform X1             129   5e-32   
ref|XP_003553729.1|  PREDICTED: cyclin-P3-1-like                        129   5e-32   
emb|CDY27777.1|  BnaA05g31860D                                          129   6e-32   
ref|XP_002271136.1|  PREDICTED: cyclin-U4-1                             129   6e-32   Vitis vinifera
ref|XP_004146934.1|  PREDICTED: cyclin-U4-1-like                        129   6e-32   
ref|NP_001149845.1|  LOC100283473                                       130   7e-32   Zea mays [maize]
gb|ACG36976.1|  PREG-like protein                                       130   7e-32   Zea mays [maize]
gb|EEE63644.1|  hypothetical protein OsJ_18461                          130   8e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79180.1|  hypothetical protein OsI_19875                          130   8e-32   Oryza sativa Indica Group [Indian rice]
sp|Q75HV0.1|CCP31_ORYSJ  RecName: Full=Cyclin-P3-1; Short=CycP3;1       130   8e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006374594.1|  hypothetical protein POPTR_0015s12380g             129   8e-32   
gb|AFK44566.1|  unknown                                                 129   1e-31   
ref|XP_010043088.1|  PREDICTED: cyclin-P3-1-like isoform X2             129   1e-31   
ref|XP_011040341.1|  PREDICTED: cyclin-U4-1-like isoform X1             128   1e-31   
gb|EYU31943.1|  hypothetical protein MIMGU_mgv1a013240mg                129   1e-31   
gb|AFK40008.1|  unknown                                                 129   1e-31   
gb|AFK44207.1|  unknown                                                 129   1e-31   
gb|KHG04231.1|  Cyclin-U2-2 -like protein                               129   1e-31   
ref|XP_006576896.1|  PREDICTED: cyclin-P3-1-like isoform X1             129   2e-31   
ref|XP_006368127.1|  PREDICTED: cyclin-P3-1-like                        127   2e-31   
ref|XP_010043087.1|  PREDICTED: cyclin-P3-1-like isoform X1             129   2e-31   
ref|XP_011032712.1|  PREDICTED: cyclin-P3-1-like isoform X2             128   2e-31   
ref|XP_008794908.1|  PREDICTED: cyclin-P4-1                             128   2e-31   
emb|CAJ86211.1|  H0323C08.1                                             130   2e-31   Oryza sativa [red rice]
ref|XP_006298431.1|  hypothetical protein CARUB_v10014501mg             129   2e-31   
ref|XP_011032710.1|  PREDICTED: cyclin-P3-1-like isoform X1             128   2e-31   
ref|XP_004133942.1|  PREDICTED: cyclin-U4-1-like                        128   2e-31   
ref|XP_009362721.1|  PREDICTED: cyclin-U4-1-like                        127   3e-31   
ref|XP_010934119.1|  PREDICTED: cyclin-P4-1-like                        127   4e-31   
ref|XP_007147054.1|  hypothetical protein PHAVU_006G092300g             126   4e-31   
ref|XP_003554251.1|  PREDICTED: cyclin-P3-1-like                        128   4e-31   
ref|XP_006366726.1|  PREDICTED: cyclin-U4-1-like                        127   5e-31   
ref|NP_001030642.1|  cyclin family protein                              127   5e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KDP28804.1|  hypothetical protein JCGZ_14575                         127   5e-31   
ref|XP_009124076.1|  PREDICTED: cyclin-P3-1-like isoform X1             127   6e-31   
emb|CDP05394.1|  unnamed protein product                                126   6e-31   
ref|XP_009124077.1|  PREDICTED: cyclin-P3-1-like isoform X2             127   7e-31   
ref|XP_008812796.1|  PREDICTED: cyclin-P3-1-like                        127   7e-31   
emb|CDP03631.1|  unnamed protein product                                127   7e-31   
ref|XP_008438223.1|  PREDICTED: cyclin-U4-1                             126   8e-31   
gb|ACJ84821.1|  unknown                                                 127   8e-31   Medicago truncatula
ref|XP_008802822.1|  PREDICTED: cyclin-U2-2-like                        127   8e-31   
gb|AFK40409.1|  unknown                                                 126   8e-31   
ref|XP_002884502.1|  hypothetical protein ARALYDRAFT_477821             126   9e-31   
gb|EMS61422.1|  hypothetical protein TRIUR3_30801                       127   1e-30   
gb|ACU23185.1|  unknown                                                 127   1e-30   
ref|XP_003572092.2|  PREDICTED: cyclin-P4-1-like                        126   1e-30   
ref|XP_010485972.1|  PREDICTED: cyclin-P3-1-like isoform X1             126   1e-30   
ref|XP_002511648.1|  Nuc-1 negative regulatory protein preg, puta...    126   1e-30   
ref|XP_002467475.1|  hypothetical protein SORBIDRAFT_01g028810          127   1e-30   
gb|KEH23760.1|  cyclin p4                                               126   1e-30   
ref|XP_006347912.1|  PREDICTED: cyclin-U2-2-like                        126   2e-30   
ref|XP_006382603.1|  hypothetical protein POPTR_0005s03660g             125   2e-30   
emb|CDP09478.1|  unnamed protein product                                126   2e-30   
ref|XP_010091558.1|  hypothetical protein L484_000801                   125   2e-30   
ref|XP_002441059.1|  hypothetical protein SORBIDRAFT_09g019600          126   2e-30   
ref|XP_011026170.1|  PREDICTED: cyclin-P3-1                             125   3e-30   
ref|XP_004139180.1|  PREDICTED: cyclin-P3-1-like                        125   3e-30   
ref|XP_004156423.1|  PREDICTED: cyclin-P3-1-like                        125   3e-30   
ref|NP_001065406.1|  Os10g0563900                                       124   4e-30   
ref|XP_004983624.1|  PREDICTED: cyclin-P4-1-like                        125   4e-30   
emb|CDX70040.1|  BnaA10g23890D                                          124   4e-30   
ref|NP_196362.1|  cyclin p4;3                                           124   5e-30   
ref|XP_008460076.1|  PREDICTED: cyclin-U4-1-like                        127   5e-30   
ref|XP_009389583.1|  PREDICTED: cyclin-P4-1-like                        124   5e-30   
gb|EPS72561.1|  hypothetical protein M569_02197                         122   6e-30   
ref|XP_009400236.1|  PREDICTED: cyclin-P4-1-like                        124   6e-30   
ref|XP_006838178.1|  hypothetical protein AMTR_s00106p00124350          124   7e-30   
tpg|DAA46330.1|  TPA: hypothetical protein ZEAMMB73_464167              124   8e-30   
dbj|BAJ89048.1|  predicted protein                                      125   8e-30   
ref|XP_010312651.1|  PREDICTED: cyclin-P3-1 isoform X2                  122   9e-30   
ref|XP_010443988.1|  PREDICTED: cyclin-U4-3-like                        124   1e-29   
dbj|BAJ87584.1|  predicted protein                                      125   1e-29   
ref|XP_010692155.1|  PREDICTED: cyclin-U2-1                             123   1e-29   
ref|XP_011017452.1|  PREDICTED: cyclin-U2-1-like                        123   1e-29   
ref|XP_010546128.1|  PREDICTED: cyclin-U4-3-like                        123   2e-29   
ref|XP_004306960.1|  PREDICTED: cyclin-U2-1-like                        123   2e-29   
ref|XP_009122338.1|  PREDICTED: cyclin-U4-2                             123   2e-29   
emb|CDY65234.1|  BnaC09g47870D                                          123   2e-29   
ref|XP_007221195.1|  hypothetical protein PRUPE_ppa024897mg             123   2e-29   
ref|XP_008232567.1|  PREDICTED: cyclin-U2-1                             123   2e-29   
gb|ABK92673.1|  unknown                                                 122   2e-29   
ref|XP_008786194.1|  PREDICTED: cyclin-P4-1                             122   2e-29   
gb|KHG29326.1|  Cyclin-U2-1 -like protein                               123   2e-29   
ref|XP_010264310.1|  PREDICTED: cyclin-U2-2-like isoform X1             122   3e-29   
ref|XP_010544609.1|  PREDICTED: cyclin-U2-1-like                        122   3e-29   
ref|XP_009782728.1|  PREDICTED: cyclin-U2-2-like                        122   3e-29   
ref|XP_011090176.1|  PREDICTED: cyclin-U2-1-like                        122   3e-29   
ref|XP_002301262.1|  hypothetical protein POPTR_0002s14440g             122   3e-29   
ref|XP_002873308.1|  CYCP4_3                                            122   3e-29   
ref|XP_010934125.1|  PREDICTED: cyclin-P4-1                             122   4e-29   
emb|CDY08862.1|  BnaA06g23620D                                          122   4e-29   
ref|XP_004235192.1|  PREDICTED: cyclin-U4-1                             121   4e-29   
ref|XP_010544563.1|  PREDICTED: cyclin-U4-1-like                        121   5e-29   
ref|XP_010457595.1|  PREDICTED: cyclin-U4-3                             122   5e-29   
ref|XP_009604946.1|  PREDICTED: cyclin-U2-2-like                        122   5e-29   
ref|XP_009344074.1|  PREDICTED: cyclin-U2-1-like isoform X1             122   5e-29   
ref|XP_004229782.1|  PREDICTED: cyclin-U2-1-like                        122   6e-29   
ref|XP_006445331.1|  hypothetical protein CICLE_v10024289mg             121   7e-29   
dbj|BAJ91153.1|  predicted protein                                      123   7e-29   
ref|XP_010483846.1|  PREDICTED: cyclin-U4-3-like                        121   9e-29   
ref|XP_006291787.1|  hypothetical protein CARUB_v10017957mg             121   9e-29   
ref|XP_002320709.1|  hypothetical protein POPTR_0014s06180g             121   1e-28   
ref|XP_003568501.1|  PREDICTED: cyclin-P3-1                             121   1e-28   
ref|XP_008375805.1|  PREDICTED: cyclin-U2-1-like isoform X1             121   1e-28   
ref|XP_007140811.1|  hypothetical protein PHAVU_008G144200g             120   1e-28   
ref|XP_009116735.1|  PREDICTED: cyclin-U2-2                             120   2e-28   
ref|XP_011033883.1|  PREDICTED: cyclin-U2-2-like                        120   2e-28   
ref|XP_004514236.1|  PREDICTED: cyclin-U2-2-like                        120   2e-28   
ref|XP_009398116.1|  PREDICTED: cyclin-P2-1-like                        120   3e-28   
ref|XP_007052178.1|  Cyclin p3,2                                        120   3e-28   
ref|NP_191871.1|  cyclin p1;1                                           120   3e-28   
gb|AAM64958.1|  unknown                                                 119   3e-28   
ref|XP_010919573.1|  PREDICTED: cyclin-U2-2-like                        120   3e-28   
ref|XP_004952051.1|  PREDICTED: cyclin-P4-1-like                        120   4e-28   
gb|ACJ84839.1|  unknown                                                 119   4e-28   
ref|XP_002275585.1|  PREDICTED: cyclin-U2-1                             119   5e-28   
ref|XP_002876566.1|  CYCP3_2                                            119   8e-28   
ref|XP_011081410.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U2-1-...    118   9e-28   
ref|XP_009136505.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U4-3        118   9e-28   
ref|XP_006394483.1|  hypothetical protein EUTSA_v10005388mg             118   1e-27   
ref|XP_010258918.1|  PREDICTED: cyclin-U2-1                             118   1e-27   
ref|XP_009143100.1|  PREDICTED: cyclin-U2-1                             118   1e-27   
ref|XP_008454704.1|  PREDICTED: cyclin-P3-1                             118   1e-27   
emb|CDY18953.1|  BnaC04g03970D                                          118   1e-27   
gb|EMT04744.1|  hypothetical protein F775_06753                         118   1e-27   
ref|XP_002862353.1|  CYCP4_2                                            118   1e-27   
emb|CDY41156.1|  BnaA09g38590D                                          118   1e-27   
ref|XP_001702428.1|  U-type cyclin                                      114   2e-27   
ref|XP_002956581.1|  cyclin                                             120   2e-27   
ref|XP_010264309.1|  PREDICTED: cyclin-U2-1-like                        118   2e-27   
emb|CBI36766.3|  unnamed protein product                                117   2e-27   
ref|XP_006291814.1|  hypothetical protein CARUB_v10017991mg             117   2e-27   
gb|KFK37958.1|  hypothetical protein AALP_AA3G051800                    117   2e-27   
ref|XP_010258919.1|  PREDICTED: cyclin-U2-1-like                        117   2e-27   
gb|KFK37301.1|  hypothetical protein AALP_AA4G239500                    117   2e-27   
dbj|BAJ86315.1|  predicted protein                                      117   2e-27   
gb|EMS49132.1|  hypothetical protein TRIUR3_24170                       120   3e-27   
ref|XP_006288646.1|  hypothetical protein CARUB_v10001951mg             117   3e-27   
ref|XP_010523281.1|  PREDICTED: cyclin-U4-2-like                        116   3e-27   
ref|XP_003570865.1|  PREDICTED: cyclin-P4-1-like                        118   3e-27   
ref|XP_006397689.1|  hypothetical protein EUTSA_v10001623mg             117   4e-27   
ref|NP_200973.1|  CYCLIN P4;2                                           117   4e-27   
gb|EMT31645.1|  hypothetical protein F775_30140                         117   4e-27   
ref|XP_008669070.1|  PREDICTED: cyclin-P4-1-like                        116   4e-27   
ref|XP_009133697.1|  PREDICTED: cyclin-U2-1-like                        116   6e-27   
ref|XP_006662071.1|  PREDICTED: cyclin-P4-1-like                        116   6e-27   
ref|XP_002447148.1|  hypothetical protein SORBIDRAFT_06g029420          117   6e-27   
ref|XP_002280845.2|  PREDICTED: cyclin-P3-1                             116   6e-27   
ref|XP_006294970.1|  hypothetical protein CARUB_v10024026mg             116   7e-27   
ref|XP_010508213.1|  PREDICTED: cyclin-U2-1-like                        116   7e-27   
ref|XP_010512719.1|  PREDICTED: cyclin-U3-1-like                        116   7e-27   
emb|CDX95626.1|  BnaC03g25070D                                          116   7e-27   
ref|XP_010506446.1|  PREDICTED: cyclin-U2-1                             115   8e-27   
ref|NP_191614.1|  cyclin p3;2                                           115   9e-27   
gb|ACU13246.1|  unknown                                                 115   1e-26   
ref|XP_010056430.1|  PREDICTED: cyclin-U2-1-like                        115   1e-26   
ref|XP_003517014.1|  PREDICTED: cyclin-U2-1-like                        115   1e-26   
ref|XP_006279771.1|  hypothetical protein CARUB_v10027784mg             115   1e-26   
ref|XP_010469167.1|  PREDICTED: cyclin-U2-2-like                        115   1e-26   
ref|XP_010524404.1|  PREDICTED: cyclin-U2-2                             115   1e-26   
gb|KHM99414.1|  Cyclin-U2-1                                             115   2e-26   
ref|XP_002878497.1|  hypothetical protein ARALYDRAFT_486815             115   2e-26   
ref|XP_010264311.1|  PREDICTED: cyclin-U2-2-like isoform X2             114   2e-26   
ref|XP_010413544.1|  PREDICTED: cyclin-U2-2-like                        115   2e-26   
ref|XP_010491362.1|  PREDICTED: cyclin-U4-2-like                        114   2e-26   
ref|XP_010089246.1|  hypothetical protein L484_021775                   115   2e-26   
ref|XP_007134728.1|  hypothetical protein PHAVU_010G070800g             114   2e-26   
ref|XP_010452710.1|  PREDICTED: cyclin-U4-2-like                        114   3e-26   
ref|XP_010423207.1|  PREDICTED: cyclin-U4-2-like                        114   3e-26   
ref|XP_003605284.1|  Cyclin-U2-1                                        114   3e-26   
ref|XP_010468884.1|  PREDICTED: cyclin-U3-1                             114   4e-26   
ref|XP_010512385.1|  PREDICTED: cyclin-U2-2                             114   4e-26   
gb|EMS63928.1|  hypothetical protein TRIUR3_31342                       115   5e-26   
emb|CBI32332.3|  unnamed protein product                                113   5e-26   
gb|KHG29431.1|  Cyclin-U4-1 -like protein                               112   5e-26   
gb|ACJ85224.1|  unknown                                                 113   5e-26   
gb|EMT12283.1|  hypothetical protein F775_15957                         113   6e-26   
gb|ACG23927.1|  nuc-1 negative regulatory protein preg                  113   6e-26   
ref|XP_009344075.1|  PREDICTED: cyclin-U2-1-like isoform X2             113   7e-26   
ref|XP_010518122.1|  PREDICTED: cyclin-U2-1-like                        113   8e-26   
gb|KDO56332.1|  hypothetical protein CISIN_1g045984mg                   110   8e-26   
gb|KFK35259.1|  hypothetical protein AALP_AA5G262100                    112   1e-25   
ref|XP_002448263.1|  hypothetical protein SORBIDRAFT_06g024180          112   1e-25   
ref|XP_008375806.1|  PREDICTED: cyclin-U2-1-like isoform X2             112   2e-25   
gb|KHN05788.1|  Cyclin-U2-1                                             112   2e-25   
ref|XP_008459728.1|  PREDICTED: cyclin-U2-1                             114   2e-25   
ref|NP_182034.1|  cyclin p3;1                                           112   2e-25   
ref|XP_010413196.1|  PREDICTED: cyclin-U3-1-like                        112   2e-25   
ref|XP_002880155.1|  CYCP3_1                                            112   2e-25   
ref|XP_009104271.1|  PREDICTED: cyclin-U2-2-like                        111   2e-25   
ref|XP_004504529.1|  PREDICTED: cyclin-U2-1-like                        111   3e-25   
gb|AFW69940.1|  nuc-1 negative regulatory protein preg                  112   3e-25   
emb|CDX67834.1|  BnaA07g18740D                                          111   3e-25   
gb|KDO57284.1|  hypothetical protein CISIN_1g0277331mg                  108   4e-25   
emb|CDX71800.1|  BnaC08g30740D                                          111   4e-25   
ref|NP_001151114.1|  cyclin-dependent protein kinase                    112   6e-25   
emb|CBN76823.1|  conserved unknown protein                              110   6e-25   
ref|XP_004164976.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U2-1-...    110   7e-25   
dbj|BAJ89972.1|  predicted protein                                      110   7e-25   
ref|XP_004140492.1|  PREDICTED: cyclin-U2-1-like                        110   8e-25   
emb|CDX98427.1|  BnaC06g17880D                                          110   8e-25   
gb|AAF27039.1|AC009177_29  hypothetical protein                         114   2e-24   
ref|XP_009116978.1|  PREDICTED: cyclin-U3-1                             109   2e-24   
ref|XP_002186459.1|  predicted protein                                  107   2e-24   
dbj|BAD08008.1|  PREG-like protein                                      109   3e-24   
ref|XP_002862291.1|  predicted protein                                  105   3e-24   
ref|XP_006402307.1|  hypothetical protein EUTSA_v10006204mg             108   5e-24   
gb|EMT32586.1|  hypothetical protein F775_21459                         107   5e-24   
ref|XP_004976447.1|  PREDICTED: cyclin-P2-1-like                        107   7e-24   
ref|XP_006375760.1|  hypothetical protein POPTR_0013s02390g             105   7e-24   
emb|CDX76682.1|  BnaC08g32680D                                          107   1e-23   
emb|CCC54006.1|  cyclin 2                                               105   1e-23   
gb|KDO39778.1|  hypothetical protein CISIN_1g039330mg                   106   1e-23   
dbj|BAK01932.1|  predicted protein                                      105   3e-23   
ref|XP_003519057.1|  PREDICTED: cyclin-U4-1-like                        102   4e-23   
ref|NP_001053503.1|  Os04g0552300                                       104   8e-23   
ref|XP_006402570.1|  hypothetical protein EUTSA_v10006220mg             104   1e-22   
gb|EJK44168.1|  hypothetical protein THAOC_37318                        107   1e-22   
ref|XP_009760210.1|  PREDICTED: cyclin-P3-1-like isoform X7             103   2e-22   
ref|XP_001443436.1|  hypothetical protein                               101   3e-22   
ref|XP_005831237.1|  hypothetical protein GUITHDRAFT_43885              100   3e-22   
ref|XP_002289712.1|  predicted protein                                  108   4e-22   
ref|XP_006599134.1|  PREDICTED: cyclin-U4-1-like isoform X1             101   4e-22   
ref|XP_005830860.1|  hypothetical protein GUITHDRAFT_87677              103   4e-22   
ref|XP_009039561.1|  hypothetical protein AURANDRAFT_54525              101   6e-22   
ref|XP_009760209.1|  PREDICTED: cyclin-P3-1-like isoform X6             102   7e-22   
emb|CDM81206.1|  unnamed protein product                                102   7e-22   
gb|EFW47511.2|  cyclin                                                  106   9e-22   
emb|CCI49379.1|  unnamed protein product                                102   1e-21   
ref|XP_004346122.1|  cyclin                                             106   1e-21   
gb|EAS03399.2|  amine-terminal domain cyclin                            100   1e-21   
ref|XP_010240469.1|  PREDICTED: uncharacterized protein LOC100832607    103   2e-21   
emb|CDY05158.1|  BnaC05g46450D                                          102   2e-21   
gb|EYU40931.1|  hypothetical protein MIMGU_mgv1a0134081mg             98.2    3e-21   
ref|XP_010425982.1|  PREDICTED: cyclin-P3-1                           98.2    3e-21   
dbj|BAJ86100.1|  predicted protein                                      100   3e-21   
ref|NP_001141658.1|  uncharacterized protein LOC100273783             97.8    3e-21   
ref|XP_001023644.1|  Cyclin, N-terminal domain containing protein       102   4e-21   
ref|XP_005709101.1|  cyclin-dependent protein kinase, putative          102   4e-21   
ref|XP_001433127.1|  hypothetical protein                             98.2    5e-21   
ref|XP_004956426.1|  PREDICTED: cyclin-P4-1-like                      99.8    6e-21   
emb|CDY02124.1|  BnaA03g40430D                                        96.3    6e-21   
ref|XP_001434955.1|  hypothetical protein                             97.4    7e-21   
ref|XP_006652616.1|  PREDICTED: cyclin-P2-1-like                      99.4    7e-21   
ref|XP_008875754.1|  hypothetical protein H310_11003                    100   8e-21   
ref|XP_005855406.1|  hypothetical protein NGA_2092720                   103   8e-21   
ref|XP_001453130.1|  hypothetical protein                             97.4    8e-21   
ref|XP_002259631.1|  cyclin2 related protein                          99.8    8e-21   
gb|EWM24594.1|  cyclin-dependent protein                                103   8e-21   
ref|XP_003569998.1|  PREDICTED: cyclin-P4-1-like                      98.6    1e-20   
ref|XP_003580261.1|  PREDICTED: cyclin-P4-1-like                      98.6    1e-20   
emb|CCA25579.1|  conserved hypothetical protein                       99.0    1e-20   
ref|XP_008610721.1|  hypothetical protein SDRG_06701                  99.0    2e-20   
ref|XP_001434000.1|  hypothetical protein                             96.7    2e-20   
gb|KDO30023.1|  hypothetical protein SPRG_05213                       99.0    2e-20   
ref|XP_008669050.1|  PREDICTED: cyclin-P2-1                           98.2    2e-20   
ref|XP_001440639.1|  hypothetical protein                             96.3    2e-20   
gb|EEC72391.1|  hypothetical protein OsI_05672                        98.6    2e-20   
ref|XP_004222830.1|  cyclin2 related protein                          98.2    3e-20   
ref|XP_743964.1|  cyclin2 related protein                             97.4    3e-20   
ref|XP_001613773.1|  cyclin2 related protein                          97.8    3e-20   
ref|XP_008815154.1|  hypothetical protein C922_01326                  97.8    3e-20   
ref|XP_001450302.1|  hypothetical protein                             97.1    3e-20   
ref|XP_008623573.1|  hypothetical protein YYE_01673                   97.1    3e-20   
ref|NP_001183837.1|  hypothetical protein                             97.4    3e-20   



>ref|XP_009782196.1| PREDICTED: cyclin-U1-1 [Nicotiana sylvestris]
Length=235

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 166/203 (82%), Gaps = 11/203 (5%)
 Frame = +1

Query  43   MLEEG---DNHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTD  213
            ML+EG   D H    P  +  +T TPRVLTILS VLEKLVARND+L L   D G  +N  
Sbjct  1    MLDEGGSDDFHRRPEPPSTAIDTTTPRVLTILSYVLEKLVARNDQLMLDHHDNGLASN--  58

Query  214  GGsssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLA  393
            GG        G  LGK+ +AFHGVRAPSISIPKY+ER+YKYTNCSPSCFVVGYVY+DRL 
Sbjct  59   GGE------VGAVLGKNFNAFHGVRAPSISIPKYLERLYKYTNCSPSCFVVGYVYIDRLG  112

Query  394  HKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfll  573
            HKYP+SL++SLNVHRLLVTCVMVASK+LDD HYNNAF+ARVGGV+NAELNKLE+ELLFLL
Sbjct  113  HKYPDSLLVSLNVHRLLVTCVMVASKMLDDAHYNNAFYARVGGVTNAELNKLELELLFLL  172

Query  574  DFGVSVSSQVFECYCQHLDKEIL  642
            DFGV+VSS+VFE YCQ+L+KE+L
Sbjct  173  DFGVNVSSRVFESYCQYLEKEML  195



>ref|XP_002515728.1| Nuc-1 negative regulatory protein preg, putative [Ricinus communis]
 gb|EEF46675.1| Nuc-1 negative regulatory protein preg, putative [Ricinus communis]
Length=230

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 157/189 (83%), Gaps = 12/189 (6%)
 Frame = +1

Query  79   PGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGF-RL  255
            P PSQ E  TPRVLTILS+V+EKLV RNDRL       G  +  DG       S+G   L
Sbjct  15   PEPSQSEQTTPRVLTILSTVIEKLVTRNDRLV-----DGLSHRVDG------MSSGLTHL  63

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
            GKSL+AFHGVRAP+ISIPKY+ER+YKYTNCSPSCFVVGYVY+DRL HK+P+SLVISLNVH
Sbjct  64   GKSLNAFHGVRAPTISIPKYLERLYKYTNCSPSCFVVGYVYIDRLLHKHPDSLVISLNVH  123

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLLVT VMVASK+LDD HYNNAF+A+VGGVSNAELN+LEIELLFLLDFGV VSS++FE Y
Sbjct  124  RLLVTSVMVASKVLDDVHYNNAFYAKVGGVSNAELNRLEIELLFLLDFGVMVSSRIFESY  183

Query  616  CQHLDKEIL  642
            C HL+KE+L
Sbjct  184  CLHLEKEML  192



>ref|XP_007043344.1| Cyclin p2,1 isoform 1 [Theobroma cacao]
 ref|XP_007043346.1| Cyclin p2,1 isoform 1 [Theobroma cacao]
 gb|EOX99175.1| Cyclin p2,1 isoform 1 [Theobroma cacao]
 gb|EOX99177.1| Cyclin p2,1 isoform 1 [Theobroma cacao]
Length=232

 Score =   248 bits (633),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 159/189 (84%), Gaps = 14/189 (7%)
 Frame = +1

Query  85   PSQPETATPRVLTILSSVLEKLVARNDRLALLC---LDGGTPNNTDGGsssssssAGFRL  255
            P+Q ET TPRVLTI+SSVLEKLVARND+L  +    LDG   + + G           RL
Sbjct  17   PTQAETTTPRVLTIISSVLEKLVARNDKLVEVLSEQLDGLNCHGSSG-----------RL  65

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
            GKSL AFHGVRAP+ISIPKY+ERIYKYTNCSPSCFVVGYVY+DRLAHK+P+SLVISLNVH
Sbjct  66   GKSLHAFHGVRAPNISIPKYLERIYKYTNCSPSCFVVGYVYIDRLAHKHPDSLVISLNVH  125

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLLVT VMVASK+LDD HYNNA +ARVGGV+NAELN+LE+ELLFLLDFGV+VSS+VFE Y
Sbjct  126  RLLVTSVMVASKMLDDVHYNNAVYARVGGVTNAELNRLELELLFLLDFGVTVSSRVFENY  185

Query  616  CQHLDKEIL  642
            C HL+KE+L
Sbjct  186  CLHLEKEML  194



>ref|XP_009601525.1| PREDICTED: cyclin-U1-1 [Nicotiana tomentosiformis]
Length=235

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 165/205 (80%), Gaps = 13/205 (6%)
 Frame = +1

Query  43   MLEEG-DNHFPALPGPSQP--ETATPRVLTILSSVLEKLVARNDRLALLCLDGG-TPNNT  210
            ML+EG  + F   P P     +T TPRVLTILS VLEKLVARND+L L   D G T N  
Sbjct  1    MLDEGGSDEFHRRPEPPSTAIDTTTPRVLTILSYVLEKLVARNDQLMLDHHDNGLTSNGG  60

Query  211  DGGsssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRL  390
            +GG           LGK+ +AFHGVRAPSISIPKY+ER+YKYTNCSPSCFVVGYVY+DRL
Sbjct  61   EGGPV---------LGKNFNAFHGVRAPSISIPKYLERLYKYTNCSPSCFVVGYVYIDRL  111

Query  391  AHKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfl  570
             HKYP+SL++SLNVHRLLVTCVMVASK+LDD HYNNAF+ARVGGV+N ELN+LE+ELLFL
Sbjct  112  GHKYPDSLLVSLNVHRLLVTCVMVASKMLDDAHYNNAFYARVGGVTNEELNRLELELLFL  171

Query  571  lDFGVSVSSQVFECYCQHLDKEILQ  645
            LDFGV+VSS+VFE YCQ+L+KE+L 
Sbjct  172  LDFGVNVSSRVFESYCQYLEKEMLS  196



>ref|XP_004243454.1| PREDICTED: cyclin-U1-1 [Solanum lycopersicum]
Length=241

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 164/205 (80%), Gaps = 12/205 (6%)
 Frame = +1

Query  43   MLEEG-DNHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPN----N  207
            ML EG  + F   P PS  + ATPRVLTILS VLEKLVARND+L LL    G  N    N
Sbjct  1    MLHEGGSDEFHRRPDPSADDVATPRVLTILSYVLEKLVARNDQLLLLGRQVGHDNELMSN  60

Query  208  TDGGsssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDR  387
              GG           LGK+ +AFHGVRAP+ISIPKY+ER+YKYTNCSPSCFVVGYVY+DR
Sbjct  61   GAGGPRRV-------LGKNFNAFHGVRAPNISIPKYLERLYKYTNCSPSCFVVGYVYIDR  113

Query  388  LAHKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellf  567
            L HKYP+SL++SLNVHRLLVT VMVASK+LDD HYNNAF+ARVGGVSNAELNKLE+ELLF
Sbjct  114  LGHKYPDSLLVSLNVHRLLVTSVMVASKMLDDAHYNNAFYARVGGVSNAELNKLELELLF  173

Query  568  llDFGVSVSSQVFECYCQHLDKEIL  642
            LLDFGV++S++VFE YCQ+L++E+L
Sbjct  174  LLDFGVNMSARVFESYCQYLEREML  198



>emb|CDP11817.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 159/191 (83%), Gaps = 7/191 (4%)
 Frame = +1

Query  76   LPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL  255
            +P PSQ E   PRVLTILS VLEKLVARND+L  L    G+ N +       + +A ++L
Sbjct  23   VPEPSQDEPTLPRVLTILSHVLEKLVARNDQLVQL----GSQNQSQ--QKWINETASYQL  76

Query  256  -GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNV  432
             GKSL  F GVRAPSISI KY+ERIYKYTNCSPSCFVVGYVY+DRL HKYP+SLV+SLNV
Sbjct  77   AGKSLKGFDGVRAPSISIGKYMERIYKYTNCSPSCFVVGYVYIDRLVHKYPDSLVVSLNV  136

Query  433  HRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFEC  612
            HRLLVTCVMVASK+LDD HYNNA +ARVGGV+NAELN+LE+ELLFLLDFGV++SSQVFE 
Sbjct  137  HRLLVTCVMVASKMLDDVHYNNAIYARVGGVTNAELNRLELELLFLLDFGVTISSQVFEI  196

Query  613  YCQHLDKEILQ  645
            YCQHL+KE+L+
Sbjct  197  YCQHLEKEMLR  207



>gb|KHG13275.1| Cyclin-U1-1 -like protein [Gossypium arboreum]
Length=223

 Score =   244 bits (624),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 178/232 (77%), Gaps = 17/232 (7%)
 Frame = +1

Query  43   MLEEGD--NHFPALPGPSQPETA-TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTD  213
            ML  GD   H    P P Q +T  TPRVLTI+SSVLEKLVARND+L  +  +       D
Sbjct  1    MLATGDYPTHPIRQPDPIQADTTPTPRVLTIISSVLEKLVARNDKLVEVLTE-----QPD  55

Query  214  GGsssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLA  393
            G +   + +    LGKSL+ FHGVRAP+ISIP Y+ERIYKYTNCSPSCFV+GYVY+DRLA
Sbjct  56   GLNLDRNGTISAPLGKSLNVFHGVRAPNISIPNYLERIYKYTNCSPSCFVLGYVYIDRLA  115

Query  394  HKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfll  573
            HK+P+SL++SLNVHRLLVTCVMVASK+LDD HYNNAF+ARVGGVSNAELN+LE+ELLFLL
Sbjct  116  HKHPDSLLVSLNVHRLLVTCVMVASKVLDDVHYNNAFYARVGGVSNAELNRLELELLFLL  175

Query  574  DFGVSVSSQVFECYCQHLDKEILQCNGIGADATIINIIQRGVE--ALDDDIT  723
            DFGV+VSSQVFE YC HL++E+L  NG+         ++RG+   A+D+ +T
Sbjct  176  DFGVAVSSQVFETYCFHLEQEML-INGVDQK------VERGISPVAVDEIVT  220



>gb|KDP25867.1| hypothetical protein JCGZ_22897 [Jatropha curcas]
Length=219

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 168/226 (74%), Gaps = 28/226 (12%)
 Frame = +1

Query  43   MLEEGDNHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGs  222
            ML  G+      P PS  E +TPRVLTILS+V+EKLVARND+L    +            
Sbjct  1    MLAAGELSVDRQPEPSHSEQSTPRVLTILSTVIEKLVARNDKLVRCIMSS----------  50

Query  223  ssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKY  402
                     R+GK L+AFHG+RAPSISIPKY+ER+YKYTNCSPSCFVVGYVY+DRL HK+
Sbjct  51   ---------RVGKRLNAFHGIRAPSISIPKYLERLYKYTNCSPSCFVVGYVYLDRLLHKH  101

Query  403  PNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFG  582
            P+SL+ISLNVHRLLVTCVMVASK+LDDEH +NAF+ARVGGVSNAELNKLEIELLFLLDFG
Sbjct  102  PDSLIISLNVHRLLVTCVMVASKMLDDEHCDNAFYARVGGVSNAELNKLEIELLFLLDFG  161

Query  583  VSVSSQVFECYCQHLDKEILQCNGIGADATIINIIQRGV--EALDD  714
            V VSS+ FE YC HL+KE+L  NG       I+ I+R +   +LDD
Sbjct  162  VMVSSRAFESYCLHLEKEML-LNG------SIHKIERAIPSNSLDD  200



>ref|XP_006447491.1| hypothetical protein CICLE_v10016515mg [Citrus clementina]
 ref|XP_006469719.1| PREDICTED: cyclin-U1-1-like [Citrus sinensis]
 gb|ESR60731.1| hypothetical protein CICLE_v10016515mg [Citrus clementina]
 gb|KDO59851.1| hypothetical protein CISIN_1g026696mg [Citrus sinensis]
Length=235

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 157/189 (83%), Gaps = 7/189 (4%)
 Frame = +1

Query  76   LPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL  255
            LP PSQ ET TPRVLTI++SV+EKLVARNDRLA    D  +   T G    S S+    +
Sbjct  14   LPEPSQNETTTPRVLTIIASVMEKLVARNDRLA----DSLSRQLTKGNGVFSGSTP---I  66

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
            G SL+ FHGVRAP+ISI KY+ERIYKYTNCSPSCFVVGYVY+DRL H++P+SLV+SLNVH
Sbjct  67   GTSLNTFHGVRAPNISIAKYLERIYKYTNCSPSCFVVGYVYIDRLLHRHPDSLVVSLNVH  126

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLLVT VMVASK +DD HYNNAF+ARVGGVSNAELN+LE+ELLFLLDFGV VSS+VFE Y
Sbjct  127  RLLVTSVMVASKTMDDVHYNNAFYARVGGVSNAELNRLELELLFLLDFGVMVSSRVFESY  186

Query  616  CQHLDKEIL  642
            C HL+KE+L
Sbjct  187  CLHLEKEML  195



>ref|XP_010109538.1| hypothetical protein L484_018273 [Morus notabilis]
 gb|EXC23142.1| hypothetical protein L484_018273 [Morus notabilis]
Length=227

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 156/186 (84%), Gaps = 7/186 (4%)
 Frame = +1

Query  85   PSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKS  264
            PSQ + +TPRVLTILSSVLEKLVARNDRL   C    T    DG    S   +G R+G++
Sbjct  17   PSQADQSTPRVLTILSSVLEKLVARNDRLIEEC----TSQALDG---LSGGLSGPRVGRN  69

Query  265  LSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLL  444
            LSAF GVRAPSISI KY+ER+YKY++CSPSCFVVGYVY+DRL HKYP+SLV+SLNVHRL+
Sbjct  70   LSAFQGVRAPSISIAKYLERLYKYSSCSPSCFVVGYVYIDRLLHKYPDSLVVSLNVHRLV  129

Query  445  VTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQH  624
            VT VMVASK+LDD HYNNAF+ARVGG+SN+ELN+LE+ELLFLLDFGV VSS VFE YC H
Sbjct  130  VTSVMVASKMLDDVHYNNAFYARVGGLSNSELNRLELELLFLLDFGVVVSSGVFEIYCLH  189

Query  625  LDKEIL  642
            L++E+L
Sbjct  190  LEREML  195



>ref|XP_010035608.1| PREDICTED: cyclin-U1-1-like [Eucalyptus grandis]
 gb|KCW47058.1| hypothetical protein EUGRSUZ_K00862 [Eucalyptus grandis]
Length=238

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 162/212 (76%), Gaps = 11/212 (5%)
 Frame = +1

Query  43   MLEEGD-NHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGG  219
            ML  GD       P PSQ E   PRVLT+LS VLE+LVARNDRL L  L G    N  GG
Sbjct  1    MLAAGDCTGLEPRPEPSQVEGTLPRVLTVLSFVLERLVARNDRL-LESLSGQL--NGLGG  57

Query  220  sssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHK  399
               +       LGKSL+ FHGVR P+ISIPKY+ERIYKYT CSPSCFVVGYVY+DRL HK
Sbjct  58   HGWAM------LGKSLNGFHGVRPPNISIPKYLERIYKYTGCSPSCFVVGYVYIDRLVHK  111

Query  400  YPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDF  579
            +P+SLV+SLNVHRLLVT VMVASK+LDDEHYNNAF+A+VGGVSNAELN+LE+ELLFLLDF
Sbjct  112  HPDSLVVSLNVHRLLVTSVMVASKMLDDEHYNNAFYAKVGGVSNAELNRLEMELLFLLDF  171

Query  580  GVSVSSQVFECYCQHLDKEILQCNGIGADATI  675
            GV VSS+VFE YC HL++E+L  NG G    I
Sbjct  172  GVVVSSRVFETYCFHLEREVL-LNGHGGHGEI  202



>ref|XP_002310464.1| cyclin family protein [Populus trichocarpa]
 gb|EEE90914.1| cyclin family protein [Populus trichocarpa]
Length=230

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 158/203 (78%), Gaps = 14/203 (7%)
 Frame = +1

Query  43   MLEEGD--NHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDG  216
            ML  GD  ++      PS  E+ TPRVLTILS V+EKLVARND+L             DG
Sbjct  1    MLGSGDLTSNLSRQSEPSPSESTTPRVLTILSHVIEKLVARNDKLV-----DDMDKKLDG  55

Query  217  GsssssssAGF-RLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLA  393
                   S+G  R+GKSL+ FHGVRAP+ISI KY+ER+YKYT+CSPSCFVVGYVY+DRL 
Sbjct  56   ------VSSGLARVGKSLNVFHGVRAPNISIVKYLERLYKYTSCSPSCFVVGYVYIDRLT  109

Query  394  HKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfll  573
            HK+P+SLVISLNVHRLLVT VMVASK+LDD HYNNAF+ARVGGVSNAELN+LE+E LFLL
Sbjct  110  HKHPDSLVISLNVHRLLVTSVMVASKMLDDVHYNNAFYARVGGVSNAELNRLEMEFLFLL  169

Query  574  DFGVSVSSQVFECYCQHLDKEIL  642
            DFGV VSS+VFE YC HL+KE++
Sbjct  170  DFGVVVSSRVFESYCSHLEKEMM  192



>ref|XP_011003213.1| PREDICTED: cyclin-U1-1 [Populus euphratica]
Length=230

 Score =   232 bits (592),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 157/203 (77%), Gaps = 14/203 (7%)
 Frame = +1

Query  43   MLEEGD--NHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDG  216
            ML  GD  ++      PS  E+ TPRVLTILS V+EKLVARND+L             DG
Sbjct  1    MLGSGDLTSNLSRQSEPSPSESTTPRVLTILSHVIEKLVARNDKLV-----DDMDKKLDG  55

Query  217  GsssssssAGF-RLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLA  393
                   S+G  R+GKSL+ FHGVRAP+ISI KY+ER+YKYT+CSPSCFVVGYVY+DRL 
Sbjct  56   ------VSSGLARVGKSLNVFHGVRAPNISIVKYLERLYKYTSCSPSCFVVGYVYIDRLT  109

Query  394  HKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfll  573
            HK+P+SLVISLNVHRLLVT VMVASK+LDD HYNNAF+ARVGGVSNAELN+LE+E LFLL
Sbjct  110  HKHPDSLVISLNVHRLLVTSVMVASKMLDDVHYNNAFYARVGGVSNAELNRLEMEFLFLL  169

Query  574  DFGVSVSSQVFECYCQHLDKEIL  642
            DFG  VSS+VFE YC HL+KE++
Sbjct  170  DFGFVVSSRVFESYCSHLEKEMM  192



>ref|XP_008230100.1| PREDICTED: cyclin-U1-1 [Prunus mume]
Length=228

 Score =   232 bits (591),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 151/184 (82%), Gaps = 10/184 (5%)
 Frame = +1

Query  91   QPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLS  270
            +PE + PRVLTILS VLEKL+ARN+ LA      G     DG      S     +GKSL+
Sbjct  13   RPEPSIPRVLTILSFVLEKLIARNNTLA-----DGLSQQLDG-----QSCGSAEIGKSLN  62

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FHGVRAPSISIPKY+ER+YKYT+CSPSCFVVGYVY+DRL HK+P+SLV+SLNVHRLLVT
Sbjct  63   VFHGVRAPSISIPKYLERLYKYTDCSPSCFVVGYVYIDRLLHKHPDSLVLSLNVHRLLVT  122

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
             VM+ASK+LDD HYNNAF+ARVGGVSNAELN+LE+ELLFLLDFGV VSS+VFE YC HL+
Sbjct  123  SVMIASKMLDDVHYNNAFYARVGGVSNAELNRLEVELLFLLDFGVMVSSRVFESYCFHLE  182

Query  631  KEIL  642
            KE++
Sbjct  183  KEMM  186



>ref|XP_003540320.1| PREDICTED: cyclin-U1-1-like [Glycine max]
 gb|KHN25773.1| Cyclin-U1-1 [Glycine soja]
Length=232

 Score =   232 bits (591),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 169/232 (73%), Gaps = 28/232 (12%)
 Frame = +1

Query  43   MLEEGD--NH-FPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLC---LDGGTPN  204
            ML  GD  NH  P  P  S  E   PRVL +LSS+LEKLVARN++L  +    LDG    
Sbjct  1    MLTAGDYSNHGRPLQPETSLAELNLPRVLCVLSSMLEKLVARNEKLIDILSQELDG----  56

Query  205  NTDGGsssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMD  384
                      +S   RLG SL+ FHGVRAPSISIPKY+ERIYKYTNCSPSCFVVGYVY+D
Sbjct  57   ---------LNSGSVRLGNSLNTFHGVRAPSISIPKYLERIYKYTNCSPSCFVVGYVYID  107

Query  385  RLAHKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiell  564
            RL H++P+SLV SLNVHRLLVT VMVASK+LDDEHYNNA +ARVGGVSNAELNKLE+ELL
Sbjct  108  RLTHRHPDSLVTSLNVHRLLVTSVMVASKMLDDEHYNNAIYARVGGVSNAELNKLELELL  167

Query  565  fllDFGVSVSSQVFECYCQHLDKEILQCNGIGADATIINIIQRGV--EALDD  714
            FLLDF V VSS+VFE YC HL+KE++  NG G        I+R +  +A+DD
Sbjct  168  FLLDFRVMVSSRVFESYCFHLEKEMV-VNGTGMK------IERALTPKAMDD  212



>ref|XP_007215945.1| hypothetical protein PRUPE_ppa011252mg [Prunus persica]
 gb|EMJ17144.1| hypothetical protein PRUPE_ppa011252mg [Prunus persica]
Length=217

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 10/184 (5%)
 Frame = +1

Query  91   QPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLS  270
            +PE + PRVLTILS VLEKLVARN+ LA      G     DG    S  SAG  +GKSL+
Sbjct  13   RPEPSIPRVLTILSFVLEKLVARNNTLA-----DGLSQQLDG---QSCGSAG--IGKSLN  62

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FHGVRAPSISIPKY+ER+YKYT+CSPSCFVVGYVY+DRL HK+P+SLV+SLNVHRLLVT
Sbjct  63   VFHGVRAPSISIPKYLERLYKYTDCSPSCFVVGYVYIDRLLHKHPDSLVLSLNVHRLLVT  122

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
             VM+ASK+LDD HYNNAF+ARVGGVSNAELN+LE+ELLFLLDFGV VSS+VFE YC HL+
Sbjct  123  SVMIASKMLDDVHYNNAFYARVGGVSNAELNRLEVELLFLLDFGVMVSSRVFESYCFHLE  182

Query  631  KEIL  642
            KE++
Sbjct  183  KEMI  186



>gb|ABX10779.1| putative cyclin-dependent protein kinase [Glycine max]
 gb|ABX10780.1| putative cyclin-dependent protein kinase [Glycine soja]
Length=198

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 160/212 (75%), Gaps = 20/212 (9%)
 Frame = +1

Query  43   MLEEGD--NH-FPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLC---LDGGTPN  204
            ML  GD  NH  P  P  S  E   PRVL +LSS+LEKLVARN++L  +    LDG    
Sbjct  1    MLTAGDYSNHGRPLQPETSLAELNLPRVLCVLSSMLEKLVARNEKLIDILSQELDG----  56

Query  205  NTDGGsssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMD  384
                      +S   RLG SL+ FHGVRAPSISIPKY+ERIYKYTNCSPSCFVVGYVY+D
Sbjct  57   ---------LNSGSVRLGNSLNTFHGVRAPSISIPKYLERIYKYTNCSPSCFVVGYVYID  107

Query  385  RLAHKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiell  564
            RL H++P+SLV SLNVHRLLVT VMVASK+LDDEHYNNA +ARVGGVSNAELNKLE+ELL
Sbjct  108  RLTHRHPDSLVTSLNVHRLLVTSVMVASKMLDDEHYNNAIYARVGGVSNAELNKLELELL  167

Query  565  fllDFGVSVSSQVFECYCQHLDKEILQCNGIG  660
            FLLDF V VSS+VFE YC HL+KE++  NG G
Sbjct  168  FLLDFRVMVSSRVFESYCFHLEKEMV-VNGTG  198



>ref|NP_001235448.1| uncharacterized protein LOC100527137 [Glycine max]
 gb|ACU16185.1| unknown [Glycine max]
Length=232

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 168/232 (72%), Gaps = 28/232 (12%)
 Frame = +1

Query  43   MLEEGD--NH-FPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLC---LDGGTPN  204
            ML  G+  NH +P  P  S  E   PRVL ILSS+LEKLVARN++L  +    LDG    
Sbjct  1    MLTAGEYSNHSWPLQPETSLTELNLPRVLCILSSMLEKLVARNEKLVDILSQQLDG----  56

Query  205  NTDGGsssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMD  384
                      +    RLG SL+ FHGVRAPSISIPKY+ERIYKYTNCSPSCFVVGYVY+D
Sbjct  57   ---------LNCGSVRLGNSLNTFHGVRAPSISIPKYLERIYKYTNCSPSCFVVGYVYID  107

Query  385  RLAHKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiell  564
            RL H++P+SLV SLNVHRLLVT VMVASK+LDDEHYNNA +ARVGGVSN ELNKLE+ELL
Sbjct  108  RLTHRHPDSLVTSLNVHRLLVTSVMVASKMLDDEHYNNAVYARVGGVSNTELNKLELELL  167

Query  565  fllDFGVSVSSQVFECYCQHLDKEILQCNGIGADATIINIIQRGV--EALDD  714
            FLLDF V VSS+VFE YC HL+KE++  NG G        I+R +  +A+DD
Sbjct  168  FLLDFRVMVSSRVFESYCFHLEKEMV-INGTGMK------IERALTPKAMDD  212



>ref|XP_011079017.1| PREDICTED: cyclin-U1-1 [Sesamum indicum]
Length=220

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 167/233 (72%), Gaps = 21/233 (9%)
 Frame = +1

Query  43   MLEEGD-NHFPA-LPGPSQPE-TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTD  213
            ML  G+  H  A LP P   + + TPRVL+ILS VLEKLVARND+L+             
Sbjct  1    MLTGGEPQHLQAPLPEPIHHDPSTTPRVLSILSHVLEKLVARNDQLS-------------  47

Query  214  GGsssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLA  393
                S         GK+LSAFHGVR P+IS+ KY+ERIYKYT CSPSCFVVG+VY+DRL 
Sbjct  48   ----SGGEGGSAGWGKNLSAFHGVRPPAISLEKYVERIYKYTKCSPSCFVVGFVYIDRLV  103

Query  394  HKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfll  573
            HKYP+SLV+SLNVHRLLVT VMVASKILDD HYNNAF+ARVGGVSN ELN+LE+ELLFLL
Sbjct  104  HKYPDSLVVSLNVHRLLVTSVMVASKILDDVHYNNAFYARVGGVSNVELNRLELELLFLL  163

Query  574  DFGVSVSSQVFECYCQHLDKEILQCNGIGADATIINIIQRGVEALDDDITLAS  732
            DFGVSVSS+VFE YCQHL+KE+L CNG+     I + +    E   +D   +S
Sbjct  164  DFGVSVSSRVFESYCQHLEKEML-CNGVVERPAITHTVDDVTEISVEDTQTSS  215



>ref|XP_004487375.1| PREDICTED: cyclin-U1-1-like [Cicer arietinum]
Length=229

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 154/201 (77%), Gaps = 14/201 (7%)
 Frame = +1

Query  61   NHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssss  240
             H P + GP+  E   PRVL +LSS LEKLVARN++L           N D       + 
Sbjct  13   QHQP-VTGPA--ELNLPRVLWVLSSTLEKLVARNEKLV-----DELNQNLD-----KLNR  59

Query  241  AGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVI  420
               RLGKSL+AFHGVRAP ISIPKY+ERIYKYT+CSPSCFVVGYVY+DRL HK+P+SLV+
Sbjct  60   GSVRLGKSLNAFHGVRAPGISIPKYLERIYKYTDCSPSCFVVGYVYIDRLTHKHPDSLVL  119

Query  421  SLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQ  600
            SLNVHRLLVTCVMVASK+LDDEHYNNA +ARVGGVSN ELNKLE+ELLFLLDF V VSS 
Sbjct  120  SLNVHRLLVTCVMVASKMLDDEHYNNAVYARVGGVSNGELNKLELELLFLLDFKVMVSSG  179

Query  601  VFECYCQHLDKEILQCNGIGA  663
            VFE YC HL+KE+L  NG G 
Sbjct  180  VFESYCLHLEKEML-VNGRGT  199



>ref|XP_010510760.1| PREDICTED: cyclin-U1-1 [Camelina sativa]
Length=210

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 151/197 (77%), Gaps = 22/197 (11%)
 Frame = +1

Query  55   GDNHFPALPGPSQP-ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGssss  231
            GD+    + GP  P E ATPRVLTI+S V+EKLVARN+ LA           T G     
Sbjct  6    GDDELDPVVGPEPPTEAATPRVLTIISHVMEKLVARNEWLA---------KQTKG-----  51

Query  232  sssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNS  411
                    GKSL AFHGVRAPSI+I KY+ERIYKYT CSPSCFVVGYVY+DRLAHKYP S
Sbjct  52   -------FGKSLEAFHGVRAPSITIAKYLERIYKYTKCSPSCFVVGYVYIDRLAHKYPGS  104

Query  412  LVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSV  591
            LV+SLNVHRLLVTCVM+ASKILDD HYNN F+ARVGGV+NA+LNK+E+ELLFLLDF V+V
Sbjct  105  LVVSLNVHRLLVTCVMIASKILDDVHYNNEFYARVGGVTNADLNKMELELLFLLDFRVTV  164

Query  592  SSQVFECYCQHLDKEIL  642
            S +VFE YC HL+KE+L
Sbjct  165  SFRVFESYCFHLEKEML  181



>ref|XP_006298586.1| hypothetical protein CARUB_v10014669mg [Capsella rubella]
 gb|EOA31484.1| hypothetical protein CARUB_v10014669mg [Capsella rubella]
Length=201

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 149/192 (78%), Gaps = 23/192 (12%)
 Frame = +1

Query  82   GPSQP-ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLG  258
            GP  P ETATPRVLTI+S V+EKLVARN+ LA           T G             G
Sbjct  16   GPEPPTETATPRVLTIISHVMEKLVARNEWLA---------KQTKG------------FG  54

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            KSL AFHGVRAPSISI KY+ERIYKYT CSPSC VVGYVY+DRLAHKYP SLV+SLNVHR
Sbjct  55   KSLEAFHGVRAPSISIAKYLERIYKYTKCSPSCLVVGYVYIDRLAHKYPGSLVVSLNVHR  114

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LLVTCVM+ASKILDD HYNN F+ARVGGVSNA+LNK+E+ELLFLLDF V+VS +VFE YC
Sbjct  115  LLVTCVMIASKILDDVHYNNEFYARVGGVSNADLNKMELELLFLLDFRVTVSFRVFESYC  174

Query  619  QHLDKEILQCNG  654
             HL+KE LQ NG
Sbjct  175  FHLEKETLQ-NG  185



>ref|XP_007043345.1| Cyclin p2,1 isoform 2 [Theobroma cacao]
 gb|EOX99176.1| Cyclin p2,1 isoform 2 [Theobroma cacao]
Length=270

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 159/227 (70%), Gaps = 52/227 (23%)
 Frame = +1

Query  85   PSQPETATPRVLTILSSVLEKLVARNDRLALLC---LDGGTPNNTDGGsssssssAGFRL  255
            P+Q ET TPRVLTI+SSVLEKLVARND+L  +    LDG   + + G           RL
Sbjct  17   PTQAETTTPRVLTIISSVLEKLVARNDKLVEVLSEQLDGLNCHGSSG-----------RL  65

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
            GKSL AFHGVRAP+ISIPKY+ERIYKYTNCSPSCFVVGYVY+DRLAHK+P+SLVISLNVH
Sbjct  66   GKSLHAFHGVRAPNISIPKYLERIYKYTNCSPSCFVVGYVYIDRLAHKHPDSLVISLNVH  125

Query  436  RLLVTCVMVASKILDD--------------------------------------EHYNNA  501
            RLLVT VMVASK+LDD                                       HYNNA
Sbjct  126  RLLVTSVMVASKMLDDVWSCPGSGKINDLELLELCFGAQSTKLFLTRQNLLDMHTHYNNA  185

Query  502  FFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
             +ARVGGV+NAELN+LE+ELLFLLDFGV+VSS+VFE YC HL+KE+L
Sbjct  186  VYARVGGVTNAELNRLELELLFLLDFGVTVSSRVFENYCLHLEKEML  232



>ref|XP_010488211.1| PREDICTED: cyclin-U1-1-like [Camelina sativa]
Length=210

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 151/197 (77%), Gaps = 22/197 (11%)
 Frame = +1

Query  55   GDNHFPALPGPSQP-ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGssss  231
            GD+    + GP  P E ATPRVLTI+S V+EKLVARN+ LA           T G     
Sbjct  6    GDDELDPVVGPEPPTEAATPRVLTIISHVMEKLVARNEWLA---------KQTKG-----  51

Query  232  sssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNS  411
                    GKSL AFHGVRAPSI+I KY+ERIYKYT CSPSCFVVGYVY+DRLAHKYP S
Sbjct  52   -------FGKSLEAFHGVRAPSITIAKYLERIYKYTKCSPSCFVVGYVYIDRLAHKYPGS  104

Query  412  LVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSV  591
            LV+SL+VHRLLVTCVM+ASKILDD HYNN F+ARVGGVSNA+LNK+E+ELLFLLDF V+V
Sbjct  105  LVVSLSVHRLLVTCVMIASKILDDVHYNNEFYARVGGVSNADLNKMELELLFLLDFRVTV  164

Query  592  SSQVFECYCQHLDKEIL  642
            S +VFE YC HL+KE+L
Sbjct  165  SFRVFESYCFHLEKEML  181



>ref|XP_010466452.1| PREDICTED: cyclin-U1-1-like [Camelina sativa]
Length=210

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 150/197 (76%), Gaps = 22/197 (11%)
 Frame = +1

Query  55   GDNHFPALPGPSQP-ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGssss  231
            GD+    + GP  P E ATPRVLTI+S V+EKLVARN+ L            T G     
Sbjct  6    GDDELDPVVGPEPPTEAATPRVLTIISHVMEKLVARNEWLT---------KQTKG-----  51

Query  232  sssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNS  411
                    GKSL AFHGVRAPSI+I KY+ERIYKYT CSPSCFVVGYVY+DRLAHKYP S
Sbjct  52   -------FGKSLEAFHGVRAPSITIAKYLERIYKYTKCSPSCFVVGYVYIDRLAHKYPGS  104

Query  412  LVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSV  591
            LV+SLNVHRLLVTCVM+ASKILDD HYNN F+ARVGGV+NA+LNK+E+ELLFLLDF V+V
Sbjct  105  LVVSLNVHRLLVTCVMIASKILDDVHYNNEFYARVGGVTNADLNKMELELLFLLDFRVTV  164

Query  592  SSQVFECYCQHLDKEIL  642
            S +VFE YC HL+KE+L
Sbjct  165  SFRVFESYCFHLEKEML  181



>ref|XP_002885474.1| CYCP2_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61733.1| CYCP2_1 [Arabidopsis lyrata subsp. lyrata]
Length=210

 Score =   226 bits (575),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 153/201 (76%), Gaps = 23/201 (11%)
 Frame = +1

Query  55   GDNHFPALPGPSQP-ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGssss  231
            GD+    + GP  P E ATPRVLTI+S V+EKLVARN+ LA           T G     
Sbjct  6    GDDELDPVVGPEPPTEAATPRVLTIISHVMEKLVARNEWLA---------KQTTG-----  51

Query  232  sssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNS  411
                    GKSL AFHGVRAPSISI KY+ERIYKYT CSP+CFVVGYVY+DRLAH++P S
Sbjct  52   -------FGKSLEAFHGVRAPSISIAKYLERIYKYTKCSPACFVVGYVYIDRLAHRHPGS  104

Query  412  LVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSV  591
            LV+SLNVHRLLVTCVM+ASKILDD HYNN F+ARVGGVSNA+LNK+E+ELLFLLDF V+V
Sbjct  105  LVVSLNVHRLLVTCVMIASKILDDVHYNNEFYARVGGVSNADLNKMELELLFLLDFRVTV  164

Query  592  SSQVFECYCQHLDKEILQCNG  654
            S +VFE YC HL+KE +Q NG
Sbjct  165  SFRVFESYCFHLEKE-MQLNG  184



>ref|XP_010240959.1| PREDICTED: cyclin-U1-1 [Nelumbo nucifera]
Length=227

 Score =   226 bits (577),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 148/189 (78%), Gaps = 21/189 (11%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLC----LDGGTPNNTDGGsssssssAGFRL  255
            S  E  TPRVL +LS +LE+LVARNDRL + C     +G +P+                 
Sbjct  17   SDAEPTTPRVLAVLSFMLERLVARNDRLVVDCGQNQFEGLSPSR----------------  60

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
             + L+ FHG+RAPSISIPKY+ERIYKYTNCSPSCFVVGYVY+DRL HKYP+SLVISLNVH
Sbjct  61   -RGLNVFHGIRAPSISIPKYLERIYKYTNCSPSCFVVGYVYIDRLLHKYPDSLVISLNVH  119

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLLVT VMVASK+LDD HYNNAF+ARVGGVSNAELN+LE+ELLFLLDF V V+S++FE Y
Sbjct  120  RLLVTSVMVASKVLDDVHYNNAFYARVGGVSNAELNRLELELLFLLDFSVIVTSRIFETY  179

Query  616  CQHLDKEIL  642
            C HL+KE++
Sbjct  180  CFHLEKEMI  188



>ref|XP_007149955.1| hypothetical protein PHAVU_005G113500g [Phaseolus vulgaris]
 gb|ESW21949.1| hypothetical protein PHAVU_005G113500g [Phaseolus vulgaris]
Length=233

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 164/220 (75%), Gaps = 18/220 (8%)
 Frame = +1

Query  76   LPGPSQPETATPRVLTILSSVLEKLVARNDRLALLC---LDGGTPNNTDGGsssssssAG  246
            LP  S  E   PRVL +LSS+LEKL+ARN++L  +    LDG              + + 
Sbjct  16   LPETSLSELNLPRVLFLLSSMLEKLLARNEKLVDVLNQQLDG-------------LNCSS  62

Query  247  FRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISL  426
             RLG SL+ FHGVRAP+ISIPKY+ERIYKYTNCSPSCFVVGYVY+DRLAH++P+SLV SL
Sbjct  63   VRLGNSLNTFHGVRAPNISIPKYLERIYKYTNCSPSCFVVGYVYIDRLAHRHPDSLVTSL  122

Query  427  NVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVF  606
            NVHRLLVT VMVASK+LDDEHYNNA +ARVGGVSNAELNKLE+ELLFLLDF V VSS VF
Sbjct  123  NVHRLLVTSVMVASKMLDDEHYNNAVYARVGGVSNAELNKLELELLFLLDFRVVVSSGVF  182

Query  607  ECYCQHLDKEILQCNGIGADATIINIIQRGVEALDDDITL  726
            E YC HL+KE +  NG G      ++  + +E L+ +I++
Sbjct  183  ESYCFHLEKE-MAVNGTGMKIE-KSLTPKAMEDLEAEISV  220



>ref|XP_006851148.1| hypothetical protein AMTR_s00043p00103760 [Amborella trichopoda]
 gb|ERN12729.1| hypothetical protein AMTR_s00043p00103760 [Amborella trichopoda]
Length=209

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 159/211 (75%), Gaps = 25/211 (12%)
 Frame = +1

Query  97   ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAF  276
            E++TPR+L +LS VLE+LVARN+RL        +P +                 +SL+ F
Sbjct  10   ESSTPRILAVLSYVLERLVARNERLG----SSTSPVSLSN--------------QSLAVF  51

Query  277  HGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCV  456
            HGVRAPSISIPKY+ERIYKYTNCSPSCFVVGYVYMDRL H+YP++ ++SLNVHRLLVT +
Sbjct  52   HGVRAPSISIPKYLERIYKYTNCSPSCFVVGYVYMDRLFHRYPDAPLVSLNVHRLLVTSL  111

Query  457  MVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            MVASK+LDD HYNNAF+ARVGGVSNAELN+LE+E+LFLLDFGV VSS+VFE YC HL+KE
Sbjct  112  MVASKVLDDVHYNNAFYARVGGVSNAELNRLELEMLFLLDFGVMVSSRVFESYCLHLEKE  171

Query  637  ILQCNGIGADATIINIIQRGVEALDDDITLA  729
            ++ CN           I++ +  LD++I L+
Sbjct  172  MM-CNPSAHK------IEKVMWNLDNEIELS  195



>ref|NP_188825.1| cyclin p2;1 [Arabidopsis thaliana]
 sp|Q9LJ45.1|CCU11_ARATH RecName: Full=Cyclin-U1-1; Short=CycU1;1; AltName: Full=Cyclin-P2.1; 
Short=CycP2;1 [Arabidopsis thaliana]
 dbj|BAB02187.1| PREG1-like negative regulator-like protein [Arabidopsis thaliana]
 gb|AAT41762.1| At3g21870 [Arabidopsis thaliana]
 gb|AAU84683.1| At3g21870 [Arabidopsis thaliana]
 gb|AEE76561.1| cyclin p2;1 [Arabidopsis thaliana]
Length=210

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 163/227 (72%), Gaps = 26/227 (11%)
 Frame = +1

Query  55   GDNHFPALPGP-SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGssss  231
            GD+    + GP S  E ATPRVLTI+S V+EKLVARN+ LA           T G     
Sbjct  6    GDDELDPVVGPESATEAATPRVLTIISHVMEKLVARNEWLA---------KQTKG-----  51

Query  232  sssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNS  411
                    GKSL AFHGVRAPSISI KY+ERIYKYT CSP+CFVVGYVY+DRLAHK+P S
Sbjct  52   -------FGKSLEAFHGVRAPSISIAKYLERIYKYTKCSPACFVVGYVYIDRLAHKHPGS  104

Query  412  LVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSV  591
            LV+SLNVHRLLVTCVM+A+KILDD HYNN F+ARVGGVSNA+LNK+E+ELLFLLDF V+V
Sbjct  105  LVVSLNVHRLLVTCVMIAAKILDDVHYNNEFYARVGGVSNADLNKMELELLFLLDFRVTV  164

Query  592  SSQVFECYCQHLDKEILQCNGIGADATIINIIQRGVEALDDDITLAS  732
            S +VFE YC HL+KE+   + + +    +  IQ   E+L    TL+S
Sbjct  165  SFRVFESYCFHLEKEMQLNDAVSS----LKDIQPMQESLSPASTLSS  207



>ref|XP_002280596.1| PREDICTED: cyclin-U1-1 [Vitis vinifera]
Length=220

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 160/222 (72%), Gaps = 24/222 (11%)
 Frame = +1

Query  79   PGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLG  258
            P  +  E+ TPRVL +L+  +E+LVARN+ L                      S G  +G
Sbjct  14   PEMTGVESTTPRVLAVLAFAMERLVARNEGLV-------------------GESIGL-MG  53

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            KSL+ FHGVRAPSISIPKY+ERIYKYTNCSPSCFVVGYVY+DRL HK+P+SLVISLNVHR
Sbjct  54   KSLNVFHGVRAPSISIPKYLERIYKYTNCSPSCFVVGYVYIDRLVHKHPDSLVISLNVHR  113

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LLVT VMVASK+LDD HYNNAF+ARVGGVSNAELN+LE+ELLF+LDFGV VSS+VFE YC
Sbjct  114  LLVTSVMVASKMLDDVHYNNAFYARVGGVSNAELNRLELELLFMLDFGVVVSSRVFESYC  173

Query  619  QHLDKEILQCNGIGA---DATIINIIQRGVEALDDDITLASS  735
             +L+KE+L  NG G     A + N +    E   DD   +SS
Sbjct  174  LYLEKEML-WNGAGQRMERAMVPNSVDEVTEISVDDTQTSSS  214



>ref|XP_004289157.1| PREDICTED: cyclin-U1-1-like [Fragaria vesca subsp. vesca]
Length=227

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 156/202 (77%), Gaps = 18/202 (9%)
 Frame = +1

Query  43   MLEEGD--NHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDG  216
            ML  G+  NH       S+PE + PRVLTILS VLEKLVARN+ L     D   P +   
Sbjct  1    MLSAGEFTNHL------SRPEPSIPRVLTILSFVLEKLVARNNSLVD---DLTQPLDA--  49

Query  217  GsssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAH  396
                  S     +GK L+ FHGVRAPSISIPKY+ER+YKYT+CSPSCFVVGYVY+DRL H
Sbjct  50   -----LSCGSAAIGKRLNPFHGVRAPSISIPKYLERLYKYTDCSPSCFVVGYVYIDRLVH  104

Query  397  KYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllD  576
            K+P+SLV+SLNVHRLLVT +MVASK+LDD HYNNAF+A+VGGVSNAELN+LE+E LFLLD
Sbjct  105  KHPDSLVLSLNVHRLLVTSIMVASKMLDDVHYNNAFYAKVGGVSNAELNRLEVEFLFLLD  164

Query  577  FGVSVSSQVFECYCQHLDKEIL  642
            FGV+VSS+VFE YC HL+KE++
Sbjct  165  FGVTVSSRVFESYCFHLEKEMM  186



>gb|EYU43110.1| hypothetical protein MIMGU_mgv1a013764mg [Erythranthe guttata]
Length=211

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 147/179 (82%), Gaps = 21/179 (12%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            TATPRVLTILS VLEKLV+RNDRL            +DGG S+         G  L+AFH
Sbjct  23   TATPRVLTILSYVLEKLVSRNDRL------------SDGGGSA---------GNILTAFH  61

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            GVR+P+IS+ KY+ERIYKYTNCSP+CFVVG+VY+DRL HKYP+SLV+SLNVHRL+VT VM
Sbjct  62   GVRSPAISLEKYLERIYKYTNCSPACFVVGFVYIDRLVHKYPDSLVVSLNVHRLVVTSVM  121

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            VASKILDD HYNNAF+ARVGGVSNAELN+LEIELLFLLDFGV VSS+VFE YCQHL+ +
Sbjct  122  VASKILDDVHYNNAFYARVGGVSNAELNRLEIELLFLLDFGVCVSSRVFESYCQHLENQ  180



>ref|XP_010532486.1| PREDICTED: cyclin-U1-1 [Tarenaya hassleriana]
Length=213

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 147/193 (76%), Gaps = 19/193 (10%)
 Frame = +1

Query  73   ALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFR  252
            A P P  P+   PRVLT++S VLE+LVARND LA                   ++  G  
Sbjct  20   AEPDPVGPDAVMPRVLTVISQVLERLVARNDWLA-------------------AAGGGGG  60

Query  253  LGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNV  432
             GK L AF GVRAP+ISIPKY+ERIYKYTNCSPSCFVVGYVY+DRLAHK+P SLV+SLNV
Sbjct  61   GGKRLEAFKGVRAPTISIPKYLERIYKYTNCSPSCFVVGYVYIDRLAHKHPGSLVVSLNV  120

Query  433  HRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFEC  612
            HRLLVTCVMVASK+LDD HYNNAF+ARVGGVS  E+N +E+ELLFLLDFG++V+S+VFE 
Sbjct  121  HRLLVTCVMVASKMLDDVHYNNAFYARVGGVSKEEMNTMEMELLFLLDFGLTVNSRVFEG  180

Query  613  YCQHLDKEILQCN  651
            YC HL++E+   N
Sbjct  181  YCFHLEREMFFLN  193



>ref|XP_003597030.1| Cyclin-U1-1 [Medicago truncatula]
 gb|AES67281.1| cyclin p4 [Medicago truncatula]
Length=233

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 149/194 (77%), Gaps = 15/194 (8%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLA-LLCLDGGTPNNTDGGsssssssAGFRLG  258
            GP+  E   PRVL ILSS LEKLV+RN++L   L  +    NN              RLG
Sbjct  19   GPA--ELNLPRVLWILSSTLEKLVSRNEKLVDELNQELDKLNN-----------GSVRLG  65

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            KSL+ FHGVRAP ISIPKY+ERIYKYTNCSPSCFVVGYVY+D L HK+P+SLV+SLNVHR
Sbjct  66   KSLNLFHGVRAPGISIPKYLERIYKYTNCSPSCFVVGYVYIDMLTHKHPDSLVLSLNVHR  125

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LLVT VMVASK+LDDEHYNNA +ARVGGVSNAELNKLE+ELLFLLDF V V  +VFE YC
Sbjct  126  LLVTSVMVASKMLDDEHYNNAVYARVGGVSNAELNKLELELLFLLDFKVMVCPRVFESYC  185

Query  619  QHLDKEILQCNGIG  660
             HL+KE+L  NG G
Sbjct  186  LHLEKEML-VNGTG  198



>gb|KFK39504.1| hypothetical protein AALP_AA3G252300 [Arabis alpina]
Length=210

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 149/197 (76%), Gaps = 22/197 (11%)
 Frame = +1

Query  55   GDNHFPALPGPSQP-ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGssss  231
            GD+    L GP  P E+ATPRVLTI+S V+EKLVARN+ LA           T G     
Sbjct  6    GDDEPDLLVGPDPPMESATPRVLTIISRVMEKLVARNEWLA---------KQTKG-----  51

Query  232  sssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNS  411
                    G SL AFHGVRAPSISI KY+ERIYKYT CSP+CFVVGYVY+DRLAHK+P S
Sbjct  52   -------FGDSLEAFHGVRAPSISITKYLERIYKYTKCSPACFVVGYVYIDRLAHKHPGS  104

Query  412  LVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSV  591
            LV+S NVHRLLVTCVM+ASKILDD HYNN F+ARVGGVSNA+LNK+E+ELLFLLDF V+V
Sbjct  105  LVVSTNVHRLLVTCVMIASKILDDVHYNNEFYARVGGVSNADLNKMELELLFLLDFRVTV  164

Query  592  SSQVFECYCQHLDKEIL  642
            S + FE YC HL+KEIL
Sbjct  165  SYRAFETYCFHLEKEIL  181



>ref|XP_006406231.1| hypothetical protein EUTSA_v10021524mg [Eutrema salsugineum]
 gb|ESQ47684.1| hypothetical protein EUTSA_v10021524mg [Eutrema salsugineum]
Length=208

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 149/198 (75%), Gaps = 23/198 (12%)
 Frame = +1

Query  55   GDNHFPALPGPSQP--ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsss  228
            G++   A+ GP  P  E ATPRVLTI+S V+EKLVARN+ LA           T G    
Sbjct  6    GEDEPDAVTGPDPPPTEAATPRVLTIISHVIEKLVARNEWLA---------KQTKG----  52

Query  229  ssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPN  408
                     GKSL AFHGVRAPSISI KY+ERIYKYT CSP+CFVVGYVY+DRLAHK+P 
Sbjct  53   --------FGKSLEAFHGVRAPSISIAKYLERIYKYTKCSPACFVVGYVYIDRLAHKHPG  104

Query  409  SLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVS  588
            S V+S+NVHRLLVTCVM+ASKILDD HYNN F+ARVGGVSN +LNK+E+ELLFLLDF V+
Sbjct  105  SFVVSMNVHRLLVTCVMIASKILDDVHYNNEFYARVGGVSNTDLNKMELELLFLLDFRVT  164

Query  589  VSSQVFECYCQHLDKEIL  642
            VS + FE YC HL+KE+L
Sbjct  165  VSFRAFESYCFHLEKEML  182



>ref|XP_008379611.1| PREDICTED: cyclin-U1-1 [Malus domestica]
Length=237

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 157/204 (77%), Gaps = 19/204 (9%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLA---LLCLDGGTPNNTDGGsssssssAGFRLG  258
            S P+ + PRVLTILS VLEKLVARN+ LA    L ++G +             SAG  +G
Sbjct  12   SLPDPSIPRVLTILSFVLEKLVARNNTLADDLSLQVNGRS-----------CGSAG--IG  58

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            KSL  FHGVR PSISIPKY+ER+YKYT+CSPSCFVVGY Y+DRL HK+P+SLV+SLNVHR
Sbjct  59   KSLDVFHGVRRPSISIPKYLERLYKYTDCSPSCFVVGYAYIDRLLHKHPDSLVLSLNVHR  118

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LLVT VMVASK+LDD HYNNAF+ARVGGVSNAELNKLE+ELLFLLDFGV+VSS+ FE YC
Sbjct  119  LLVTSVMVASKMLDDVHYNNAFYARVGGVSNAELNKLELELLFLLDFGVTVSSRDFESYC  178

Query  619  QHLDKEILQ---CNGIGADATIIN  681
             HL+KE LQ   C  I     ++N
Sbjct  179  FHLEKENLQNGACRRIERPLLVLN  202



>ref|XP_009353246.1| PREDICTED: cyclin-U1-1 [Pyrus x bretschneideri]
Length=237

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 156/201 (78%), Gaps = 13/201 (6%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            S+P+ + PRVLT+LS VLEKLVARN+ LA            +G    S  SAG  +GKSL
Sbjct  12   SRPDPSIPRVLTLLSFVLEKLVARNNTLA-----DDLSQQING---LSCGSAG--IGKSL  61

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
              FHG+R PSISIP Y+ER+YKYT+CSPSCFVVGYVY+DRL HK+P+SLV+SLNVHRLLV
Sbjct  62   DVFHGMRRPSISIPNYLERLYKYTDCSPSCFVVGYVYIDRLLHKHPDSLVLSLNVHRLLV  121

Query  448  TCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHL  627
            T VMVASK+LDD HYNNAF+ARVGGVSNAELNKLE+ELLFLLDFGV+VSS+ FE YC HL
Sbjct  122  TSVMVASKMLDDVHYNNAFYARVGGVSNAELNKLELELLFLLDFGVTVSSRDFESYCFHL  181

Query  628  DKEILQ---CNGIGADATIIN  681
            +KE LQ   C  I     ++N
Sbjct  182  EKENLQNRACRRIERPLLVLN  202



>emb|CDY38647.1| BnaA05g19400D [Brassica napus]
Length=210

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 148/197 (75%), Gaps = 22/197 (11%)
 Frame = +1

Query  55   GDNHFPALPGPSQP-ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGssss  231
            GD+    + G   P E ATPRVLTI+S V+EKLVARN+ LA           T G     
Sbjct  6    GDDEPDLVVGQDLPTEAATPRVLTIISHVMEKLVARNEWLA---------KQTKG-----  51

Query  232  sssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNS  411
                    GKSL AFHGVRAPSISI KY+ERIYKYT CSPSCFVVGY Y+DRLAHK+P S
Sbjct  52   -------FGKSLEAFHGVRAPSISIAKYLERIYKYTKCSPSCFVVGYAYIDRLAHKHPGS  104

Query  412  LVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSV  591
            LV+SLNVHRLLVTCVM+ASK+LDD HYNN F+ARVGGVSNA+LNK+E+ELLFLLDF V+V
Sbjct  105  LVVSLNVHRLLVTCVMIASKMLDDVHYNNEFYARVGGVSNADLNKMELELLFLLDFRVTV  164

Query  592  SSQVFECYCQHLDKEIL  642
            S + FE YC HL+KE+L
Sbjct  165  SFRAFESYCFHLEKEML  181



>emb|CDY54190.1| BnaCnng26370D [Brassica napus]
Length=210

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 148/197 (75%), Gaps = 22/197 (11%)
 Frame = +1

Query  55   GDNHFPALPGPSQP-ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGssss  231
            GD+    + G   P E ATPRVLTI+S V+EKLVARN+ LA           T G     
Sbjct  6    GDDEPDLVVGQDLPTEAATPRVLTIISHVMEKLVARNEWLA---------KQTKG-----  51

Query  232  sssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNS  411
                    GKSL AFHGVRAPSISI KY+ERIYKYT CSPSCFVVGY Y+DRLAHK+P S
Sbjct  52   -------FGKSLEAFHGVRAPSISIAKYLERIYKYTKCSPSCFVVGYAYIDRLAHKHPGS  104

Query  412  LVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSV  591
            LV+SLNVHRLLVTCVM+ASK+LDD HYNN F+ARVGGVSNA+LNK+E+ELLFLLDF V+V
Sbjct  105  LVVSLNVHRLLVTCVMIASKMLDDVHYNNEFYARVGGVSNADLNKMELELLFLLDFRVTV  164

Query  592  SSQVFECYCQHLDKEIL  642
            S + FE YC HL+KE+L
Sbjct  165  SFRAFESYCFHLEKEML  181



>ref|XP_009342256.1| PREDICTED: cyclin-U1-1-like [Pyrus x bretschneideri]
Length=239

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 151/199 (76%), Gaps = 15/199 (8%)
 Frame = +1

Query  97   ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFR-LGKSLSA  273
            ET+ PRVLTILS VLEKLVARN+ L             D     S  S G   +GK+L  
Sbjct  15   ETSIPRVLTILSFVLEKLVARNNTLV-----------DDLNQQLSGISCGSAVIGKNLDV  63

Query  274  FHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTC  453
             HGVR PS+SIPKY+ER+YKYT+CSPSCFVVGYVY+DRL HK+P+SLV+SLNVHRLLVT 
Sbjct  64   LHGVRPPSVSIPKYLERLYKYTDCSPSCFVVGYVYIDRLLHKHPDSLVLSLNVHRLLVTS  123

Query  454  VMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDK  633
            VMVASK+LDD HYNNAF+ARVGGVSNAELNKLE+ELLFLLDFGV VSS+VFE YC HL+K
Sbjct  124  VMVASKMLDDVHYNNAFYARVGGVSNAELNKLEVELLFLLDFGVMVSSRVFESYCFHLEK  183

Query  634  EILQ---CNGIGADATIIN  681
            E +Q   C  I     ++N
Sbjct  184  ENMQNGACQRIERPLLVLN  202



>ref|XP_004151930.1| PREDICTED: cyclin-U1-1-like [Cucumis sativus]
 gb|KGN63274.1| hypothetical protein Csa_2G422050 [Cucumis sativus]
Length=233

 Score =   216 bits (551),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 161/217 (74%), Gaps = 11/217 (5%)
 Frame = +1

Query  73   ALPGPSQPETA---TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssA  243
            A PG  + + A   TPRVL IL+ VL++LVARNDRL    L+  +    + G  SS   +
Sbjct  8    AAPGRVEGDNAAEPTPRVLIILAFVLDRLVARNDRL----LNELSQQLEELGCCSS---S  60

Query  244  GFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVIS  423
               LG S +AFHGVRAP+ISI KY+ERIYKYTNCSPSC VVG+VY+DRL H++P+SLVIS
Sbjct  61   SNHLGNSFNAFHGVRAPTISILKYLERIYKYTNCSPSCLVVGFVYIDRLIHRHPDSLVIS  120

Query  424  LNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQV  603
            LNVHRLLVT VMVASK+LDD HYNNAF+ARVGGVS  ELNKLE+E+LFLLDFGV+VSS+V
Sbjct  121  LNVHRLLVTSVMVASKMLDDVHYNNAFYARVGGVSKGELNKLELEMLFLLDFGVTVSSRV  180

Query  604  FECYCQHLDKEILQCNGIGADATIINIIQRGVEALDD  714
            FE YC HL+KE+L  NG G    +   +      LDD
Sbjct  181  FETYCWHLEKEML-LNGNGEMQRVERPLIMPTNTLDD  216



>ref|XP_008455834.1| PREDICTED: cyclin-U1-1 [Cucumis melo]
Length=233

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 166/226 (73%), Gaps = 12/226 (5%)
 Frame = +1

Query  61   NHFPALPGPSQPETA---TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGssss  231
            N F A PG ++ + A   TPRVL IL+ VL++LVARNDRL    L+  T    + G  SS
Sbjct  5    NDFAA-PGRAEGDNAAEPTPRVLIILAFVLDRLVARNDRL----LNELTQQLEELGCCSS  59

Query  232  sssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNS  411
               +   LG S +AFHGVRAP+ISI KY+ERIYKYTNCSPSC VVG+VY+DRL H++P+S
Sbjct  60   ---SSNHLGNSFNAFHGVRAPTISILKYLERIYKYTNCSPSCLVVGFVYIDRLIHRHPDS  116

Query  412  LVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSV  591
            LVISLNVHRLLVT VMVASK+LDD HYNNAF+ARVGGVS  ELNKLE+E+LFLLDFGV+V
Sbjct  117  LVISLNVHRLLVTSVMVASKMLDDVHYNNAFYARVGGVSKGELNKLELEMLFLLDFGVTV  176

Query  592  SSQVFECYCQHLDKEILQCNGIGADATIINIIQRGVEALDDDITLA  729
            SS+ FE YC HL+KE+L  NG G    +   +      LDD + ++
Sbjct  177  SSRAFETYCCHLEKEML-LNGNGEMQRVERPLVMPTNTLDDVLEIS  221



>ref|XP_004172662.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-U1-1-like, partial [Cucumis 
sativus]
Length=213

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 154/203 (76%), Gaps = 8/203 (4%)
 Frame = +1

Query  106  TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGV  285
            TPRVL IL+ VL++LVARNDRL    L+  +    + G  SS   +   LG S +AFHGV
Sbjct  2    TPRVLIILAFVLDRLVARNDRL----LNELSQQLEELGCCSS---SSNHLGNSFNAFHGV  54

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
            RAP+ISI KY+ERIYKYTNCSPSC VVG+VY+DRL H++P+SLVISLNVHRLLVT VMVA
Sbjct  55   RAPTISILKYLERIYKYTNCSPSCLVVGFVYIDRLIHRHPDSLVISLNVHRLLVTSVMVA  114

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQ  645
            SK+LDD HYNNAF+ARVGGVS  ELNKLE+E+ FLLDFGV+VSS+VFE YC HL+KE+L 
Sbjct  115  SKMLDDVHYNNAFYARVGGVSKGELNKLELEMXFLLDFGVTVSSRVFETYCWHLEKEML-  173

Query  646  CNGIGADATIINIIQRGVEALDD  714
             NG G    +   +      LDD
Sbjct  174  LNGNGEMQRVERPLIMPTNTLDD  196



>ref|XP_009145444.1| PREDICTED: cyclin-U1-1 [Brassica rapa]
Length=210

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 146/197 (74%), Gaps = 22/197 (11%)
 Frame = +1

Query  55   GDNHFPALPGPSQP-ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGssss  231
            GD+    + G   P E ATPRVLTI+S V+EKLVARN+ LA           T G     
Sbjct  6    GDDEPDLVVGQDLPTEAATPRVLTIISHVMEKLVARNEWLA---------KQTKG-----  51

Query  232  sssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNS  411
                    GKSL AF GVRAPSISI KY+ERIYKYT CSPSCFVVGY Y+DRLAHK+P S
Sbjct  52   -------FGKSLEAFDGVRAPSISIAKYLERIYKYTKCSPSCFVVGYAYIDRLAHKHPGS  104

Query  412  LVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSV  591
            LV+SLNVHRLLVTCVM+ASK+LDD HYNN  +ARVGGVSNA+LNK+E+ELLFLLDF V+V
Sbjct  105  LVVSLNVHRLLVTCVMIASKMLDDVHYNNELYARVGGVSNADLNKMELELLFLLDFRVTV  164

Query  592  SSQVFECYCQHLDKEIL  642
            S + FE YC HL+KE+L
Sbjct  165  SFRAFESYCFHLEKEML  181



>gb|KHN36553.1| Cyclin-U1-1 [Glycine soja]
Length=198

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 149/198 (75%), Gaps = 25/198 (13%)
 Frame = +1

Query  136  VLEKLVARNDRLALLC---LDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRAPSISI  306
            +LEKLVARN++L  +    LDG              +    RLG SL+ FHGVRAPSISI
Sbjct  1    MLEKLVARNEKLVDILSQQLDG-------------LNCGSVRLGNSLNTFHGVRAPSISI  47

Query  307  PKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASKILDDE  486
            PKY+ERIYKYTNCSPSCFVVGYVY+DRL H++P+SLV SLNVHRLLVT VMVASK+LDDE
Sbjct  48   PKYLERIYKYTNCSPSCFVVGYVYIDRLTHRHPDSLVTSLNVHRLLVTSVMVASKMLDDE  107

Query  487  HYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQCNGIGAD  666
            HYNNA +ARVGGVSN ELNKLE+ELLFLLDF V VSS+VFE YC HL+KE++  NG G  
Sbjct  108  HYNNAVYARVGGVSNTELNKLELELLFLLDFRVMVSSRVFESYCFHLEKEMV-INGTGMK  166

Query  667  ATIINIIQRGV--EALDD  714
                  I+R +  +A+DD
Sbjct  167  ------IERALTPKAMDD  178



>ref|XP_001784037.1| predicted protein [Physcomitrella patens]
 gb|EDQ51143.1| predicted protein [Physcomitrella patens]
Length=171

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 135/182 (74%), Gaps = 17/182 (9%)
 Frame = +1

Query  97   ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAF  276
            E   P+V+T+L+SVL++LVARN++ A       TP+             G    K L+ F
Sbjct  4    EREIPKVITVLASVLDRLVARNEQFA------NTPSQ-----------PGVFNSKKLTIF  46

Query  277  HGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCV  456
            HG+RAPSISI KY+ERI+KYTNCS SCFVVGYV++DRL H+ P+ LV SLNVHRLLVT V
Sbjct  47   HGLRAPSISIAKYLERIFKYTNCSASCFVVGYVFIDRLIHRQPDLLVTSLNVHRLLVTSV  106

Query  457  MVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            MVA+KILDD H+NNAFFARVGGVS  ELN+LE+E LF LDF ++V+  +FE YC +L+KE
Sbjct  107  MVATKILDDVHFNNAFFARVGGVSVGELNRLELEFLFRLDFRLTVTVSIFESYCSYLEKE  166

Query  637  IL  642
            ++
Sbjct  167  VM  168



>ref|XP_010906680.1| PREDICTED: cyclin-U1-1 [Elaeis guineensis]
Length=235

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 135/185 (73%), Gaps = 10/185 (5%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
             + E A PRVL +L+ VLE+LVARNDR+         P N + G          R  + L
Sbjct  20   EEAEAAPPRVLAVLTQVLERLVARNDRIGPEA--ERWPENAEDGWQ--------RRQRGL  69

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
            +AF   R PSIS+ KY+ERI++YT CSPSCFVVG+VY+DR  H+ P SLV+SLNVHRL++
Sbjct  70   AAFRAARPPSISVGKYLERIHRYTGCSPSCFVVGFVYIDRAVHRNPGSLVVSLNVHRLIL  129

Query  448  TCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHL  627
            T V++ASK+LDD H+NNAFFARVGGVSN ELN+LE+ELLFLLDF V VSS VFE Y  HL
Sbjct  130  TSVLIASKVLDDMHHNNAFFARVGGVSNTELNQLELELLFLLDFRVMVSSHVFESYYLHL  189

Query  628  DKEIL  642
            +KE++
Sbjct  190  EKEMM  194



>ref|XP_001784038.1| predicted protein [Physcomitrella patens]
 gb|EDQ51144.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 136/187 (73%), Gaps = 22/187 (12%)
 Frame = +1

Query  82   GP-SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLG  258
            GP +  E   P+VL +L++VL++LV+RN++ A        P+                 G
Sbjct  1    GPNTTSEREIPKVLHVLAAVLDRLVSRNEQFA------NAPSQQ---------------G  39

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            K L+ FHG+RAPSI+I KY+ERI+KYTNCSPSCFVVGYVY+DRL H+ P+ LV SLNVHR
Sbjct  40   KKLTIFHGLRAPSINIAKYLERIFKYTNCSPSCFVVGYVYLDRLIHRQPDLLVTSLNVHR  99

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LLVT VMVA+K+LDD H+NNAFFARVGGVS  ELN+LE+E LF LDF +SV+  VFE YC
Sbjct  100  LLVTSVMVATKMLDDVHFNNAFFARVGGVSVVELNRLELEFLFRLDFKLSVTISVFESYC  159

Query  619  QHLDKEI  639
             +L+++I
Sbjct  160  SYLERDI  166



>gb|ABK22429.1| unknown [Picea sitchensis]
Length=241

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 134/183 (73%), Gaps = 23/183 (13%)
 Frame = +1

Query  94   PETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSA  273
            PE+  PR+L +LS  L++LV RND+ AL       P +                GK ++ 
Sbjct  30   PESQLPRILAVLSYALQRLVTRNDQCAL-------PAD----------------GKKITV  66

Query  274  FHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTC  453
            FHGVR+PSI++ KY+ERIYKYT+CSPSCFVVGYVY+DRL H+ P+  VISLN+HRLL+T 
Sbjct  67   FHGVRSPSITVAKYLERIYKYTSCSPSCFVVGYVYIDRLVHRQPDFPVISLNIHRLLLTS  126

Query  454  VMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDK  633
            VM+A+K+LDD HYNNAF+ARVGG+SN ELN+LEI+ LF L F + V+ +VFE YC HL+K
Sbjct  127  VMIAAKMLDDAHYNNAFYARVGGISNTELNRLEIDFLFRLGFRLKVTGKVFESYCLHLEK  186

Query  634  EIL  642
            E+L
Sbjct  187  EML  189



>ref|XP_001763676.1| predicted protein [Physcomitrella patens]
 gb|EDQ71566.1| predicted protein, partial [Physcomitrella patens]
Length=161

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 131/181 (72%), Gaps = 21/181 (12%)
 Frame = +1

Query  97   ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAF  276
            E  TP+VL +L++VL++LV RN+      L    P+                 GK L+ F
Sbjct  2    EKETPKVLNVLAAVLDRLVTRNE------LFVNAPSQQ---------------GKKLTIF  40

Query  277  HGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCV  456
            HG+RAPSISI KY+ERI+KYTNCSPSCFVV YV++DRL H+ P+ LV +LNVHRLLVT V
Sbjct  41   HGLRAPSISIAKYLERIFKYTNCSPSCFVVAYVFLDRLVHRQPDLLVTTLNVHRLLVTSV  100

Query  457  MVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            MVA+K+LDD H+NNAFFARVGGVS  ELN+LE+E LF LDF +SV+  VFE YC +L+++
Sbjct  101  MVATKMLDDVHFNNAFFARVGGVSVVELNRLELEFLFRLDFKLSVTISVFESYCTYLERD  160

Query  637  I  639
            I
Sbjct  161  I  161



>ref|XP_001760666.1| predicted protein [Physcomitrella patens]
 gb|EDQ74405.1| predicted protein, partial [Physcomitrella patens]
Length=166

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 133/186 (72%), Gaps = 23/186 (12%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            G S  E   P+VL +L++VL++LVARN++ +        P+                 GK
Sbjct  3    GSSDKEI--PKVLYVLAAVLDRLVARNEQFS------NAPSQQ---------------GK  39

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
             L+ FHG+RAP+ISI  Y+ERI+KYT+CSPSCFVVGYV++DRL H+ P+ LV SLNVHRL
Sbjct  40   KLTIFHGLRAPNISIANYLERIFKYTSCSPSCFVVGYVFLDRLIHRQPDLLVTSLNVHRL  99

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            LVT VMVA+K+LDD H+NNAFFARVGGVS  ELN+LE+E LF LDF +SV+  VFE YC 
Sbjct  100  LVTSVMVATKMLDDVHFNNAFFARVGGVSVLELNRLELEFLFRLDFKLSVTISVFESYCT  159

Query  622  HLDKEI  639
             L+++I
Sbjct  160  FLERDI  165



>gb|AAC32127.1| PREG-like protein [Picea mariana]
Length=284

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 134/200 (67%), Gaps = 34/200 (17%)
 Frame = +1

Query  61   NHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssss  240
            N FP       P++  PR+L++LS  L +LV RND+         TP N           
Sbjct  62   NDFP-------PDSQQPRILSVLSYALRRLVTRNDQF--------TPKNF----------  96

Query  241  AGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVI  420
                    ++ FHGVR P ISI KY+ER+YKYT+CSPSCFVV Y+Y+DRL H+ PN  VI
Sbjct  97   --------VTVFHGVRTPGISIAKYLERVYKYTSCSPSCFVVAYIYIDRLVHRQPNFPVI  148

Query  421  SLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQ  600
            SLN+HRLL+T +M+A+K+LDD HYNNAF+ARVGGVS AELN+LE++ LF LDF + V++ 
Sbjct  149  SLNIHRLLLTSLMIAAKMLDDAHYNNAFYARVGGVSIAELNRLEVDFLFRLDFRLKVTAS  208

Query  601  VFECYCQHLDKEILQCNGIG  660
            VFE YC HL+KE+L C   G
Sbjct  209  VFESYCLHLEKEML-CGASG  227



>ref|XP_001753286.1| predicted protein [Physcomitrella patens]
 gb|EDQ81915.1| predicted protein [Physcomitrella patens]
Length=164

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 132/181 (73%), Gaps = 17/181 (9%)
 Frame = +1

Query  97   ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAF  276
            E   P+V+T+L+SVL++LVA N++ A       TP+     +            K+L+ F
Sbjct  1    EREIPKVVTVLASVLDRLVASNEQFA------TTPSQPSVYN-----------PKTLTIF  43

Query  277  HGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCV  456
            HG+RAPSISI KY+ERI+KYTNCS SCFVVGYV++DRL H+ P  LV SLNVHRLLVT V
Sbjct  44   HGLRAPSISIAKYLERIFKYTNCSASCFVVGYVFIDRLIHQQPELLVTSLNVHRLLVTSV  103

Query  457  MVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            MVA+KILDD H+NNAFFAR GGVS +ELN+LE+E LF L F ++V+  +FE YC +L+KE
Sbjct  104  MVATKILDDVHFNNAFFARGGGVSVSELNRLELEFLFRLGFRLTVTVSLFESYCSYLEKE  163

Query  637  I  639
            +
Sbjct  164  V  164



>ref|XP_002976722.1| hypothetical protein SELMODRAFT_416667 [Selaginella moellendorffii]
 gb|EFJ22391.1| hypothetical protein SELMODRAFT_416667 [Selaginella moellendorffii]
Length=264

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 136/180 (76%), Gaps = 4/180 (2%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSA----F  276
            PR+L +L+SVLE+L+ARN++      + G+ +    G +++  +      +S S+    F
Sbjct  46   PRILALLASVLERLIARNEQYMRGSSNRGSSSGKYLGIATARGAKNVFSARSCSSPGMVF  105

Query  277  HGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCV  456
             G++APSISI KY+ERI+KYTNCSP+CFVVGYVY+DRL+HK+P+  +  LNVHRLLVT V
Sbjct  106  SGLKAPSISIEKYLERIFKYTNCSPACFVVGYVYIDRLSHKHPDLPITPLNVHRLLVTSV  165

Query  457  MVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            M ASKILDD H+NNAFFARVGG+S +E+NKLE+E LF LDF ++V+ Q FE YC +LD+E
Sbjct  166  MTASKILDDVHFNNAFFARVGGISTSEVNKLELEFLFRLDFRLTVTVQEFESYCSYLDRE  225



>ref|XP_002973135.1| hypothetical protein SELMODRAFT_413599 [Selaginella moellendorffii]
 gb|EFJ25509.1| hypothetical protein SELMODRAFT_413599 [Selaginella moellendorffii]
Length=267

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 136/180 (76%), Gaps = 4/180 (2%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSA----F  276
            PR+L +L+SVLE+L+ARN++      + G+ +    G +++  +      +S S+    F
Sbjct  46   PRILALLASVLERLIARNEQYMRGSSNRGSSSGKYLGIATARGAKSVFSARSCSSPGRIF  105

Query  277  HGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCV  456
             G++APSISI KY+ERI+KYTNCSP+CFVVGYVY+DRL+HK+P+  +  LNVHRLLVT V
Sbjct  106  SGLKAPSISIEKYLERIFKYTNCSPACFVVGYVYIDRLSHKHPDLPITPLNVHRLLVTSV  165

Query  457  MVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            M ASKILDD H+NNAFFARVGG+S +E+NKLE+E LF LDF ++V+ Q FE YC +LD+E
Sbjct  166  MTASKILDDVHFNNAFFARVGGISTSEVNKLELEFLFRLDFRLTVTVQEFESYCSYLDRE  225



>ref|XP_010666788.1| PREDICTED: cyclin-U1-1 [Beta vulgaris subsp. vulgaris]
Length=211

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 137/189 (72%), Gaps = 17/189 (9%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            S+PE  TPRVL +L+++LE+ VARN+    L L   + N+ +                +L
Sbjct  21   SEPEATTPRVLLMLAAILERQVARNE----LILVERSTNSLNEVI-------------NL  63

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
              F+GVRAP+ISI KY++R+YKYT CSPSCFVV YVY+DRL H++P  L+IS+NVHRL++
Sbjct  64   KVFNGVRAPNISIAKYLDRLYKYTKCSPSCFVVAYVYIDRLIHRHPELLLISINVHRLVL  123

Query  448  TCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHL  627
            T VM+A K+LDD  YNNAF+A+VGG+SN ELN+LE+ELLFLLDF V VSS VF+ YC +L
Sbjct  124  TSVMIACKMLDDVQYNNAFYAKVGGISNTELNRLELELLFLLDFEVVVSSPVFQSYCWYL  183

Query  628  DKEILQCNG  654
            +KE  + N 
Sbjct  184  EKEDRRINA  192



>ref|XP_002985239.1| hypothetical protein SELMODRAFT_48560, partial [Selaginella moellendorffii]
 gb|EFJ13733.1| hypothetical protein SELMODRAFT_48560, partial [Selaginella moellendorffii]
Length=170

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 127/187 (68%), Gaps = 24/187 (13%)
 Frame = +1

Query  97   ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAF  276
            E   P V+++L+S+LE++VARN R     L GG                       L+ F
Sbjct  1    ENRPPTVISVLASLLERVVARNHRH----LGGG--------------------ATKLTVF  36

Query  277  HGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCV  456
            HG+RAPSISI KY+ERI+KY NCSP+CFVV Y YMDR  H+ P+  + SLNVHRLL+T V
Sbjct  37   HGLRAPSISIEKYLERIFKYANCSPACFVVAYAYMDRFIHQQPDVPITSLNVHRLLITSV  96

Query  457  MVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            MVA+K LDD +YNNA++A+VGGVS  E+N+LE++ LF LDF + V+  +FE YC HL++E
Sbjct  97   MVAAKFLDDAYYNNAYYAKVGGVSTLEMNRLELQFLFRLDFRLQVTVTMFESYCSHLERE  156

Query  637  ILQCNGI  657
            ++ C+ +
Sbjct  157  VVCCSAL  163



>gb|EPS61803.1| hypothetical protein M569_12990, partial [Genlisea aurea]
Length=158

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 125/173 (72%), Gaps = 25/173 (14%)
 Frame = +1

Query  127  LSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRAPSISI  306
            LS+ L+KLV R++ L+                      AG   G  LS FHGVRAP+I++
Sbjct  1    LSTALQKLVNRSEPLS----------------------AG---GGRLSVFHGVRAPAIAL  35

Query  307  PKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASKILDDE  486
              YIERIYKYT+CSPSCFVVG+VY+DRL HK+P+S+V  LNVHRL VT VMVA+KILDD 
Sbjct  36   ENYIERIYKYTSCSPSCFVVGFVYIDRLLHKHPDSVVSPLNVHRLAVTSVMVAAKILDDV  95

Query  487  HYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQ  645
            HYNN F+ARVGGVS  E+N+LE+ELLFLLDF V VSS VFE Y  +L+KE+L+
Sbjct  96   HYNNGFYARVGGVSKEEMNRLELELLFLLDFHVYVSSTVFEAYSLYLEKEMLR  148



>ref|XP_009385065.1| PREDICTED: cyclin-U1-1 [Musa acuminata subsp. malaccensis]
Length=239

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 140/188 (74%), Gaps = 3/188 (2%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL-G  258
            G +    A  RVL  +   LE++VARN+R+     D       +     +++    R+ G
Sbjct  12   GDTGDAEAAARVLDGIVHALERMVARNERVTRT--DAEEEEEDEEEEGETAALGAERMRG  69

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            + L+AF G R+P IS+ KY+ER+++YT CS SCFVVG+VY+DR+AH++P S V+SLNVHR
Sbjct  70   RGLAAFRGTRSPGISVGKYLERLWRYTGCSSSCFVVGFVYIDRVAHRHPASPVVSLNVHR  129

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            L++T +++ASK+LDD+H+NNAFFA+VGGVSNAELN++E+ELLFLLDFG+ VSS+VFE Y 
Sbjct  130  LVLTSLLIASKVLDDKHHNNAFFAKVGGVSNAELNRMELELLFLLDFGLVVSSRVFESYR  189

Query  619  QHLDKEIL  642
            +HL+KE +
Sbjct  190  RHLEKEKM  197



>ref|XP_002994358.1| hypothetical protein SELMODRAFT_48686, partial [Selaginella moellendorffii]
 gb|EFJ04573.1| hypothetical protein SELMODRAFT_48686, partial [Selaginella moellendorffii]
Length=157

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 120/176 (68%), Gaps = 20/176 (11%)
 Frame = +1

Query  112  RVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRA  291
            R+L +LSS+L+++V +N+R A      G  N                    L+ FHG+RA
Sbjct  1    RILAVLSSLLDRVVVKNERYAASATANGHSN--------------------LTVFHGLRA  40

Query  292  PSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASK  471
            PSISI KY+ERI+KY NCSPSCFVV YVY+DR   + P+  V SLNVHRLLVT VMVA+K
Sbjct  41   PSISIDKYLERIFKYANCSPSCFVVAYVYIDRFIQQKPSLPVTSLNVHRLLVTSVMVAAK  100

Query  472  ILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
             LDD +YNNA++A+VGGV+  E+N+LE+E LF L+F + V+  VFE YC  L+KE+
Sbjct  101  FLDDAYYNNAYYAKVGGVNTQEMNRLELEFLFHLNFRLQVTVSVFESYCNRLEKEV  156



>ref|XP_002966846.1| hypothetical protein SELMODRAFT_68732, partial [Selaginella moellendorffii]
 gb|EFJ31445.1| hypothetical protein SELMODRAFT_68732, partial [Selaginella moellendorffii]
Length=157

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 120/176 (68%), Gaps = 20/176 (11%)
 Frame = +1

Query  112  RVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRA  291
            R+L +LSS+L+++V +N+R A      G  N                    L+ FHG+RA
Sbjct  1    RILAVLSSLLDRVVVKNERYAASATANGHSN--------------------LTVFHGLRA  40

Query  292  PSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASK  471
            PSISI KY+ERI+KY NCSPSCFVV YVY+DR   + P+  + SLNVHRLLVT VMVA+K
Sbjct  41   PSISIDKYLERIFKYANCSPSCFVVAYVYIDRFIQQKPSLPITSLNVHRLLVTSVMVAAK  100

Query  472  ILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
             LDD +YNNA++A+VGGV+  E+N+LE+E LF L+F + V+  VFE YC  L+KE+
Sbjct  101  FLDDAYYNNAYYAKVGGVNTQEMNRLELEFLFHLNFRLQVTVSVFESYCNRLEKEV  156



>gb|AFK42393.1| unknown [Medicago truncatula]
Length=141

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 99/136 (73%), Gaps = 14/136 (10%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLA-LLCLDGGTPNNTDGGsssssssAGFRLG  258
            GP+  E   PRVL ILSS LEKLV+RN +L   L  +    NN              RLG
Sbjct  19   GPA--ELNLPRVLWILSSTLEKLVSRNKKLVDELNQELDKLNN-----------GSVRLG  65

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            KSL+ FHGVRAP ISIPKY+ERIYKYTNCSPSCFVVGYVY+D L HK+P+SLV+SLNVHR
Sbjct  66   KSLNLFHGVRAPGISIPKYLERIYKYTNCSPSCFVVGYVYIDMLTHKHPDSLVLSLNVHR  125

Query  439  LLVTCVMVASKILDDE  486
            LLVT VM ASK+LDDE
Sbjct  126  LLVTSVMAASKMLDDE  141



>gb|ABA27005.1| TO51-3 [Taraxacum officinale]
Length=94

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  244  GFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVIS  423
            G RLGK+L AFHG R P+I+IPKY++RIYKYTNCSP+CFVVGY Y+DRL H++P SLV+ 
Sbjct  5    GARLGKNLEAFHGARPPAITIPKYLDRIYKYTNCSPACFVVGYAYIDRLVHRHPGSLVVP  64

Query  424  LNVHRLLVTCVMVASKILDDEHYNNAFFAR  513
            LNVHRLLVT +MVA+KILDD HYNNAF+ R
Sbjct  65   LNVHRLLVTSIMVAAKILDDVHYNNAFYVR  94



>gb|KHG00595.1| Cyclin-P3-1 [Gossypium arboreum]
Length=215

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 116/177 (66%), Gaps = 23/177 (13%)
 Frame = +1

Query  106  TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGV  285
            TPR+LT+LSS+LEK V +N+      +   T +  D                +++ FHG+
Sbjct  31   TPRILTLLSSLLEKSVQKNE------MQIETASAKD----------------NIAIFHGL  68

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
            R P+ISI +YI+RI+KY  CSPSCF+V Y+Y+DR + +    L  SLNVHRLL+T VMVA
Sbjct  69   RVPTISIRQYIDRIFKYARCSPSCFLVAYIYLDRFSQQTDMHLT-SLNVHRLLITSVMVA  127

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            +K +DD ++NNA++ARVGG+S AELN+LE++ L  LDF + VS   F  YC  L KE
Sbjct  128  AKFIDDTYFNNAYYARVGGISTAELNRLEMKFLLSLDFRLQVSINTFRRYCLQLQKE  184



>ref|XP_002512374.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF49826.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=221

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 119/185 (64%), Gaps = 26/185 (14%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            + TPRVL +L+SVLE+   +NDRL                        G R    ++ FH
Sbjct  23   SGTPRVLLLLASVLERSTQKNDRL----------------------LEGSRRKDVVTVFH  60

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G R+PS+SI +YIER++KYT CS SCFVV Y+Y++R   +  ++ + SLNVHRLL+T +M
Sbjct  61   GSRSPSLSIRQYIERVFKYTKCSTSCFVVAYIYVERFLRRM-DACLTSLNVHRLLITSIM  119

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            +A+K LDDE YNNA++A+VGGVS  E+N++E +LLF LDF + V+ + F  YC  L++E 
Sbjct  120  LAAKFLDDECYNNAYYAKVGGVSTPEMNRMETKLLFNLDFRLQVTVEAFRSYCLKLERE-  178

Query  640  LQCNG  654
              C G
Sbjct  179  --CGG  181



>ref|XP_007134401.1| hypothetical protein PHAVU_010G044800g [Phaseolus vulgaris]
 gb|ESW06395.1| hypothetical protein PHAVU_010G044800g [Phaseolus vulgaris]
Length=200

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 114/181 (63%), Gaps = 23/181 (13%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            +  P+V++ LSS+LE++   ND                            +  + +S FH
Sbjct  10   SVMPKVISFLSSMLERVAESNDE-----------------------KQQLQQQQKISVFH  46

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+  P+IS+ KY+ERI+KY NCSPSCF+V YVY+DR   + P+  + S NVHRLL+T VM
Sbjct  47   GLTRPNISVQKYLERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVM  106

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++VS   F+ YC HL +E+
Sbjct  107  VAAKFMDDMYYNNAYYAKVGGISKIEMNFLELDFLFGLGFQLNVSPGTFQSYCVHLQREM  166

Query  640  L  642
            L
Sbjct  167  L  167



>ref|XP_006375171.1| cyclin family protein [Populus trichocarpa]
 gb|ERP52968.1| cyclin family protein [Populus trichocarpa]
Length=202

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 120/192 (63%), Gaps = 24/192 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+ +T LSS+L+++   ND                        +  F+  K +S FHG+ 
Sbjct  11   PKSITFLSSLLQRVADSND-----------------------LNREFQPQK-ISVFHGLT  46

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR A + P+  + SLNVHRLL+T V+V++
Sbjct  47   RPTISIQSYLERIFKYANCSPSCFVVAYVYLDRFAQRQPSLPINSLNVHRLLITSVLVSA  106

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD +YNNA++ARVGG+S  E+N LE++ LF L F ++V+   F  YC +L +E++Q 
Sbjct  107  KFMDDMYYNNAYYARVGGISTIEMNYLEVDFLFGLGFNLNVTPNTFHTYCSYLQREMMQQ  166

Query  649  NGIGADATIINI  684
              +    + +N+
Sbjct  167  PSLNLAESSLNL  178



>ref|XP_011032483.1| PREDICTED: cyclin-U4-1 [Populus euphratica]
Length=202

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 119/192 (62%), Gaps = 24/192 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+ +T LSS+L+++   ND                           F+  K +S FHG+ 
Sbjct  11   PKSITFLSSLLQRVADSND-----------------------LHREFQPQK-ISVFHGLT  46

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR A + P+  + SLNVHRLL+T V+V++
Sbjct  47   RPTISIQSYLERIFKYANCSPSCFVVAYVYLDRFAQRQPSLPINSLNVHRLLITSVLVSA  106

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD +YNNA++ARVGG+S  E+N LE++ LF L F ++V+   F  YC +L +E++Q 
Sbjct  107  KFMDDMYYNNAYYARVGGISTIEMNYLEVDFLFGLGFNLNVTPNTFHTYCSYLQREMMQQ  166

Query  649  NGIGADATIINI  684
              +    + +N+
Sbjct  167  PSLNLAESSLNL  178



>ref|XP_010056382.1| PREDICTED: cyclin-U4-1 [Eucalyptus grandis]
 gb|KCW73091.1| hypothetical protein EUGRSUZ_E01538 [Eucalyptus grandis]
Length=202

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 115/184 (63%), Gaps = 24/184 (13%)
 Frame = +1

Query  103  ATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHG  282
            A PR++  LSS+L+K    ND      LD                       + +S FHG
Sbjct  9    AMPRLIAFLSSLLQKAAESND------LDRQIHQQP----------------QRISVFHG  46

Query  283  VRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMV  462
            +  P+ISI  Y+ERI+KY NCSPSCFVV YVY++R A + P   + SLNVHRLL+T VMV
Sbjct  47   LTRPAISIRSYLERIFKYANCSPSCFVVAYVYLERFAQRQPTLPLNSLNVHRLLITSVMV  106

Query  463  ASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            A+K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F+ YC +L +E++
Sbjct  107  AAKFLDDIYYNNAYYAKVGGISTMEMNFLEVDFLFGLGFNLNVTPSAFQTYCSYLQREMM  166

Query  643  --QC  648
              QC
Sbjct  167  LQQC  170



>ref|XP_010546693.1| PREDICTED: cyclin-P3-1 [Tarenaya hassleriana]
Length=221

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 118/197 (60%), Gaps = 29/197 (15%)
 Frame = +1

Query  49   EEGDNHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsss  228
            EE       L    +P + TPRV+T+L+SVLEK++ RN                      
Sbjct  15   EELFKWIGLLQDSDKPGSGTPRVITLLASVLEKMILRNKEKK------------------  56

Query  229  ssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPN  408
                      + ++ FHG R P++SI  YIERI+KY+ CSPSCFV+ +VY+ R   +   
Sbjct  57   ----------EEITVFHGTRVPTMSIHHYIERIHKYSGCSPSCFVMAFVYIQRYLQRMEG  106

Query  409  -SLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGV  585
             +L+ SLNVHRLL+T V+VA+K LDDE YNNA++A+VGGVS  E+N+LE+  LF LDF +
Sbjct  107  FTLLTSLNVHRLLITSVLVAAKFLDDECYNNAYYAKVGGVSKEEMNRLELTFLFDLDFRL  166

Query  586  SVSSQVFECYCQHLDKE  636
            S++   F+ YC  L +E
Sbjct  167  SITRDAFKKYCLMLQRE  183



>ref|XP_007139676.1| hypothetical protein PHAVU_008G049600g [Phaseolus vulgaris]
 gb|ESW11670.1| hypothetical protein PHAVU_008G049600g [Phaseolus vulgaris]
Length=204

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 24/181 (13%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T  P++++ LSS+L+++   ND      L+                    +L + +S FH
Sbjct  8    TVMPKLISFLSSLLKRVAESND------LNQQ------------------QLHQKISVFH  43

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+  P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR   + P+  + S NVHRLL+T VM
Sbjct  44   GLTRPTISIQTYLERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVM  103

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++V+   F+ YC HL +E+
Sbjct  104  VAAKFMDDLYYNNAYYAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQREM  163

Query  640  L  642
            L
Sbjct  164  L  164



>gb|KDP22483.1| hypothetical protein JCGZ_26314 [Jatropha curcas]
Length=202

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 123/200 (62%), Gaps = 24/200 (12%)
 Frame = +1

Query  103  ATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHG  282
            A P+V++ LSS+L+++   ND  + L                          + +S FHG
Sbjct  9    AMPKVISFLSSLLQRVAESNDLRSQL------------------------YPQRISVFHG  44

Query  283  VRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMV  462
            +  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR A + P+  + S NVHRLL+T V+V
Sbjct  45   LTRPNISIQTYLERIFKYANCSPSCFVVAYVYLDRFAQRQPSLPINSFNVHRLLITSVLV  104

Query  463  ASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            ++K +DD +YNNA++A+VGG+S AE+N LE++ LF L F ++V+   F  YC +L +E+L
Sbjct  105  SAKFMDDIYYNNAYYAKVGGISTAEMNVLEVDFLFGLGFQLNVAPTTFHTYCSYLQREML  164

Query  643  QCNGIGADATIINIIQRGVE  702
              + +      +N+  R ++
Sbjct  165  MQSPVQLVEPPLNMTIRPLK  184



>ref|XP_004515319.1| PREDICTED: cyclin-U4-1-like [Cicer arietinum]
Length=202

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 115/190 (61%), Gaps = 25/190 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++T LSS+LE++   ND                               + +S FHG+ 
Sbjct  10   PKLITFLSSLLERVAESNDETQQ------------------------EQQQKISVFHGLT  45

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR     P+  + S NVHRLL+T VMVA+
Sbjct  46   RPNISIQSYLERIFKYANCSPSCFIVAYVYLDRFTQTQPSLPINSFNVHRLLITSVMVAA  105

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD +YNNA++A+VGG++ AE+N LE++ LF L F ++V+   F+ Y  HL +E+   
Sbjct  106  KFMDDVYYNNAYYAKVGGITKAEMNFLELDFLFGLGFNLNVTPITFQAYSVHLQREMFHM  165

Query  649  NGIG-ADATI  675
              +  AD+TI
Sbjct  166  QPLHFADSTI  175



>gb|AFK41945.1| unknown [Lotus japonicus]
Length=207

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 112/178 (63%), Gaps = 22/178 (12%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P++L  LSS+L+K+   ND      L                      + + +S FHG+ 
Sbjct  11   PKLLAFLSSMLKKVAESNDLNQQQQL----------------------IHQKISVFHGLT  48

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR   K P+  + S NVHRLL+T VMVA+
Sbjct  49   RPTISIQSYLERIFKYANCSPSCFIVAYVYLDRFTQKQPSLPINSFNVHRLLITSVMVAA  108

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            K +DD +YNNA++ARVGG++  E+N LE++ LF L F ++V+   F+ YC HL +E++
Sbjct  109  KFMDDMYYNNAYYARVGGITTIEMNFLELDFLFGLGFNLNVTPGTFQGYCSHLQREMM  166



>ref|XP_008777890.1| PREDICTED: cyclin-U1-1 [Phoenix dactylifera]
Length=130

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 91/132 (69%), Gaps = 10/132 (8%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
             + ETA PRVL +L+ VLE+LVARNDR+         P   + G          R  + L
Sbjct  8    EEAETAPPRVLAVLTQVLERLVARNDRIGPAA--ERWPEKAEEGWQ--------RRRRDL  57

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
            +AF G R PSIS+ KY+ERI++YT CSPSCFVVG+VY+DR  H+ P SLV+SLNVHRL++
Sbjct  58   AAFLGPRPPSISVGKYLERIHRYTGCSPSCFVVGFVYIDRAVHRNPGSLVVSLNVHRLIL  117

Query  448  TCVMVASKILDD  483
            T V++ASK+LDD
Sbjct  118  TSVLIASKVLDD  129



>emb|CDP15519.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 119/196 (61%), Gaps = 33/196 (17%)
 Frame = +1

Query  49   EEGDNHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsss  228
            EE DN      G  +P    PR+L IL+S LEK + +N++L                   
Sbjct  23   EEYDN------GTLEP----PRILAILASTLEKSILKNEKL-------------------  53

Query  229  ssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPN  408
                    +   ++ FHG+RAP +SI +YIERI+KY NCSPSCFVV Y+YM+R  H+  N
Sbjct  54   ---LKATNVKDVITIFHGLRAPELSIRRYIERIFKYANCSPSCFVVAYIYMERFLHQ-TN  109

Query  409  SLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVS  588
              + SLN HRLL+TC M+A+K ++DE YNNA++A+VGG+S  E+N+LE +L+  +DF + 
Sbjct  110  GYLTSLNAHRLLITCFMLAAKFVEDECYNNAYYAKVGGISTTEMNRLETKLVVAIDFRLH  169

Query  589  VSSQVFECYCQHLDKE  636
            VS + F+ Y   L+ E
Sbjct  170  VSVETFDDYSFRLEDE  185



>ref|XP_006397655.1| hypothetical protein EUTSA_v10001641mg [Eutrema salsugineum]
 gb|ESQ39108.1| hypothetical protein EUTSA_v10001641mg [Eutrema salsugineum]
Length=199

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 119/203 (59%), Gaps = 25/203 (12%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++  LSS+LE++   NDR   +                          + +S FHG+ 
Sbjct  11   PKLIAFLSSLLERVAESNDRTRRVTTQS----------------------QRVSVFHGLS  48

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+I+I  Y+ERI+KY NCSPSCFVV YVY+DR  H+ P+  + S NVHRLL+T VMV++
Sbjct  49   RPTITIQSYLERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSA  108

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L KE+   
Sbjct  109  KFLDDLYYNNAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLQKEMTLL  168

Query  649  NGIGADATIINIIQRGVEALDDD  717
              +   + ++    R V   +DD
Sbjct  169  QPL---SLVVVAPPRSVITFNDD  188



>ref|XP_011085729.1| PREDICTED: cyclin-U4-1 [Sesamum indicum]
Length=209

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 118/194 (61%), Gaps = 27/194 (14%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T  PR++  LSS+L+++   ND                        + GF   K +S FH
Sbjct  8    TVMPRLIGFLSSLLQRVAEAND-----------------------LNRGFHPQK-ISVFH  43

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+  P+ISI  Y+ERI+KY NCSPSC++V YVY+DR   + P   + S NVHRLL+T VM
Sbjct  44   GLTRPTISIQTYLERIFKYANCSPSCYIVAYVYLDRFTQRQPALPINSFNVHRLLITSVM  103

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            V++K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  YC +L +E+
Sbjct  104  VSAKFMDDMYYNNAYYAKVGGISTTEMNFLEVDFLFGLGFHLNVTPTTFHTYCSYLQREM  163

Query  640  L---QCNGIGADAT  672
            +   Q N I A+ +
Sbjct  164  MLQPQLNNIAAEPS  177



>gb|KDP21459.1| hypothetical protein JCGZ_21930 [Jatropha curcas]
Length=219

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 117/177 (66%), Gaps = 23/177 (13%)
 Frame = +1

Query  106  TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGV  285
            TPRVLT+LSS LE+LV +N+ L                          ++  S++ FHG+
Sbjct  31   TPRVLTLLSSFLERLVHKNEML----------------------METSQIKDSITVFHGL  68

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
            RAP++SI +YI+RI+KY+ CSPSCFVV ++Y+DR      +  V SLNVHRLL+T +M+A
Sbjct  69   RAPAVSIQQYIDRIFKYSACSPSCFVVAHIYVDRFIQS-THVHVTSLNVHRLLMTSLMIA  127

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            +K +DD  +NNA++A+VGGVS AELN+LE++ LF +DF + V+   F  YC  L+KE
Sbjct  128  AKFIDDAFFNNAYYAKVGGVSTAELNRLEMKFLFSIDFRLHVNLNTFGRYCCQLEKE  184



>ref|XP_006490025.1| PREDICTED: cyclin-U4-1-like [Citrus sinensis]
Length=220

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 116/189 (61%), Gaps = 24/189 (13%)
 Frame = +1

Query  76   LPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL  255
            L G  +     P+++T+LSS+L+++   ND                        S  F  
Sbjct  19   LEGHQEEAAVMPKLITVLSSLLQRVAESND-----------------------LSQRFHP  55

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
             K +S FHG+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR A K P+  + S NVH
Sbjct  56   QK-ISVFHGLTRPTISIHSYLERIFKYANCSPSCFVVAYVYLDRFAQKQPSLPINSFNVH  114

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T V+V++K +DD +YNNAF+A+VGG+S  E+N LE++ LF L F ++V+   F  Y
Sbjct  115  RLLITSVLVSAKFMDDIYYNNAFYAKVGGISTTEMNLLEVDFLFDLGFQLNVTPAAFYTY  174

Query  616  CQHLDKEIL  642
            C +L +E+ 
Sbjct  175  CSYLQREMF  183



>ref|XP_010246095.1| PREDICTED: cyclin-U4-1-like [Nelumbo nucifera]
Length=203

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 121/195 (62%), Gaps = 26/195 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL-GKSLSAFHGV  285
            P+V+T LSS+L+++   ND                            RL  + +S FHG+
Sbjct  11   PKVITFLSSLLQRVADSND-------------------------VNRRLETQRISVFHGL  45

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
              P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR A + P+  + SLN+HRLL+T VMVA
Sbjct  46   TRPTISIQSYLERIFKYANCSPSCFVVAYVYLDRFAQRQPSLPINSLNIHRLLITSVMVA  105

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQ  645
            +K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++V+   +  YC +L +E+  
Sbjct  106  AKFMDDMYYNNAYYAKVGGINTTEMNYLEVDFLFGLSFHLNVTPNTYYTYCSYLQREVYI  165

Query  646  CNGIGADATIINIIQ  690
             + +    T +N+++
Sbjct  166  ESPLSLVETPLNLVR  180



>ref|XP_006851092.1| hypothetical protein AMTR_s00025p00245040 [Amborella trichopoda]
 gb|ERN12673.1| hypothetical protein AMTR_s00025p00245040 [Amborella trichopoda]
Length=227

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 115/176 (65%), Gaps = 22/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL++LSSVLE  V +N     + LD                       K L+ F G+R
Sbjct  33   PRVLSVLSSVLEGTVLKN----AIALDVTKKQ------------------KRLTIFDGLR  70

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             PS+ I +Y+ERI++Y++CSPSCF++ Y+YMDR  H+ P   + SLNVHRLL+T VMVA+
Sbjct  71   PPSLCIRQYLERIFEYSSCSPSCFILAYIYMDRFIHQQPEVPLTSLNVHRLLITSVMVAA  130

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD  ++NA++A+VGGVS  E+N+LE+ELLF LDF + VS   F+  C HL+KE
Sbjct  131  KFIDDAFFDNAYYAKVGGVSTTEINRLELELLFTLDFRLQVSIVAFQTCCAHLEKE  186



>gb|KDP23522.1| hypothetical protein JCGZ_23355 [Jatropha curcas]
Length=218

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 117/176 (66%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL + + VLE+ + +N+ L     D     +T                  ++ FHG R
Sbjct  23   PRVLQLFACVLERSIQKNESL----FDESRKKDT------------------VTVFHGSR  60

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            +PS+SI +YIER++KY+ CS SCFVV Y+Y++R  H+   SL  SLNVHRLL+T +MVA+
Sbjct  61   SPSLSIRQYIERVFKYSRCSTSCFVVSYIYIERFLHRMDVSLT-SLNVHRLLITSIMVAA  119

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K LDDE YNNA++A+VGGVS AE+N++E++LLF LDF + V+ + F+ YC  L++E
Sbjct  120  KFLDDECYNNAYYAKVGGVSTAEMNRMEMKLLFNLDFRLQVTVEGFKNYCLKLERE  175



>ref|XP_009600659.1| PREDICTED: cyclin-P3-1-like [Nicotiana tomentosiformis]
Length=226

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 118/176 (67%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P++L+IL+SVLEK V +N++                      +  G +    ++ FHG R
Sbjct  34   PKILSILASVLEKTVQKNEK----------------------AMKGSKERGVVTVFHGTR  71

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP +++ +YIERI+KY+NCSPSCFVV YVY++R  +   + L+ SLNVHRLL+TC+++A 
Sbjct  72   APVLTVQQYIERIFKYSNCSPSCFVVAYVYLERFLN-LTDCLLTSLNVHRLLITCIVLAV  130

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD+ YN+A++A+VGG++  ELNKLE++ L  LDF + VS + F+ YC  L+KE
Sbjct  131  KFVDDDCYNDAYYAKVGGITTKELNKLEMKFLAALDFRLHVSVESFDKYCLQLEKE  186



>ref|XP_007218421.1| hypothetical protein PRUPE_ppa011572mg [Prunus persica]
 ref|XP_008234040.1| PREDICTED: cyclin-U4-1-like [Prunus mume]
 gb|EMJ19620.1| hypothetical protein PRUPE_ppa011572mg [Prunus persica]
Length=205

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 121/202 (60%), Gaps = 24/202 (12%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            + PE A PR++  +SSVLE++   ND                        S GF   + L
Sbjct  8    TSPE-AMPRMIDFMSSVLERVAKSND-----------------------LSRGFEPTQRL  43

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
            S FH +  P+I+I  Y++RI+KY +CSPSCFVV YVY+DR     P   + S NVHRLL+
Sbjct  44   SLFHSLTTPTITIHSYLQRIFKYADCSPSCFVVAYVYLDRFTQTQPLLPIDSFNVHRLLI  103

Query  448  TCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHL  627
              V+V++K +DD +YNNA++ARVGG+S AE+N LE++ LF L F ++V+   F  YC +L
Sbjct  104  ASVLVSAKFMDDIYYNNAYYARVGGISTAEMNLLEVDFLFGLGFQLNVTPATFYTYCSYL  163

Query  628  DKEILQCNGIGADATIINIIQR  693
             +E+L  + +    + +N+ +R
Sbjct  164  QREMLLQSPLHVAESPLNLARR  185



>gb|KFK37277.1| hypothetical protein AALP_AA4G236200 [Arabis alpina]
Length=201

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 112/182 (62%), Gaps = 23/182 (13%)
 Frame = +1

Query  94   PETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSA  273
            PE   P+++  LSS+LE++   ND+   +                          + +S 
Sbjct  7    PE-VMPKLIAFLSSLLEQVAQSNDQTRRVTTQT----------------------QRVSV  43

Query  274  FHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTC  453
            FHG+  P+I+I  Y+ERIYKY NCSPSCFVV YVY+DR  H+ P+  + S NVHRLL+T 
Sbjct  44   FHGLSRPTITIQSYLERIYKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITS  103

Query  454  VMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDK  633
            VMV++K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V    F+ Y  +L K
Sbjct  104  VMVSAKFLDDLYYNNAYYAKVGGISTKEMNLLELDFLFGLGFDLNVKPNTFQAYFTYLQK  163

Query  634  EI  639
            E+
Sbjct  164  EM  165



>ref|XP_008343752.1| PREDICTED: cyclin-U4-1-like [Malus domestica]
Length=207

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 127/217 (59%), Gaps = 41/217 (19%)
 Frame = +1

Query  97   ETATPRVLT----ILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKS  264
            E  +PRV+T     LSS+++++   ND                        ++ F+  K 
Sbjct  3    ELESPRVMTKIITFLSSLVQRVAESND-----------------------LNSHFQHQK-  38

Query  265  LSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLL  444
            +S FHG+  P+ISI  Y+ERI+KY NCSPSC +V YVY+DR + + P+  + S NVHRLL
Sbjct  39   ISVFHGLTRPTISIQNYLERIFKYANCSPSCLIVAYVYLDRFSQRQPSLPINSFNVHRLL  98

Query  445  VTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQH  624
            +T VMVA+K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  YC +
Sbjct  99   ITSVMVAAKFMDDMYYNNAYYAKVGGISTIEMNFLEVDFLFGLSFNLNVTPSTFTIYCSY  158

Query  625  LDKEILQCNGIGADATIINIIQRGVEALDDDITLASS  735
            L +E+L             ++Q  +E+ D  +TL  S
Sbjct  159  LQREML-------------LLQPPLESADSSLTLGKS  182



>gb|KHN31107.1| Cyclin-U4-1 [Glycine soja]
Length=209

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 118/203 (58%), Gaps = 23/203 (11%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
               +  +  P+V+T L S+LE++   ND                        +   +  +
Sbjct  4    AEEESPSVMPKVITFLCSLLERVAESNDH-----------------------NQHLQQHQ  40

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
             +S FHG+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR   + P+  + S NVHRL
Sbjct  41   KISVFHGLTRPNISIQCYLERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRL  100

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            L+T VMVA+K +DD  YNNA +A+VGG++  E+N LE++ LF L F ++V+   F+ YC 
Sbjct  101  LITSVMVAAKFMDDMFYNNAHYAKVGGITKVEMNFLELDFLFGLGFHLNVTPGTFQAYCV  160

Query  622  HLDKEILQCNGIGADATIINIIQ  690
            HL +E+L    +    + +N+ Q
Sbjct  161  HLQREMLLIQPLNFSDSTLNLGQ  183



>ref|XP_006444072.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 ref|XP_006479719.1| PREDICTED: cyclin-P3-1-like isoform X1 [Citrus sinensis]
 ref|XP_006479720.1| PREDICTED: cyclin-P3-1-like isoform X2 [Citrus sinensis]
 gb|ESR57312.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 gb|KDO68736.1| hypothetical protein CISIN_1g026467mg [Citrus sinensis]
 gb|KDO68737.1| hypothetical protein CISIN_1g026467mg [Citrus sinensis]
Length=217

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 24/178 (13%)
 Frame = +1

Query  103  ATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHG  282
             +P++L+++  +LEK V +N+ L    LD                       K ++ FHG
Sbjct  30   GSPKILSLIGRLLEKSVQKNEML----LDTIKT-------------------KDVTIFHG  66

Query  283  VRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMV  462
            +RAP+ISI +YI+RI+KY  CSPSCFV+ ++YMDR   K    L  SLNVHRLL+T VMV
Sbjct  67   LRAPTISIQQYIDRIFKYGACSPSCFVIAHIYMDRFLQKTDGHLT-SLNVHRLLITSVMV  125

Query  463  ASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            A+K +DD  +NNA++ARVGGVS AE+N++E++ LF LDF + V+ + F  +C  L KE
Sbjct  126  AAKFIDDAFFNNAYYARVGGVSTAEMNRMEVKFLFSLDFRLQVNVETFHKFCSQLGKE  183



>gb|KHN12243.1| Cyclin-U4-1 [Glycine soja]
Length=202

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 113/181 (62%), Gaps = 26/181 (14%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            +  P+V+T LSS+LE++   ND                            +  + +S FH
Sbjct  8    SVMPKVITFLSSLLERVAESNDHN--------------------------QQHQKISVFH  41

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR   + P+  + + NVHRLL+T VM
Sbjct  42   GLTRPNISIQSYLERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINTFNVHRLLITSVM  101

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++V+   F+ YC +L +E+
Sbjct  102  VAAKFMDDMYYNNAYYAKVGGITKIEMNFLELDFLFGLGFHLNVTPGTFQAYCVNLQREM  161

Query  640  L  642
            L
Sbjct  162  L  162



>ref|XP_004307245.1| PREDICTED: cyclin-U4-1-like [Fragaria vesca subsp. vesca]
Length=204

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 113/177 (64%), Gaps = 24/177 (14%)
 Frame = +1

Query  112  RVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRA  291
            + +T LSS+++++   ND                        ++ F++ K +S FHG+  
Sbjct  12   KTITFLSSLVQRVAESND-----------------------LNSQFQIQK-VSVFHGLTR  47

Query  292  PSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASK  471
            P+ISI  Y+ERI+KY NCSPSC +V YVY+DR   K P+  + S NVHRLL+T VMVA+K
Sbjct  48   PTISIQSYLERIFKYANCSPSCLIVAYVYLDRFTQKQPSLPINSFNVHRLLITSVMVAAK  107

Query  472  ILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
             +DD +YNNA++A+VGG+S AE+N LE++ LF L F ++V+   F  YC +L +E+L
Sbjct  108  FMDDLYYNNAYYAKVGGISTAEMNFLEVDFLFGLSFNLNVTPTTFTTYCSYLQREML  164



>ref|XP_002520742.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF41704.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=219

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 115/184 (63%), Gaps = 23/184 (13%)
 Frame = +1

Query  106  TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGV  285
            TPR LT+LSS+LE+ V +N+ L                          ++  S + FHG 
Sbjct  31   TPRALTLLSSLLERSVQKNEML----------------------LETTQINDSRTEFHGS  68

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
            RAP++SI +YI+RI+KY+ CSPSCF+V ++Y+DR        L  SLNVHRLL+T VMVA
Sbjct  69   RAPTVSIRQYIDRIFKYSGCSPSCFIVAHIYVDRFIQNTDIHLT-SLNVHRLLITSVMVA  127

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQ  645
            +K +DD  +NNA++A+VGGVS  ELNKLE++ LF +DF + VS   F  YC  L+KE  +
Sbjct  128  AKFIDDAFFNNAYYAKVGGVSTEELNKLEMKFLFSIDFRLQVSVNTFGRYCSQLEKEAAE  187

Query  646  CNGI  657
             + I
Sbjct  188  GHQI  191



>ref|NP_001235331.1| uncharacterized protein LOC100305689 [Glycine max]
 gb|ACU13506.1| unknown [Glycine max]
Length=209

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 118/203 (58%), Gaps = 23/203 (11%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
               +  +  P+V+T L S+LE++   ND                        +   +  +
Sbjct  4    AEEESPSVMPKVITFLCSLLERVAESNDH-----------------------NHHLQQHQ  40

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
             +S FHG+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR   + P+  + S NVHRL
Sbjct  41   KISVFHGLTRPNISIQCYLERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRL  100

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            L+T VMVA+K +DD  YNNA +A+VGG++  E+N LE++ LF L F ++V+   F+ YC 
Sbjct  101  LITSVMVAAKFMDDMFYNNAHYAKVGGITKVEMNFLELDFLFGLGFHLNVTPGTFQAYCV  160

Query  622  HLDKEILQCNGIGADATIINIIQ  690
            HL +E+L    +    + +N+ Q
Sbjct  161  HLQREMLLIQPLNFSDSTLNLGQ  183



>ref|XP_006444071.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 gb|ESR57311.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 gb|KDO68735.1| hypothetical protein CISIN_1g026467mg [Citrus sinensis]
Length=238

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 114/177 (64%), Gaps = 24/177 (14%)
 Frame = +1

Query  106  TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGV  285
            +P++L+++  +LEK V +N+ L    LD                       K ++ FHG+
Sbjct  52   SPKILSLIGRLLEKSVQKNEML----LDTIKT-------------------KDVTIFHGL  88

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
            RAP+ISI +YI+RI+KY  CSPSCFV+ ++YMDR   K    L  SLNVHRLL+T VMVA
Sbjct  89   RAPTISIQQYIDRIFKYGACSPSCFVIAHIYMDRFLQKTDGHLT-SLNVHRLLITSVMVA  147

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            +K +DD  +NNA++ARVGGVS AE+N++E++ LF LDF + V+ + F  +C  L KE
Sbjct  148  AKFIDDAFFNNAYYARVGGVSTAEMNRMEVKFLFSLDFRLQVNVETFHKFCSQLGKE  204



>ref|XP_002511026.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF51628.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=203

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 113/178 (63%), Gaps = 24/178 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+V+T LSS+L+++   ND    L                          + +S FHG+ 
Sbjct  12   PKVVTFLSSLLQRVAESNDLSHQLH------------------------PQRISVFHGLT  47

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             PSIS+  Y+ERI+KY NCSPSCFV+ YVY+DR A + P+  + S NVHRLL+T V+V++
Sbjct  48   RPSISVQSYLERIFKYANCSPSCFVIAYVYLDRFAQRQPSFPINSFNVHRLLITSVLVSA  107

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            K +DD +YNNA++A+VGG+S +E+N LE++ LF L F ++V+   F  YC +L +E+L
Sbjct  108  KFMDDIYYNNAYYAKVGGISTSEMNILEVDFLFGLGFQLNVTPNTFHTYCSYLQREML  165



>ref|XP_003529016.1| PREDICTED: cyclin-U4-1-like [Glycine max]
Length=202

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 113/181 (62%), Gaps = 26/181 (14%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            +  P+V+T LSS+LE++   ND                            +  + +S FH
Sbjct  8    SVMPKVITFLSSLLERVAESNDHN--------------------------QQHQKISVFH  41

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR   + P+  + + NVHRLL+T VM
Sbjct  42   GLTRPNISIHSYLERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINTFNVHRLLITSVM  101

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++V+   F+ YC +L +E+
Sbjct  102  VAAKFMDDMYYNNAYYAKVGGITKIEMNFLELDFLFGLGFHLNVTPGTFQAYCVNLQREM  161

Query  640  L  642
            L
Sbjct  162  L  162



>ref|XP_009800863.1| PREDICTED: cyclin-U4-1 [Nicotiana sylvestris]
Length=208

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 114/185 (62%), Gaps = 24/185 (13%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            +Q ++  P+++  LSS+L+++   ND                          G    + +
Sbjct  7    TQNQSLMPKLIDYLSSLLQRVAEAND------------------------INGRFQPQKI  42

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
            S FHG+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR     P+  + S N+HRLL+
Sbjct  43   SVFHGLTRPNISIQNYLERIFKYANCSPSCFVVAYVYLDRFTQCQPSLPINSFNIHRLLI  102

Query  448  TCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHL  627
            T VM+A+K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F+ YC +L
Sbjct  103  TSVMIAAKFMDDMYYNNAYYAKVGGISTTEMNFLEVDFLFGLGFRLNVTPTTFQTYCSYL  162

Query  628  DKEIL  642
             KE+L
Sbjct  163  QKEML  167



>ref|XP_009387832.1| PREDICTED: cyclin-P3-1-like [Musa acuminata subsp. malaccensis]
Length=222

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 115/176 (65%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVLT+LSS+LE  V +N++     LD                     + + ++ F G+R
Sbjct  32   PRVLTLLSSILEATVQKNEKK----LDS------------------LEIKEFVTLFDGMR  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP++SI KY+ERI+KY+ CSPSCFV+ Y+Y++R   + PN  + SLNVHRLL+  V+VA+
Sbjct  70   APTLSIKKYMERIFKYSKCSPSCFVLAYIYIERFLQQ-PNICLTSLNVHRLLIASVVVAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD  ++NA++A+VGG+S  E+N+LEI  LF +DF + V+   FE YC  L+KE
Sbjct  129  KFIDDAFFSNAYYAKVGGISTMEMNRLEINFLFSVDFRLQVTVGTFEAYCLRLEKE  184



>ref|XP_009760207.1| PREDICTED: cyclin-P3-1-like isoform X5 [Nicotiana sylvestris]
 ref|XP_009760208.1| PREDICTED: cyclin-P3-1-like isoform X5 [Nicotiana sylvestris]
Length=224

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 121/185 (65%), Gaps = 23/185 (12%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            G  + +   P++L+IL+SVLE+ V +N++                      +  G +   
Sbjct  22   GLEEYDKGHPKILSILASVLERTVQKNEK----------------------AMKGSKERG  59

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
             ++ FHG R+P +++ +YIERI+KY+NCSPSCFVV YVY++R  +   + L+ SLNVHR+
Sbjct  60   VVTVFHGTRSPVLTVQQYIERIFKYSNCSPSCFVVAYVYLERFLN-LTDCLLTSLNVHRI  118

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            L+T +++A K +DD+ YNNA++A+VGG++ AELNKLE++ L  LDF + VS + F+ YC 
Sbjct  119  LITSIVLAVKFVDDDCYNNAYYAKVGGITTAELNKLEMKFLAALDFRLHVSVESFDKYCL  178

Query  622  HLDKE  636
             L+KE
Sbjct  179  QLEKE  183



>ref|XP_010684268.1| PREDICTED: cyclin-P3-1-like [Beta vulgaris subsp. vulgaris]
Length=232

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 118/193 (61%), Gaps = 23/193 (12%)
 Frame = +1

Query  73   ALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFR  252
             L  P +    TPR L+++SS+LE  V +N+    L LD     +               
Sbjct  34   GLREPDKMGFKTPRFLSLISSLLENSVQKNE----LLLDTAEIEDV--------------  75

Query  253  LGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNV  432
                 +AFHG   P +SI +YIER+YKY  CSPSCFVV Y+Y+DR   +   + + SLNV
Sbjct  76   ----FTAFHGRSTPPVSIKQYIERMYKYAGCSPSCFVVAYIYVDRYLQQ-TKTYLTSLNV  130

Query  433  HRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFEC  612
            HRLLVT VMVA+K +DD  +NNA++A+VGG++ +E+N+LE++LLF +DF + V+ + F  
Sbjct  131  HRLLVTSVMVAAKFIDDSFFNNAYYAKVGGINTSEMNRLEMKLLFGVDFRLQVNVETFRR  190

Query  613  YCQHLDKEILQCN  651
            YC  LDKE+  C 
Sbjct  191  YCLLLDKEVGGCE  203



>ref|XP_006445448.1| hypothetical protein CICLE_v10022279mg [Citrus clementina]
 ref|XP_006464405.1| PREDICTED: cyclin-U4-1-like [Citrus sinensis]
 gb|ESR58688.1| hypothetical protein CICLE_v10022279mg [Citrus clementina]
 gb|KDO85467.1| hypothetical protein CISIN_1g028611mg [Citrus sinensis]
Length=206

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +1

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            + +S FHG+  PSISI  Y+ERI+KY NCSPSCF+V YVY+DR   + P+  + S NVHR
Sbjct  37   QKISVFHGLTRPSISIQSYLERIFKYANCSPSCFIVAYVYLDRFVQRQPSLPINSFNVHR  96

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LL+T VMVA+K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  YC
Sbjct  97   LLITSVMVAAKFLDDMYYNNAYYAKVGGISTIEMNFLELDFLFGLSFHLNVTPNAFHTYC  156

Query  619  QHLDKEIL  642
             +L +E+L
Sbjct  157  TYLQREML  164



>ref|XP_002526473.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF35864.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=203

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 113/178 (63%), Gaps = 24/178 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++T LSS+L+++   ND    L L   T                    + +S FHG+ 
Sbjct  11   PKLITFLSSLLQRVAESND----LNLQIHT--------------------QKISVFHGLT  46

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR A + P+  + S NVHRLL+T VMVA+
Sbjct  47   RPTISIQNYLERIFKYANCSPSCFIVAYVYLDRFAQRQPSLPLNSFNVHRLLITSVMVAA  106

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L +E++
Sbjct  107  KFMDDMYYNNAYYAKVGGISTIEMNYLEVDFLFGLGFHLNVTPNTFHTYSSYLQREMM  164



>ref|XP_006838523.1| hypothetical protein AMTR_s00002p00190080 [Amborella trichopoda]
 gb|ERN01092.1| hypothetical protein AMTR_s00002p00190080 [Amborella trichopoda]
Length=227

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 114/182 (63%), Gaps = 21/182 (12%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRV+ +LS +L+++  +ND                        + G    + +S FHG+ 
Sbjct  19   PRVIRLLSFLLQRVAEKNDE---------------------RENEGPCFSQKISVFHGIC  57

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ER++KY NCSPSCFVV YVY+DR + +     + SL+VHRLL+T V+VA+
Sbjct  58   RPAISIESYLERVFKYANCSPSCFVVAYVYLDRFSQRQQTLPITSLSVHRLLITSVLVAA  117

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  YC HL +E+ +C
Sbjct  118  KFMDDLYYNNAYYAKVGGISITEMNCLEVDFLFGLGFHLNVTPTAFNSYCTHLQREMFEC  177

Query  649  NG  654
             G
Sbjct  178  IG  179



>ref|XP_010258734.1| PREDICTED: cyclin-U4-1-like [Nelumbo nucifera]
Length=189

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 111/177 (63%), Gaps = 24/177 (14%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+V+T LSS+L+++   ND                        S  F   K +S FHG+ 
Sbjct  11   PKVITFLSSMLQRVSESND-----------------------VSRRFEPQK-ISVFHGLT  46

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCFVV Y+Y+DR A K P+  + S NVHRLL+T VMVA+
Sbjct  47   RPTISIQSYLERIFKYANCSPSCFVVAYIYLDRFAQKQPSLPINSFNVHRLLITSVMVAA  106

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            K +DD +YNNA++A+VGG+   E+N LE++ LF L F ++V+   F  YC ++ +E+
Sbjct  107  KFMDDMYYNNAYYAKVGGIITTEMNYLEVDFLFGLSFHLNVTPSTFHTYCSYIQREM  163



>gb|ACU24636.1| unknown [Glycine max]
Length=188

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 112/178 (63%), Gaps = 23/178 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P++++ LSS+L+++   ND            N                + + +S FHG+ 
Sbjct  11   PKLISFLSSLLKRVAESNDL-----------NQQQ------------LIHQKVSVFHGLT  47

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR   + P+S + S NVHRL +T VMVA+
Sbjct  48   RPTISIQSYLERIFKYANCSPSCFIVAYVYLDRFTQRQPSSPINSFNVHRLPITSVMVAA  107

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++V+   F+ YC HL  E+L
Sbjct  108  KFMDDLYYNNAYYAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEML  165



>ref|XP_009760205.1| PREDICTED: cyclin-P3-1-like isoform X4 [Nicotiana sylvestris]
Length=256

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 121/185 (65%), Gaps = 23/185 (12%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            G  + +   P++L+IL+SVLE+ V +N++                      +  G +   
Sbjct  54   GLEEYDKGHPKILSILASVLERTVQKNEK----------------------AMKGSKERG  91

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
             ++ FHG R+P +++ +YIERI+KY+NCSPSCFVV YVY++R  +   + L+ SLNVHR+
Sbjct  92   VVTVFHGTRSPVLTVQQYIERIFKYSNCSPSCFVVAYVYLERFLN-LTDCLLTSLNVHRI  150

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            L+T +++A K +DD+ YNNA++A+VGG++ AELNKLE++ L  LDF + VS + F+ YC 
Sbjct  151  LITSIVLAVKFVDDDCYNNAYYAKVGGITTAELNKLEMKFLAALDFRLHVSVESFDKYCL  210

Query  622  HLDKE  636
             L+KE
Sbjct  211  QLEKE  215



>gb|KHN22156.1| Cyclin-U4-1 [Glycine soja]
Length=206

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 113/178 (63%), Gaps = 23/178 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P++++ LSS+L+++   ND      L+                     + + +S FHG+ 
Sbjct  11   PKLISFLSSLLKRVAESND------LNQQQ-----------------LIHQKVSVFHGLT  47

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR   + P+  + S NVHRLL+T VMVA+
Sbjct  48   RPTISIQSYLERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAA  107

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++V+   F+ YC HL  E+L
Sbjct  108  KFMDDLYYNNAYYAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEML  165



>ref|XP_009760204.1| PREDICTED: cyclin-P3-1-like isoform X3 [Nicotiana sylvestris]
Length=257

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 121/185 (65%), Gaps = 23/185 (12%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            G  + +   P++L+IL+SVLE+ V +N++                      +  G +   
Sbjct  55   GLEEYDKGHPKILSILASVLERTVQKNEK----------------------AMKGSKERG  92

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
             ++ FHG R+P +++ +YIERI+KY+NCSPSCFVV YVY++R  +   + L+ SLNVHR+
Sbjct  93   VVTVFHGTRSPVLTVQQYIERIFKYSNCSPSCFVVAYVYLERFLN-LTDCLLTSLNVHRI  151

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            L+T +++A K +DD+ YNNA++A+VGG++ AELNKLE++ L  LDF + VS + F+ YC 
Sbjct  152  LITSIVLAVKFVDDDCYNNAYYAKVGGITTAELNKLEMKFLAALDFRLHVSVESFDKYCL  211

Query  622  HLDKE  636
             L+KE
Sbjct  212  QLEKE  216



>ref|XP_006295023.1| hypothetical protein CARUB_v10024094mg [Capsella rubella]
 gb|EOA27921.1| hypothetical protein CARUB_v10024094mg [Capsella rubella]
Length=199

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 118/202 (58%), Gaps = 25/202 (12%)
 Frame = +1

Query  112  RVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRA  291
            +++  LSS+LE++   ND+   +                          + +S FHG+  
Sbjct  12   KLIAFLSSLLERVAESNDQTRRVTTQS----------------------QRVSVFHGLSR  49

Query  292  PSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASK  471
            P+I+I  Y+ERI+KY NCSPSCFVV YVY+DR  H+ P+  + S NVHRLL+T VMVA+K
Sbjct  50   PTITIQSYLERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAK  109

Query  472  ILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQCN  651
             LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L KE+    
Sbjct  110  FLDDLYYNNAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFHAYFSYLQKEMTLLQ  169

Query  652  GIGADATIINIIQRGVEALDDD  717
             +   + ++    R V   +DD
Sbjct  170  PL---SLVVVPSSRSVITFNDD  188



>gb|EYU46584.1| hypothetical protein MIMGU_mgv1a013898mg [Erythranthe guttata]
Length=207

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 116/187 (62%), Gaps = 23/187 (12%)
 Frame = +1

Query  76   LPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL  255
            L G  +     P VL++LS+ LE+ V +N+R         T   +D              
Sbjct  21   LKGSRKDNIGKPGVLSLLSTFLERSVQKNER---------TMETSDTKDV----------  61

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
               ++ FHG+ APS+SI +YI+RI+KY+ CSPSCFV+  +YMDR   +   SL  SLN+H
Sbjct  62   ---ITIFHGLCAPSLSIEQYIDRIFKYSCCSPSCFVIANIYMDRFMQRTNLSLN-SLNIH  117

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T VMVA+K +DD  +NNA++ARVGGVS AELNKLE++ LF LDF + VS Q F  Y
Sbjct  118  RLLITSVMVAAKFIDDAFFNNAYYARVGGVSTAELNKLEMKFLFSLDFRLHVSVQTFRKY  177

Query  616  CQHLDKE  636
            C  L +E
Sbjct  178  CALLKQE  184



>gb|KCW58844.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
Length=215

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 115/177 (65%), Gaps = 23/177 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL +LSS L++ V +N+RL        T  + D                 ++ FHGVR
Sbjct  30   PRVLMLLSSALDRSVQKNERLL------ETSQSKD----------------VITIFHGVR  67

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+++I +YIERI+KY+ CSPSCFV+  +YMDR      + L+ SLNVHRLL+T + VA+
Sbjct  68   PPALTIRQYIERIFKYSACSPSCFVIAQIYMDRFVQN-TDVLLTSLNVHRLLITSLTVAA  126

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            K +DD  +NNA++A+VGGVS +ELN+LE++ LF +DF + VS   F+ YC  L+KE+
Sbjct  127  KFVDDAFFNNAYYAKVGGVSTSELNRLEMKFLFSIDFRLHVSIDTFQRYCLLLEKEV  183



>gb|KDP28881.1| hypothetical protein JCGZ_14652 [Jatropha curcas]
Length=206

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 114/177 (64%), Gaps = 24/177 (14%)
 Frame = +1

Query  112  RVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRA  291
            +++T LSS+L+++   ND                        ++ F+  K +S FHG+  
Sbjct  12   KLITFLSSLLQRVAESND-----------------------LNSQFQPQK-ISVFHGLTR  47

Query  292  PSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASK  471
            P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR A + P+  + S NVHRLL+T V+VA+K
Sbjct  48   PTISIQSYLERIFKYANCSPSCFIVAYVYLDRFAQRQPSLPINSFNVHRLLITSVLVAAK  107

Query  472  ILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
             +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  YC +L +E++
Sbjct  108  FMDDMYYNNAYYAKVGGISTIEMNYLEVDFLFGLGFHLNVTPNTFHTYCSYLQREMM  164



>ref|XP_006349678.1| PREDICTED: cyclin-P3-1-like isoform X2 [Solanum tuberosum]
Length=217

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 118/182 (65%), Gaps = 23/182 (13%)
 Frame = +1

Query  91   QPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLS  270
            + ++  PRVL++LS++LE+ V  N+ L    L+     +                   ++
Sbjct  26   KEKSGKPRVLSLLSTLLERSVQNNESL----LESSQSEDV------------------IT  63

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FHG RAPS+SI +Y++RIYKY+ CSPSCFVV ++YM+R   +   + + SLNVHRLL+T
Sbjct  64   IFHGSRAPSLSIEQYLDRIYKYSCCSPSCFVVAHIYMERFI-ECTGAHLTSLNVHRLLIT  122

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
             VMVA+K +DD  YNNA++ARVGGV+  ELNKLE++ LF LDF + V+ Q F  YC  L+
Sbjct  123  SVMVAAKFIDDAFYNNAYYARVGGVTTKELNKLEMKFLFGLDFQLHVNVQTFGSYCSLLE  182

Query  631  KE  636
            KE
Sbjct  183  KE  184



>ref|XP_010109140.1| hypothetical protein L484_017079 [Morus notabilis]
 gb|EXC21069.1| hypothetical protein L484_017079 [Morus notabilis]
Length=205

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 113/189 (60%), Gaps = 24/189 (13%)
 Frame = +1

Query  76   LPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL  255
            L  P     A PRV+  LSS+L+++   ND                        +  F  
Sbjct  4    LESPVSSAAAMPRVIGFLSSLLQRVAESND-----------------------VNRRFEP  40

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
             K +S FHG+  P+ISI  Y++RI+KY NCSPSCFVV YVY+DR     P   + S NVH
Sbjct  41   QK-ISVFHGLTRPTISIESYLQRIFKYANCSPSCFVVAYVYLDRFTQCQPLLPINSFNVH  99

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLLVT VMV++K +DD +YNNA++A+VGG+S AE+N LE++ LF L F ++V+   F  Y
Sbjct  100  RLLVTSVMVSAKFVDDLYYNNAYYAKVGGISTAEMNLLELDFLFGLSFQLNVTPTTFHSY  159

Query  616  CQHLDKEIL  642
            C +L +E+L
Sbjct  160  CSYLQREML  168



>ref|XP_004304998.1| PREDICTED: cyclin-P3-1-like [Fragaria vesca subsp. vesca]
Length=228

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 123/209 (59%), Gaps = 33/209 (16%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T  PRVL++LSS+LE+ V +N++L                          ++   ++ FH
Sbjct  22   TEKPRVLSVLSSILERSVQKNEKLV----------------------RASKMKDVVTMFH  59

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
               AP++SI KYIERI+KY++CS SCFVV Y+YM+R   +    L  SLNVHRLL+T ++
Sbjct  60   ASEAPALSITKYIERIFKYSSCSNSCFVVAYIYMERFLQRTGTCLT-SLNVHRLLITSIL  118

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K +D + Y+N ++A+VGGVS  E+N LE+  L  LDF + V++++FE YCQ L+   
Sbjct  119  VAAKFMDVDCYSNGYYAKVGGVSIGEMNNLEMTFLLSLDFKLHVTTEMFEKYCQQLE---  175

Query  640  LQCNGIGADATIINIIQRGVEALDDDITL  726
                 +G   T      R V+ L DD T+
Sbjct  176  ----DVGGHQTGHF---RKVQTLKDDWTI  197



>ref|XP_006376963.1| hypothetical protein POPTR_0012s11610g [Populus trichocarpa]
 gb|ERP54760.1| hypothetical protein POPTR_0012s11610g [Populus trichocarpa]
Length=225

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 111/181 (61%), Gaps = 24/181 (13%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T  P+V+T LSS+L+++   ND    L                          + +S FH
Sbjct  32   TVMPKVITFLSSLLQRVAESNDLSQQL------------------------YPQKVSIFH  67

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+  P ISI  Y+ERI+KY NCSPSCFVV YVY+DR A +     + S NVHRLL+T V+
Sbjct  68   GLSRPPISIQNYLERIFKYANCSPSCFVVAYVYLDRFAQRQSCFPINSFNVHRLLITSVL  127

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            ++ K +DD +YNNAF+A+VGG+S AE+N LE++ LF L F ++V+  +F  YC +L +E+
Sbjct  128  ISVKFMDDIYYNNAFYAKVGGISTAEMNLLEVDFLFGLGFQLNVTPTMFHAYCSYLQREM  187

Query  640  L  642
            L
Sbjct  188  L  188



>ref|XP_006349677.1| PREDICTED: cyclin-P3-1-like isoform X1 [Solanum tuberosum]
Length=223

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 118/182 (65%), Gaps = 23/182 (13%)
 Frame = +1

Query  91   QPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLS  270
            + ++  PRVL++LS++LE+ V  N+ L    L+     +                   ++
Sbjct  32   KEKSGKPRVLSLLSTLLERSVQNNESL----LESSQSEDV------------------IT  69

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FHG RAPS+SI +Y++RIYKY+ CSPSCFVV ++YM+R   +   + + SLNVHRLL+T
Sbjct  70   IFHGSRAPSLSIEQYLDRIYKYSCCSPSCFVVAHIYMERFI-ECTGAHLTSLNVHRLLIT  128

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
             VMVA+K +DD  YNNA++ARVGGV+  ELNKLE++ LF LDF + V+ Q F  YC  L+
Sbjct  129  SVMVAAKFIDDAFYNNAYYARVGGVTTKELNKLEMKFLFGLDFQLHVNVQTFGSYCSLLE  188

Query  631  KE  636
            KE
Sbjct  189  KE  190



>emb|CDX83419.1| BnaA03g20870D [Brassica napus]
Length=200

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 119/203 (59%), Gaps = 26/203 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++  LS++LE++   ND    L     T + +D                  S FHG+ 
Sbjct  11   PKLIAFLSALLERVAESND----LTRRVTTQSQSD------------------SVFHGLS  48

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             PSI+I  Y+ERIYKY NCS SCFVV YVY+DR  H+ P+  + S NVHRLL+T VM A+
Sbjct  49   RPSITIQSYLERIYKYANCSSSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMTAA  108

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L KE+   
Sbjct  109  KFLDDLYYNNAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLQKEMTLL  168

Query  649  NGIGADATIINIIQRGVEALDDD  717
              +    +++ +  R V   +D+
Sbjct  169  QPL----SLVVVPPRSVITFNDE  187



>ref|XP_009133684.1| PREDICTED: cyclin-U4-1-like [Brassica rapa]
Length=199

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 120/203 (59%), Gaps = 26/203 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++  LS++LE++   ND    L     T + +D                  S FHG+ 
Sbjct  11   PKLIAFLSALLERVAESND----LTRRVTTQSQSD------------------SVFHGLS  48

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             PSI+I  Y+ERIYKY +CS SCFVV YVY+DR  H+ P+  + S NVHRLL+T VM+A+
Sbjct  49   RPSITIQSYLERIYKYADCSSSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMIAA  108

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L KE+   
Sbjct  109  KFLDDLYYNNAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLRKEMTLL  168

Query  649  NGIGADATIINIIQRGVEALDDD  717
              +    +++ +  R V   +DD
Sbjct  169  QPL----SLVVVPPRSVITFNDD  187



>emb|CDY48257.1| BnaC04g05160D [Brassica napus]
Length=199

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 119/203 (59%), Gaps = 26/203 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++  LSS+LE++   ND    +                          +S+S F G+ 
Sbjct  11   PKLIAFLSSLLERVSESNDLTRRVATQS----------------------QSVSVFDGLS  48

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             PSI++  Y+ERI+KY NCSPSCFVV YVY+DR  H+ P+  + S NVHRLL+T VMV++
Sbjct  49   RPSITVQSYLERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSA  108

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L KE+   
Sbjct  109  KFLDDRYYNNAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLKKEMTLL  168

Query  649  NGIGADATIINIIQRGVEALDDD  717
              +    +++ +  R V   +D+
Sbjct  169  QPL----SLVLVPPRSVLTFNDE  187



>ref|XP_010938790.1| PREDICTED: cyclin-P3-1-like isoform X1 [Elaeis guineensis]
Length=248

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 129/214 (60%), Gaps = 36/214 (17%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T  PR+L++LSS L++ V +N++L    LD                    ++ + ++ FH
Sbjct  29   TEFPRILSLLSSHLDRAVQKNEKL----LDSK------------------KIKEIVTIFH  66

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+RAP++SI KY+ERI+KY+ CSPSCFV+ ++Y+D+   +    L  SLNVHRLL+T V+
Sbjct  67   GLRAPNLSIQKYVERIFKYSKCSPSCFVLAHIYIDKFLQQSDIHLT-SLNVHRLLITSVV  125

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K +DD  +NNA++A+VGG+S  E+N+LE+  LF LDF + V    F  YC  L+KE 
Sbjct  126  VAAKFIDDAFFNNAYYAKVGGISTVEMNRLELNFLFSLDFRLQVDLDTFGKYCLQLEKEA  185

Query  640  LQCNGIGADATIINIIQRGVEA--LDDDITLASS  735
              CN           ++R ++   LDD  T+  S
Sbjct  186  TVCN-----------VERPIQVCRLDDWTTVEDS  208



>ref|XP_003552477.1| PREDICTED: cyclin-U4-1-like [Glycine max]
Length=205

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 117/190 (62%), Gaps = 24/190 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P++++ LSS+L+++   ND            N                L + +S FHG+ 
Sbjct  11   PKLISFLSSLLKRVAESNDL-----------NQQQ------------LLHQKVSVFHGLT  47

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR   + P+  +   NVHRLL+T VMVA+
Sbjct  48   RPTISIQSYLERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINFFNVHRLLITSVMVAA  107

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++V+   F+ YC HL  E+L  
Sbjct  108  KFMDDLYYNNAYYAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEMLLM  167

Query  649  NGIG-ADATI  675
              +  AD+++
Sbjct  168  QPLNFADSSL  177



>ref|XP_008246475.1| PREDICTED: cyclin-P3-1 [Prunus mume]
Length=196

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 120/190 (63%), Gaps = 23/190 (12%)
 Frame = +1

Query  67   FPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAG  246
            F A+    +  T TPRVL+++SSVLE+ + +N++L                        G
Sbjct  11   FIAVGILEESATRTPRVLSVVSSVLERSIRKNEKL----------------------IRG  48

Query  247  FRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISL  426
             ++   ++ FH    P++SI +YIERI+KY++CSPSCFVV Y+Y++R   +    L  SL
Sbjct  49   SKMKDVITMFHASEVPALSIRRYIERIFKYSSCSPSCFVVAYIYIERFLQRRGICLT-SL  107

Query  427  NVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVF  606
            N+HRLL+T ++VA+K +DDE Y+NA++A++GGVS +ELNKLEIE L  LDF + V+   F
Sbjct  108  NIHRLLITSIVVAAKFMDDECYSNAYYAKIGGVSLSELNKLEIEFLLSLDFKLHVTIDTF  167

Query  607  ECYCQHLDKE  636
              YC+ L+ E
Sbjct  168  GKYCRQLEDE  177



>ref|XP_009143062.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-U4-1 [Brassica rapa]
Length=199

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 119/203 (59%), Gaps = 26/203 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P++++ LSS+LE++   ND    +                          +S+S F G+ 
Sbjct  11   PKLISFLSSLLERVSESNDLTRRVTTQS----------------------QSVSVFEGLS  48

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P I+I  Y+ERI+KY NCSPSCFVV YVY+DR  H+ P+  + S NVHRLL+T VMV++
Sbjct  49   RPPITIQSYLERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSA  108

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L KE+   
Sbjct  109  KFLDDRYYNNAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLKKEM---  165

Query  649  NGIGADATIINIIQRGVEALDDD  717
              +    +++ +  R V   +D+
Sbjct  166  -TLLQPXSLVLVPSRPVLTFNDE  187



>ref|XP_007050616.1| Cyclin p1,1 isoform 1 [Theobroma cacao]
 gb|EOX94773.1| Cyclin p1,1 isoform 1 [Theobroma cacao]
Length=218

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 23/177 (13%)
 Frame = +1

Query  106  TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGV  285
            TPR+L++LSS+LEK V +N+      +   T +  D                S++ FHG+
Sbjct  31   TPRILSLLSSLLEKSVQKNE------MQSETVDIKD----------------SVAIFHGL  68

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
            RAP+ISI +YI+RI+KY  CSPSCFVV Y+Y+DR   +    L  SLNVHRLL+T VMVA
Sbjct  69   RAPTISIQQYIDRIFKYAGCSPSCFVVAYIYVDRFVQQTDVHLT-SLNVHRLLITSVMVA  127

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            +K +DD  +NNA++ARVGG+S AELN+LE++ LF LDF + VS   F+ YC  L KE
Sbjct  128  AKFIDDAFFNNAYYARVGGISTAELNRLEMKFLFSLDFRLQVSVNTFQRYCSQLQKE  184



>ref|XP_010938791.1| PREDICTED: cyclin-P3-1-like isoform X2 [Elaeis guineensis]
Length=232

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 129/214 (60%), Gaps = 36/214 (17%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T  PR+L++LSS L++ V +N++L    LD                    ++ + ++ FH
Sbjct  29   TEFPRILSLLSSHLDRAVQKNEKL----LDSK------------------KIKEIVTIFH  66

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+RAP++SI KY+ERI+KY+ CSPSCFV+ ++Y+D+   +    L  SLNVHRLL+T V+
Sbjct  67   GLRAPNLSIQKYVERIFKYSKCSPSCFVLAHIYIDKFLQQSDIHLT-SLNVHRLLITSVV  125

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K +DD  +NNA++A+VGG+S  E+N+LE+  LF LDF + V    F  YC  L+KE 
Sbjct  126  VAAKFIDDAFFNNAYYAKVGGISTVEMNRLELNFLFSLDFRLQVDLDTFGKYCLQLEKEA  185

Query  640  LQCNGIGADATIINIIQRGVEA--LDDDITLASS  735
              CN           ++R ++   LDD  T+  S
Sbjct  186  TVCN-----------VERPIQVCRLDDWTTVEDS  208



>ref|XP_010089785.1| hypothetical protein L484_008035 [Morus notabilis]
 gb|EXB38377.1| hypothetical protein L484_008035 [Morus notabilis]
Length=210

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +1

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            + +S FHG+  P+ISI  Y+ERI+KY NCSPSC+VV YVY+DR A + P+  + SLNVHR
Sbjct  39   QKISVFHGLTRPTISIQSYLERIFKYANCSPSCYVVAYVYLDRFAQRQPSLPINSLNVHR  98

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LL+T VMVA+K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++VS   F+ YC
Sbjct  99   LLITSVMVAAKFMDDMYYNNAYYAKVGGINTREMNFLEVDFLFGLGFHLNVSPTTFQTYC  158

Query  619  QHLDKEIL  642
             +L +E+L
Sbjct  159  CYLQREML  166



>ref|XP_009760202.1| PREDICTED: cyclin-P3-1-like isoform X1 [Nicotiana sylvestris]
Length=268

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 121/185 (65%), Gaps = 23/185 (12%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            G  + +   P++L+IL+SVLE+ V +N++                      +  G +   
Sbjct  66   GLEEYDKGHPKILSILASVLERTVQKNEK----------------------AMKGSKERG  103

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
             ++ FHG R+P +++ +YIERI+KY+NCSPSCFVV YVY++R  +   + L+ SLNVHR+
Sbjct  104  VVTVFHGTRSPVLTVQQYIERIFKYSNCSPSCFVVAYVYLERFLN-LTDCLLTSLNVHRI  162

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            L+T +++A K +DD+ YNNA++A+VGG++ AELNKLE++ L  LDF + VS + F+ YC 
Sbjct  163  LITSIVLAVKFVDDDCYNNAYYAKVGGITTAELNKLEMKFLAALDFRLHVSVESFDKYCL  222

Query  622  HLDKE  636
             L+KE
Sbjct  223  QLEKE  227



>gb|KHN40524.1| Cyclin-U4-1 [Glycine soja]
Length=205

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 117/190 (62%), Gaps = 24/190 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P++++ LSS+L+++   ND            N                L + +S FHG+ 
Sbjct  11   PKLISFLSSLLKRVAESNDL-----------NQQQ------------LLHQKVSVFHGLT  47

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR   + P+  +   NVHRLL+T VMVA+
Sbjct  48   RPTISIQSYLERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINFFNVHRLLITSVMVAA  107

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++V+   F+ YC HL  E+L  
Sbjct  108  KFMDDLYYNNAYYAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEMLLM  167

Query  649  NGIG-ADATI  675
              +  AD+++
Sbjct  168  QPLNFADSSL  177



>ref|XP_006421507.1| hypothetical protein CICLE_v10005725mg [Citrus clementina]
 gb|ESR34747.1| hypothetical protein CICLE_v10005725mg [Citrus clementina]
Length=246

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 115/189 (61%), Gaps = 24/189 (13%)
 Frame = +1

Query  76   LPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL  255
            L G  +     P+++T+LSS+L+++   ND                        S  F  
Sbjct  45   LEGHQEEAAVMPKLITVLSSLLQRVAESND-----------------------ISQRFHP  81

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
             K +S FHG+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR A K  +  + S NVH
Sbjct  82   QK-ISVFHGLTRPTISIHSYLERIFKYANCSPSCFVVAYVYLDRFAQKQTSLPINSFNVH  140

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T V+V++K +DD +YNNAF+A+VGGVS  E+N LE++ LF L F ++V+   F  Y
Sbjct  141  RLLITSVLVSAKFMDDIYYNNAFYAKVGGVSTTEMNLLEVDFLFALGFQLNVTPAAFYTY  200

Query  616  CQHLDKEIL  642
            C +L +E+ 
Sbjct  201  CSYLQREMF  209



>ref|XP_010070213.1| PREDICTED: cyclin-P3-1 isoform X2 [Eucalyptus grandis]
 gb|KCW58845.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
Length=228

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 115/177 (65%), Gaps = 23/177 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL +LSS L++ V +N+RL        T  + D                 ++ FHGVR
Sbjct  43   PRVLMLLSSALDRSVQKNERLL------ETSQSKD----------------VITIFHGVR  80

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+++I +YIERI+KY+ CSPSCFV+  +YMDR      + L+ SLNVHRLL+T + VA+
Sbjct  81   PPALTIRQYIERIFKYSACSPSCFVIAQIYMDRFVQN-TDVLLTSLNVHRLLITSLTVAA  139

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            K +DD  +NNA++A+VGGVS +ELN+LE++ LF +DF + VS   F+ YC  L+KE+
Sbjct  140  KFVDDAFFNNAYYAKVGGVSTSELNRLEMKFLFSIDFRLHVSIDTFQRYCLLLEKEV  196



>ref|XP_009760203.1| PREDICTED: cyclin-P3-1-like isoform X2 [Nicotiana sylvestris]
Length=267

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 121/185 (65%), Gaps = 23/185 (12%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            G  + +   P++L+IL+SVLE+ V +N++                      +  G +   
Sbjct  65   GLEEYDKGHPKILSILASVLERTVQKNEK----------------------AMKGSKERG  102

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
             ++ FHG R+P +++ +YIERI+KY+NCSPSCFVV YVY++R  +   + L+ SLNVHR+
Sbjct  103  VVTVFHGTRSPVLTVQQYIERIFKYSNCSPSCFVVAYVYLERFLN-LTDCLLTSLNVHRI  161

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            L+T +++A K +DD+ YNNA++A+VGG++ AELNKLE++ L  LDF + VS + F+ YC 
Sbjct  162  LITSIVLAVKFVDDDCYNNAYYAKVGGITTAELNKLEMKFLAALDFRLHVSVESFDKYCL  221

Query  622  HLDKE  636
             L+KE
Sbjct  222  QLEKE  226



>ref|XP_004290653.1| PREDICTED: cyclin-P3-1-like [Fragaria vesca subsp. vesca]
Length=214

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 128/212 (60%), Gaps = 38/212 (18%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL+ LSS+LE+ V  N+    + ++                       K ++ FHG+R
Sbjct  33   PRVLSPLSSLLERSVQSNE----MHMEATEI-------------------KEVTIFHGLR  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP +SI +YI+R++KY+ CSPSCFVV  +Y+DR        L  S NVHRLL+T VM+A+
Sbjct  70   APPLSIRQYIDRVFKYSGCSPSCFVVAKIYVDRYLQSTQVHLT-SFNVHRLLITSVMLAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD  +NNA++A+VGGVS AELN+LE++ LF +DF + VS   F+ YC HL+KE    
Sbjct  129  KFIDDAFFNNAYYAKVGGVSTAELNRLEMKFLFSIDFRLQVSIDTFKKYCSHLEKE----  184

Query  649  NGIGADATIINIIQRGVEA---LDDDITLASS  735
                     ++ I+R ++A    +D+I +ASS
Sbjct  185  -------AAVHQIERSIQACGIKEDEIVIASS  209



>ref|XP_003636176.1| Cyclin-U4-1 [Medicago truncatula]
 gb|ACJ84314.1| unknown [Medicago truncatula]
 gb|AFK49541.1| unknown [Medicago truncatula]
 gb|KEH17921.1| cyclin p4 [Medicago truncatula]
Length=200

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 115/190 (61%), Gaps = 27/190 (14%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++  LSS+LE++   ND          T N+                   +S FHG+ 
Sbjct  10   PKLINFLSSLLERVAESNDE---------TQNH-----------------HKISIFHGLS  43

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCS SCF+V YVY+DR     P+  + S NVHRLL+T VMVA+
Sbjct  44   RPNISIQSYLERIFKYANCSSSCFIVAYVYLDRFTQTQPSLPINSFNVHRLLITSVMVAA  103

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD  YNNA++A+VGG++  E+N LE++ LF L F ++V+   F+ YC HL +E+LQ 
Sbjct  104  KFMDDVCYNNAYYAKVGGITKTEMNFLELDFLFGLGFNLNVTPVTFQAYCVHLQREMLQM  163

Query  649  NG-IGADATI  675
               +  D+T+
Sbjct  164  QPLVFEDSTL  173



>ref|XP_003624270.1| Cyclin-dependent protein kinase regulator Pho80 [Medicago truncatula]
 gb|AES80488.1| cyclin p4 [Medicago truncatula]
Length=203

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 110/178 (62%), Gaps = 24/178 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++  LSS+L+++   ND    L                        L + +S F G+ 
Sbjct  11   PKLIAFLSSLLKRVAESNDINQQL------------------------LEQKISVFQGLT  46

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR   + P+  + S NVHRLL+T VMVA+
Sbjct  47   CPNISIQNYLERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAA  106

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++V+   F+ YC HL  E++
Sbjct  107  KFMDDMYYNNAYYAKVGGITTIEMNFLELDFLFGLGFHLNVTPNTFQAYCVHLQSEMM  164



>ref|XP_010070212.1| PREDICTED: cyclin-P3-1 isoform X1 [Eucalyptus grandis]
 gb|KCW58846.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
 gb|KCW58847.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
Length=239

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 115/177 (65%), Gaps = 23/177 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL +LSS L++ V +N+RL        T  + D                 ++ FHGVR
Sbjct  54   PRVLMLLSSALDRSVQKNERLL------ETSQSKD----------------VITIFHGVR  91

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+++I +YIERI+KY+ CSPSCFV+  +YMDR      + L+ SLNVHRLL+T + VA+
Sbjct  92   PPALTIRQYIERIFKYSACSPSCFVIAQIYMDRFVQN-TDVLLTSLNVHRLLITSLTVAA  150

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            K +DD  +NNA++A+VGGVS +ELN+LE++ LF +DF + VS   F+ YC  L+KE+
Sbjct  151  KFVDDAFFNNAYYAKVGGVSTSELNRLEMKFLFSIDFRLHVSIDTFQRYCLLLEKEV  207



>emb|CDY30482.1| BnaA04g25830D [Brassica napus]
 emb|CDY23452.1| BnaC04g49800D [Brassica napus]
Length=201

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 118/203 (58%), Gaps = 26/203 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++  LSS+LE++   ND    +                          +S+S FHG+ 
Sbjct  11   PKLIAFLSSLLERVAESNDLTRRVTTQS----------------------QSVSVFHGLS  48

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+I+I  Y+ERI+KY NCSPSCFVV YVY+DR   + P+  + S NVHRLL+T VMV++
Sbjct  49   RPTITIQSYLERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVSA  108

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V    F  Y  +L KE+   
Sbjct  109  KFLDDLYYNNAYYAKVGGISTKEMNLLELDFLFGLGFDLNVKPNTFHAYFSYLQKEMTLV  168

Query  649  NGIGADATIINIIQRGVEALDDD  717
              +    +++ +  R V   +D+
Sbjct  169  QPL----SLVVVPPRSVITFNDE  187



>ref|XP_011003554.1| PREDICTED: cyclin-U4-1-like [Populus euphratica]
Length=225

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 112/181 (62%), Gaps = 24/181 (13%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T  P+V+T LSS+L+++   ND    L                          + +S FH
Sbjct  32   TVMPKVITFLSSLLQRVAESNDLSQQL------------------------YPQKVSIFH  67

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR + +     + S NVHRLL+T V+
Sbjct  68   GLSRPAISIQNYLERIFKYANCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITSVL  127

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            V+ K +DD +YNNAF+A+VGG+S AE+N LE++ LF L F ++V+  +F  YC +L +E+
Sbjct  128  VSVKFMDDIYYNNAFYAKVGGISTAEMNLLEVDFLFGLGFQLNVTPTMFHAYCSYLQREM  187

Query  640  L  642
            L
Sbjct  188  L  188



>ref|XP_008453846.1| PREDICTED: cyclin-U4-1-like [Cucumis melo]
Length=207

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 113/189 (60%), Gaps = 21/189 (11%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            G  +     P+V+  LSSVL+++   ND+   +  +G   NN  G               
Sbjct  5    GEKEEMVGIPKVINYLSSVLQRVSESNDQEDRMMNNGTKRNNYSG---------------  49

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHK-YPNSLVI-SLNVH  435
                F G+  PSISI  Y+ERI+KY NCSPSCFVV YVY+ R  H  +P++  I S NVH
Sbjct  50   ----FDGISRPSISIQSYLERIFKYANCSPSCFVVAYVYLHRFLHNHHPSNFHIDSFNVH  105

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T V+V++K  DD +YNNA++A+VGG+S  E+N LE++ LF L F ++VS   F  Y
Sbjct  106  RLLITSVLVSAKFFDDLYYNNAYYAKVGGISTMEMNLLELDFLFGLRFQLNVSPNTFHIY  165

Query  616  CQHLDKEIL  642
            C +L  E+L
Sbjct  166  CSYLQSEML  174



>ref|XP_010524444.1| PREDICTED: cyclin-U4-1 [Tarenaya hassleriana]
Length=191

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 113/194 (58%), Gaps = 25/194 (13%)
 Frame = +1

Query  94   PETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSA  273
            PE   P+++  LSS+LE++   ND    L     T                    + +S 
Sbjct  7    PE-VMPKLIAFLSSLLERVAETND----LSRRIQT--------------------QKISV  41

Query  274  FHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTC  453
            FHG+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR  H  P+  + S N+HRLL+T 
Sbjct  42   FHGITRPTISIHNYLERIFKYANCSPSCFVVAYVYLDRFTHLQPSLPITSFNLHRLLITS  101

Query  454  VMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDK  633
            VMV++K LDD +YNNA++A++GG+  AE+N LE++ LF L F ++V+   F  Y  +L K
Sbjct  102  VMVSAKFLDDIYYNNAYYAKIGGIGTAEMNFLELDFLFGLGFDLNVTPNTFHAYLSYLHK  161

Query  634  EILQCNGIGADATI  675
            E +    I     I
Sbjct  162  ETMLLQPIPVRPVI  175



>ref|XP_010508257.1| PREDICTED: cyclin-U4-1 [Camelina sativa]
 ref|XP_010508258.1| PREDICTED: cyclin-U4-1 [Camelina sativa]
Length=200

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
             + +S FHG+  P+I+I  Y+ERI+KY NCSPSCFVV YVY+DR  H+ P+  + S NVH
Sbjct  38   SQRVSVFHGLSRPTITIQSYLERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVH  97

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T VMVA+K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y
Sbjct  98   RLLITSVMVAAKFLDDLYYNNAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFHAY  157

Query  616  CQHLDKEI  639
              +L KE+
Sbjct  158  FTYLQKEM  165



>ref|XP_010506407.1| PREDICTED: cyclin-U4-1-like [Camelina sativa]
Length=200

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
             + +S FHG+  P+I+I  Y+ERI+KY NCSPSCFVV YVY+DR  H+ P+  + S NVH
Sbjct  38   SQRVSVFHGLSRPTITIQSYLERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVH  97

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T VMVA+K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y
Sbjct  98   RLLITSVMVAAKFLDDLYYNNAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFHAY  157

Query  616  CQHLDKEI  639
              +L KE+
Sbjct  158  FTYLQKEM  165



>emb|CDX74684.1| BnaA05g04300D [Brassica napus]
Length=226

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 110/177 (62%), Gaps = 22/177 (12%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P++++ LSS+LE++   ND +  +                          +S+S F G+ 
Sbjct  11   PKLISFLSSLLERVSETNDLIRRVTTQS----------------------QSVSVFEGLS  48

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P I+I  Y+ERI+KY NCSPSCFVV YVY+DR  H+ P+  + S NVHRLL+T VMV++
Sbjct  49   RPPITIQSYLERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSA  108

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L KE+
Sbjct  109  KFLDDRYYNNAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLKKEM  165



>ref|XP_010518078.1| PREDICTED: cyclin-U4-1-like [Camelina sativa]
Length=200

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
             + +S FHG+  P+I+I  Y+ERI+KY NCSPSCFVV YVY+DR  H+ P+  + S NVH
Sbjct  38   SQRVSVFHGLSRPTITIQSYLERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVH  97

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T VMVA+K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y
Sbjct  98   RLLITSVMVAAKFLDDLYYNNAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFHAY  157

Query  616  CQHLDKEI  639
              +L KE+
Sbjct  158  FTYLQKEM  165



>ref|NP_182002.1| cyclin p4;1  [Arabidopsis thaliana]
 sp|O80513.1|CCU41_ARATH RecName: Full=Cyclin-U4-1; Short=CycU4;1; AltName: Full=Cyclin-P4.1; 
Short=CycP4;1 [Arabidopsis thaliana]
 gb|AAC27476.1| putative PREG1-like negative regulator [Arabidopsis thaliana]
 gb|AAY17415.1| At2g44740 [Arabidopsis thaliana]
 gb|AAY57312.1| At2g44740 [Arabidopsis thaliana]
 dbj|BAF01242.1| putative PREG1-like negative regulator [Arabidopsis thaliana]
 gb|AEC10461.1| cyclin-U4-1 [Arabidopsis thaliana]
Length=202

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
             + +S FHG+  P+I+I  Y+ERI+KY NCSPSCFVV YVY+DR  H+ P+  + S NVH
Sbjct  38   SQRVSVFHGLSRPTITIQSYLERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVH  97

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T VMVA+K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y
Sbjct  98   RLLITSVMVAAKFLDDLYYNNAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFNAY  157

Query  616  CQHLDKEI  639
              +L KE+
Sbjct  158  FSYLQKEM  165



>sp|Q0J9W0.2|CCP11_ORYSJ RecName: Full=Cyclin-P1-1; Short=CycP1;1 [Oryza sativa Japonica 
Group]
 emb|CAE04249.3| OSJNBa0089N06.10 [Oryza sativa Japonica Group]
Length=264

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 120/193 (62%), Gaps = 15/193 (8%)
 Frame = +1

Query  91   QPETAT---PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            Q  TA+   P  L +++  +++LVARND +  L                 +++       
Sbjct  14   QKATASAPPPPELDMVARAVQRLVARNDAVEALSG------------GGEAAAGLGAGMA  61

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
            +  A  G  AP I + +Y+ER+++Y    P C+VV Y Y+D  AH+ P + V S NVHRL
Sbjct  62   AFEAARGAPAPRIGVAQYLERVHRYAGLEPECYVVAYAYVDMAAHRRPAAAVASRNVHRL  121

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            L+ C++VASK+LDD H+NNAFFARVGGVSNAE+N+LE+ELL +LDF V +S +V+E Y +
Sbjct  122  LLACLLVASKVLDDFHHNNAFFARVGGVSNAEMNRLELELLAVLDFEVMLSHRVYELYRE  181

Query  622  HLDKEILQCNGIG  660
            HL+KE  +  G G
Sbjct  182  HLEKEARRDGGGG  194



>gb|EYU40342.1| hypothetical protein MIMGU_mgv1a013920mg [Erythranthe guttata]
Length=206

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 112/181 (62%), Gaps = 23/181 (13%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            +  P+++  LSS+L++    ND                        S  F+  + +S FH
Sbjct  8    SVMPKLIGFLSSLLQRAAETND-----------------------LSREFQPPQKISVFH  44

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+  P+ISI  Y+ERI+KY NCSPSC++V YVY+DR     P+  + S NVHRLL+T VM
Sbjct  45   GLSRPNISIQSYLERIFKYANCSPSCYIVAYVYLDRFTQTQPSLPINSFNVHRLLITSVM  104

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            V++K +DD +YNNA++A+VGG+S  E+N LE++ LF + F ++V+   F+ YC +L +E+
Sbjct  105  VSAKFMDDMYYNNAYYAKVGGISTTEMNFLELDFLFGMGFHLNVTPSTFQTYCSYLQREM  164

Query  640  L  642
            +
Sbjct  165  M  165



>ref|XP_009142278.1| PREDICTED: cyclin-U4-1 [Brassica rapa]
Length=201

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 118/203 (58%), Gaps = 26/203 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++  LSS+LE++   ND    +                          +S+S FHG+ 
Sbjct  11   PKLIAFLSSLLERVAESNDLTRRVTTQS----------------------QSVSVFHGLS  48

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+I+I  Y+ERI+KY NCSPSCFVV YVY+DR   + P+  + S NVHRLL+T VMV++
Sbjct  49   RPTITIHSYLERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVSA  108

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V    F  Y  +L KE+   
Sbjct  109  KFLDDLYYNNAYYAKVGGISTKEMNLLELDFLFGLGFDLNVKPNTFHAYFSYLQKEMTLV  168

Query  649  NGIGADATIINIIQRGVEALDDD  717
              +    +++ +  R V   +D+
Sbjct  169  QPL----SLVVVPPRSVITFNDE  187



>ref|XP_009355462.1| PREDICTED: cyclin-P3-1-like [Pyrus x bretschneideri]
 ref|XP_009355466.1| PREDICTED: cyclin-P3-1-like [Pyrus x bretschneideri]
 ref|XP_009367646.1| PREDICTED: cyclin-P3-1-like [Pyrus x bretschneideri]
 ref|XP_009367663.1| PREDICTED: cyclin-P3-1-like [Pyrus x bretschneideri]
 ref|XP_009367681.1| PREDICTED: cyclin-P3-1-like [Pyrus x bretschneideri]
Length=219

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 115/179 (64%), Gaps = 23/179 (13%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T TPRVL+ LSS+LE+ V RN+ L        T N                + + ++ FH
Sbjct  29   TKTPRVLSPLSSILERSVQRNEMLL------ETTN----------------IKEVITIFH  66

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+RAP +SI +YI+RI KY+ CSPSCFVV  +Y+DR   K     + S NVHRLL+T VM
Sbjct  67   GLRAPPLSIGQYIDRICKYSGCSPSCFVVAQIYVDRYL-KCTEVHLTSFNVHRLLITSVM  125

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            +A+K +DD  +NNA++A+VGGVS AELN+LE++ LF +DF + V+ + F  YC  L+KE
Sbjct  126  LAAKFMDDAFFNNAYYAKVGGVSTAELNRLEMKFLFTIDFRLQVTLETFTKYCSQLEKE  184



>ref|XP_004492903.1| PREDICTED: cyclin-U4-1-like [Cicer arietinum]
Length=203

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 109/178 (61%), Gaps = 24/178 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P++++ LSS+L+++   ND    L                             S F G+ 
Sbjct  11   PKLISFLSSLLKRVSESNDMNQQLVQQKN------------------------SVFQGLT  46

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR   + P+  + SLNVHRLL+T VMVA+
Sbjct  47   RPTISIQSYLERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSLNVHRLLITSVMVAA  106

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            K +DD +YNNA++A+VGG++  E+N LE++ LF L F ++V+   F+ YC HL  E++
Sbjct  107  KFMDDMYYNNAYYAKVGGITTIEMNFLELDFLFGLGFHLNVTPNTFQVYCVHLQSEMM  164



>emb|CDX95612.1| BnaC03g24930D [Brassica napus]
Length=198

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 117/203 (58%), Gaps = 26/203 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+++  LS++LE++   ND    L     T + +D                  S FHG+ 
Sbjct  11   PKLIAFLSALLERVAESND----LTRRVTTQSQSD------------------SVFHGLS  48

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             PSI+I  Y+ERIYKY NCS SCFVV YVY+DR  H+ P+  + S NVHRLL+T VM A+
Sbjct  49   RPSITIQSYLERIYKYANCSSSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMTAA  108

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y   L KE+   
Sbjct  109  KFLDDLYYNNAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSLLQKEMTLL  168

Query  649  NGIGADATIINIIQRGVEALDDD  717
              +    +++ +  R V    DD
Sbjct  169  QPL----SLVVVPPRTVITFKDD  187



>ref|XP_007030853.1| Cyclin family protein, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY11355.1| Cyclin family protein, putative isoform 2, partial [Theobroma 
cacao]
Length=206

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 115/178 (65%), Gaps = 23/178 (13%)
 Frame = +1

Query  103  ATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHG  282
              PRVL++LSS+LE+ + RN++L                        G R    ++ FHG
Sbjct  11   GAPRVLSLLSSILERSIQRNEKLV----------------------GGSRRMDVVTIFHG  48

Query  283  VRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMV  462
             +AP++ I +Y+ERI+KY+ CS SCFVV  VY+DR   +    L  SLNVHRLL+T  MV
Sbjct  49   TKAPALGIRQYVERIFKYSKCSNSCFVVALVYVDRFLERMGAHLT-SLNVHRLLITSFMV  107

Query  463  ASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            A+K +DD+ YNNA++A+VGGVS  E+N+LE++LLF LDF + V+++VF  YC  +++E
Sbjct  108  AAKFIDDQCYNNAYYAKVGGVSTEEMNELEMKLLFSLDFRLHVTTEVFNKYCLKIERE  165



>ref|XP_007200546.1| hypothetical protein PRUPE_ppa011715mg [Prunus persica]
 gb|EMJ01745.1| hypothetical protein PRUPE_ppa011715mg [Prunus persica]
Length=199

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 115/176 (65%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL+ LSS+LE+ V +N+ L            TD             + + ++ FHG+R
Sbjct  32   PRVLSPLSSLLERCVQKNEMLL---------EATD-------------IKEVMTIFHGLR  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP++SI +YI+RI+KY+ CSPSCFVV  +Y+DR        L  S N+HRLL+T VM+A+
Sbjct  70   APTLSIRQYIDRIFKYSGCSPSCFVVAQIYVDRFIQCTEVRLT-SFNIHRLLITGVMLAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD  +NNA++A+VGGVS +ELN+LE++ LF +DF + VS + F+ YC  L+KE
Sbjct  129  KFIDDAFFNNAYYAKVGGVSTSELNRLEMKFLFTIDFRLQVSIETFKRYCSQLEKE  184



>ref|XP_010552777.1| PREDICTED: cyclin-U3-1 [Tarenaya hassleriana]
Length=222

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 111/177 (63%), Gaps = 23/177 (13%)
 Frame = +1

Query  106  TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGV  285
            +P VL+ LSS LE+ V +N++L                         F +  S + FHG 
Sbjct  31   SPMVLSWLSSSLERSVLQNEKL----------------------IGSFEIKDSATVFHGR  68

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
              P IS+ +Y++RI+KY+ CSPSCFVV  +YMDR   +     + SLNVHRLL+T VM+A
Sbjct  69   SPPDISVRQYLDRIFKYSGCSPSCFVVAQIYMDRFL-QLARVHLTSLNVHRLLITSVMLA  127

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            +K+LDD ++NNA++ARVGGVS  ELN+LE++LLF LDF + V  Q F  YC  L+KE
Sbjct  128  AKVLDDRYFNNAYYARVGGVSTRELNRLEMKLLFTLDFKLQVKPQTFHVYCCQLEKE  184



>ref|XP_010674760.1| PREDICTED: cyclin-P3-1 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=226

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 118/183 (64%), Gaps = 26/183 (14%)
 Frame = +1

Query  85   PSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKS  264
            P +P    P+V++ ++S+LEK + +N +L                          R   +
Sbjct  29   PEKP----PQVISFIASILEKTIQKNGKL---------------------LKRSSRSKDN  63

Query  265  LSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLL  444
            ++ +HG++AP++SI +YIER++KY+ CSPSCFVV Y+YMD+         + SLNVHRLL
Sbjct  64   VTIYHGIKAPTLSIRQYIERVFKYSKCSPSCFVVAYIYMDKFIQA-TKCYLTSLNVHRLL  122

Query  445  VTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQH  624
            + CV+VA+K ++D  YNNA+FA+VGGVS AE+NKLE++LL  LD+ + V+ ++F+ YC  
Sbjct  123  IACVLVATKFIEDVSYNNAYFAKVGGVSIAEMNKLEMKLLRSLDYRLHVTLELFDQYCLQ  182

Query  625  LDK  633
            L+K
Sbjct  183  LEK  185



>ref|XP_010674759.1| PREDICTED: cyclin-P3-1 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=230

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 118/183 (64%), Gaps = 26/183 (14%)
 Frame = +1

Query  85   PSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKS  264
            P +P    P+V++ ++S+LEK + +N +L                          R   +
Sbjct  29   PEKP----PQVISFIASILEKTIQKNGKL---------------------LKRSSRSKDN  63

Query  265  LSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLL  444
            ++ +HG++AP++SI +YIER++KY+ CSPSCFVV Y+YMD+         + SLNVHRLL
Sbjct  64   VTIYHGIKAPTLSIRQYIERVFKYSKCSPSCFVVAYIYMDKFIQA-TKCYLTSLNVHRLL  122

Query  445  VTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQH  624
            + CV+VA+K ++D  YNNA+FA+VGGVS AE+NKLE++LL  LD+ + V+ ++F+ YC  
Sbjct  123  IACVLVATKFIEDVSYNNAYFAKVGGVSIAEMNKLEMKLLRSLDYRLHVTLELFDQYCLQ  182

Query  625  LDK  633
            L+K
Sbjct  183  LEK  185



>ref|XP_002274682.1| PREDICTED: cyclin-P3-1 isoform X1 [Vitis vinifera]
Length=226

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +1

Query  250  RLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLN  429
            ++  +++ FHG RAP++S+ +YI+RI+KY+ CSPSCFVV ++Y+DR   ++ ++ + SLN
Sbjct  66   QIKDAITIFHGSRAPTLSVRQYIDRIFKYSGCSPSCFVVAHIYVDRFL-QHTDAHLTSLN  124

Query  430  VHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFE  609
            VHRLL+T VMVA+K +DD  +NNA++A+VGGVS AELN+LE++ LF LDF + V+ + F 
Sbjct  125  VHRLLITSVMVAAKFIDDAFFNNAYYAKVGGVSTAELNRLEMKFLFSLDFRLQVTVETFR  184

Query  610  CYCQHLDKEI  639
             YC  LDKE+
Sbjct  185  SYCSQLDKEV  194



>gb|EEC78069.1| hypothetical protein OsI_17535 [Oryza sativa Indica Group]
Length=254

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 120/193 (62%), Gaps = 15/193 (8%)
 Frame = +1

Query  91   QPETAT---PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            Q  TA+   P  L +++  +++LVARND +  L                 +++       
Sbjct  4    QKATASAPPPPELDMVARAVQRLVARNDAVEALS------------GGGEAAAGLGAGMA  51

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
            +  A  G  AP I + +Y+ER+++Y    P C+VV Y Y+D  AH+ P + V S NVHRL
Sbjct  52   AFEAARGAPAPRIGVAQYLERVHRYAGLEPECYVVAYAYVDMAAHRRPAAAVASRNVHRL  111

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            L+ C++VASK+LDD H+NNAFFARVGGVSNAE+N+LE+ELL +LDF V +S +V+E Y +
Sbjct  112  LLACLLVASKVLDDFHHNNAFFARVGGVSNAEMNRLELELLAVLDFEVMLSHRVYELYHE  171

Query  622  HLDKEILQCNGIG  660
            HL+KE  +  G G
Sbjct  172  HLEKEARRDGGGG  184



>ref|XP_010652114.1| PREDICTED: cyclin-P3-1 isoform X2 [Vitis vinifera]
Length=217

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +1

Query  250  RLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLN  429
            ++  +++ FHG RAP++S+ +YI+RI+KY+ CSPSCFVV ++Y+DR   ++ ++ + SLN
Sbjct  57   QIKDAITIFHGSRAPTLSVRQYIDRIFKYSGCSPSCFVVAHIYVDRFL-QHTDAHLTSLN  115

Query  430  VHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFE  609
            VHRLL+T VMVA+K +DD  +NNA++A+VGGVS AELN+LE++ LF LDF + V+ + F 
Sbjct  116  VHRLLITSVMVAAKFIDDAFFNNAYYAKVGGVSTAELNRLEMKFLFSLDFRLQVTVETFR  175

Query  610  CYCQHLDKEI  639
             YC  LDKE+
Sbjct  176  SYCSQLDKEV  185



>ref|XP_007218436.1| hypothetical protein PRUPE_ppa011642mg [Prunus persica]
 gb|EMJ19635.1| hypothetical protein PRUPE_ppa011642mg [Prunus persica]
Length=202

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            + +S FHG+  P+ISI  Y+ERI+KY NCSPSC +V YVY+DR + + P   + S NVHR
Sbjct  36   QRISVFHGLTRPTISIQSYLERIFKYANCSPSCLIVAYVYLDRFSQRQPTLPINSYNVHR  95

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LL+T VMVA+K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  YC
Sbjct  96   LLITSVMVAAKFMDDMYYNNAYYAKVGGISTIEMNFLEVDFLFGLSFNLNVTPSTFTTYC  155

Query  619  QHLDKEIL  642
             +L +E+L
Sbjct  156  SYLQREML  163



>ref|XP_002278426.1| PREDICTED: cyclin-U4-1 [Vitis vinifera]
 emb|CBI38577.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 109/177 (62%), Gaps = 24/177 (14%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P +++ LSS+L+++   ND    L                          + +SAFHG+ 
Sbjct  11   PELISFLSSLLQRVAISNDLNPKLH------------------------TQKISAFHGLT  46

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             PSISI  Y+ERI+KY NCSPSCF+V ++Y+DR +   P+  + S N HRLL+T VMVA+
Sbjct  47   RPSISIQSYLERIFKYANCSPSCFIVAFIYLDRFSQSQPSLPLSSFNAHRLLITSVMVAA  106

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            K +DD +YNNA++A+VGG+S AE+N LE++ LF L F ++V+   F  YC  L KE+
Sbjct  107  KFMDDMYYNNAYYAKVGGISRAEMNLLEVDFLFGLKFQLNVTPNAFHSYCSFLHKEM  163



>ref|XP_002881978.1| CYCP4_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58237.1| CYCP4_1 [Arabidopsis lyrata subsp. lyrata]
Length=201

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
             + +S FHG+  P+I+I  Y++RI+KY NCSPSCFVV YVY+DR  H+ P+  + S NVH
Sbjct  38   SQRVSVFHGLSRPTITIQSYLQRIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVH  97

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T VMVA+K LDD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y
Sbjct  98   RLLITSVMVAAKFLDDLYYNNAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFNAY  157

Query  616  CQHLDKEI  639
              +L KE+
Sbjct  158  FSYLQKEM  165



>ref|XP_004148894.1| PREDICTED: cyclin-P3-1-like [Cucumis sativus]
 ref|XP_004158917.1| PREDICTED: cyclin-P3-1-like isoform 2 [Cucumis sativus]
 gb|KGN44814.1| hypothetical protein Csa_7G389460 [Cucumis sativus]
Length=218

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 115/183 (63%), Gaps = 23/183 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVLT+LSS+LE+ V +N+ L                          ++  + + FHG+R
Sbjct  32   PRVLTLLSSLLERSVKKNELL----------------------MEATQVKDARTMFHGLR  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP++SI  YI+RI+KY  CSPSCFV+  +Y+DR   K     + SLNVHRLL+T +M+A+
Sbjct  70   APTLSIRCYIDRIFKYFGCSPSCFVIANIYVDRFL-KCTEIQLTSLNVHRLLITSIMLAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD  +NNA++A+VGGVS AE+NKLE++ LF +DF + V+ Q F  YC  L+KE  + 
Sbjct  129  KFIDDSFFNNAYYAKVGGVSTAEINKLEMKFLFSIDFRLQVNIQTFSRYCYQLEKECTET  188

Query  649  NGI  657
              I
Sbjct  189  RQI  191



>ref|XP_007038242.1| Cyclin p4,1 [Theobroma cacao]
 gb|EOY22743.1| Cyclin p4,1 [Theobroma cacao]
Length=207

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 110/177 (62%), Gaps = 24/177 (14%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+V+T LSS+L+++   ND +  L                          +++S FHG+ 
Sbjct  16   PKVITFLSSLLQRVAESNDHIRRL------------------------QSQNISVFHGLT  51

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR     P+  + S NVHRLL+T V+V++
Sbjct  52   RPTISIRSYLERIFKYANCSPSCFVVAYVYLDRFVQMQPSLPINSFNVHRLLITSVLVSA  111

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            K +DD +YNNA++A+VGG+S  ELN LE++ LF L F ++V+   F  YC  L +E+
Sbjct  112  KFMDDIYYNNAYYAKVGGISTVELNLLELDFLFGLGFQLNVTPSDFHTYCSFLQREM  168



>ref|XP_004145018.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
 ref|XP_004153078.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
Length=225

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 116/192 (60%), Gaps = 20/192 (10%)
 Frame = +1

Query  103  ATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHG  282
            + P+++T LSSVL+++   ND L          +N D  + +          +  SAFHG
Sbjct  10   SMPKLITFLSSVLQRVAESNDDL----------DNNDSATET----------QKNSAFHG  49

Query  283  VRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMV  462
            +  PSIS+  Y+ERI+KY NCS SCF+V YVY+DR A K P   + S NVHRLL+T V+V
Sbjct  50   LTRPSISLQSYLERIFKYANCSNSCFIVAYVYLDRFAQKQPLLPINSYNVHRLLITSVLV  109

Query  463  ASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            A+K +DD  YNNAF+ARVGG+S  E+N LE++ LF L F ++V+   F  Y   L  EI 
Sbjct  110  AAKFMDDLCYNNAFYARVGGISTREINFLEVDFLFGLGFELNVTPTTFHTYSSCLQNEIF  169

Query  643  QCNGIGADATII  678
              N    + +I+
Sbjct  170  LLNPPFTNISIL  181



>ref|XP_010255964.1| PREDICTED: cyclin-P3-1-like isoform X2 [Nelumbo nucifera]
 ref|XP_010255965.1| PREDICTED: cyclin-P3-1-like isoform X2 [Nelumbo nucifera]
Length=221

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +1

Query  265  LSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLL  444
            ++ FHG+RAP++SI +YI+RI+KY++CSPSCFVV Y+YMDR   +  +  + SLNVHRLL
Sbjct  62   VTVFHGLRAPTLSIHQYIDRIFKYSSCSPSCFVVAYIYMDRFLQR-TDIYLTSLNVHRLL  120

Query  445  VTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQH  624
            +T VMVA+K LDD  +NNA++A+VGGVS AE+N+LE++ LF LDF + V+ + F+ YC  
Sbjct  121  ITSVMVAAKFLDDAFFNNAYYAKVGGVSLAEMNRLEMKFLFTLDFRLHVTVETFKSYCLL  180

Query  625  LDKE  636
            L+KE
Sbjct  181  LEKE  184



>ref|XP_004160682.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
 gb|KGN46271.1| hypothetical protein Csa_6G078670 [Cucumis sativus]
Length=226

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 116/192 (60%), Gaps = 20/192 (10%)
 Frame = +1

Query  103  ATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHG  282
            + P+++T LSSVL+++   ND L          +N D  + +          +  SAFHG
Sbjct  10   SMPKLITFLSSVLQRVAESNDDL----------DNNDSATET----------QKNSAFHG  49

Query  283  VRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMV  462
            +  PSIS+  Y+ERI+KY NCS SCF+V YVY+DR A K P   + S NVHRLL+T V+V
Sbjct  50   LTRPSISLQSYLERIFKYANCSNSCFIVAYVYLDRFAQKQPLLPINSYNVHRLLITSVLV  109

Query  463  ASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            A+K +DD  YNNAF+ARVGG+S  E+N LE++ LF L F ++V+   F  Y   L  EI 
Sbjct  110  AAKFMDDLCYNNAFYARVGGISTREINFLEVDFLFGLGFELNVTPTTFHTYSSCLQNEIF  169

Query  643  QCNGIGADATII  678
              N    + +I+
Sbjct  170  LLNPPFTNISIL  181



>ref|XP_009370411.1| PREDICTED: cyclin-U4-1 [Pyrus x bretschneideri]
Length=207

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 120/202 (59%), Gaps = 24/202 (12%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            + PE+  PR++  +SSVLE++   ND                        +  F   + L
Sbjct  10   TSPESM-PRMIAFMSSVLERVSESND-----------------------LNRRFHPTQKL  45

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
            S FH +  P+ISI  Y++RI+KY +CSPSCF+V YVY+DR     P   + S NVHRLL+
Sbjct  46   SVFHSLTTPTISIHSYLQRIFKYADCSPSCFIVAYVYLDRFTQMQPLLPIDSFNVHRLLI  105

Query  448  TCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHL  627
            T V+V++K +DD +YNNAF+ARVGG+S  E+N LE++ LF L F ++V+   +  YC +L
Sbjct  106  TSVLVSAKFMDDIYYNNAFYARVGGISTQEMNLLEVDFLFGLGFQMNVTPATYYTYCSYL  165

Query  628  DKEILQCNGIGADATIINIIQR  693
             +E+L  + +    + +++ +R
Sbjct  166  QREMLLQSPLQFADSPVDLARR  187



>ref|XP_009592904.1| PREDICTED: cyclin-U4-1 [Nicotiana tomentosiformis]
Length=207

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 112/184 (61%), Gaps = 24/184 (13%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            +Q ++  P+++  LSS+L+++   ND                          G    + +
Sbjct  7    TQNQSLMPKLIDYLSSLLQRVAEAND------------------------INGRFQPQKI  42

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
            S FHG+  P+ISI  Y+ERI+KY NCSP CFVV YVY+DR     P+  + S N+HRLL+
Sbjct  43   SVFHGLTRPNISIQNYLERIFKYANCSPCCFVVAYVYLDRFTQCQPSLPINSFNIHRLLI  102

Query  448  TCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHL  627
            T VM+A+K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F+ YC +L
Sbjct  103  TSVMIAAKFMDDMYYNNAYYAKVGGISTTEMNFLEVDFLFGLGFRLNVTPTTFQTYCSYL  162

Query  628  DKEI  639
             KE+
Sbjct  163  QKEM  166



>ref|XP_011023596.1| PREDICTED: cyclin-P3-1-like [Populus euphratica]
 ref|XP_011023597.1| PREDICTED: cyclin-P3-1-like [Populus euphratica]
 ref|XP_011023598.1| PREDICTED: cyclin-P3-1-like [Populus euphratica]
 ref|XP_011016429.1| PREDICTED: cyclin-P3-1-like [Populus euphratica]
 ref|XP_011016430.1| PREDICTED: cyclin-P3-1-like [Populus euphratica]
 ref|XP_011016431.1| PREDICTED: cyclin-P3-1-like [Populus euphratica]
Length=200

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 124/192 (65%), Gaps = 23/192 (12%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            + TPRVL +++SVLEK + +N++ +                         R   +++ FH
Sbjct  22   SGTPRVLVLIASVLEKSLQKNEKQSTTS----------------------RRKDAITIFH  59

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G R+P++SI +YI+RI++Y+ CS SCFVV Y+Y+++   +  ++ + SLNVHRLL+T +M
Sbjct  60   GSRSPTLSITQYIDRIFRYSRCSTSCFVVAYIYINKFLQQ-TDAYLTSLNVHRLLITSIM  118

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K LDDE Y+NA++AR+GGVS AE+N++E++ LF LDF + V+++VF   C  L+ E 
Sbjct  119  VAAKFLDDECYDNAYYARIGGVSTAEMNRMEMKFLFNLDFRLHVTAEVFMNCCLKLENES  178

Query  640  LQCNGIGADATI  675
             +     AD ++
Sbjct  179  GKYQNGQADPSL  190



>ref|XP_009389264.1| PREDICTED: cyclin-P4-1 [Musa acuminata subsp. malaccensis]
Length=197

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 109/179 (61%), Gaps = 22/179 (12%)
 Frame = +1

Query  103  ATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHG  282
            A PRV+ +LS++LE+L  RND +                           L    SAFHG
Sbjct  10   AIPRVVAVLSTILERLAERNDAV----------------------RRPLALHHCASAFHG  47

Query  283  VRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMV  462
            +  P+IS+  Y+ERI++Y NCSPSC+VV Y+Y+DR   ++P   + S NVHR L+T V+ 
Sbjct  48   LTKPAISVRSYLERIFRYANCSPSCYVVAYIYIDRFLWRHPAVFLDSFNVHRFLITSVLT  107

Query  463  ASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            A K +DD +YNNA+FA+VGG+S  E+N LE++ LF + F ++V+  +F  YC  L +E+
Sbjct  108  AVKFMDDIYYNNAYFAKVGGISLMEMNYLEVDFLFGVGFELNVTPVIFSSYCSTLQREM  166



>ref|XP_008235285.1| PREDICTED: cyclin-P3-1 [Prunus mume]
 ref|XP_008235286.1| PREDICTED: cyclin-P3-1 [Prunus mume]
Length=217

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 115/176 (65%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL+ LSS+LE+ V +N+ L            TD             + + ++ FHG+R
Sbjct  32   PRVLSPLSSLLERCVQKNEMLL---------EATD-------------IKEVMTIFHGLR  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP++SI +Y++RI+KY+ CSPSCFVV  +Y+DR        L  S NVHRLL+T VM+A+
Sbjct  70   APTLSIRQYVDRIFKYSGCSPSCFVVAQIYVDRFIQCTEVRLT-SFNVHRLLITSVMLAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD  +NNA++A+VGGVS +ELN+LE++ LF +DF + VS + F+ YC  L+KE
Sbjct  129  KFIDDAFFNNAYYAKVGGVSTSELNRLEMKFLFTIDFRLQVSIETFKRYCSQLEKE  184



>ref|XP_010255963.1| PREDICTED: cyclin-P3-1-like isoform X1 [Nelumbo nucifera]
Length=246

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +1

Query  265  LSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLL  444
            ++ FHG+RAP++SI +YI+RI+KY++CSPSCFVV Y+YMDR   +  +  + SLNVHRLL
Sbjct  87   VTVFHGLRAPTLSIHQYIDRIFKYSSCSPSCFVVAYIYMDRFLQR-TDIYLTSLNVHRLL  145

Query  445  VTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQH  624
            +T VMVA+K LDD  +NNA++A+VGGVS AE+N+LE++ LF LDF + V+ + F+ YC  
Sbjct  146  ITSVMVAAKFLDDAFFNNAYYAKVGGVSLAEMNRLEMKFLFTLDFRLHVTVETFKSYCLL  205

Query  625  LDKE  636
            L+KE
Sbjct  206  LEKE  209



>emb|CDP09417.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 112/183 (61%), Gaps = 22/183 (12%)
 Frame = +1

Query  97   ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLG-KSLSA  273
            E  +PRV++ L S L  L+ R              N+ +            RL  + +S 
Sbjct  3    ELESPRVMSKLISFLSSLLQR----------AAESNDLNR-----------RLQPQKISV  41

Query  274  FHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTC  453
            FHG+  P+ISI  Y++RI KY NCSPSCF+V Y+Y+DR   + P   + S NVHRLL+T 
Sbjct  42   FHGLTRPTISIENYLDRILKYANCSPSCFIVSYIYLDRFTQRQPALPINSFNVHRLLITS  101

Query  454  VMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDK  633
            VMVA+K +DD +YNNA++A+VGG+S AE+N LE++ LF L F ++V+   F  YC +L +
Sbjct  102  VMVAAKFMDDMYYNNAYYAKVGGISTAEMNFLEVDFLFGLGFHLNVTPTTFHTYCSYLQR  161

Query  634  EIL  642
            E+L
Sbjct  162  EML  164



>ref|XP_004158916.1| PREDICTED: cyclin-P3-1-like isoform 1 [Cucumis sativus]
Length=241

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 115/183 (63%), Gaps = 23/183 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVLT+LSS+LE+ V +N+ L                          ++  + + FHG+R
Sbjct  55   PRVLTLLSSLLERSVKKNELL----------------------MEATQVKDARTMFHGLR  92

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP++SI  YI+RI+KY  CSPSCFV+  +Y+DR   K     + SLNVHRLL+T +M+A+
Sbjct  93   APTLSIRCYIDRIFKYFGCSPSCFVIANIYVDRFL-KCTEIQLTSLNVHRLLITSIMLAA  151

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD  +NNA++A+VGGVS AE+NKLE++ LF +DF + V+ Q F  YC  L+KE  + 
Sbjct  152  KFIDDSFFNNAYYAKVGGVSTAEINKLEMKFLFSIDFRLQVNIQTFSRYCYQLEKECTET  211

Query  649  NGI  657
              I
Sbjct  212  RQI  214



>ref|XP_011082555.1| PREDICTED: cyclin-P3-1 [Sesamum indicum]
 ref|XP_011082556.1| PREDICTED: cyclin-P3-1 [Sesamum indicum]
Length=211

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 114/176 (65%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+VL++LS  LE+ V +N+R+        T    D                 ++  HG+R
Sbjct  26   PQVLSLLSMFLERCVQKNERML------ETSQTKD----------------VVTILHGLR  63

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            APS+SI +YI+RI+KY+ CSPSCFV+ ++Y+DR   +  N  + SLN+HRLL+T VMVA+
Sbjct  64   APSLSIQQYIDRIFKYSCCSPSCFVIAHIYVDRFIQR-TNLCLTSLNIHRLLITSVMVAA  122

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD  +NNA++ARVGGVS AELNKLE++ LF L+F + VS Q F  YC  L K+
Sbjct  123  KFMDDAFFNNAYYARVGGVSTAELNKLEMKFLFSLNFQLHVSVQTFRNYCSVLRKD  178



>ref|XP_010942426.1| PREDICTED: cyclin-P3-1-like [Elaeis guineensis]
Length=222

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 123/181 (68%), Gaps = 23/181 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PR+L++LSS+LE++V +N+ L    LD                    ++  +++ FHG+R
Sbjct  32   PRILSLLSSLLERVVQKNEML----LDSN------------------KIKNAVTVFHGLR  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP+ISI KY+ERI+KY+ CSPSCFV+ ++Y+DR  H+ P+  + SLNVHRLL+T ++VA+
Sbjct  70   APNISIQKYLERIFKYSKCSPSCFVLAHIYIDRFLHQ-PDIHLTSLNVHRLLITSIVVAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD  +NNA++A+VGGVS  E+N+LE+  LF LDF + V+ + F  YC  L K+  +C
Sbjct  129  KFIDDAFFNNAYYAKVGGVSTVEMNRLELNFLFNLDFRLQVNLETFGSYCLQLKKQATEC  188

Query  649  N  651
            +
Sbjct  189  S  189



>ref|XP_004230189.1| PREDICTED: cyclin-P3-1 isoform X1 [Solanum lycopersicum]
Length=226

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 118/180 (66%), Gaps = 23/180 (13%)
 Frame = +1

Query  97   ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAF  276
            +   P++L I++SV+E+ V +N++       G   +N  G                ++ F
Sbjct  30   DKGNPKILWIVASVIERSVQKNEK-------GLKGSNKRG---------------VVTVF  67

Query  277  HGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCV  456
            HG RAP +++ +YIERI+KY+NCSPSCFVV Y+Y++R  +   + L+ SLNVHRLL+T +
Sbjct  68   HGTRAPVLTVQQYIERIFKYSNCSPSCFVVAYIYLERFLN-LTDCLLTSLNVHRLLITSI  126

Query  457  MVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            M+A K +DD+ YNNA++A+VGG++  ELNKLE++ L  LDF + VS + F+ YC  L+K+
Sbjct  127  MLAVKFVDDDCYNNAYYAKVGGITTRELNKLEVKFLAALDFRLHVSVESFDKYCLQLEKD  186



>ref|XP_008368850.1| PREDICTED: cyclin-P3-1-like [Malus domestica]
Length=219

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 111/176 (63%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL+ LSS+LE+ V RN+ L                          ++ + ++ +HG+R
Sbjct  32   PRVLSPLSSILERYVQRNEML----------------------LETTKIKQVITIYHGLR  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP +SI +YI+RI KY+ CSPSCFVV  +Y+DR        L  S NVHRLL+T VM+A+
Sbjct  70   APPLSIRQYIDRICKYSGCSPSCFVVAQIYLDRYLQCXQVHLT-SFNVHRLLITSVMLAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD  +NNA++A+VGGVS AELN+LEI+ LF +DF + V+ + F  YC  LDKE
Sbjct  129  KFMDDAFFNNAYYAKVGGVSTAELNRLEIKFLFTIDFRLQVTIETFNKYCSQLDKE  184



>ref|XP_008386497.1| PREDICTED: cyclin-P3-1-like [Malus domestica]
Length=219

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 114/177 (64%), Gaps = 23/177 (13%)
 Frame = +1

Query  106  TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGV  285
            TPRVL+ LSS+LE+ V RN+ L        T N                + + ++ FHG+
Sbjct  31   TPRVLSPLSSILERSVQRNEMLL------ETTN----------------IKEVITIFHGL  68

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
            RAP +SI +YI+RI KY+ CSPSCFVV  +Y+DR   K     + S NVHRLL+T VM+A
Sbjct  69   RAPPLSIRQYIDRICKYSGCSPSCFVVAQIYVDRYL-KCTEVHLTSFNVHRLLITSVMLA  127

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            +K +DD  +NNA++A+VGGVS AELN+LE++ LF +DF + V+ + F  YC  L+KE
Sbjct  128  AKFMDDAFFNNAYYAKVGGVSTAELNRLEMKFLFTIDFRLQVNLETFTKYCSQLEKE  184



>ref|XP_006386267.1| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
 ref|XP_006386268.1| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
 ref|XP_006386270.1| cyclin family protein [Populus trichocarpa]
 gb|ERP64064.1| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
 gb|ERP64065.1| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
 gb|ERP64067.1| cyclin family protein [Populus trichocarpa]
Length=219

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 125/210 (60%), Gaps = 26/210 (12%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL +LSS+LE+ V +N+ L                          ++   ++ FHG+R
Sbjct  32   PRVLMLLSSLLERSVQKNEILM----------------------EKTQIKDVVTIFHGLR  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P +SI +Y++RI+KY+ CSPSCFVV +VY+DR   +    L  SLNVHRLL+T VM+A+
Sbjct  70   PPPVSIQQYVDRIFKYSACSPSCFVVAHVYVDRFLQQTDIHLT-SLNVHRLLITSVMIAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD  +NNA++ARVGGVS  ELN+LE++ LF +DF + V+   F  YC  L+KE    
Sbjct  129  KFVDDAFFNNAYYARVGGVSKEELNRLEMKFLFSIDFRLQVNVNTFGKYCYRLEKE--SS  186

Query  649  NGIGADATIINI-IQRGVEALDDDITLASS  735
            +G+  +  I    I+    + DD  T AS+
Sbjct  187  DGLQIERPIQACRIKESWSSKDDSTTCAST  216



>gb|KHG11686.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=214

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 109/181 (60%), Gaps = 24/181 (13%)
 Frame = +1

Query  97   ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAF  276
            +   P+++T LSS+L+++   ND   L                           + +S F
Sbjct  16   QEIVPKIITFLSSLLQRVAESNDHCRLF------------------------QSQKISVF  51

Query  277  HGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCV  456
            HG+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR     P+  + S NVHRLL+T V
Sbjct  52   HGLTRPTISIKSYLERIFKYANCSPSCFVVAYVYLDRFVQMQPSLPINSYNVHRLLLTSV  111

Query  457  MVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            +V++K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  YC  L +E
Sbjct  112  LVSAKFMDDMYYNNAYYAKVGGISTVEMNLLEVDFLFGLGFHLNVAPTTFHTYCTFLQRE  171

Query  637  I  639
            +
Sbjct  172  M  172



>ref|XP_004229728.1| PREDICTED: cyclin-U4-1 [Solanum lycopersicum]
Length=206

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 111/184 (60%), Gaps = 24/184 (13%)
 Frame = +1

Query  91   QPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLS  270
            Q +   P+++  LSS+L+++   ND                          G    + +S
Sbjct  7    QNQNLMPKLIDYLSSLLQRVAEAND------------------------INGRFQPQKIS  42

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FHG+  P+ISI  Y+ERI+KY NCSP CFVV YVY+DR     P+  + S N+HRLL+T
Sbjct  43   VFHGLTRPNISIQSYLERIFKYANCSPCCFVVAYVYLDRFTQCQPSLPINSFNIHRLLIT  102

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
             VM+A+K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F+ YC +L 
Sbjct  103  SVMIAAKFMDDMYYNNAYYAKVGGISITEMNFLEVDFLFGLGFHLNVTPTTFQTYCAYLQ  162

Query  631  KEIL  642
            KE+L
Sbjct  163  KEML  166



>gb|EYU20163.1| hypothetical protein MIMGU_mgv1a024090mg [Erythranthe guttata]
Length=205

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 110/179 (61%), Gaps = 28/179 (16%)
 Frame = +1

Query  112  RVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL--GKSLSAFHGV  285
            +V+  LSS+L+++   ND                          GFR    + +S FHG+
Sbjct  12   KVIKFLSSLLQRVSETND--------------------------GFRFFHTQRISIFHGL  45

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
              P+ISI  Y+ERI+KY NCSPSCFVV Y+Y+DR A K P   + S NVHRLL+  V+V+
Sbjct  46   TRPTISIESYLERIFKYANCSPSCFVVAYIYLDRFAQKQPLLPINSFNVHRLLIASVLVS  105

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            +K +DD  YNNA++A++GG++ AE+N LE++ LF L F ++VS   F  YC +L +E+L
Sbjct  106  AKFMDDIFYNNAYYAKIGGITTAEMNLLEMDFLFGLGFQLNVSISTFHHYCSYLQREML  164



>ref|XP_006375761.1| hypothetical protein POPTR_0013s02390g [Populus trichocarpa]
 ref|XP_006375762.1| hypothetical protein POPTR_0013s02390g [Populus trichocarpa]
 gb|ERP53558.1| hypothetical protein POPTR_0013s02390g [Populus trichocarpa]
 gb|ERP53559.1| hypothetical protein POPTR_0013s02390g [Populus trichocarpa]
Length=200

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 120/187 (64%), Gaps = 23/187 (12%)
 Frame = +1

Query  76   LPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL  255
            L   S+  + TPRVL +++SVLEK +  N++L                          R 
Sbjct  14   LDESSRGVSGTPRVLVLIASVLEKSLQNNEKLLTTS----------------------RR  51

Query  256  GKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVH  435
              +++ FHG R+P++SI +YIER++KY+ CS SCFVV Y+Y+++   +  ++ + SLN H
Sbjct  52   KDAITIFHGSRSPTLSIRQYIERVFKYSRCSTSCFVVAYIYINKFLQQ-TDAYLTSLNAH  110

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T +MVA+K LDD+ Y+NA++AR+GGVS AE+N++E++ LF LDF + V+++VF   
Sbjct  111  RLLITSIMVAAKFLDDDCYDNAYYARIGGVSTAEMNRMEMKFLFNLDFRLHVTAEVFMNC  170

Query  616  CQHLDKE  636
            C  L+ E
Sbjct  171  CLKLENE  177



>ref|XP_010692026.1| PREDICTED: cyclin-U4-1 [Beta vulgaris subsp. vulgaris]
Length=217

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 112/183 (61%), Gaps = 30/183 (16%)
 Frame = +1

Query  103  ATPRVLTILSSVLEKLVARND---RLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSA  273
            + P+++T LSS+L+++   ND   RL                             + +S 
Sbjct  13   SVPKMITFLSSLLQRVAESNDIHRRLE---------------------------PQKVSV  45

Query  274  FHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTC  453
            FHG+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR   + P   + S NVHRLL+T 
Sbjct  46   FHGLTQPTISIQSYLERIFKYANCSPSCFVVAYVYLDRFTQRQPLLPINSYNVHRLLITS  105

Query  454  VMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDK  633
            VM+++K +DD +YNNA++A++GG++  E+N LE++ LF L F ++V+   F  YC +L +
Sbjct  106  VMISAKFMDDMYYNNAYYAKIGGITITEMNFLEVDFLFGLGFHLNVTPNTFHTYCSYLQR  165

Query  634  EIL  642
            E+L
Sbjct  166  EML  168



>ref|XP_007052360.1| Cyclin p4,1 [Theobroma cacao]
 gb|EOX96517.1| Cyclin p4,1 [Theobroma cacao]
Length=203

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 115/190 (61%), Gaps = 25/190 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P ++T LSS+L+K+   ND                          G    + +S FHG+ 
Sbjct  11   PNLITFLSSLLQKVAESND------------------------VNGRFQPQKISVFHGLT  46

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+I+I  Y++RIYKY NCSPSCF+V YVY+DR A +  +  + S NVHRLL+T VMVA+
Sbjct  47   RPTITIQNYLDRIYKYANCSPSCFIVAYVYLDRFAQRQTSLPINSFNVHRLLITSVMVAA  106

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE-ILQ  645
            K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L +E +LQ
Sbjct  107  KFMDDMYYNNAYYAKVGGISTTEMNFLEVDFLFGLGFHLNVTPNTFHTYYSYLQREMMLQ  166

Query  646  CNGIGADATI  675
                 AD+++
Sbjct  167  PPPSIADSSL  176



>ref|XP_006347995.1| PREDICTED: cyclin-U4-1-like [Solanum tuberosum]
Length=208

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 111/184 (60%), Gaps = 24/184 (13%)
 Frame = +1

Query  91   QPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLS  270
            Q +   P+++  LSS+L+++   ND                          G    + +S
Sbjct  7    QNQNLMPKLIDYLSSLLQRVAEAND------------------------INGRFQPQKIS  42

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FHG+  P+ISI  Y+ERI+KY NCSP CFVV YVY+DR     P+  + S N+HRLL+T
Sbjct  43   VFHGLSRPNISIQSYLERIFKYANCSPCCFVVAYVYLDRFTQCQPSLPINSFNIHRLLIT  102

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
             VM+A+K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F+ YC +L 
Sbjct  103  SVMIAAKFMDDMYYNNAYYAKVGGISITEMNFLEVDFLFGLGFHLNVTPTTFQTYCAYLQ  162

Query  631  KEIL  642
            KE+L
Sbjct  163  KEML  166



>gb|KHG19596.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=206

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 120/189 (63%), Gaps = 26/189 (14%)
 Frame = +1

Query  115  VLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRAP  294
            ++T LSS+L+++   ND   L C                    GF+  K +S FHG+  P
Sbjct  13   LITFLSSLLKEVAESND---LNC--------------------GFKAQK-ISVFHGLTRP  48

Query  295  SISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASKI  474
            +ISI  Y++RIYKY NCSPSCF+V YVY+DR A + P+  + S NVHRLL++ VMVA+K 
Sbjct  49   TISIQSYLDRIYKYANCSPSCFIVAYVYLDRFAQRQPSLPINSFNVHRLLISSVMVAAKF  108

Query  475  LDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE--ILQC  648
            +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L ++  +LQ 
Sbjct  109  MDDMYYNNAYYAKVGGISTTEMNFLEVDFLFGLGFHLNVTPNTFHTYYTYLQRKMMMLQP  168

Query  649  NGIGADATI  675
              I A++++
Sbjct  169  PPIIAESSL  177



>gb|KHG18521.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=203

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 111/182 (61%), Gaps = 26/182 (14%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P ++T LSS+ +K+   ND                        +  F+  K +S FHG+ 
Sbjct  11   PNLITFLSSLFQKVAESND-----------------------VNRRFKAQK-VSVFHGLS  46

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+ISI  Y++RIYKY NCSP CF+V YVY+DR A + P+  + S NVHRLL+T VMVA+
Sbjct  47   RPTISIQNYLDRIYKYANCSPCCFIVAYVYLDRFAQRQPSLPINSFNVHRLLITSVMVAA  106

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL--  642
            K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  Y  +L +E +  
Sbjct  107  KFMDDMYYNNAYYAKVGGISTTEMNFLEVDFLFGLGFQLNVTPNTFNTYYSYLKRETMLQ  166

Query  643  QC  648
            QC
Sbjct  167  QC  168



>ref|XP_008232383.1| PREDICTED: cyclin-U4-1-like [Prunus mume]
Length=202

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            + +S FHG+  P+ISI  Y+ERI+KY NCSPSC +V YVY+DR + + P   + S NVHR
Sbjct  36   QRISVFHGLTRPTISIQSYLERIFKYANCSPSCLIVAYVYLDRFSQRQPTLPINSYNVHR  95

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LL+  VMVA+K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  YC
Sbjct  96   LLIASVMVAAKFMDDMYYNNAYYAKVGGISTIEMNFLEVDFLFGLSFNLNVTPSTFTTYC  155

Query  619  QHLDKEIL  642
             +L +E+L
Sbjct  156  SYLQREML  163



>ref|XP_006386269.1| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
 gb|ERP64066.1| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
Length=243

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 125/210 (60%), Gaps = 26/210 (12%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL +LSS+LE+ V +N+ L                          ++   ++ FHG+R
Sbjct  56   PRVLMLLSSLLERSVQKNEILM----------------------EKTQIKDVVTIFHGLR  93

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P +SI +Y++RI+KY+ CSPSCFVV +VY+DR   +    L  SLNVHRLL+T VM+A+
Sbjct  94   PPPVSIQQYVDRIFKYSACSPSCFVVAHVYVDRFLQQTDIHLT-SLNVHRLLITSVMIAA  152

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD  +NNA++ARVGGVS  ELN+LE++ LF +DF + V+   F  YC  L+KE    
Sbjct  153  KFVDDAFFNNAYYARVGGVSKEELNRLEMKFLFSIDFRLQVNVNTFGKYCYRLEKE--SS  210

Query  649  NGIGADATIINI-IQRGVEALDDDITLASS  735
            +G+  +  I    I+    + DD  T AS+
Sbjct  211  DGLQIERPIQACRIKESWSSKDDSTTCAST  240



>ref|XP_006361848.1| PREDICTED: cyclin-P3-1-like [Solanum tuberosum]
Length=226

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 116/180 (64%), Gaps = 23/180 (13%)
 Frame = +1

Query  97   ETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAF  276
            +   P++L I++SV+E+ V +N++     L G                        ++ F
Sbjct  30   DKGNPKILWIVASVVERSVQKNEK----ALKGSNKRGV------------------VTVF  67

Query  277  HGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCV  456
            HG RAP +++ +YIERI+KY+NCSPSCFVV Y+Y++R  +   + L+ SLNVHRLL+T +
Sbjct  68   HGTRAPVLTVQQYIERIFKYSNCSPSCFVVAYIYLERFLN-LTHCLLTSLNVHRLLITSI  126

Query  457  MVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            M+A K +DD+ YNNA++A+VGG++  ELNKLE++ L  LDF + VS + F+ YC  L+K+
Sbjct  127  MLAVKFVDDDCYNNAYYAKVGGITTTELNKLEMKFLAALDFRLHVSVENFDKYCLQLEKD  186



>ref|XP_007208184.1| hypothetical protein PRUPE_ppa020960mg, partial [Prunus persica]
 gb|EMJ09383.1| hypothetical protein PRUPE_ppa020960mg, partial [Prunus persica]
Length=175

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 122/200 (61%), Gaps = 29/200 (15%)
 Frame = +1

Query  67   FPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAG  246
            F AL    +  T TPRVL+++SSV E+ + +N++L                         
Sbjct  3    FTALGILGKSATRTPRVLSVVSSVFERSIRKNEKL----------------------IRR  40

Query  247  FRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISL  426
             ++   ++ FH    P++SI +YIERI+KY++CSPSCFVV Y+Y++R   +    L  SL
Sbjct  41   SKMKDVITMFHASEVPALSIRRYIERIFKYSSCSPSCFVVAYIYIERFLQRTGICLT-SL  99

Query  427  NVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVF  606
            N+HRLL+T +MVA+K +DDE Y+NA +A++GGVS +ELNKLEIE L  LDF + V+  +F
Sbjct  100  NIHRLLITSIMVAAKFMDDECYSNAHYAKIGGVSLSELNKLEIEFLLSLDFKLHVTINMF  159

Query  607  ECYCQHLDKEILQCNGIGAD  666
              YC+ L+      +G+G +
Sbjct  160  GKYCRQLE------DGVGEN  173



>ref|XP_008343655.1| PREDICTED: cyclin-U4-1-like [Malus domestica]
Length=206

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 114/181 (63%), Gaps = 24/181 (13%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T   +++T LSS+++++   ND                        ++ F+  K +S FH
Sbjct  8    TVMTKIITFLSSLVQRVAESND-----------------------LNSHFQPQK-ISVFH  43

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G+  P+ISI  Y+ERI+KY NCSPSC +V YVY+DR + + P+  + S NVHRLL+T V+
Sbjct  44   GLTRPTISIQSYLERIFKYANCSPSCLIVAYVYLDRFSQRQPSLPINSFNVHRLLITSVL  103

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  +C +L +E+
Sbjct  104  VAAKFMDDMYYNNAYYAKVGGISTIEMNFLEVDFLFGLSFDLNVTPTTFTTHCSYLQREM  163

Query  640  L  642
            L
Sbjct  164  L  164



>gb|KHG14991.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=205

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +1

Query  244  GFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVIS  423
            GF+  K +S FHG+ +P+ISI  Y+ RIYKY NCSPSCF+V YVY+DR A + P+  + S
Sbjct  33   GFQAQK-ISVFHGLTSPTISIQSYLHRIYKYANCSPSCFIVAYVYLDRFAQRQPSLPINS  91

Query  424  LNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQV  603
             NVHRLL+T VMVA+K +DD +YNNAF+A+VGG+S  E+N LE++ LF L F ++V+ + 
Sbjct  92   FNVHRLLITSVMVAAKFMDDMYYNNAFYAKVGGISTTEMNFLEVDFLFGLGFHLNVNLKT  151

Query  604  FECYCQHLDK  633
            F  Y  +L +
Sbjct  152  FHTYYSYLQR  161



>ref|XP_002302113.2| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
 gb|EEE81386.2| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
Length=250

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 125/210 (60%), Gaps = 26/210 (12%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL +LSS+LE+ V +N+ L                          ++   ++ FHG+R
Sbjct  63   PRVLMLLSSLLERSVQKNEILM----------------------EKTQIKDVVTIFHGLR  100

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P +SI +Y++RI+KY+ CSPSCFVV +VY+DR   +    L  SLNVHRLL+T VM+A+
Sbjct  101  PPPVSIQQYVDRIFKYSACSPSCFVVAHVYVDRFLQQTDIHLT-SLNVHRLLITSVMIAA  159

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQC  648
            K +DD  +NNA++ARVGGVS  ELN+LE++ LF +DF + V+   F  YC  L+KE    
Sbjct  160  KFVDDAFFNNAYYARVGGVSKEELNRLEMKFLFSIDFRLQVNVNTFGKYCYRLEKE--SS  217

Query  649  NGIGADATIINI-IQRGVEALDDDITLASS  735
            +G+  +  I    I+    + DD  T AS+
Sbjct  218  DGLQIERPIQACRIKESWSSKDDSTTCAST  247



>ref|XP_009627788.1| PREDICTED: cyclin-P3-1 [Nicotiana tomentosiformis]
Length=217

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 119/182 (65%), Gaps = 23/182 (13%)
 Frame = +1

Query  91   QPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLS  270
            + ++  PRVL++LS++LE+ V + + L    L+     +                   ++
Sbjct  26   KQKSGKPRVLSLLSTLLERSVQKTESL----LESTQRKDV------------------IT  63

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FHG RAPS+ I +Y++RI+KY+ CSPSCFVV ++YM+R   ++ ++ + SLNVHRLL+T
Sbjct  64   IFHGSRAPSLGIEQYLDRIFKYSCCSPSCFVVAHIYMERFI-EHTSAHLTSLNVHRLLIT  122

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
             VMVA+K +DD  YNNA++ARVGGV+  ELNKLE++ LF LDF + V+ + F  YC  L+
Sbjct  123  SVMVAAKFIDDAFYNNAYYARVGGVTTKELNKLEMKFLFGLDFRLHVNVKTFGSYCSLLE  182

Query  631  KE  636
            KE
Sbjct  183  KE  184



>ref|XP_009375368.1| PREDICTED: cyclin-U4-1 [Pyrus x bretschneideri]
Length=206

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 114/177 (64%), Gaps = 24/177 (14%)
 Frame = +1

Query  112  RVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRA  291
            +++T LSS+++++   ND                        ++ F+  K +S FHG+  
Sbjct  12   KIITFLSSLVQRVAESND-----------------------LNSHFQPQK-ISVFHGLTR  47

Query  292  PSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASK  471
            P+ISI  Y+ERI+KY +CSPSC +V YVY+DR + ++P+  + S NVHRLL+T VMVA+K
Sbjct  48   PTISIQSYLERIFKYADCSPSCLIVAYVYLDRFSQRHPSLPINSFNVHRLLITSVMVAAK  107

Query  472  ILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
             +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  +C +L +E+L
Sbjct  108  FMDDMYYNNAYYAKVGGISTIEMNFLEVDFLFGLSFDLNVTPSTFTTHCSYLQREML  164



>ref|XP_004493668.1| PREDICTED: cyclin-P3-1-like [Cicer arietinum]
Length=218

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 112/176 (64%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL++LSS L++ V +N+ L    LD     +                   ++ FHG+ 
Sbjct  32   PRVLSLLSSFLDRSVQKNEML----LDDKHIEDV------------------VTVFHGLS  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP++S+ KYI+RI+KY+ CSPSCFVV ++Y+DR        L  SLNVHRLL+T +M+A+
Sbjct  70   APALSVRKYIDRIFKYSGCSPSCFVVAHIYVDRFLQNTDIKLT-SLNVHRLLITSIMLAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD  +NNA++A+VGGVS AELN+LE+  LF +DF + VS   F  YC  L+KE
Sbjct  129  KFMDDAFFNNAYYAKVGGVSTAELNRLEMSFLFGIDFRLQVSVDTFGRYCWDLEKE  184



>ref|XP_006433309.1| hypothetical protein CICLE_v10002472mg [Citrus clementina]
 ref|XP_006472004.1| PREDICTED: cyclin-P3-1-like [Citrus sinensis]
 gb|ESR46549.1| hypothetical protein CICLE_v10002472mg [Citrus clementina]
Length=211

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 117/182 (64%), Gaps = 23/182 (13%)
 Frame = +1

Query  91   QPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLS  270
            +  +++PRVL+ILSSVLE+ + +N+  +                         +  + ++
Sbjct  24   KKSSSSPRVLSILSSVLERSIQKNESSS----------------------KASKKKEVVT  61

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FH  +APS+SI +YIERI+KY+ C+PS FVV Y+Y+DR   +  N  +  LN+HRLL+T
Sbjct  62   IFHCSQAPSLSIRQYIERIFKYSRCNPSSFVVAYIYLDRFLQQI-NGCLTRLNIHRLLIT  120

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
              +VA+K +DDE YNNA++A++GG+S AE+NKLE+  LF L+F + V+++VF  YC  LD
Sbjct  121  SFLVAAKFVDDECYNNAYYAKIGGISTAEMNKLELNFLFTLEFKLHVTTEVFAKYCSQLD  180

Query  631  KE  636
             E
Sbjct  181  ME  182



>ref|XP_008451358.1| PREDICTED: cyclin-P3-1 [Cucumis melo]
 ref|XP_008451359.1| PREDICTED: cyclin-P3-1 [Cucumis melo]
Length=218

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 113/176 (64%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVLT+LSS+LE+ V +N+ L                          ++  + + FHG+R
Sbjct  32   PRVLTLLSSLLERSVKKNELL----------------------MEATQVKDARTMFHGLR  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP++SI  Y++RI+KY  CSPSCFV+  +Y+DR   K     + SLNVHRLL+T +M+A+
Sbjct  70   APTLSIRCYMDRIFKYFGCSPSCFVIANIYVDRFL-KCTEIQLTSLNVHRLLITSIMLAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD  +NNA++A+VGGVS AELNKLE++ LF +DF + V+ Q F  YC  L+KE
Sbjct  129  KFIDDSFFNNAYYAKVGGVSTAELNKLEMKFLFSIDFRLQVNIQTFGRYCYQLEKE  184



>ref|XP_008362758.1| PREDICTED: cyclin-U4-1-like [Malus domestica]
Length=207

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 119/202 (59%), Gaps = 24/202 (12%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            + PE+  PR++  +SSVLE++   ND                        +  F   + L
Sbjct  10   TSPESM-PRMIAFMSSVLERVSKSND-----------------------LNRRFHRTQKL  45

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
            S FH +  P+ISI  Y++RI+ Y +CSPSCF+V YVY+DR     P   + S NVHRLL+
Sbjct  46   SVFHSLTTPTISIHSYLQRIFNYADCSPSCFIVAYVYLDRFTQMQPLLPIDSFNVHRLLI  105

Query  448  TCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHL  627
            T V+V++K +DD +YNNAF+ARVGG+S  E+N LE++ LF L F ++V+   +  YC +L
Sbjct  106  TSVLVSAKFMDDIYYNNAFYARVGGISTQEMNLLEVDFLFGLGFQMNVTPATYYTYCSYL  165

Query  628  DKEILQCNGIGADATIINIIQR  693
             +E+L  + +    + +++ +R
Sbjct  166  QREMLLQSPLQFADSPVDLARR  187



>ref|XP_010485974.1| PREDICTED: cyclin-P3-1-like isoform X2 [Camelina sativa]
Length=213

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 122/209 (58%), Gaps = 35/209 (17%)
 Frame = +1

Query  43   MLEEGDNHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGs  222
            +LE+ D      P  S P    PRV+T+L+S+LEK++ +N +         T +N D   
Sbjct  18   LLEDSDQ-----PSDSTP----PRVITLLASILEKMIQKNKK------PHHTRHNKDD--  60

Query  223  ssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRL----  390
                          ++ FHG +APS+SI +Y ERI++Y  CSP+CFV  + YM R     
Sbjct  61   -------------EITMFHGSKAPSMSIYRYTERIHRYAQCSPACFVAAFAYMLRYLQRP  107

Query  391  -AHKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellf  567
             A   P   + +LNVHRLL+T ++VA+K L+ + YNNA++A++GGVS  E+N LE   LF
Sbjct  108  EATSTPRRRLTALNVHRLLITSLLVAAKFLERKCYNNAYYAKIGGVSTEEMNTLERTFLF  167

Query  568  llDFGVSVSSQVFECYCQHLDKEILQCNG  654
             +DF ++++++ FE +C  L +E + C+ 
Sbjct  168  DVDFRLNITTETFEKHCLMLQRETVPCDS  196



>ref|XP_008375750.1| PREDICTED: cyclin-U4-1 [Malus domestica]
Length=207

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 120/202 (59%), Gaps = 24/202 (12%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            + PE+  PR++  +SS+LE++   ND                        +    L + L
Sbjct  10   TSPESM-PRMIAFMSSILERVSNSND-----------------------LNRRLELTQKL  45

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
            S FH +  P+ISI  Y++RI+KY +CSPSCFVV YVY+DR     P   + S +VHRLL+
Sbjct  46   SVFHSLTTPTISIHSYLQRIFKYADCSPSCFVVAYVYLDRFTQMQPLLPIDSFSVHRLLI  105

Query  448  TCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHL  627
            T V+V++K +DD +YNNA++ARVGG+S  E+N LE++ LF L F ++V+   +  YC +L
Sbjct  106  TSVLVSAKFMDDNYYNNAYYARVGGISTQEMNLLEVDFLFGLGFQMNVTPVTYYTYCTYL  165

Query  628  DKEILQCNGIGADATIINIIQR  693
             +E+L    +  + + +++ +R
Sbjct  166  QREMLLQYPLQFEDSPVDLARR  187



>ref|XP_004247165.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum]
 ref|XP_010326376.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum]
 ref|XP_010326378.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum]
Length=217

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 118/182 (65%), Gaps = 23/182 (13%)
 Frame = +1

Query  91   QPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLS  270
            + ++  PRVL++LS++LE+ V  N+ L    L+     +                   ++
Sbjct  26   KEKSGKPRVLSLLSTLLERSVQNNESL----LESSQSEDV------------------IT  63

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FHG RAPS++I +Y++RIYKY+ CSPSCFVV ++YM+R   +  ++ + SLNVHRLL+T
Sbjct  64   IFHGSRAPSLNIEQYLDRIYKYSCCSPSCFVVAHIYMERFI-ECTSAHLTSLNVHRLLIT  122

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
             VMVA+K +DD  YNNA++ARVGGV+  ELNKLE++ LF LDF + V+   F  YC  ++
Sbjct  123  SVMVAAKFIDDAFYNNAYYARVGGVTTKELNKLEMKFLFGLDFQLHVNVPTFGSYCSLIE  182

Query  631  KE  636
            KE
Sbjct  183  KE  184



>ref|XP_008245770.1| PREDICTED: cyclin-U4-1-like [Prunus mume]
Length=203

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            K +S FHG   P ISI  Y+ERI+KY +CSPSC +V +VY+DR + + P+  + S NVHR
Sbjct  37   KKISVFHGQTRPPISIQSYLERIFKYADCSPSCLIVAHVYLDRFSQRQPDLPINSYNVHR  96

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LL+T VMVA+K +DD +YNNA++A+VGG+S  E+N LE++ LF L+F ++V+   F  YC
Sbjct  97   LLITSVMVAAKFMDDMYYNNAYYAKVGGISTIEMNFLEVDFLFGLNFNLNVNPSTFTTYC  156

Query  619  QHLDKEIL  642
             +L +EIL
Sbjct  157  SYLQREIL  164



>ref|XP_004307773.1| PREDICTED: cyclin-U4-1-like [Fragaria vesca subsp. vesca]
Length=204

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 117/202 (58%), Gaps = 28/202 (14%)
 Frame = +1

Query  94   PETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRL-GKSLS  270
            PE A PR++  LS VL+++   ND                            RL  + LS
Sbjct  8    PE-AMPRMIAFLSDVLDRVAKSND-------------------------LNRRLDSQKLS  41

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FH +  P+ISI  Y+ERI+KY +CSPSCFVV YVY+DR   +     + S NVHRLL+T
Sbjct  42   VFHCLTKPTISIQSYLERIFKYADCSPSCFVVAYVYLDRFTQRQKALPINSFNVHRLLIT  101

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
             VMV++K +DD  YNNA+FARVGG+S  E+N LE++ LF L F ++V+ + F  YC +L 
Sbjct  102  SVMVSAKFMDDISYNNAYFARVGGISTKEMNLLEMDFLFGLGFELNVTPENFITYCSYLQ  161

Query  631  KE-ILQCNGIGADATIINIIQR  693
            +E +LQ   +    + +N+  R
Sbjct  162  REMLLQSPPLHVTDSPLNLASR  183



>ref|XP_009760376.1| PREDICTED: cyclin-U4-1-like [Nicotiana sylvestris]
Length=205

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 107/178 (60%), Gaps = 24/178 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+V+  ++SVLE++   ND                               + +S FHG+ 
Sbjct  12   PKVINFMASVLERVAETNDLSRRFS------------------------AQKISMFHGLT  47

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+IS+  Y+ERI+KY NCSPSCFVV Y+Y+DR + + P   + S NVHRLL+T V+V++
Sbjct  48   RPTISVESYLERIFKYANCSPSCFVVAYIYLDRFSQRQPLLPINSFNVHRLLITSVLVSA  107

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            K +DD  YNNA++A+VGG+S  E+N LE++ LF + F ++V+   F  YC +L  E+L
Sbjct  108  KFMDDIFYNNAYYAKVGGISTKEMNLLEVDFLFGIGFQLNVTPTTFHTYCSYLQTEML  165



>ref|XP_010464054.1| PREDICTED: cyclin-P3-1-like [Camelina sativa]
Length=213

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 122/209 (58%), Gaps = 35/209 (17%)
 Frame = +1

Query  43   MLEEGDNHFPALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGs  222
            +LE+ D      P  S P    PRV+T+L+S+LEK++ +N +         T +N D   
Sbjct  18   LLEDSDQ-----PSDSTP----PRVITLLASILEKMIQKNKK------PHHTRHNKDD--  60

Query  223  ssssssAGFRLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRL----  390
                          ++ FHG +APS+SI +Y ERI++Y  CSP+CFV  + Y+ R     
Sbjct  61   -------------EITMFHGSKAPSMSIYRYTERIHRYAQCSPACFVTAFAYILRYLQRP  107

Query  391  -AHKYPNSLVISLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellf  567
             A   P   + SLNVHRLL+T ++VA+K L+ + YNNA++A++GGVS  E+N LE   LF
Sbjct  108  EATSTPRRRLTSLNVHRLLITSLLVAAKFLERKCYNNAYYAKIGGVSTEEMNTLERTFLF  167

Query  568  llDFGVSVSSQVFECYCQHLDKEILQCNG  654
             +DF ++++++ FE +C  L +E + C+ 
Sbjct  168  DVDFRLNITTETFEKHCLMLQRETVPCDS  196



>ref|XP_009804077.1| PREDICTED: cyclin-P3-1 [Nicotiana sylvestris]
Length=217

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 118/182 (65%), Gaps = 23/182 (13%)
 Frame = +1

Query  91   QPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLS  270
            + ++  PRVL++LS++LE+ V + + L    L+     +                   ++
Sbjct  26   KQKSGKPRVLSLLSTLLERSVQKTESL----LESTQRKDV------------------IT  63

Query  271  AFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVT  450
             FHG RAPS+ I +Y++RI+KY+ CSPSCFVV  +YM+R   ++ ++ + SLNVHRLL+T
Sbjct  64   IFHGSRAPSLGIEQYLDRIFKYSCCSPSCFVVAQIYMERFI-EHTSAHLTSLNVHRLLIT  122

Query  451  CVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
             VMVA+K +DD  YNNA++ARVGGV+  ELNKLE++ LF LDF + V+ + F  YC  L+
Sbjct  123  SVMVAAKFIDDAFYNNAYYARVGGVTTKELNKLEMKFLFGLDFRLHVNVKTFGSYCSLLE  182

Query  631  KE  636
            KE
Sbjct  183  KE  184



>ref|XP_010919767.1| PREDICTED: cyclin-P4-1 [Elaeis guineensis]
Length=201

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 112/179 (63%), Gaps = 22/179 (12%)
 Frame = +1

Query  103  ATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHG  282
            A PRV++I+SS+L+++  RND           P   D                  SAFHG
Sbjct  11   AIPRVVSIVSSLLQRVAERND------ASQRRPALHDRA----------------SAFHG  48

Query  283  VRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMV  462
            +  P+IS+  Y+ERI++Y NCSP+C+VV Y+Y+DR   ++P+  + SLNVHR ++T V+ 
Sbjct  49   LSKPAISVRSYLERIFRYANCSPACYVVAYIYLDRFTLRHPSVSIDSLNVHRFIITSVLT  108

Query  463  ASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            A K +DD +YNNA+FA+VGG++  E+N LE++ LF + F ++VS  +F  YC  L +E+
Sbjct  109  AVKFMDDIYYNNAYFAKVGGITLMEMNYLEVDFLFGMGFELNVSPDIFHSYCSVLQREM  167



>ref|XP_010277841.1| PREDICTED: cyclin-P3-1-like [Nelumbo nucifera]
 ref|XP_010277851.1| PREDICTED: cyclin-P3-1-like [Nelumbo nucifera]
Length=221

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = +1

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRL  441
            +++ FHG++AP++SI KYI+RI+KY+ C+PSCFVV Y+YMDR   +  +  + SLNVHRL
Sbjct  61   AITIFHGLKAPTMSIRKYIDRIFKYSGCTPSCFVVAYIYMDRFLQQ-TDVYLTSLNVHRL  119

Query  442  LVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQ  621
            L+T VM+A K ++D +YNNA++ARVGG++ AE+N++E++ LF L+F + V+++ F+ YC 
Sbjct  120  LITAVMLAVKFVEDVYYNNAYYARVGGITIAEMNRMEMKFLFSLEFRLHVTTETFKSYCL  179

Query  622  HLDKE  636
             L+KE
Sbjct  180  QLEKE  184



>ref|XP_009613666.1| PREDICTED: cyclin-U4-1-like [Nicotiana tomentosiformis]
Length=209

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 107/178 (60%), Gaps = 24/178 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P+V+  ++SVLE++   ND                               + +S FHG+ 
Sbjct  12   PKVINFMASVLERVAETNDLSRRFS------------------------AQKISMFHGLT  47

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
             P+IS+  Y+ERI+KY NCSPSCFVV Y+Y+DR + + P   + S NVHRLL+T V+V++
Sbjct  48   RPTISVESYLERIFKYANCSPSCFVVAYIYLDRFSQRQPLLPINSFNVHRLLITSVLVSA  107

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            K +DD  YNNA++A+VGG+S  E+N LE++ LF + F ++V+   F  YC +L  E+L
Sbjct  108  KFMDDIFYNNAYYAKVGGISTNEMNLLEVDFLFGIGFQLNVTPTTFHTYCSYLQTEML  165



>ref|XP_011079855.1| PREDICTED: cyclin-P3-1-like [Sesamum indicum]
 ref|XP_011079856.1| PREDICTED: cyclin-P3-1-like [Sesamum indicum]
Length=217

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 112/176 (64%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            P +L++L++VLE+ V +N+ +        T    D                 ++ FHG+R
Sbjct  32   PPILSLLAAVLERSVQKNEWIL------ETSQTKD----------------VITIFHGLR  69

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            APS+SI +YI+RI+KY  CSPSCFV+  +Y+DR   +  N  + SLN+HRLL+T VMVA+
Sbjct  70   APSLSIQQYIDRIFKYACCSPSCFVIANIYLDRFIQR-TNLFLTSLNIHRLLITSVMVAA  128

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD  +NNA++ARVGGVS AELNKLEI+ LF LDF + V+ + F  YC    KE
Sbjct  129  KFMDDAFFNNAYYARVGGVSTAELNKLEIKFLFGLDFRIHVTVKTFGEYCSVFKKE  184



>ref|XP_006653792.1| PREDICTED: cyclin-P1-1-like [Oryza brachyantha]
Length=270

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 113/173 (65%), Gaps = 14/173 (8%)
 Frame = +1

Query  118  LTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRAPS  297
            L +++  +++LVARND +A L        +  G   +    A F   K      G  AP 
Sbjct  30   LDMVACAVQRLVARNDAVAAL--------SGGGEEGAGVGMAAFEAAK------GAPAPR  75

Query  298  ISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASKIL  477
            I + +Y+ER+++Y    P C+VV Y Y+D +AH+ P + V S NVHRLL+ C++VASK+ 
Sbjct  76   IGVAQYLERVHRYAVLEPECYVVAYAYVDMVAHRRPAAAVDSRNVHRLLLACLLVASKVH  135

Query  478  DDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            DD H+NNAFFARVGGVSNAE+NKLE+ELL +LDF V +S +V+E Y  HL+KE
Sbjct  136  DDFHHNNAFFARVGGVSNAEMNKLELELLAVLDFEVMLSHRVYELYRAHLEKE  188



>ref|XP_009363720.1| PREDICTED: cyclin-U4-1-like [Pyrus x bretschneideri]
Length=207

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 119/202 (59%), Gaps = 24/202 (12%)
 Frame = +1

Query  88   SQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            + PE+  PR++  +SSVLE++   N                         +  F   + L
Sbjct  10   TSPESM-PRMIGFMSSVLERVSESN-----------------------VLNRRFHPTQKL  45

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLV  447
            S FH +  P+ISI  Y++RI+KY +CSPSCF+V YVY+DR     P   + S NVHRLL+
Sbjct  46   SVFHSLTTPTISIHSYLQRIFKYADCSPSCFIVAYVYLDRFTQMQPLLPIDSFNVHRLLI  105

Query  448  TCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHL  627
            T V+V++K +DD +YNNAF+ARVGG+S  E+N LE++ LF L F ++V+   +  YC +L
Sbjct  106  TSVLVSAKFMDDIYYNNAFYARVGGISTQEMNLLEVDFLFGLGFQMNVTPATYYTYCSYL  165

Query  628  DKEILQCNGIGADATIINIIQR  693
             +E+L  + +    + +++ +R
Sbjct  166  QREMLLQSPLQFADSPVDLARR  187



>ref|XP_007205921.1| hypothetical protein PRUPE_ppa011614mg [Prunus persica]
 gb|EMJ07120.1| hypothetical protein PRUPE_ppa011614mg [Prunus persica]
Length=203

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  259  KSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHR  438
            + +S FHG   P I+I  Y+ERI+KY +CSPSC +V YVY+DR + + P+  + S NVHR
Sbjct  37   QKISVFHGQTRPPIAIQGYLERIFKYADCSPSCLIVAYVYLDRFSQRQPDLPINSYNVHR  96

Query  439  LLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYC  618
            LL+T VMVA+K +DD +YNNA++A+VGG+S  E+N LE++ LF L+F ++V+   F  YC
Sbjct  97   LLITSVMVAAKFMDDMYYNNAYYAKVGGISTIEMNFLEVDFLFGLNFNLNVTPSTFTTYC  156

Query  619  QHLDKEIL  642
             +L +E+L
Sbjct  157  SYLQREML  164



>ref|XP_007030852.1| Cyclin family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY11354.1| Cyclin family protein, putative isoform 1 [Theobroma cacao]
Length=251

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 115/182 (63%), Gaps = 27/182 (15%)
 Frame = +1

Query  103  ATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHG  282
              PRVL++LSS+LE+ + RN++L                        G R    ++ FHG
Sbjct  52   GAPRVLSLLSSILERSIQRNEKLV----------------------GGSRRMDVVTIFHG  89

Query  283  VRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMV  462
             +AP++ I +Y+ERI+KY+ CS SCFVV  VY+DR   +    L  SLNVHRLL+T  MV
Sbjct  90   TKAPALGIRQYVERIFKYSKCSNSCFVVALVYVDRFLERMGAHLT-SLNVHRLLITSFMV  148

Query  463  ASKILDDEH----YNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLD  630
            A+K +DD+     YNNA++A+VGGVS  E+N+LE++LLF LDF + V+++VF  YC  ++
Sbjct  149  AAKFIDDQRICRCYNNAYYAKVGGVSTEEMNELEMKLLFSLDFRLHVTTEVFNKYCLKIE  208

Query  631  KE  636
            +E
Sbjct  209  RE  210



>ref|XP_006388184.1| hypothetical protein POPTR_0296s00210g [Populus trichocarpa]
 gb|ERP47098.1| hypothetical protein POPTR_0296s00210g [Populus trichocarpa]
Length=201

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 111/182 (61%), Gaps = 25/182 (14%)
 Frame = +1

Query  97   ETAT-PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSA  273
            ETA  P+V+T LSS+L+++   ND    L                          +  S 
Sbjct  6    ETAVMPKVITFLSSLLQRVAESNDISHQL------------------------YPQKASI  41

Query  274  FHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTC  453
            FHG+  P+ISI  Y+ERI+KY+NCSPSCFVV YVY+DR + +     + S NVHRLL+T 
Sbjct  42   FHGLTRPTISIQNYLERIFKYSNCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITS  101

Query  454  VMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDK  633
            V+V+ K +DD +YNNAF+A+VGG+S  E+N LE++ LF L F ++V+   F  YC +L +
Sbjct  102  VLVSVKFMDDIYYNNAFYAKVGGISTREMNLLEVDFLFGLGFQLNVTPTTFHLYCSYLQR  161

Query  634  EI  639
            E+
Sbjct  162  EM  163



>ref|XP_006654367.1| PREDICTED: cyclin-P3-1-like [Oryza brachyantha]
Length=235

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 114/188 (61%), Gaps = 23/188 (12%)
 Frame = +1

Query  73   ALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFR  252
             +P   + +   P+VL +L++ L+++V +N+ L    LD     N               
Sbjct  22   TVPQSKKKDAEYPKVLLLLATYLDRVVQKNEDL----LDSNEIKN---------------  62

Query  253  LGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNV  432
               S + FHG RAP +SI  Y ERI+KY+ CSPSCFV+  +YM+R   + P+  + SL+V
Sbjct  63   ---SSTIFHGQRAPDLSIKLYAERIFKYSECSPSCFVLALIYMERYLQQ-PHVYMTSLSV  118

Query  433  HRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFEC  612
            HRLL+T V+VA+K  DD  +NNAF+ARVGG+S  E+N+LE++LLF LDF + V    F  
Sbjct  119  HRLLITSVVVAAKFTDDAFFNNAFYARVGGISTVEMNRLELDLLFNLDFRLKVDLDTFGS  178

Query  613  YCQHLDKE  636
            YC  L+KE
Sbjct  179  YCLQLEKE  186



>ref|XP_007162425.1| hypothetical protein PHAVU_001G151100g [Phaseolus vulgaris]
 ref|XP_007162426.1| hypothetical protein PHAVU_001G151100g [Phaseolus vulgaris]
 gb|ESW34419.1| hypothetical protein PHAVU_001G151100g [Phaseolus vulgaris]
 gb|ESW34420.1| hypothetical protein PHAVU_001G151100g [Phaseolus vulgaris]
Length=217

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 116/176 (66%), Gaps = 23/176 (13%)
 Frame = +1

Query  109  PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVR  288
            PRVL++LSS+LE+LV RN+ L    L+                     +   ++ FHG+R
Sbjct  31   PRVLSLLSSLLERLVQRNETL----LEAN------------------HIKDVVTVFHGLR  68

Query  289  APSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVAS  468
            AP++S+ KYI+RI+KY+ CSPSCFVV ++Y+DR        L  SLNVHRLL+T +M+A+
Sbjct  69   APTLSVRKYIDRIFKYSGCSPSCFVVAHIYVDRFIQHTEIKLT-SLNVHRLLITSIMLAA  127

Query  469  KILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            K +DD  YNNA++A+VGGVS +ELN+LE+  LF +DF + VS   F  YC+ L+KE
Sbjct  128  KFIDDAFYNNAYYAKVGGVSTSELNRLEMSFLFGVDFRLQVSVDTFGRYCRQLEKE  183



>emb|CDY18791.1| BnaAnng02560D [Brassica napus]
Length=214

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 132/212 (62%), Gaps = 27/212 (13%)
 Frame = +1

Query  91   QPETAT-PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            QP T+T P V+T+LSSVL K++ +N++          P +T            FR  + +
Sbjct  24   QPSTSTLPPVITLLSSVLTKMIQKNEK----------PFHTRRN--------KFR-DEEI  64

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSL-----VISLNV  432
            + FHG RAPS++I +Y ER+++Y  CSP+CFV  +VY+ R   + P +      + SLNV
Sbjct  65   TMFHGSRAPSMNIQRYTERVHRYARCSPACFVAAFVYIVRYLER-PGATSMTRRLTSLNV  123

Query  433  HRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFEC  612
            HRLL+T ++VA+K LD + YNNA++A++GGVS  E+N+LE   LF LDF +++++++FE 
Sbjct  124  HRLLITSILVAAKFLDRKCYNNAYYAKIGGVSTEEMNRLERTFLFDLDFRLNITAEMFEK  183

Query  613  YCQHLDKEILQCNGIGADATIINIIQRGVEAL  708
            +C  L ++ + C G G   T +  +  G +A+
Sbjct  184  HCLMLQRQTVPC-GSGRLRTALEEMTCGCQAI  214



>ref|XP_004962162.1| PREDICTED: cyclin-P3-1-like [Setaria italica]
Length=237

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 114/190 (60%), Gaps = 23/190 (12%)
 Frame = +1

Query  73   ALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFR  252
             +P   +     P+VL +LS+ L+K V +N+ L    LD                    +
Sbjct  23   TVPHSQKGNAEFPKVLLLLSTYLDKTVQQNEEL----LDSS------------------K  60

Query  253  LGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNV  432
            + +S + FHG R P +SI  Y ERI+KY  CSPSCFV+  +YM+R   + PN  + S +V
Sbjct  61   VKESTTIFHGQRVPELSIKLYAERIFKYAQCSPSCFVLALIYMERYLQQ-PNIYMTSFSV  119

Query  433  HRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFEC  612
            HRLL+T V+VA+K +DD  +NNA++ RVGG+S  E+N+LE++LLF LDF + V+ + F  
Sbjct  120  HRLLITSVVVAAKFIDDSFFNNAYYGRVGGISTREMNRLELDLLFSLDFRLKVNLETFRS  179

Query  613  YCQHLDKEIL  642
            YC  L+KE L
Sbjct  180  YCLQLEKEAL  189



>gb|KHF97746.1| Cyclin-P3-1 [Gossypium arboreum]
Length=264

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 97/136 (71%), Gaps = 1/136 (1%)
 Frame = +1

Query  250  RLGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLN  429
            +   +++ FHG+RAP+ISI  YI+RI+KY  CSPSCF+V Y+Y+DR   +    L  SLN
Sbjct  103  KFKDNVAMFHGLRAPTISIQHYIDRIFKYAGCSPSCFLVAYIYVDRFVQQTDVHLT-SLN  161

Query  430  VHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFE  609
            VHRLL+T V+VA+K +DD  +NNA++ARVGGVS AELN+LE+  LF LDF + V+   F+
Sbjct  162  VHRLLITSVLVAAKFIDDAFFNNAYYARVGGVSTAELNRLEMSFLFGLDFRLQVTVNTFQ  221

Query  610  CYCQHLDKEILQCNGI  657
             YC  L KE  + N I
Sbjct  222  RYCCQLQKECWEGNQI  237



>ref|XP_004976902.1| PREDICTED: cyclin-P1-1-like [Setaria italica]
Length=246

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 113/174 (65%), Gaps = 16/174 (9%)
 Frame = +1

Query  118  LTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRAPS  297
            L +L+  +++LVARND +A        P+   GG             ++  A  G  AP 
Sbjct  27   LAMLARAVQRLVARNDAVA-------APDGRGGGGGGL---------RAFEAARGAPAPR  70

Query  298  ISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASKIL  477
            I + +Y+ER+++Y    P C+VV Y Y+D  AH+ P + V S NVHRLL+ C++VASK+L
Sbjct  71   IGVAEYLERVHRYAGLDPECYVVAYAYVDMAAHRRPAAAVASRNVHRLLLACLLVASKVL  130

Query  478  DDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            DD H++NAFFARVGGVSNAE+NKLE+ELL +LDF V+V  + +  Y +HL+KE+
Sbjct  131  DDFHHSNAFFARVGGVSNAEMNKLELELLDVLDFAVAVDHRAYGRYREHLEKEM  184



>ref|XP_006408089.1| hypothetical protein EUTSA_v10021509mg [Eutrema salsugineum]
 gb|ESQ49542.1| hypothetical protein EUTSA_v10021509mg [Eutrema salsugineum]
Length=212

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 120/194 (62%), Gaps = 28/194 (14%)
 Frame = +1

Query  91   QPETATP-RVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            QP ++TP RV+T+L+SVLEK++ +N++                        A  +  + +
Sbjct  24   QPSSSTPPRVITLLASVLEKMIQKNEK---------------------PFYARHKTDEEI  62

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDR-----LAHKYPNSLVISLNV  432
            S FHG R PS++I +Y ER+++Y  CSP+CFV  + Y+ R     +A +    L + LNV
Sbjct  63   SMFHGSREPSMTIHRYTERVHRYARCSPACFVAAFAYILRYLQRPVATRMTRRLTL-LNV  121

Query  433  HRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFEC  612
            HRLL+T ++VA+K LD + YNNA++A++GGVS  E+N+LE   LF LDF ++++ ++FE 
Sbjct  122  HRLLITSILVAAKFLDRKCYNNAYYAKIGGVSTEEMNRLERTFLFDLDFRLNITPEMFEK  181

Query  613  YCQHLDKEILQCNG  654
            YC  L +E + C+ 
Sbjct  182  YCLMLQRENVPCDS  195



>emb|CDY18769.1| BnaAnng02340D [Brassica napus]
Length=212

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 123/196 (63%), Gaps = 26/196 (13%)
 Frame = +1

Query  76   LPGPSQPETAT-PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFR  252
            + G  QP  +T PRV+T+L+S+L K++ +N++         T  N D             
Sbjct  19   IEGYDQPSASTLPRVITLLASLLTKMIQKNEK------PFHTRRNKD-------------  59

Query  253  LGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDR-LAHKYPNSLVI---  420
              + ++ FHG RAPS++I +Y ER+++Y  CSP+CFV  +VY+ R L      S+ +   
Sbjct  60   --EEITMFHGSRAPSMNIQRYTERVHRYARCSPACFVAAFVYIIRYLERPGATSMTLRLT  117

Query  421  SLNVHRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQ  600
            SLNVHRLL+T ++VA+K LD + YNNA++A++GGVS  E+N+LE   LF LDF ++++++
Sbjct  118  SLNVHRLLITSLLVAAKFLDRKCYNNAYYAKIGGVSTEEMNRLERTFLFDLDFRLNITAE  177

Query  601  VFECYCQHLDKEILQC  648
            +FE +C  L ++ + C
Sbjct  178  MFEKHCLMLQRQTVPC  193



>ref|XP_004167894.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
Length=196

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 111/189 (59%), Gaps = 25/189 (13%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            G  +     P+V+  LSSVL+++   ND+   +     T  N  G               
Sbjct  2    GEKEGMVGIPKVINYLSSVLQRVSDSNDKENRMI----TKRNNSG---------------  42

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHK-YPNSLVI-SLNVH  435
                F G+  PSISI  Y+ERI+KY NCSPSCFV  YVY+ R  H  +P++L I S NVH
Sbjct  43   ----FDGISRPSISIQSYLERIFKYANCSPSCFVAAYVYLHRFLHNHHPSNLHIDSFNVH  98

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T V+V++K  DD +YNNA++A+VGG+S  E+N LE++ LF L F ++VS   F  Y
Sbjct  99   RLLITSVLVSAKFFDDLYYNNAYYAKVGGISTMEMNHLELDFLFGLRFQLNVSPNTFHIY  158

Query  616  CQHLDKEIL  642
            C +L  E+L
Sbjct  159  CSYLQSEML  167



>ref|XP_009147251.1| PREDICTED: cyclin-P3-1-like [Brassica rapa]
Length=212

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 121/192 (63%), Gaps = 26/192 (14%)
 Frame = +1

Query  91   QPETAT-PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            QP T+T PRV+T+L+ +L K++ +N++         T +N +G                +
Sbjct  24   QPSTSTLPRVITLLALILGKMIQKNEK------SLHTRHNKEG---------------EI  62

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDR-LAHKYPNSL---VISLNVH  435
            + FHG RAPS++I +Y ER+Y+Y  CSP+CFV  + Y+ R L      S+   + SLNVH
Sbjct  63   TMFHGSRAPSMNIHRYTERVYRYARCSPACFVAAFAYILRYLETPVATSMTPRLTSLNVH  122

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T ++VA+K LD + YNNA++A++GGVS  E+N+LE   LF +DF +++++++FE +
Sbjct  123  RLLITSLLVAAKFLDRKCYNNAYYAKIGGVSTEEMNRLERTFLFDVDFRLNITAEMFERH  182

Query  616  CQHLDKEILQCN  651
            C  L +E + C 
Sbjct  183  CLMLQRETVTCE  194



>ref|XP_011076450.1| PREDICTED: cyclin-U4-1-like [Sesamum indicum]
Length=203

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 109/177 (62%), Gaps = 24/177 (14%)
 Frame = +1

Query  112  RVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRA  291
            +V+  LSS+L+++   ND     C D                       + +S FHG+  
Sbjct  12   KVIKFLSSLLQRVAEAND--VFRCFDA----------------------QKISIFHGLTR  47

Query  292  PSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASK  471
            P+ISI  Y+ERI+KY NCSPSCF+V YVY+DR + + P   + S NVHRLL+  V+V++K
Sbjct  48   PTISIQCYLERIFKYANCSPSCFIVAYVYLDRFSQRQPLLPINSFNVHRLLIASVLVSAK  107

Query  472  ILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
             +DD  YNNA++A+VGG+S AE+N LE++ LF L F ++VS+  F  Y  +L +E+L
Sbjct  108  FMDDIFYNNAYYAKVGGISTAEMNLLEVDFLFGLGFELNVSTATFHRYNSYLQREML  164



>ref|XP_002306774.1| cyclin family protein [Populus trichocarpa]
 gb|EEE93770.1| cyclin family protein [Populus trichocarpa]
Length=219

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 112/177 (63%), Gaps = 23/177 (13%)
 Frame = +1

Query  106  TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGV  285
            +PRVL +LSS+L++ V +N+ L                          ++   ++ FHG+
Sbjct  31   SPRVLMLLSSLLDRSVQKNEML----------------------LETTQIKDVVTIFHGL  68

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
            R P++SI  Y++RI+KY+ CSPSCFVV ++YMDR   +    L  +LNVHRLL+T VM+A
Sbjct  69   RPPTVSIRNYVDRIFKYSACSPSCFVVAHIYMDRFLQQTDIHLT-ALNVHRLLITSVMIA  127

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKE  636
            +K +DD  +NNA++A+VGGVS  ELN+LE++ LF +DF + V+   F  +C  L+KE
Sbjct  128  AKFVDDAFFNNAYYAKVGGVSTEELNRLEMKFLFSIDFRLQVNVNTFGKHCYQLEKE  184



>ref|XP_011084761.1| PREDICTED: cyclin-U4-1-like isoform X1 [Sesamum indicum]
Length=199

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 103/176 (59%), Gaps = 26/176 (15%)
 Frame = +1

Query  115  VLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGVRAP  294
            V+  LSS L+++   ND         G P  T                   S FHG+  P
Sbjct  12   VIKYLSSFLQRIAESNDVF-------GVPLKT-------------------SIFHGLTRP  45

Query  295  SISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVASKI  474
            +ISI  Y+ERIYKY NCSPSC VV Y+Y+DR   K P   + S  VHRLL+  V+V++K 
Sbjct  46   TISILCYMERIYKYANCSPSCLVVAYIYIDRFVQKQPLLPISSFTVHRLLIASVLVSAKF  105

Query  475  LDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEIL  642
            +DD  YNNA++A+VGG+S AE+N LE++ LF L F +SVS   F+ YC  L +E+L
Sbjct  106  MDDMFYNNAYYAKVGGISTAEMNLLEMDFLFGLGFQLSVSPSTFQTYCSFLQREML  161



>ref|XP_003553729.1| PREDICTED: cyclin-P3-1-like [Glycine max]
 gb|KHN43280.1| Cyclin-P3-1 [Glycine soja]
Length=176

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 113/185 (61%), Gaps = 23/185 (12%)
 Frame = +1

Query  76   LPGPSQPE-TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFR  252
            L  PS+   + TP VL  LSS  E+ + +N++L L       P                 
Sbjct  13   LGAPSKSHASGTPLVLLNLSSNWERSILKNEKLLLTTRKKNDP-----------------  55

Query  253  LGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNV  432
                ++ FHG +AP++S+  Y+ERI KY++CSPSCFV+  +YMDR   K     + S N 
Sbjct  56   ----VTIFHGSKAPNLSVTHYMERILKYSHCSPSCFVIAQIYMDRFFQK-KGGYLTSFNA  110

Query  433  HRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFEC  612
            HRLL+T VMVA K LDD++Y+NA++A+VGGVS  E+N++E+E LF L+F + V++++F  
Sbjct  111  HRLLITSVMVAVKFLDDKYYSNAYYAKVGGVSTEEMNRMELEFLFNLEFRLFVTTELFLK  170

Query  613  YCQHL  627
            YC+ L
Sbjct  171  YCEKL  175



>emb|CDY27777.1| BnaA05g31860D [Brassica napus]
Length=212

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 121/192 (63%), Gaps = 26/192 (14%)
 Frame = +1

Query  91   QPETAT-PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSL  267
            QP T+T PRV+T+L+ +L K++ +N++         T +N +G                +
Sbjct  24   QPSTSTLPRVITLLALILGKMIQKNEK------SLHTRHNKEG---------------EI  62

Query  268  SAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDR-LAHKYPNSL---VISLNVH  435
            + FHG RAPS++I +Y ER+Y+Y  CSP+CFV  + Y+ R L      S+   + SLNVH
Sbjct  63   TMFHGSRAPSMNIHRYTERVYRYARCSPACFVAAFAYILRYLETPVATSMTPRLTSLNVH  122

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T ++VA+K LD + YNNA++A++GGVS  E+N+LE   LF +DF +++++++FE +
Sbjct  123  RLLITSLLVAAKFLDRKCYNNAYYAKIGGVSTEEMNRLERTFLFDVDFRLNITAEMFERH  182

Query  616  CQHLDKEILQCN  651
            C  L +E + C 
Sbjct  183  CLMLQRETVACE  194



>ref|XP_002271136.1| PREDICTED: cyclin-U4-1 [Vitis vinifera]
 emb|CBI16684.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = +1

Query  253  LGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNV  432
            L + +S FHG+  P+ISI  Y+ERI+ Y NCSPSC+VV Y+Y+DR   K P+  + S NV
Sbjct  35   LPQKISVFHGLTRPNISIQSYLERIFNYANCSPSCYVVAYIYLDRFVQKQPSLPINSYNV  94

Query  433  HRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFEC  612
            HRLL+T VMVA+K +DD +YNNA++A+VGG+S  E+N LE++ LF L F ++V+   F  
Sbjct  95   HRLLITGVMVAAKFMDDMYYNNAYYAKVGGISTREMNFLEVDFLFGLAFDLNVTPTTFHT  154

Query  613  YCQHLDKEIL  642
            YC  L +E+L
Sbjct  155  YCCCLQREML  164



>ref|XP_004146934.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
 gb|KGN53181.1| hypothetical protein Csa_4G025110 [Cucumis sativus]
Length=196

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 111/189 (59%), Gaps = 25/189 (13%)
 Frame = +1

Query  82   GPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGK  261
            G  +     P+V+  LSSVL+++   ND+   +     T  N  G               
Sbjct  2    GEKEGMVGIPKVINYLSSVLQRVSDSNDKENRMI----TKRNNSG---------------  42

Query  262  SLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHK-YPNSLVI-SLNVH  435
                F G+  PSISI  Y+ERI+KY NCSPSCFV  YVY+ R  H  +P++L I S NVH
Sbjct  43   ----FDGISRPSISIQSYLERIFKYANCSPSCFVAAYVYLHRFLHNHHPSNLHIDSFNVH  98

Query  436  RLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECY  615
            RLL+T V+V++K  DD +YNNA++A+VGG+S  E+N LE++ LF L F ++VS   F  Y
Sbjct  99   RLLITSVLVSAKFFDDLYYNNAYYAKVGGISTMEMNHLELDFLFGLRFQLNVSPNTFHIY  158

Query  616  CQHLDKEIL  642
            C +L  E+L
Sbjct  159  CSYLQSEML  167



>ref|NP_001149845.1| LOC100283473 [Zea mays]
 gb|ACL54060.1| unknown [Zea mays]
 gb|ACR35554.1| unknown [Zea mays]
 gb|ACR37589.1| unknown [Zea mays]
 gb|AFW77918.1| PREG-like protein [Zea mays]
Length=236

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 114/186 (61%), Gaps = 24/186 (13%)
 Frame = +1

Query  88   SQPETAT-PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKS  264
            SQ + A  P+VL +LS+ L+K V +N+ L    LD                    ++ +S
Sbjct  27   SQKDNAEFPKVLLLLSAYLDKTVQQNEEL----LDSS------------------KIKES  64

Query  265  LSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLL  444
             + FHG R P +SI  Y ERI+KY  CSPSCFV+  +YM+R   + PN  + S +VHRLL
Sbjct  65   TTIFHGQRVPELSIKLYAERIFKYAKCSPSCFVLALIYMERYLQQ-PNIYMTSFSVHRLL  123

Query  445  VTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQH  624
            +T V+VA+K +DD  +NNA++ RVGG+S  E+N LE++LLF LDF + V  + FE YC  
Sbjct  124  ITSVVVAAKFIDDAFFNNAYYGRVGGISTREMNMLELDLLFGLDFRLKVDIETFESYCLQ  183

Query  625  LDKEIL  642
            L++ ++
Sbjct  184  LEEALV  189



>gb|ACG36976.1| PREG-like protein [Zea mays]
Length=234

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 114/186 (61%), Gaps = 24/186 (13%)
 Frame = +1

Query  88   SQPETAT-PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKS  264
            SQ + A  P+VL +LS+ L+K V +N+ L    LD                    ++ +S
Sbjct  25   SQKDNAEFPKVLLLLSAYLDKTVQQNEEL----LDSS------------------KIKES  62

Query  265  LSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLL  444
             + FHG R P +SI  Y ERI+KY  CSPSCFV+  +YM+R   + PN  + S +VHRLL
Sbjct  63   TTIFHGQRVPELSIKLYAERIFKYAKCSPSCFVLALIYMERYLQQ-PNIYMTSFSVHRLL  121

Query  445  VTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQH  624
            +T V+VA+K +DD  +NNA++ RVGG+S  E+N LE++LLF LDF + V  + FE YC  
Sbjct  122  ITSVVVAAKFIDDAFFNNAYYGRVGGISTREMNMLELDLLFGLDFRLKVDIETFESYCLQ  181

Query  625  LDKEIL  642
            L++ ++
Sbjct  182  LEEALV  187



>gb|EEE63644.1| hypothetical protein OsJ_18461 [Oryza sativa Japonica Group]
Length=234

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 113/181 (62%), Gaps = 23/181 (13%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T  P+VL +L++ L++ V +N+ L    LD                    ++  S + FH
Sbjct  31   TEYPKVLLLLAAYLDRSVQKNEDL----LDSN------------------KIKDSSTIFH  68

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G RAP +SI  Y ERI+KY+ CSPSCFV+  +YM+R   + P+  + SL+VHRLL+T V+
Sbjct  69   GHRAPDLSIKLYAERIFKYSECSPSCFVLALIYMERYLQQ-PHVYMTSLSVHRLLITSVV  127

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K  DD  +NNAF+ARVGG+S  E+N+LE++LLF LDF + V  + F  YC  L+KE 
Sbjct  128  VAAKFTDDAFFNNAFYARVGGISTVEMNRLELDLLFNLDFRLKVDLETFGSYCLQLEKET  187

Query  640  L  642
            +
Sbjct  188  M  188



>gb|EEC79180.1| hypothetical protein OsI_19875 [Oryza sativa Indica Group]
Length=234

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 113/181 (62%), Gaps = 23/181 (13%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T  P+VL +L++ L++ V +N+ L    LD                    ++  S + FH
Sbjct  31   TEYPKVLLLLAAYLDRSVQKNEDL----LDSN------------------KIKDSSTIFH  68

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G RAP +SI  Y ERI+KY+ CSPSCFV+  +YM+R   + P+  + SL+VHRLL+T V+
Sbjct  69   GHRAPDLSIKLYAERIFKYSECSPSCFVLALIYMERYLQQ-PHVYMTSLSVHRLLITSVV  127

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K  DD  +NNAF+ARVGG+S  E+N+LE++LLF LDF + V  + F  YC  L+KE 
Sbjct  128  VAAKFTDDAFFNNAFYARVGGISTVEMNRLELDLLFNLDFRLKVDLETFGSYCLQLEKET  187

Query  640  L  642
            +
Sbjct  188  M  188



>sp|Q75HV0.1|CCP31_ORYSJ RecName: Full=Cyclin-P3-1; Short=CycP3;1 [Oryza sativa Japonica 
Group]
 gb|AAT07648.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU10797.1| unknown protein [Oryza sativa Japonica Group]
Length=236

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 113/181 (62%), Gaps = 23/181 (13%)
 Frame = +1

Query  100  TATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFH  279
            T  P+VL +L++ L++ V +N+ L    LD                    ++  S + FH
Sbjct  33   TEYPKVLLLLAAYLDRSVQKNEDL----LDSN------------------KIKDSSTIFH  70

Query  280  GVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVM  459
            G RAP +SI  Y ERI+KY+ CSPSCFV+  +YM+R   + P+  + SL+VHRLL+T V+
Sbjct  71   GHRAPDLSIKLYAERIFKYSECSPSCFVLALIYMERYLQQ-PHVYMTSLSVHRLLITSVV  129

Query  460  VASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEI  639
            VA+K  DD  +NNAF+ARVGG+S  E+N+LE++LLF LDF + V  + F  YC  L+KE 
Sbjct  130  VAAKFTDDAFFNNAFYARVGGISTVEMNRLELDLLFNLDFRLKVDLETFGSYCLQLEKET  189

Query  640  L  642
            +
Sbjct  190  M  190



>ref|XP_006374594.1| hypothetical protein POPTR_0015s12380g [Populus trichocarpa]
 gb|ERP52391.1| hypothetical protein POPTR_0015s12380g [Populus trichocarpa]
Length=201

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 111/182 (61%), Gaps = 25/182 (14%)
 Frame = +1

Query  97   ETAT-PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSA  273
            ETA  P+V+T LSS+L+++   ND    L                          +  S 
Sbjct  6    ETAVMPKVITFLSSLLKRVAESNDISHQL------------------------YPQKASI  41

Query  274  FHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTC  453
            FHG+  P+ISI  Y+ERI+KY+NCSPSCFVV YVY+DR + +     + S NVHRLL+T 
Sbjct  42   FHGLTRPTISIQNYLERIFKYSNCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITS  101

Query  454  VMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDK  633
            V+V+ K +DD +YNNAF+A+VGG+S  E+N LE++ LF L F ++V+   F  YC +L +
Sbjct  102  VLVSVKFMDDIYYNNAFYAKVGGISTREMNLLEVDFLFGLGFQLNVTPATFHLYCSYLQR  161

Query  634  EI  639
            ++
Sbjct  162  DM  163



>gb|AFK44566.1| unknown [Lotus japonicus]
Length=214

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 97/130 (75%), Gaps = 4/130 (3%)
 Frame = +1

Query  265  LSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLL  444
            ++ FHG+RAP++S+ KYI+RI+KY+ CSPSCFV+ ++Y+DR        L  SLNVHRLL
Sbjct  61   VTVFHGLRAPALSVHKYIDRIFKYSGCSPSCFVLAHIYVDRFLQHTEIKLT-SLNVHRLL  119

Query  445  VTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQH  624
            +T +M+A+K +DD  +NNA++A+VGGVS +ELN+LE+  LF +DF + VS   F+ YC  
Sbjct  120  ITSIMLATKFMDDAFFNNAYYAKVGGVSTSELNRLEMSFLFGIDFRLQVSVDKFQRYCWQ  179

Query  625  LDKE---ILQ  645
            L+KE   ILQ
Sbjct  180  LEKESADILQ  189



>ref|XP_010043088.1| PREDICTED: cyclin-P3-1-like isoform X2 [Eucalyptus grandis]
 gb|KCW85146.1| hypothetical protein EUGRSUZ_B01989 [Eucalyptus grandis]
Length=224

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 115/188 (61%), Gaps = 23/188 (12%)
 Frame = +1

Query  73   ALPGPSQPETATPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFR  252
             L   S  ++ TP++L  ++S LEK + RN++L+        P+    G           
Sbjct  20   GLDKSSNDDSGTPQILFDMASALEKSIRRNEKLS-------KPSKRKEG-----------  61

Query  253  LGKSLSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNV  432
                ++ FHG RAP++S+ +Y+ERI KYT+CS SCFVV Y+Y++R   +    L  SLN+
Sbjct  62   ----VTIFHGSRAPTMSVRQYLERICKYTSCSMSCFVVAYIYINRFLERTAGCLT-SLNI  116

Query  433  HRLLVTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFEC  612
            HRLL+T V+VASK +D+   NN++FA+VGG+SNAE+N++E+  LF LDF + VS +  E 
Sbjct  117  HRLLITSVVVASKFIDNAGANNSYFAKVGGISNAEMNRMEVNFLFKLDFRLCVSPEELEI  176

Query  613  YCQHLDKE  636
            Y   L  E
Sbjct  177  YRSQLQTE  184



>ref|XP_011040341.1| PREDICTED: cyclin-U4-1-like isoform X1 [Populus euphratica]
Length=194

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 110/182 (60%), Gaps = 25/182 (14%)
 Frame = +1

Query  97   ETAT-PRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSA  273
            ETA  P+V+  LSS+L+++   ND    L                          + +S 
Sbjct  6    ETAVMPKVIPFLSSLLQRVAESNDISHQL------------------------YPQKVSI  41

Query  274  FHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTC  453
            FHG+  P+ISI  Y+ERI+KY NCSPSCFVV YVY+DR + +     + S NVHRLL+T 
Sbjct  42   FHGLSRPAISIQNYLERIFKYANCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITS  101

Query  454  VMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDK  633
            V+V+ K +DD +YNNAF+A+VGG+S  E+N LE++ LF L F ++V+   F  YC +L +
Sbjct  102  VLVSVKFMDDIYYNNAFYAKVGGISTREMNLLEVDFLFGLGFQLNVTPATFHFYCSYLQR  161

Query  634  EI  639
            E+
Sbjct  162  EM  163



>gb|EYU31943.1| hypothetical protein MIMGU_mgv1a013240mg [Erythranthe guttata]
Length=226

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 116/190 (61%), Gaps = 18/190 (9%)
 Frame = +1

Query  106  TPRVLTILSSVLEKLVARNDRLALLCLDGGTPNNTDGGsssssssAGFRLGKSLSAFHGV  285
            TP V+++L+S++E+ +ARN+R+A  C                      +L K+   F   
Sbjct  25   TPLVISVLASLIERTLARNERIAKNC-----------------RVISHKLSKT-RVFDSD  66

Query  286  RAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLLVTCVMVA  465
             AP ++I  Y+ERI++YT   PS +VV YVY+DRL   YP   +   NVHRLL+T +MVA
Sbjct  67   EAPDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRLCQFYPEFRIGPRNVHRLLITTIMVA  126

Query  466  SKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQHLDKEILQ  645
            SK ++D +Y N++FARVGG++  E+NKLE E +F++ F + V+  V+E YC HL++E+  
Sbjct  127  SKFVEDMNYRNSYFARVGGITREEMNKLEFEFIFMMKFKLHVNVSVYESYCCHLEREVSI  186

Query  646  CNGIGADATI  675
              G   + T+
Sbjct  187  GGGYQIERTL  196



>gb|AFK40008.1| unknown [Lotus japonicus]
Length=214

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 97/130 (75%), Gaps = 4/130 (3%)
 Frame = +1

Query  265  LSAFHGVRAPSISIPKYIERIYKYTNCSPSCFVVGYVYMDRLAHKYPNSLVISLNVHRLL  444
            ++ FHG+RAP++S+ KYI+RI+KY+ CSPSCFV+ ++Y+DR        L  SLNVHRLL
Sbjct  61   VTVFHGLRAPALSVHKYIDRIFKYSGCSPSCFVLAHIYVDRFLQHTEIKLT-SLNVHRLL  119

Query  445  VTCVMVASKILDDEHYNNAFFARVGGVSNAelnkleiellfllDFGVSVSSQVFECYCQH  624
            +T +M+A+K +DD  +NNA++A+VGGVS +ELN+LE+  LF +DF + VS   F+ YC  
Sbjct  120  ITSIMLAAKFMDDAFFNNAYYAKVGGVSTSELNRLEMSFLFGIDFRLQVSVDKFQRYCWQ  179

Query  625  LDKE---ILQ  645
            L+KE   ILQ
Sbjct  180  LEKESADILQ  189



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2314958397494