BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c37287_g1_i1 len=1028 path=[1:0-1027]

Length=1028
                                                                      Score     E

emb|CDP03543.1|  unnamed protein product                                287   5e-92   
ref|XP_002270131.1|  PREDICTED: bidirectional sugar transporter S...    273   4e-86   Vitis vinifera
ref|XP_007050795.1|  Medicago truncatula MTN3                           273   1e-85   
gb|EYU46728.1|  hypothetical protein MIMGU_mgv1a011381mg                271   2e-85   
emb|CBI32263.3|  unnamed protein product                                273   2e-85   
ref|XP_004247459.1|  PREDICTED: bidirectional sugar transporter NEC1    271   3e-85   
ref|XP_009609628.1|  PREDICTED: bidirectional sugar transporter N...    270   5e-85   
ref|XP_009765830.1|  PREDICTED: bidirectional sugar transporter N...    266   1e-83   
gb|KDP28088.1|  hypothetical protein JCGZ_13859                         265   3e-83   
gb|KHG13555.1|  Bidirectional sugar transporter SWEET15                 264   1e-82   
gb|KDO87388.1|  hypothetical protein CISIN_1g036251mg                   263   3e-82   
ref|XP_006444236.1|  hypothetical protein CICLE_v10023774mg             262   4e-82   
ref|XP_006480106.1|  PREDICTED: bidirectional sugar transporter S...    262   5e-82   
ref|XP_011079737.1|  PREDICTED: bidirectional sugar transporter N...    262   9e-82   
ref|XP_002520679.1|  conserved hypothetical protein                     261   2e-81   Ricinus communis
ref|XP_007200238.1|  hypothetical protein PRUPE_ppa015264mg             260   4e-81   
ref|XP_008392763.1|  PREDICTED: bidirectional sugar transporter S...    259   5e-81   
ref|XP_009337539.1|  PREDICTED: bidirectional sugar transporter N3      258   6e-80   
ref|XP_008235079.1|  PREDICTED: bidirectional sugar transporter S...    256   2e-79   
emb|CDP09549.1|  unnamed protein product                                256   2e-79   
ref|XP_004235470.1|  PREDICTED: bidirectional sugar transporter S...    254   4e-79   
ref|XP_006347653.1|  PREDICTED: bidirectional sugar transporter S...    254   5e-79   
ref|XP_006366913.1|  PREDICTED: bidirectional sugar transporter S...    257   5e-79   
ref|XP_009337947.1|  PREDICTED: bidirectional sugar transporter N...    254   6e-79   
ref|XP_008370771.1|  PREDICTED: bidirectional sugar transporter N...    254   7e-79   
ref|XP_004297512.1|  PREDICTED: bidirectional sugar transporter S...    254   8e-79   
ref|XP_006366912.1|  PREDICTED: bidirectional sugar transporter S...    253   1e-78   
ref|XP_009379704.1|  PREDICTED: bidirectional sugar transporter N...    253   2e-78   
gb|EYU30738.1|  hypothetical protein MIMGU_mgv1a012552mg                252   2e-78   
ref|XP_004297511.1|  PREDICTED: bidirectional sugar transporter S...    253   4e-78   
gb|KHG20984.1|  Bidirectional sugar transporter SWEET15 -like pro...    253   4e-78   
ref|XP_006844581.1|  hypothetical protein AMTR_s00016p00202420          252   7e-78   
ref|XP_007205793.1|  hypothetical protein PRUPE_ppa010594mg             250   1e-77   
ref|XP_008392764.1|  PREDICTED: bidirectional sugar transporter S...    251   1e-77   
sp|Q9FPN0.1|NEC1_PETHY  RecName: Full=Bidirectional sugar transpo...    250   2e-77   Petunia x hybrida [garden petunia]
ref|XP_004952573.1|  PREDICTED: bidirectional sugar transporter S...    251   4e-77   
ref|XP_010534707.1|  PREDICTED: bidirectional sugar transporter S...    250   4e-77   
ref|XP_010242697.1|  PREDICTED: bidirectional sugar transporter S...    249   4e-77   
ref|XP_004302124.1|  PREDICTED: bidirectional sugar transporter N...    248   1e-76   
ref|XP_011085139.1|  PREDICTED: bidirectional sugar transporter N...    248   1e-76   
ref|XP_008386620.1|  PREDICTED: bidirectional sugar transporter S...    248   3e-76   
ref|XP_004490502.1|  PREDICTED: bidirectional sugar transporter N...    246   7e-76   
ref|XP_004235340.1|  PREDICTED: bidirectional sugar transporter S...    247   8e-76   
ref|XP_008374287.1|  PREDICTED: bidirectional sugar transporter N...    247   8e-76   
ref|XP_002284244.1|  PREDICTED: bidirectional sugar transporter S...    245   2e-75   Vitis vinifera
ref|XP_007159040.1|  hypothetical protein PHAVU_002G203600g             244   3e-75   
ref|XP_002453892.1|  hypothetical protein SORBIDRAFT_04g021000          247   3e-75   Sorghum bicolor [broomcorn]
ref|XP_006347632.1|  PREDICTED: bidirectional sugar transporter S...    245   3e-75   
ref|XP_004489106.1|  PREDICTED: bidirectional sugar transporter S...    244   4e-75   
ref|XP_011023930.1|  PREDICTED: bidirectional sugar transporter S...    244   4e-75   
emb|CAN71371.1|  hypothetical protein VITISV_023352                     244   4e-75   Vitis vinifera
gb|KHN23963.1|  Bidirectional sugar transporter SWEET14                 244   5e-75   
ref|XP_003531061.1|  PREDICTED: bidirectional sugar transporter N...    244   6e-75   
gb|KHN39181.1|  Bidirectional sugar transporter N3                      244   8e-75   
ref|XP_009393865.1|  PREDICTED: bidirectional sugar transporter S...    244   8e-75   
ref|XP_006347635.1|  PREDICTED: bidirectional sugar transporter S...    244   8e-75   
ref|XP_007030240.1|  Nodulin MtN3 family protein isoform 1              244   8e-75   
gb|KEH21559.1|  bidirectional sugar transporter                         243   9e-75   
ref|XP_006479044.1|  PREDICTED: bidirectional sugar transporter S...    243   9e-75   
ref|XP_010027132.1|  PREDICTED: bidirectional sugar transporter N...    243   1e-74   
ref|XP_008234052.1|  PREDICTED: bidirectional sugar transporter N...    241   1e-74   
emb|CDX77928.1|  BnaC03g52910D                                          243   1e-74   
ref|XP_009121791.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    243   2e-74   
ref|XP_009783143.1|  PREDICTED: bidirectional sugar transporter N...    242   2e-74   
ref|XP_004161952.1|  PREDICTED: bidirectional sugar transporter S...    243   3e-74   
ref|NP_001239695.1|  uncharacterized protein LOC100777741               242   3e-74   
ref|XP_009601079.1|  PREDICTED: bidirectional sugar transporter S...    242   3e-74   
ref|XP_002443167.1|  hypothetical protein SORBIDRAFT_08g013840          243   4e-74   Sorghum bicolor [broomcorn]
ref|XP_004153501.1|  PREDICTED: bidirectional sugar transporter S...    242   5e-74   
ref|XP_010556111.1|  PREDICTED: bidirectional sugar transporter S...    243   5e-74   
sp|A2X5B4.1|SWT15_ORYSI  RecName: Full=Bidirectional sugar transp...    243   5e-74   Oryza sativa Indica Group [Indian rice]
ref|NP_001046944.1|  Os02g0513100                                       243   6e-74   Oryza sativa Japonica Group [Japonica rice]
gb|KFK27668.1|  hypothetical protein AALP_AA8G413300                    242   7e-74   
ref|XP_009347840.1|  PREDICTED: bidirectional sugar transporter N...    243   7e-74   
ref|XP_004138979.1|  PREDICTED: bidirectional sugar transporter N...    241   1e-73   
ref|XP_009150178.1|  PREDICTED: bidirectional sugar transporter S...    241   1e-73   
emb|CDX83046.1|  BnaA01g20460D                                          241   1e-73   
ref|XP_002442119.1|  hypothetical protein SORBIDRAFT_08g014040          241   1e-73   Sorghum bicolor [broomcorn]
ref|XP_010674202.1|  PREDICTED: bidirectional sugar transporter N...    240   2e-73   
ref|XP_008441812.1|  PREDICTED: bidirectional sugar transporter N...    239   2e-73   
ref|NP_001131289.1|  mtN3-like protein                                  241   2e-73   Zea mays [maize]
emb|CDX91144.1|  BnaC02g04530D                                          241   2e-73   
dbj|BAJ94651.1|  predicted protein                                      241   2e-73   
ref|XP_008464393.1|  PREDICTED: bidirectional sugar transporter S...    241   2e-73   
ref|XP_010696414.1|  PREDICTED: bidirectional sugar transporter S...    242   2e-73   
ref|XP_008340254.1|  PREDICTED: bidirectional sugar transporter N...    241   2e-73   
ref|XP_002264875.1|  PREDICTED: bidirectional sugar transporter N3      240   2e-73   Vitis vinifera
ref|XP_009412768.1|  PREDICTED: bidirectional sugar transporter S...    240   2e-73   
gb|AGL98401.1|  sucrose transporter SWEET9                              239   3e-73   
ref|XP_004145147.1|  PREDICTED: bidirectional sugar transporter S...    240   3e-73   
ref|XP_003615405.1|  Protein RUPTURED POLLEN GRAIN                      239   3e-73   
ref|XP_010243612.1|  PREDICTED: bidirectional sugar transporter S...    239   4e-73   
ref|XP_008389921.1|  PREDICTED: bidirectional sugar transporter N...    240   4e-73   
ref|XP_008677256.1|  PREDICTED: LOC100282648 isoform X1                 240   4e-73   
ref|XP_003523161.1|  PREDICTED: bidirectional sugar transporter S...    238   4e-73   
ref|XP_007209422.1|  hypothetical protein PRUPE_ppa009422mg             239   5e-73   
gb|AFK47472.1|  unknown                                                 238   5e-73   
ref|XP_011073105.1|  PREDICTED: bidirectional sugar transporter N...    239   5e-73   
ref|XP_004138032.1|  PREDICTED: bidirectional sugar transporter S...    239   5e-73   
ref|XP_010678287.1|  PREDICTED: bidirectional sugar transporter S...    240   5e-73   
ref|XP_007043874.1|  Senescence-associated gene 29                      239   6e-73   
ref|XP_004235339.1|  PREDICTED: bidirectional sugar transporter S...    239   6e-73   
ref|XP_011020821.1|  PREDICTED: bidirectional sugar transporter N...    239   7e-73   
ref|XP_002322282.2|  hypothetical protein POPTR_0015s11380g             239   7e-73   Populus trichocarpa [western balsam poplar]
ref|XP_004962649.1|  PREDICTED: bidirectional sugar transporter S...    239   8e-73   
ref|XP_003524088.1|  PREDICTED: bidirectional sugar transporter N...    239   8e-73   
gb|KHN03192.1|  Bidirectional sugar transporter N3                      238   9e-73   
ref|NP_001242732.1|  uncharacterized protein LOC100810962               238   9e-73   
gb|KGN61326.1|  hypothetical protein Csa_2G083730                       238   9e-73   
ref|XP_003551863.1|  PREDICTED: bidirectional sugar transporter N...    238   9e-73   
emb|CDX68492.1|  BnaC01g25700D                                          238   1e-72   
ref|NP_001141106.1|  uncharacterized protein LOC100273190               239   1e-72   Zea mays [maize]
ref|XP_006647263.1|  PREDICTED: bidirectional sugar transporter S...    239   1e-72   
ref|NP_196821.1|  senescence-associated protein 29                      238   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|EMT22394.1|  Protein RUPTURED POLLEN GRAIN 1                         238   1e-72   
ref|XP_008222221.1|  PREDICTED: bidirectional sugar transporter N3      238   2e-72   
ref|NP_001149028.1|  LOC100282648                                       239   2e-72   Zea mays [maize]
ref|XP_008441813.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    237   2e-72   
ref|XP_009150896.1|  PREDICTED: bidirectional sugar transporter S...    238   2e-72   
gb|ACG28570.1|  MTN3                                                    238   2e-72   Zea mays [maize]
ref|XP_011083538.1|  PREDICTED: bidirectional sugar transporter S...    238   2e-72   
ref|XP_006436901.1|  hypothetical protein CICLE_v10032313mg             238   3e-72   
ref|XP_008239523.1|  PREDICTED: bidirectional sugar transporter N3      238   3e-72   
ref|XP_006493253.1|  PREDICTED: bidirectional sugar transporter S...    237   3e-72   
ref|XP_009758166.1|  PREDICTED: bidirectional sugar transporter S...    238   3e-72   
ref|XP_009125890.1|  PREDICTED: bidirectional sugar transporter S...    238   3e-72   
ref|XP_006402062.1|  hypothetical protein EUTSA_v10014273mg             237   3e-72   
ref|XP_003576036.1|  PREDICTED: bidirectional sugar transporter S...    238   4e-72   
ref|XP_010929602.1|  PREDICTED: bidirectional sugar transporter S...    237   4e-72   
ref|XP_009586714.1|  PREDICTED: bidirectional sugar transporter N...    236   4e-72   
ref|XP_002443163.1|  hypothetical protein SORBIDRAFT_08g013620          238   4e-72   Sorghum bicolor [broomcorn]
emb|CDX69663.1|  BnaA10g20120D                                          238   4e-72   
ref|XP_009336454.1|  PREDICTED: bidirectional sugar transporter N...    238   4e-72   
gb|EYU43030.1|  hypothetical protein MIMGU_mgv1a011435mg                237   4e-72   
gb|EYU42078.1|  hypothetical protein MIMGU_mgv1a010705mg                238   4e-72   
ref|XP_003532478.1|  PREDICTED: bidirectional sugar transporter S...    236   5e-72   
ref|NP_001241307.1|  uncharacterized protein LOC100810946               236   5e-72   
ref|XP_008356571.1|  PREDICTED: bidirectional sugar transporter S...    237   5e-72   
emb|CDY05867.1|  BnaC08g20440D                                          237   5e-72   
ref|XP_010235464.1|  PREDICTED: bidirectional sugar transporter S...    238   5e-72   
ref|XP_009779208.1|  PREDICTED: bidirectional sugar transporter S...    236   5e-72   
ref|XP_009405955.1|  PREDICTED: bidirectional sugar transporter S...    236   5e-72   
emb|CDX80379.1|  BnaC07g30650D                                          237   6e-72   
emb|CDX85668.1|  BnaA02g01450D                                          237   6e-72   
sp|B8BKP4.1|SWT14_ORYSI  RecName: Full=Bidirectional sugar transp...    237   6e-72   Oryza sativa Indica Group [Indian rice]
ref|NP_001067955.1|  Os11g0508600                                       237   6e-72   Oryza sativa Japonica Group [Japonica rice]
gb|KDP22572.1|  hypothetical protein JCGZ_26403                         237   6e-72   
ref|XP_010492063.1|  PREDICTED: bidirectional sugar transporter S...    237   6e-72   
ref|XP_002873602.1|  nodulin MtN3 family protein                        237   6e-72   
ref|XP_009385515.1|  PREDICTED: bidirectional sugar transporter S...    236   6e-72   
ref|XP_004491680.1|  PREDICTED: bidirectional sugar transporter N...    236   7e-72   
ref|XP_009605549.1|  PREDICTED: bidirectional sugar transporter S...    237   7e-72   
ref|XP_008239633.1|  PREDICTED: bidirectional sugar transporter S...    236   7e-72   
gb|AAM65389.1|  senescence-associated protein (SAG29)                   236   7e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663471.1|  PREDICTED: bidirectional sugar transporter S...    237   8e-72   
ref|XP_002877629.1|  nodulin MtN3 family protein                        236   8e-72   
ref|XP_010093933.1|  Bidirectional sugar transporter SWEET10            236   8e-72   
ref|XP_007159993.1|  hypothetical protein PHAVU_002G283900g             235   8e-72   
ref|XP_009605550.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71   
ref|NP_001237418.1|  N3 protein                                         235   1e-71   
ref|XP_010112742.1|  Bidirectional sugar transporter NEC1               235   1e-71   
emb|CDX88041.1|  BnaA06g26320D                                          236   1e-71   
ref|XP_004979336.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71   
ref|XP_009597195.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71   
ref|XP_004155149.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    235   1e-71   
ref|XP_004235333.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71   
ref|XP_006399805.1|  hypothetical protein EUTSA_v10014234mg             236   1e-71   
ref|NP_190443.1|  bidirectional sugar transporter SWEET11               236   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438820.1|  hypothetical protein CICLE_v10032218mg             236   1e-71   
ref|XP_006578712.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71   
gb|EYU43032.1|  hypothetical protein MIMGU_mgv1a010677mg                236   2e-71   
ref|XP_009796436.1|  PREDICTED: bidirectional sugar transporter S...    236   2e-71   
gb|ACU23483.1|  unknown                                                 234   2e-71   Glycine max [soybeans]
emb|CDY08093.1|  BnaA06g16330D                                          235   2e-71   
ref|XP_009149800.1|  PREDICTED: bidirectional sugar transporter S...    235   2e-71   
ref|XP_006404221.1|  hypothetical protein EUTSA_v10010591mg             235   2e-71   
ref|XP_009591687.1|  PREDICTED: bidirectional sugar transporter N...    236   2e-71   
gb|EYU23059.1|  hypothetical protein MIMGU_mgv1a019104mg                235   2e-71   
ref|XP_007137870.1|  hypothetical protein PHAVU_009G162700g             234   2e-71   
gb|KHN24976.1|  Bidirectional sugar transporter N3                      234   2e-71   
ref|XP_003530901.1|  PREDICTED: bidirectional sugar transporter N...    234   2e-71   
ref|XP_009758167.1|  PREDICTED: bidirectional sugar transporter S...    235   2e-71   
ref|XP_010442555.1|  PREDICTED: bidirectional sugar transporter S...    235   3e-71   
ref|XP_002511126.1|  conserved hypothetical protein                     235   3e-71   Ricinus communis
ref|XP_007222479.1|  hypothetical protein PRUPE_ppa009789mg             234   3e-71   
ref|XP_010454652.1|  PREDICTED: bidirectional sugar transporter S...    235   3e-71   
ref|XP_009758165.1|  PREDICTED: bidirectional sugar transporter S...    235   3e-71   
gb|KHG03157.1|  Bidirectional sugar transporter SWEET15 -like pro...    234   3e-71   
emb|CDY53626.1|  BnaC03g71480D                                          235   4e-71   
ref|XP_002450786.1|  hypothetical protein SORBIDRAFT_05g018110          234   4e-71   Sorghum bicolor [broomcorn]
ref|XP_010421173.1|  PREDICTED: bidirectional sugar transporter S...    234   4e-71   
ref|XP_004980522.1|  PREDICTED: bidirectional sugar transporter S...    235   5e-71   
emb|CDX97233.1|  BnaC09g43920D                                          234   5e-71   
ref|XP_002322281.2|  N3 like family protein                             234   5e-71   Populus trichocarpa [western balsam poplar]
ref|XP_009411801.1|  PREDICTED: bidirectional sugar transporter S...    234   6e-71   
gb|EMS46194.1|  Bidirectional sugar transporter SWEET15                 236   6e-71   
ref|XP_004310113.1|  PREDICTED: bidirectional sugar transporter S...    234   6e-71   
gb|AFW71563.1|  hypothetical protein ZEAMMB73_472818                    236   6e-71   
emb|CAC44123.1|  N3 like protein                                        233   7e-71   Medicago truncatula
emb|CDX78511.1|  BnaA03g04230D                                          234   7e-71   
ref|XP_003552719.1|  PREDICTED: bidirectional sugar transporter N...    233   8e-71   
ref|XP_006394628.1|  hypothetical protein EUTSA_v10004719mg             234   8e-71   
gb|KFK25541.1|  hypothetical protein AALP_AA8G128400                    234   9e-71   
gb|KEH20983.1|  bidirectional sugar transporter                         233   9e-71   
ref|XP_011036129.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-70   
ref|XP_010493487.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-70   
ref|XP_011023931.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-70   
ref|XP_010250599.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-70   
ref|XP_010442345.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-70   
ref|XP_010039121.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-70   
gb|AFK48645.1|  unknown                                                 232   1e-70   
ref|XP_006288378.1|  hypothetical protein CARUB_v10001629mg             233   1e-70   
ref|XP_010453373.1|  PREDICTED: bidirectional sugar transporter S...    233   2e-70   
emb|CDP21121.1|  unnamed protein product                                233   2e-70   
ref|NP_197755.1|  bidirectional sugar transporter SWEET12               233   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|EMT20808.1|  Protein RUPTURED POLLEN GRAIN 1                         233   2e-70   
gb|EMT03611.1|  Protein RUPTURED POLLEN GRAIN 1                         233   2e-70   
ref|XP_010503515.1|  PREDICTED: bidirectional sugar transporter S...    233   2e-70   
ref|XP_010419882.1|  PREDICTED: bidirectional sugar transporter S...    233   2e-70   
ref|XP_006493252.1|  PREDICTED: bidirectional sugar transporter S...    233   2e-70   
ref|NP_001149087.1|  MTN3                                               233   2e-70   Zea mays [maize]
ref|XP_002299333.2|  hypothetical protein POPTR_0001s13410g             232   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_008392727.1|  PREDICTED: bidirectional sugar transporter S...    233   2e-70   
ref|XP_009132693.1|  PREDICTED: bidirectional sugar transporter S...    233   3e-70   
gb|KDP26857.1|  hypothetical protein JCGZ_18015                         233   3e-70   
ref|XP_004145146.1|  PREDICTED: bidirectional sugar transporter S...    233   3e-70   
ref|XP_006347634.1|  PREDICTED: bidirectional sugar transporter S...    233   3e-70   
gb|KHN17298.1|  Bidirectional sugar transporter NEC1                    231   3e-70   
ref|XP_009794695.1|  PREDICTED: bidirectional sugar transporter N...    233   3e-70   
gb|EYU43031.1|  hypothetical protein MIMGU_mgv1a011488mg                232   3e-70   
gb|KHG02402.1|  Bidirectional sugar transporter SWEET10 -like pro...    232   3e-70   
ref|XP_004235326.1|  PREDICTED: bidirectional sugar transporter N3      232   4e-70   
ref|XP_009349481.1|  PREDICTED: bidirectional sugar transporter N...    233   4e-70   
gb|AFK35161.1|  unknown                                                 231   4e-70   
emb|CDX84877.1|  BnaA03g13530D                                          231   5e-70   
gb|EMS51422.1|  Bidirectional sugar transporter SWEET13                 232   5e-70   
ref|XP_010045482.1|  PREDICTED: bidirectional sugar transporter S...    231   6e-70   
ref|XP_009421186.1|  PREDICTED: bidirectional sugar transporter S...    231   6e-70   
ref|XP_010249453.1|  PREDICTED: bidirectional sugar transporter S...    231   6e-70   
gb|EMT20480.1|  Protein RUPTURED POLLEN GRAIN 1                         231   6e-70   
ref|XP_009803865.1|  PREDICTED: bidirectional sugar transporter S...    231   8e-70   
ref|XP_009614917.1|  PREDICTED: bidirectional sugar transporter S...    231   8e-70   
ref|XP_006347633.1|  PREDICTED: bidirectional sugar transporter S...    231   9e-70   
ref|NP_001141654.1|  hypothetical protein                               231   1e-69   Zea mays [maize]
emb|CDY16863.1|  BnaA09g05190D                                          231   1e-69   
ref|XP_010426372.1|  PREDICTED: bidirectional sugar transporter S...    231   1e-69   
ref|XP_009587580.1|  PREDICTED: bidirectional sugar transporter S...    231   1e-69   
ref|XP_002877428.1|  hypothetical protein ARALYDRAFT_484952             231   1e-69   
ref|XP_004503778.1|  PREDICTED: bidirectional sugar transporter S...    229   1e-69   
ref|XP_010093935.1|  Bidirectional sugar transporter SWEET12            231   1e-69   
gb|KHG27148.1|  Bidirectional sugar transporter SWEET10 -like pro...    230   1e-69   
ref|XP_004962650.1|  PREDICTED: bidirectional sugar transporter S...    230   1e-69   
ref|XP_010482380.1|  PREDICTED: bidirectional sugar transporter S...    231   1e-69   
ref|XP_009762335.1|  PREDICTED: bidirectional sugar transporter S...    231   2e-69   
dbj|BAJ85621.1|  predicted protein                                      230   2e-69   
ref|XP_009787633.1|  PREDICTED: bidirectional sugar transporter N...    231   2e-69   
ref|XP_002511128.1|  conserved hypothetical protein                     230   2e-69   Ricinus communis
ref|XP_004235334.1|  PREDICTED: bidirectional sugar transporter S...    230   3e-69   
ref|XP_002321731.1|  N3 like family protein                             229   3e-69   Populus trichocarpa [western balsam poplar]
ref|XP_011023934.1|  PREDICTED: bidirectional sugar transporter S...    229   4e-69   
ref|XP_007030241.1|  Nodulin MtN3 family protein isoform 2              229   4e-69   
ref|XP_007139174.1|  hypothetical protein PHAVU_008G007600g             228   4e-69   
emb|CDX87161.1|  BnaC09g04760D                                          229   4e-69   
gb|EMT11081.1|  Protein RUPTURED POLLEN GRAIN 1                         229   4e-69   
gb|AHL43546.1|  nodule-specific sucrose transporter                     229   4e-69   
gb|EMT09236.1|  Protein RUPTURED POLLEN GRAIN 1                         229   6e-69   
gb|ACV71016.1|  UPA16                                                   229   6e-69   Capsicum annuum
gb|EMT20481.1|  Protein RUPTURED POLLEN GRAIN 1                         229   7e-69   
ref|XP_008389034.1|  PREDICTED: bidirectional sugar transporter N...    228   7e-69   
ref|XP_004161953.1|  PREDICTED: bidirectional sugar transporter S...    229   7e-69   
ref|XP_009141677.1|  PREDICTED: bidirectional sugar transporter S...    228   8e-69   
ref|XP_006347346.1|  PREDICTED: bidirectional sugar transporter S...    229   8e-69   
ref|XP_009614916.1|  PREDICTED: bidirectional sugar transporter S...    229   8e-69   
ref|XP_008440025.1|  PREDICTED: bidirectional sugar transporter S...    229   9e-69   
ref|XP_006363981.1|  PREDICTED: bidirectional sugar transporter S...    229   9e-69   
gb|KDP22573.1|  hypothetical protein JCGZ_26404                         228   1e-68   
ref|XP_010926783.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-68   
ref|XP_010037373.1|  PREDICTED: bidirectional sugar transporter S...    227   1e-68   
ref|XP_004241452.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-68   
ref|XP_006664549.1|  PREDICTED: bidirectional sugar transporter S...    227   2e-68   
gb|EMS48886.1|  Bidirectional sugar transporter SWEET13                 231   2e-68   
gb|EMS45810.1|  Bidirectional sugar transporter SWEET11                 228   2e-68   
ref|XP_006436900.1|  hypothetical protein CICLE_v10033645mg             227   2e-68   
ref|XP_010550745.1|  PREDICTED: bidirectional sugar transporter S...    228   2e-68   
ref|XP_002865823.1|  nodulin MtN3 family protein                        228   2e-68   
sp|Q2QR07.1|SWT13_ORYSJ  RecName: Full=Bidirectional sugar transp...    228   2e-68   
gb|KFK34174.1|  hypothetical protein AALP_AA5G110100                    228   2e-68   
dbj|BAK07340.1|  predicted protein                                      227   3e-68   
gb|EAY83053.1|  hypothetical protein OsI_38270                          227   3e-68   
ref|XP_003576225.1|  PREDICTED: bidirectional sugar transporter S...    227   3e-68   
ref|NP_199892.1|  bidirectional sugar transporter SWEET10               227   3e-68   
gb|KDO64483.1|  hypothetical protein CISIN_1g020739mg                   227   4e-68   
ref|XP_009403777.1|  PREDICTED: bidirectional sugar transporter S...    227   4e-68   
ref|XP_002511127.1|  conserved hypothetical protein                     226   5e-68   
ref|XP_008464392.1|  PREDICTED: bidirectional sugar transporter S...    227   5e-68   
emb|CDY69440.1|  BnaCnng63490D                                          224   6e-68   
ref|XP_007148462.1|  hypothetical protein PHAVU_006G210800g             226   6e-68   
gb|EPS64389.1|  hypothetical protein M569_10392                         225   8e-68   
gb|KFK26707.1|  hypothetical protein AALP_AA8G282900                    226   8e-68   
ref|XP_006347652.1|  PREDICTED: bidirectional sugar transporter S...    232   8e-68   
ref|XP_004138250.1|  PREDICTED: bidirectional sugar transporter S...    226   8e-68   
ref|XP_003620983.1|  Protein RUPTURED POLLEN GRAIN                      225   9e-68   
ref|XP_009802194.1|  PREDICTED: bidirectional sugar transporter S...    226   9e-68   
ref|XP_007137872.1|  hypothetical protein PHAVU_009G162900g             226   9e-68   
ref|XP_003578398.1|  PREDICTED: bidirectional sugar transporter S...    226   1e-67   
ref|XP_002511125.1|  conserved hypothetical protein                     226   1e-67   
ref|XP_002303766.2|  hypothetical protein POPTR_0003s16520g             226   1e-67   
ref|XP_010090683.1|  Bidirectional sugar transporter N3                 226   1e-67   
gb|KEH21447.1|  sugar efflux transporter for intercellular exchan...    225   1e-67   
ref|NP_001240121.1|  uncharacterized protein LOC100800347               225   2e-67   
ref|XP_003617528.1|  Protein RUPTURED POLLEN GRAIN                      224   2e-67   
gb|EMT23597.1|  Protein RUPTURED POLLEN GRAIN 1                         225   2e-67   
ref|XP_007038075.1|  Nodulin MtN3 family protein, putative isoform 1    224   2e-67   
ref|XP_010438942.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-67   
ref|XP_004157602.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-67   
ref|XP_010037364.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-67   
ref|XP_003602780.1|  Protein RUPTURED POLLEN GRAIN                      224   3e-67   
ref|XP_002321730.2|  N3 like family protein                             224   3e-67   
ref|XP_010448490.1|  PREDICTED: bidirectional sugar transporter S...    224   3e-67   
ref|XP_006289174.1|  hypothetical protein CARUB_v10002612mg             224   3e-67   
gb|EMT20483.1|  Protein RUPTURED POLLEN GRAIN 1                         225   3e-67   
ref|XP_008459891.1|  PREDICTED: bidirectional sugar transporter N3      224   3e-67   
ref|XP_004140547.1|  PREDICTED: bidirectional sugar transporter S...    224   4e-67   
ref|XP_006291603.1|  hypothetical protein CARUB_v10017757mg             224   4e-67   
ref|XP_006285021.1|  hypothetical protein CARUB_v10006328mg             224   5e-67   
ref|NP_001132836.1|  hypothetical protein                               226   5e-67   
ref|XP_008218389.1|  PREDICTED: bidirectional sugar transporter N...    221   5e-67   
ref|XP_002514863.1|  conserved hypothetical protein                     223   6e-67   
ref|XP_010926782.1|  PREDICTED: bidirectional sugar transporter S...    223   7e-67   
ref|NP_194231.1|  bidirectional sugar transporter SWEET14               223   8e-67   
ref|XP_003518628.1|  PREDICTED: bidirectional sugar transporter NEC1    223   8e-67   
ref|XP_008791098.1|  PREDICTED: bidirectional sugar transporter S...    223   1e-66   
gb|KHN33482.1|  Bidirectional sugar transporter SWEET15                 223   1e-66   
ref|XP_006281748.1|  hypothetical protein CARUB_v10027907mg             223   1e-66   
ref|XP_009614915.1|  PREDICTED: bidirectional sugar transporter S...    223   1e-66   
dbj|BAK04274.1|  predicted protein                                      224   1e-66   
ref|XP_011015361.1|  PREDICTED: bidirectional sugar transporter S...    222   1e-66   
ref|XP_004138978.1|  PREDICTED: bidirectional sugar transporter N...    221   1e-66   
gb|KEH21448.1|  bidirectional sugar transporter                         222   1e-66   
ref|XP_010943754.1|  PREDICTED: bidirectional sugar transporter S...    223   2e-66   
gb|EYU34244.1|  hypothetical protein MIMGU_mgv1a022710mg                221   2e-66   
ref|XP_006347347.1|  PREDICTED: bidirectional sugar transporter S...    223   2e-66   
ref|XP_009109231.1|  PREDICTED: bidirectional sugar transporter S...    222   2e-66   
ref|XP_006413354.1|  hypothetical protein EUTSA_v10025975mg             222   2e-66   
ref|XP_009599477.1|  PREDICTED: bidirectional sugar transporter S...    222   2e-66   
ref|XP_004235342.2|  PREDICTED: uncharacterized protein LOC101265905    231   2e-66   
gb|EMS53876.1|  Bidirectional sugar transporter SWEET14                 229   3e-66   
ref|XP_011023933.1|  PREDICTED: bidirectional sugar transporter S...    221   3e-66   
ref|XP_010682692.1|  PREDICTED: bidirectional sugar transporter S...    221   3e-66   
ref|XP_010042796.1|  PREDICTED: bidirectional sugar transporter N...    221   4e-66   
ref|XP_011071246.1|  PREDICTED: bidirectional sugar transporter N3      222   5e-66   
ref|XP_009137488.1|  PREDICTED: bidirectional sugar transporter S...    221   5e-66   
ref|XP_010678288.1|  PREDICTED: bidirectional sugar transporter N3      222   6e-66   
ref|XP_010519500.1|  PREDICTED: bidirectional sugar transporter S...    221   9e-66   
gb|KDO64484.1|  hypothetical protein CISIN_1g020739mg                   221   1e-65   
ref|XP_007038076.1|  Nodulin MtN3 family protein, putative isoform 2    220   1e-65   
emb|CDY24854.1|  BnaA08g14560D                                          220   1e-65   
ref|XP_007038077.1|  Medicago truncatula MTN3, putative                 220   1e-65   
gb|EMS51423.1|  Bidirectional sugar transporter SWEET13                 221   1e-65   
ref|XP_010027261.1|  PREDICTED: bidirectional sugar transporter N...    220   2e-65   
ref|XP_004957300.1|  PREDICTED: bidirectional sugar transporter S...    220   2e-65   
ref|XP_009802608.1|  PREDICTED: bidirectional sugar transporter S...    220   2e-65   
ref|XP_010536596.1|  PREDICTED: bidirectional sugar transporter S...    220   2e-65   
emb|CDX92666.1|  BnaC07g39240D                                          219   2e-65   
ref|XP_004491681.1|  PREDICTED: bidirectional sugar transporter N...    218   3e-65   
gb|EPS72542.1|  hypothetical protein M569_02215                         217   4e-65   
ref|XP_010027260.1|  PREDICTED: bidirectional sugar transporter N...    219   4e-65   
gb|EMS49335.1|  Bidirectional sugar transporter SWEET14                 221   5e-65   
emb|CDX71659.1|  BnaC09g27000D                                          219   5e-65   
ref|XP_010528779.1|  PREDICTED: bidirectional sugar transporter S...    218   5e-65   
ref|XP_003602778.1|  Protein RUPTURED POLLEN GRAIN                      219   7e-65   
ref|XP_010999465.1|  PREDICTED: bidirectional sugar transporter S...    217   7e-65   
ref|XP_010027258.1|  PREDICTED: bidirectional sugar transporter N...    218   8e-65   
ref|XP_007139100.1|  hypothetical protein PHAVU_008G001200g             218   8e-65   
ref|XP_009802195.1|  PREDICTED: bidirectional sugar transporter S...    218   8e-65   
ref|XP_010545940.1|  PREDICTED: bidirectional sugar transporter S...    218   9e-65   
emb|CDY34333.1|  BnaA01g14360D                                          218   1e-64   
ref|XP_009801964.1|  PREDICTED: bidirectional sugar transporter S...    218   1e-64   
ref|XP_009605548.1|  PREDICTED: bidirectional sugar transporter S...    218   1e-64   
ref|XP_002867630.1|  nodulin MtN3 family protein                        218   1e-64   
ref|XP_002267792.1|  PREDICTED: bidirectional sugar transporter NEC1    218   1e-64   
ref|XP_007038078.1|  Medicago truncatula MTN3, putative                 218   1e-64   
ref|XP_011069431.1|  PREDICTED: bidirectional sugar transporter N...    216   1e-64   
gb|KDP32879.1|  hypothetical protein JCGZ_12171                         217   1e-64   
ref|XP_011073577.1|  PREDICTED: bidirectional sugar transporter S...    217   2e-64   
emb|CDY03395.1|  BnaC01g16870D                                          216   2e-64   
sp|P93332.1|NOD3_MEDTR  RecName: Full=Bidirectional sugar transpo...    216   3e-64   
ref|XP_006411131.1|  hypothetical protein EUTSA_v10017080mg             216   4e-64   
ref|XP_003593107.1|  Protein RUPTURED POLLEN GRAIN                      216   5e-64   
ref|XP_007139099.1|  hypothetical protein PHAVU_008G001100g             216   5e-64   
ref|XP_009337540.1|  PREDICTED: bidirectional sugar transporter NEC1    216   6e-64   
ref|XP_009123765.1|  PREDICTED: bidirectional sugar transporter S...    216   7e-64   
gb|AFK39311.1|  unknown                                                 215   8e-64   
ref|XP_009138751.1|  PREDICTED: bidirectional sugar transporter S...    215   8e-64   
ref|XP_010027262.1|  PREDICTED: bidirectional sugar transporter N...    215   8e-64   
ref|XP_010442559.1|  PREDICTED: bidirectional sugar transporter S...    216   8e-64   
ref|XP_002865824.1|  nodulin MtN3 family protein                        216   9e-64   
ref|XP_010442358.1|  PREDICTED: bidirectional sugar transporter S...    216   9e-64   
ref|XP_010482381.1|  PREDICTED: bidirectional sugar transporter S...    216   1e-63   
gb|KHN24975.1|  Bidirectional sugar transporter N3                      215   1e-63   
ref|XP_003532319.1|  PREDICTED: bidirectional sugar transporter N...    215   1e-63   
ref|XP_003532471.1|  PREDICTED: bidirectional sugar transporter S...    215   1e-63   
gb|AFW71562.1|  hypothetical protein ZEAMMB73_472818                    216   2e-63   
emb|CDP21733.1|  unnamed protein product                                214   2e-63   
gb|AHB08882.1|  bidirectional sugar transporter SWEET14-like protein    216   2e-63   
gb|AAM65058.1|  MtN3-like protein                                       215   2e-63   
ref|NP_199893.1|  bidirectional sugar transporter SWEET13               215   2e-63   
ref|XP_010037362.1|  PREDICTED: bidirectional sugar transporter S...    214   3e-63   
ref|XP_007137871.1|  hypothetical protein PHAVU_009G162800g             211   3e-63   
ref|XP_004301046.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    214   4e-63   
ref|XP_002862913.1|  nodulin MtN3 family protein                        214   4e-63   
ref|XP_010037379.1|  PREDICTED: bidirectional sugar transporter S...    213   5e-63   
gb|KDP22571.1|  hypothetical protein JCGZ_26402                         213   5e-63   
ref|XP_004242139.1|  PREDICTED: bidirectional sugar transporter S...    213   8e-63   
gb|KCW49071.1|  hypothetical protein EUGRSUZ_K02671                     212   9e-63   
ref|XP_010025273.1|  PREDICTED: bidirectional sugar transporter N...    213   1e-62   
ref|XP_010045483.1|  PREDICTED: bidirectional sugar transporter S...    213   1e-62   
ref|XP_006402061.1|  hypothetical protein EUTSA_v10014268mg             213   1e-62   
ref|XP_009794853.1|  PREDICTED: bidirectional sugar transporter S...    212   1e-62   
ref|XP_006282018.1|  hypothetical protein CARUB_v10028257mg             212   2e-62   
gb|KCW61425.1|  hypothetical protein EUGRSUZ_H04154                     211   2e-62   
gb|KCW61897.1|  hypothetical protein EUGRSUZ_H04592                     211   2e-62   
ref|XP_010037381.1|  PREDICTED: bidirectional sugar transporter S...    211   3e-62   
ref|XP_006661417.1|  PREDICTED: bidirectional sugar transporter S...    209   3e-62   
ref|XP_010025272.1|  PREDICTED: bidirectional sugar transporter N...    211   4e-62   
emb|CDY70861.1|  BnaCnng70080D                                          208   5e-62   
ref|XP_010039123.1|  PREDICTED: bidirectional sugar transporter S...    209   6e-62   
ref|XP_004501816.1|  PREDICTED: bidirectional sugar transporter S...    210   6e-62   
ref|XP_007159991.1|  hypothetical protein PHAVU_002G283800g             211   1e-61   
ref|XP_004239304.1|  PREDICTED: bidirectional sugar transporter N3      210   1e-61   
gb|KCW61894.1|  hypothetical protein EUGRSUZ_H04587                     208   2e-61   
ref|XP_010027259.1|  PREDICTED: bidirectional sugar transporter N...    209   2e-61   
ref|XP_009103141.1|  PREDICTED: bidirectional sugar transporter S...    207   3e-61   
emb|CDP21120.1|  unnamed protein product                                207   1e-60   
ref|XP_004309712.1|  PREDICTED: bidirectional sugar transporter S...    206   1e-60   
ref|XP_003526939.1|  PREDICTED: bidirectional sugar transporter S...    208   1e-60   
gb|KFK36797.1|  hypothetical protein AALP_AA4G172400                    206   2e-60   
ref|XP_009777590.1|  PREDICTED: bidirectional sugar transporter N...    208   2e-60   
ref|NP_001149496.1|  MTN3                                               207   2e-60   
ref|XP_010036837.1|  PREDICTED: bidirectional sugar transporter N...    205   2e-60   
ref|XP_009612477.1|  PREDICTED: bidirectional sugar transporter N...    207   2e-60   
gb|KGN63457.1|  hypothetical protein Csa_1G001290                       206   3e-60   
gb|AAM63257.1|  similar to MtN3 protein                                 205   4e-60   
ref|NP_181439.1|  bidirectional sugar transporter SWEET9                205   4e-60   
gb|KCW61896.1|  hypothetical protein EUGRSUZ_H04589                     205   5e-60   
gb|KHN31280.1|  Bidirectional sugar transporter SWEET14-like protein    206   6e-60   
gb|AFK36312.1|  unknown                                                 205   7e-60   
ref|XP_010517242.1|  PREDICTED: bidirectional sugar transporter S...    204   8e-60   
ref|XP_011042931.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    205   9e-60   
ref|XP_007030239.1|  Nodulin MtN3 family protein                        203   1e-59   
gb|KHN23961.1|  Bidirectional sugar transporter SWEET12                 205   1e-59   
ref|XP_002881628.1|  nodulin MtN3 family protein                        204   1e-59   
ref|XP_004501726.1|  PREDICTED: bidirectional sugar transporter S...    205   2e-59   
ref|XP_008802109.1|  PREDICTED: bidirectional sugar transporter S...    204   2e-59   
ref|XP_002280599.1|  PREDICTED: bidirectional sugar transporter S...    204   2e-59   
ref|XP_009383909.1|  PREDICTED: bidirectional sugar transporter N...    206   2e-59   
ref|XP_006376915.1|  hypothetical protein POPTR_0012s10500g             204   2e-59   
ref|XP_006296061.1|  hypothetical protein CARUB_v10025211mg             203   3e-59   
ref|NP_001288941.1|  bidirectional sugar transporter SWEET9             203   4e-59   
gb|ACJ84828.1|  unknown                                                 202   8e-59   
gb|EYU43027.1|  hypothetical protein MIMGU_mgv1a022177mg                201   9e-59   
ref|XP_010041902.1|  PREDICTED: bidirectional sugar transporter S...    202   1e-58   
ref|XP_010509074.1|  PREDICTED: bidirectional sugar transporter S...    201   1e-58   
gb|EMT20482.1|  Protein RUPTURED POLLEN GRAIN 1                         204   1e-58   
ref|XP_010505570.1|  PREDICTED: bidirectional sugar transporter S...    201   1e-58   
gb|KCW61900.1|  hypothetical protein EUGRSUZ_H04596                     201   1e-58   
ref|XP_006388397.1|  hypothetical protein POPTR_0198s00220g             200   1e-58   
ref|XP_011084749.1|  PREDICTED: bidirectional sugar transporter N...    202   2e-58   
gb|EAZ45313.1|  hypothetical protein OsJ_29956                          202   2e-58   
gb|EAZ09693.1|  hypothetical protein OsI_31976                          202   2e-58   
gb|KHN47229.1|  Bidirectional sugar transporter NEC1-like protein       200   2e-58   
ref|XP_004309713.1|  PREDICTED: bidirectional sugar transporter N...    201   3e-58   
ref|XP_010037372.1|  PREDICTED: bidirectional sugar transporter S...    201   3e-58   
ref|XP_010039124.1|  PREDICTED: bidirectional sugar transporter S...    199   3e-58   
ref|XP_004984398.1|  PREDICTED: bidirectional sugar transporter S...    201   5e-58   
ref|XP_009417933.1|  PREDICTED: bidirectional sugar transporter S...    199   6e-58   
ref|XP_009391576.1|  PREDICTED: bidirectional sugar transporter S...    199   6e-58   
ref|XP_006371147.1|  hypothetical protein POPTR_0019s04590g             198   6e-58   
gb|KFK26708.1|  hypothetical protein AALP_AA8G283000                    200   1e-57   
gb|ACU14542.1|  unknown                                                 196   2e-57   
emb|CBI15715.3|  unnamed protein product                                199   2e-57   
gb|KCW49087.1|  hypothetical protein EUGRSUZ_K02694                     199   2e-57   
ref|XP_010039128.1|  PREDICTED: bidirectional sugar transporter S...    199   2e-57   
ref|XP_004503779.1|  PREDICTED: bidirectional sugar transporter S...    198   3e-57   
gb|AGV54262.1|  bidirectional sugar transporter SWEET12                 200   3e-57   
gb|KHN17480.1|  Bidirectional sugar transporter SWEET15                 198   4e-57   
gb|EMT31030.1|  Protein RUPTURED POLLEN GRAIN 1                         196   6e-57   
ref|XP_002465280.1|  hypothetical protein SORBIDRAFT_01g035490          198   9e-57   
dbj|BAJ99068.1|  predicted protein                                      198   1e-56   
gb|KCW49075.1|  hypothetical protein EUGRSUZ_K026741                    196   1e-56   
ref|XP_004174114.1|  PREDICTED: bidirectional sugar transporter S...    193   3e-56   
ref|XP_010045484.1|  PREDICTED: bidirectional sugar transporter S...    194   3e-56   
gb|KDO64482.1|  hypothetical protein CISIN_1g047365mg                   194   4e-56   
ref|XP_002462642.1|  hypothetical protein SORBIDRAFT_02g029430          195   4e-56   
ref|XP_006651370.1|  PREDICTED: bidirectional sugar transporter S...    197   4e-56   
ref|XP_006359431.1|  PREDICTED: bidirectional sugar transporter N...    193   6e-56   
gb|AES73031.2|  sugar efflux transporter for intercellular exchan...    191   2e-55   
gb|KDO64485.1|  hypothetical protein CISIN_1g020739mg                   190   5e-55   
ref|XP_006347482.1|  PREDICTED: bidirectional sugar transporter S...    192   6e-55   
gb|KCW83110.1|  hypothetical protein EUGRSUZ_B00066                     191   6e-55   



>emb|CDP03543.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 191/258 (74%), Gaps = 4/258 (2%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            ++ QLA  FGILGN++SF+V+LAPLPTF+ IYK+KS++GF  +PYSVALFS M+ LYYA 
Sbjct  5    STCQLAAAFGILGNVVSFLVYLAPLPTFYRIYKKKSTQGFQAVPYSVALFSAMLYLYYAY  64

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K++ + L TIN  G  +ETIYLVL+ +YA K  ++  A  +++FN+G   LIV  T+ L
Sbjct  65   LKKNGIILATINSGGCAIETIYLVLFMIYATKDAKMRTAKLLVIFNVGAYALIVASTFLL  124

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
            S+G++RV +VGWI SV SVCVFAAPLSIMMKVIRT+SVE+MPF+LS FLTLCAV+W  YG
Sbjct  125  SQGHRRVALVGWICSVFSVCVFAAPLSIMMKVIRTRSVEFMPFSLSCFLTLCAVMWFFYG  184

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
              I+D+YIATPN+LGFA GI Q+ILYAIYR+R    +V P   ++ +A+ V    A +  
Sbjct  185  FLIKDYYIATPNILGFAFGIAQMILYAIYRERDN-GLVLPEAYVKEIAVTVMEVGAVLET  243

Query  169  KGTDDEIHETTPSSVVVD  116
               D   ++T  +  V+D
Sbjct  244  PPAD---YDTACAKPVID  258



>ref|XP_002270131.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
Length=276

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 179/259 (69%), Gaps = 12/259 (5%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+    +A  FGILGNI+SF+V+L+PLPTF+ IYKRKS+EGF  +PYSVALFS M+ LYY
Sbjct  3    MLTVPHMAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLLLYY  62

Query  715  ALVK-QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            A +K  + + LITIN +G  +E  YL++Y +YA +  +I  A  +L+FN GV G IV+ T
Sbjct  63   AFLKTDNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIVLST  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            +FLS+G++R KIVGW+ +  S+CVFAAPLSIM  VIRTKSVEYMPF LS FLT+CAV+W 
Sbjct  123  FFLSKGHRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAVMWF  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA------PNGGIQGVAIVV  197
             YGL IRDFYIA PN+LGFA GI Q+ILY IY++ K   +        PNG      +  
Sbjct  183  FYGLLIRDFYIAFPNILGFAFGIAQMILYTIYKNAKKGVLAEFKLQELPNG-----LVFP  237

Query  196  DATAAEMLQKGTDDEIHET  140
                AE      +D+  +T
Sbjct  238  TLKKAENTDTNPNDQPEDT  256



>ref|XP_007050795.1| Medicago truncatula MTN3 [Theobroma cacao]
 gb|EOX94952.1| Medicago truncatula MTN3 [Theobroma cacao]
Length=306

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 183/270 (68%), Gaps = 13/270 (5%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            ++ H  + VFG+LGNI+SF+V+LAPLPTF+ I+K+KS+EGF  +PYSVALFS M+ LYYA
Sbjct  32   IHDHGFSVVFGLLGNILSFLVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLLLYYA  91

Query  712  LVKQHVLF-LITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             +K+H  F LITIN IG F+E+IYL+LY VYA K  R+     ++ FN+G LG I++LT+
Sbjct  92   FLKKHDAFMLITINSIGCFIESIYLLLYMVYATKSARVYTTKLLIFFNLGALGSIILLTF  151

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
              S+G+ R+ +VGWI +V SVCVFAAPLSI+  VI+TK+VEYMPF LS FLTLCAV W L
Sbjct  152  IFSKGSSRISVVGWICAVFSVCVFAAPLSIIRLVIKTKTVEYMPFPLSFFLTLCAVTWFL  211

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YG  +RD+YIATPN+LGF  GI Q+ILY +YR            G +   I+ +  A E 
Sbjct  212  YGFSLRDYYIATPNILGFIFGITQMILYLLYR------------GGRKEQILPEIKAQET  259

Query  175  LQKGTDDEIHETTPSSVVVDMKKVVEMQQG  86
            L +    E       S +   ++   M  G
Sbjct  260  LPESKAKEQANGVQLSTLNQHQEAAAMNNG  289



>gb|EYU46728.1| hypothetical protein MIMGU_mgv1a011381mg [Erythranthe guttata]
Length=283

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/283 (47%), Positives = 188/283 (66%), Gaps = 21/283 (7%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M +  +A VFG+LGNI+SF+V+L+P+PTF+ I+K+KS+EGF  +PYSVALFS M+ LYYA
Sbjct  1    MATPMVATVFGVLGNIVSFLVYLSPMPTFYRIFKKKSTEGFQSIPYSVALFSAMLYLYYA  60

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             +K +VL L+TIN  G  VE  YLV Y +YA K  R+     +++FN+  LG I+ +T+F
Sbjct  61   FLKTNVLILVTINSFGSVVEVGYLVTYLIYATKESRVFTTKLLMLFNVSSLGFIIAVTHF  120

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L+ G+ R+KIVGWI +  SV VFAAPLSIM +VI+TKSVE+MPF LSLFLT+CAVVW  Y
Sbjct  121  LANGDTRLKIVGWICAAFSVSVFAAPLSIMRRVIQTKSVEFMPFTLSLFLTICAVVWFFY  180

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEML  173
            G  I DFYIATPN++GF  GI Q+ LY +Y+++       P   I  V I          
Sbjct  181  GFLIHDFYIATPNIVGFVLGIAQMTLYVVYKNKN------PKKNILPVEIT---------  225

Query  172  QKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV*ATSLRYNLAI  44
                  ++H+   S+++V+MK +    Q +     ++++ L +
Sbjct  226  ------KVHDLQTSTIIVEMKAIDPQPQDRDSENPTVKHELEL  262



>emb|CBI32263.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 179/259 (69%), Gaps = 12/259 (5%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+    +A  FGILGNI+SF+V+L+PLPTF+ IYKRKS+EGF  +PYSVALFS M+ LYY
Sbjct  3    MLTVPHMAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLLLYY  62

Query  715  ALVK-QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            A +K  + + LITIN +G  +E  YL++Y +YA +  +I  A  +L+FN GV G IV+ T
Sbjct  63   AFLKTDNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIVLST  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            +FLS+G++R KIVGW+ +  S+CVFAAPLSIM  VIRTKSVEYMPF LS FLT+CAV+W 
Sbjct  123  FFLSKGHRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAVMWF  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA------PNGGIQGVAIVV  197
             YGL IRDFYIA PN+LGFA GI Q+ILY IY++ K   +        PNG      +  
Sbjct  183  FYGLLIRDFYIAFPNILGFAFGIAQMILYTIYKNAKKGVLAEFKLQELPNG-----LVFP  237

Query  196  DATAAEMLQKGTDDEIHET  140
                AE      +D+  +T
Sbjct  238  TLKKAENTDTNPNDQPEDT  256



>ref|XP_004247459.1| PREDICTED: bidirectional sugar transporter NEC1 [Solanum lycopersicum]
Length=286

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/279 (51%), Positives = 189/279 (68%), Gaps = 9/279 (3%)
 Frame = -2

Query  880  QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQ  701
            QLA  FGILGN +SF+V+L+PLPTF+ I+KRKS+EGF  +PYSV+LFS M+ LYYA +K+
Sbjct  8    QLAFAFGILGNGVSFLVYLSPLPTFYRIFKRKSTEGFQSIPYSVSLFSAMLYLYYAYLKK  67

Query  700  HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY-FLSE  524
            + + LITIN  G  ++ IYL ++ +YA K  +I     ++ FN+   G IV LTY F +E
Sbjct  68   NEILLITINSFGTGIQLIYLTIFMIYATKSAKIFATKLLIGFNLVAFGAIVGLTYVFANE  127

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
             + R+ IVGWI +V SV VFAAPLSIM +VI+TKSVE+MPF LS FLT+CAV+W  YGL 
Sbjct  128  NDLRISIVGWICAVFSVSVFAAPLSIMRRVIQTKSVEFMPFPLSFFLTICAVMWFFYGLL  187

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN---GGIQGVAIVVDATAAEML  173
             +D YIA PN+LGF+ GI Q+ILYAIYR+RK    V P+     ++ +AI + A   E++
Sbjct  188  KKDMYIAMPNILGFSFGIAQMILYAIYRNRKQQ--VLPDLSLMDLKEIAIDMKAVVVEII  245

Query  172  QKGTDDEIHETTPSS---VVVDMKKVVEMQQGKVV*ATS  65
            Q+  DDE           V VD KK VE  +  V   TS
Sbjct  246  QENVDDENKNKINKQEEVVSVDEKKDVEYDKQDVALTTS  284



>ref|XP_009609628.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
tomentosiformis]
Length=277

 Score =   270 bits (690),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/273 (50%), Positives = 182/273 (67%), Gaps = 3/273 (1%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
             + QLA VFG+LGN +SF+V+L+P+PTF+ IYKRKS+EGF  +PYSVALFS M+ LYYA 
Sbjct  5    TASQLAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYLYYAY  64

Query  709  VKQ-HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            +K+ + + L+TIN  G  +E IYL ++ +YA +  +I     VL+ NIG  G IV LTY 
Sbjct  65   LKEKNGILLVTINSFGTAIELIYLTIFLIYATREAKIYTTKLVLLLNIGSYGAIVALTYI  124

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
             ++   RV IVGWI +V SVCVFAAPLSIM +VIRT+SVE+MPF LS FLT+CAV+W  Y
Sbjct  125  FAKDETRVTIVGWICAVFSVCVFAAPLSIMRRVIRTRSVEFMPFPLSFFLTICAVMWFFY  184

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAA--E  179
            GL I+D YIATPN+LGF  GI Q+ILYAI+R+RK     A +       +V+D  A   E
Sbjct  185  GLLIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKDLTQVVIDMKAMVLE  244

Query  178  MLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKV  80
            M +    ++  E   +      ++VV      V
Sbjct  245  MQENSDPNKEAEVDDTDEKKTKQEVVAQTTSNV  277



>ref|XP_009765830.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
sylvestris]
Length=278

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/266 (52%), Positives = 179/266 (67%), Gaps = 4/266 (2%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            SH LA VFG+LGN +SF+V+L+P+PTF+ IYKRKS+EGF  +PYSVALFS M+ LYYA +
Sbjct  7    SH-LAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYLYYAYL  65

Query  706  KQ-HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            K+ + + LITIN  G  +E IYL ++ +YA +  +I     VL+ NIG  G IV LTY  
Sbjct  66   KEKNGILLITINSFGTAIEFIYLTIFLMYATREAKIYTTKLVLLLNIGSFGAIVALTYIF  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
            ++   RV IVGWI +V SVCVFAAPLSIM +VI+T+SVE+MPF LS FLT+CAV+W  YG
Sbjct  126  AKDKTRVTIVGWICAVFSVCVFAAPLSIMRRVIKTRSVEFMPFPLSFFLTICAVMWFFYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L I+D YIATPN+LGF  GI Q+ILYAI+R+RK     A +       +V+D  A  +  
Sbjct  186  LLIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKDLTQVVIDMKAMVLEM  245

Query  169  KGTDDEIHETTPSSVVVDMKKVVEMQ  92
            +   D   E        D KK  + +
Sbjct  246  QENSDPNKEAEVDD--TDEKKTNKQE  269



>gb|KDP28088.1| hypothetical protein JCGZ_13859 [Jatropha curcas]
Length=272

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 174/262 (66%), Gaps = 6/262 (2%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            ++S  L  VFG+LGN ISF V+LAPLPTF+ I+K+KS+EGF  +PYSVALFS M+TLYY 
Sbjct  3    LHSSHLVLVFGLLGNAISFFVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLTLYYG  62

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             +K     LITIN +G  +E +YL++Y +YA K  RI     +++FN     LIVVLT F
Sbjct  63   TLKADGFMLITINSVGCVIEALYLIIYMIYANKSSRIYTLKILVLFNTIAYLLIVVLTTF  122

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            LS G++RV +VGWI +V SV VFAAPLSIM  VIRTKSVEYMPF+LS FLTLCA  WL Y
Sbjct  123  LSHGSQRVNVVGWICAVFSVSVFAAPLSIMRLVIRTKSVEYMPFSLSFFLTLCATSWLGY  182

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEML  173
            GL + D+YIATPNV GF  GI Q+ILY IY+ +K    + P    Q +A    +   +M 
Sbjct  183  GLAVEDYYIATPNVFGFGFGIAQMILYLIYKKKKNE--ILPETKSQELA----SEPCQMC  236

Query  172  QKGTDDEIHETTPSSVVVDMKK  107
            +   +    E      V +M K
Sbjct  237  KDDDNSNQTEEEAERSVANMDK  258



>gb|KHG13555.1| Bidirectional sugar transporter SWEET15 [Gossypium arboreum]
Length=275

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 179/253 (71%), Gaps = 8/253 (3%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            ++    + VFG+LGNI+SF V+LAPLPTF+ I+K+KS+EGF  +PYSVALFS M+ LYYA
Sbjct  5    IHDQSFSIVFGLLGNILSFFVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLLLYYA  64

Query  712  LVKQH-VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             +KQH  + LITIN IG  +E+IYL+ Y +YA K  RI     V+ FNI  LG I+++T 
Sbjct  65   FLKQHDAVMLITINSIGSCIESIYLIFYQIYATKTARIYTTKLVIFFNIVALGFIILVTL  124

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
               +G+ RV IVGWI ++ SVCVFAAPLSI+  VI+TKSVEYMPF LS FLTLCA+ W L
Sbjct  125  VFFKGHLRVSIVGWICAIFSVCVFAAPLSIIRLVIKTKSVEYMPFPLSFFLTLCAITWFL  184

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAP--NGGIQGVAIVVDATAA  182
            YG  +RDFYIATPN+LGF+ GI Q+ILY +YR  +T A+V P  N  +Q    +     A
Sbjct  185  YGFSLRDFYIATPNILGFSFGITQMILYLVYRG-ETKALVLPDSNNKVQ----LEQFPNA  239

Query  181  EMLQKGTDDEIHE  143
              +Q+ T ++  E
Sbjct  240  NNVQQSTVNQNQE  252



>gb|KDO87388.1| hypothetical protein CISIN_1g036251mg [Citrus sinensis]
Length=275

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/265 (52%), Positives = 184/265 (69%), Gaps = 11/265 (4%)
 Frame = -2

Query  868  VFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK-QHVL  692
            +FG+LGNI+SF+V+LAPLPTF+ I+K+KS++GF  +PYSVALFS M+ LYYA +K  +  
Sbjct  11   IFGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLLYYASLKGSNAF  70

Query  691  FLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEG-NK  515
             LITINGIG  +E++YL+ + +YA K  +I     +++FNIG LGLIV+LTY LS+  ++
Sbjct  71   MLITINGIGCIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVLLTYLLSKSSDQ  130

Query  514  RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRD  335
            R+ IVGWI +V SVCVFAAPLSI+ +VIRTKSVEYMPF+LS  LT+CA +WLLYGL I+D
Sbjct  131  RLTIVGWICAVFSVCVFAAPLSIIRQVIRTKSVEYMPFSLSCCLTICAGMWLLYGLSIKD  190

Query  334  FYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKGTDD  155
            +YIATPN+LG A G  Q+ILY  YR R+ + ++         A+V      E    G  D
Sbjct  191  YYIATPNILGMAFGATQMILYLAYRTRRNSEILP-----VAAAVVDPKDREESNNTGAAD  245

Query  154  EI----HETTPSSVVVDMKKVVEMQ  92
                  H    S+  V++K V   Q
Sbjct  246  PCCNHHHRHDSSNGEVEIKAVETNQ  270



>ref|XP_006444236.1| hypothetical protein CICLE_v10023774mg [Citrus clementina]
 gb|ESR57476.1| hypothetical protein CICLE_v10023774mg [Citrus clementina]
Length=275

 Score =   262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/265 (52%), Positives = 184/265 (69%), Gaps = 11/265 (4%)
 Frame = -2

Query  868  VFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK-QHVL  692
            +FG+LGNI+SF+V+LAPLPTF+ I+K+KS++GF  +PYSVALFS M+ LYYA +K  +  
Sbjct  11   IFGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLLYYASLKGSNAF  70

Query  691  FLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEG-NK  515
             LITINGIG  +E++YL+ + +YA K  +I     +++FNIG LGLIV+LTY LS+  ++
Sbjct  71   MLITINGIGCIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVLLTYLLSKSSDQ  130

Query  514  RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRD  335
            R+ IVGWI +V SVCVFAAPLSI+ +VIRTKSVEYMPF+LS  LT+CA +WLLYGL I+D
Sbjct  131  RLTIVGWICAVFSVCVFAAPLSIIRQVIRTKSVEYMPFSLSCCLTICAGMWLLYGLSIKD  190

Query  334  FYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKGTDD  155
            +YIATPN+LG A G  Q+ILY  YR R+ + ++         A+V      E    G  D
Sbjct  191  YYIATPNILGMAFGATQMILYLAYRTRRNSEILP-----VAAAVVDPKDREESNNTGAAD  245

Query  154  ----EIHETTPSSVVVDMKKVVEMQ  92
                  H    S+  V++K V   Q
Sbjct  246  PRCNHHHRHDSSNGEVEIKAVETNQ  270



>ref|XP_006480106.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Citrus 
sinensis]
Length=275

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/265 (52%), Positives = 184/265 (69%), Gaps = 11/265 (4%)
 Frame = -2

Query  868  VFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK-QHVL  692
            +FG+LGNI+SF+V+LAPLPTF+ I+K+KS++GF  +PYSVALFS M+ LYYA +K  +  
Sbjct  11   IFGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLLYYASLKGSNAF  70

Query  691  FLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEG-NK  515
             LITINGIG  +E++YL+ + +YA K  +I     +++FNIG LGLIV+LTY LS+  ++
Sbjct  71   MLITINGIGYIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVLLTYLLSKSSDQ  130

Query  514  RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRD  335
            R+ IVGWI +V SVCVFAAPLSI+ +VIRTKSVEYMPF+LS  LT+CA +WLLYGL I+D
Sbjct  131  RLTIVGWICAVFSVCVFAAPLSIIRQVIRTKSVEYMPFSLSCCLTICAGMWLLYGLSIKD  190

Query  334  FYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKGTDD  155
            +YIATPN+LG A G  Q+ILY  YR R+ + ++         A+V      E    G  D
Sbjct  191  YYIATPNILGMAFGATQMILYLAYRTRRNSEILP-----VAAAVVDPKDREESNNTGAAD  245

Query  154  EI----HETTPSSVVVDMKKVVEMQ  92
                  H    S+  V++K V   Q
Sbjct  246  PCCNHHHRHDSSNGEVEIKAVETNQ  270



>ref|XP_011079737.1| PREDICTED: bidirectional sugar transporter NEC1-like isoform 
X1 [Sesamum indicum]
Length=283

 Score =   262 bits (669),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 181/260 (70%), Gaps = 11/260 (4%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            ++++  +A  FGILGNI+SF+V+LAPLPTF+ I+K+KS+EGF  +PYSVALFS M+ LYY
Sbjct  3    ILSTLHIANAFGILGNIVSFLVYLAPLPTFYRIWKKKSTEGFQAIPYSVALFSAMLYLYY  62

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            A +KQ+ + LITIN IG   E  YL +Y +YA K  R+     + +FN+ +LG+++  TY
Sbjct  63   AFLKQNSIILITINTIGCVTEIAYLTVYMIYATKVSRVSTTRLLFLFNVSLLGVVIGATY  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
             L+ G++RV  VGWI +  SV VFAAPL+I+ +VIRTKSVE+MPF LS FLT+CAVVW L
Sbjct  123  LLARGHQRVTAVGWICAAFSVSVFAAPLAIIRRVIRTKSVEFMPFYLSFFLTICAVVWFL  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT----AAVVAPNGGIQGVAIVVDAT  188
            YG  I+D++IA PN+LGF  GI+Q+ LY +Y+DRK     AAVV    G     I+ D  
Sbjct  183  YGFLIKDYFIAGPNILGFIFGIMQMTLYVVYKDRKQQILPAAVVETKCGDH---IIKDVD  239

Query  187  AAEMLQKGTDDEIHETTPSS  128
                LQ+ +     ET P++
Sbjct  240  HQSQLQENSS----ETQPNN  255



>ref|XP_002520679.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41641.1| conserved hypothetical protein [Ricinus communis]
Length=286

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 182/263 (69%), Gaps = 4/263 (2%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            +N  +    FGILGNI+SF+V+LAPLPTF  I K+KS+EGF  +PYSVALFS M+TLYYA
Sbjct  3    LNDPRFILAFGILGNIVSFLVYLAPLPTFWRIVKKKSTEGFQSIPYSVALFSAMLTLYYA  62

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLV-FNIGVLGLIVVLTY  536
             +K++ + LITIN IG  +E IYL +Y +YA +  R+ +   +L+ FN+G   LIV+L  
Sbjct  63   TLKENAILLITINSIGCLIEGIYLTIYMIYATQTSRVQIHFKLLILFNLGTYLLIVMLAS  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
             L+ G  RV++VGWI +V SVCVFAAPLSIM  VI+TKSVEYMPF+LS FLTLCA+ WL 
Sbjct  123  ELTHGTLRVQVVGWICAVFSVCVFAAPLSIMRLVIKTKSVEYMPFSLSFFLTLCAISWLG  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YGL + D++IA+PN+LGF  GIVQ++LY IY+++K    + P    Q +A+    T+ + 
Sbjct  183  YGLAVNDYFIASPNILGFLFGIVQMVLYMIYKNKKNE--ILPTSTSQELAVSKPETSQDR  240

Query  175  LQKGTDDEIHETTPSSVVVDMKK  107
             +      +++    +   D ++
Sbjct  241  -ENSNSSSLNQQDLEAAKDDRRE  262



>ref|XP_007200238.1| hypothetical protein PRUPE_ppa015264mg [Prunus persica]
 gb|EMJ01437.1| hypothetical protein PRUPE_ppa015264mg [Prunus persica]
Length=284

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/258 (52%), Positives = 180/258 (70%), Gaps = 11/258 (4%)
 Frame = -2

Query  877  LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQH  698
            LA VFGILGNI++FMV+LAPLPTF+ I+K+KS+EGF  +PYSVALFS M+ LYYA +K +
Sbjct  9    LASVFGILGNIVAFMVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLMLYYAFLKTN  68

Query  697  VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN  518
               LITIN +G  +ET YLV+Y +YA  + RI  A  +++FN+GV G+IV+ TY +    
Sbjct  69   AFMLITINSVGCIIETSYLVMYMIYAPAKTRIYTAKLLVLFNVGVYGVIVLSTYLIPNHF  128

Query  517  KRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIR  338
             R+K+VGWI  V SVCVFAAPLSIM  VIRT+SVE+M F LS  LTLCAV+W  YGL +R
Sbjct  129  LRIKVVGWISVVFSVCVFAAPLSIMRLVIRTRSVEFMSFPLSFCLTLCAVMWFFYGLLVR  188

Query  337  DFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN---GGIQGVAIVVDATAA-----  182
            D +IA PN+LGFA G+ Q+I+Y ++++ K + +  P      I  V  V D  A+     
Sbjct  189  DLFIAAPNILGFAFGLAQMIMYLMFKNSKKSML--PEFSLNQIPNVVAVNDIVASDSQLK  246

Query  181  -EMLQKGTDDEIHETTPS  131
             E  +K ++ E +++T S
Sbjct  247  TEDTKKSSEAEENQSTES  264



>ref|XP_008392763.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=248

 Score =   259 bits (661),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            + H LA  FGILGNI+SF+VFLAPLPTF  +YK+KS+EGF  +PY  ALFS MI +YYA 
Sbjct  6    SHHPLAFAFGILGNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAF  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K HV+ LITIN  G  +ETIY+ +Y  YA K  R+     +L+ N G   LI++L++FL
Sbjct  66   LKSHVILLITINSFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
            S+G  RV+++GW+    SV VFAAPLS+M  VIRTKSVE+MPFNLS FLTL AV+WL YG
Sbjct  126  SQGPTRVEVLGWVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT  248
            L ++D Y+ATPN+LGF+ G+VQ+ LYA YR+ KT
Sbjct  186  LLLKDLYVATPNILGFSFGVVQMALYAKYRNTKT  219



>ref|XP_009337539.1| PREDICTED: bidirectional sugar transporter N3 [Pyrus x bretschneideri]
Length=298

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 138/273 (51%), Positives = 177/273 (65%), Gaps = 22/273 (8%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            + H LA  FGILGNI+SF+VFLAPLPTF  +YKRKS+EGF  +PY  ALFS MI +YYA 
Sbjct  6    SHHPLAFAFGILGNIVSFIVFLAPLPTFWRVYKRKSTEGFQSVPYVFALFSAMIWIYYAF  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K HV+ LITIN  G  +ETIY+ +Y  YA K+ R+     +L+ N G   LI++L+ FL
Sbjct  66   LKSHVILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLLLVNFGGFCLILLLSRFL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
            S+G  RV+++GW+    SV VFAAPLS+M  VIRTKSVE+MPFNLS FLTL AV+WL YG
Sbjct  126  SQGPTRVEVLGWVCVTFSVGVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT----------AAVV--------APNG  224
            L ++D Y+ATPN++GF+ G+VQ+ LY  YR+ KT          A VV         P  
Sbjct  186  LLLKDLYVATPNIIGFSFGVVQMALYTKYRNTKTIGEEKLPEHKADVVKQITILTTTPEV  245

Query  223  GIQGVAIVV-DATAAEMLQK---GTDDEIHETT  137
             +Q  A V  DA   +  Q     TD  +H  T
Sbjct  246  EVQVQAPVTSDANGTDAHQNSELNTDQHVHAQT  278



>ref|XP_008235079.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Prunus 
mume]
Length=275

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 179/258 (69%), Gaps = 11/258 (4%)
 Frame = -2

Query  877  LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQH  698
            LA VFGILGNI++FMV+LAPLPTF+ I+K+KS+EGF  +PYSVALFS M+ LYYA +K +
Sbjct  9    LASVFGILGNIVAFMVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLMLYYAFLKTN  68

Query  697  VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN  518
               LITIN +G  +ET +LV+Y +YA  + RI  A  +++FN GV G+I++ TY +    
Sbjct  69   AFMLITINSVGCIIETSFLVMYIIYAPAKTRIYTAKLLVLFNAGVYGVIILSTYLIPNHF  128

Query  517  KRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIR  338
             R+K+VGWI  V SVCVFAAPLSIM  VIRT+SVE+M F LS  LTLCAV+W  YGL +R
Sbjct  129  LRIKVVGWISVVFSVCVFAAPLSIMRLVIRTRSVEFMSFPLSFCLTLCAVMWFFYGLLVR  188

Query  337  DFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN---GGIQGVAIVVDATAAEM---  176
            D +IA PN+LGFA G+ Q+I+Y ++++ K +  + P      I  V  V D  A++    
Sbjct  189  DLFIAAPNILGFAFGLAQMIMYLMFKNSKKS--ILPEFSLNQIPNVVAVNDIVASDSQLK  246

Query  175  ---LQKGTDDEIHETTPS  131
                +K ++ E +++T S
Sbjct  247  TKDTKKSSEAEENQSTES  264



>emb|CDP09549.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 183/278 (66%), Gaps = 16/278 (6%)
 Frame = -2

Query  892  MNSHQLAGVFGIL----------GNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVAL  743
            +++  LA +FG+L          GNIISF+VFLAPLPTF+TIYK+K+SEGF  +PY VAL
Sbjct  4    LSAQVLALIFGLLVWLSNFEFSTGNIISFLVFLAPLPTFYTIYKKKTSEGFQSIPYVVAL  63

Query  742  FSCMITLYYALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGV  563
            FS  + LYYA +K + L ++TIN IG  +ETIYL +Y +YA K  ++     +  FNIG 
Sbjct  64   FSASLLLYYAFLKTNALLIVTINAIGCIIETIYLSMYVLYAPKTSKMFTLKLLGFFNIGC  123

Query  562  LGLIVVLTYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFL  383
            LG+IV ++  L++G KRV +VGW  +VI++ VFAAPLSIM +VIRTKSVEYMPF LS FL
Sbjct  124  LGVIVAVSLALAKGAKRVSLVGWFCAVINLAVFAAPLSIMAQVIRTKSVEYMPFTLSFFL  183

Query  382  TLCAVVWLLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAI  203
            TLCA  W  YG  +RD+YIA PNV+GF  GIVQ+ILY IY++ K    +  N  ++G   
Sbjct  184  TLCATSWFFYGFFVRDYYIAVPNVMGFLFGIVQMILYFIYKNAKKDGEI--NTKLEGA--  239

Query  202  VVDATAAEMLQKGTDDEIHET--TPSSVVVDMKKVVEM  95
            +      +M  +G +D+   +   P S      + +EM
Sbjct  240  MEQKEGIQMNIEGVEDKKFSSIEKPKSAAAHKPQDIEM  277



>ref|XP_004235470.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=276

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            ++H L   FGILGN++SFMVF+AP+PTF+ I K+KSSEGFH LPY V LFS M+ +YYA+
Sbjct  6    HTHPLVYTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAM  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            VK +V  LITIN  G   ETIY+ +YF YA K+ R+     VL+ N GV GLI+ LT  L
Sbjct  66   VKTNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQIL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G KR +++GWI    S+ VF APLSIM +VIRTKSVE+MPFNLSL LT+ AV+W LYG
Sbjct  126  CQGTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
            L ++D Y+A PN+ G   G++Q+ILY IYR+ K+  V
Sbjct  186  LLLKDVYVAVPNIPGMILGVLQMILYGIYRNSKSNNV  222



>ref|XP_006347653.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            ++H L   FGILGN++SFMVF+AP+PTF+ I K+KSSEGFH LPY V LFS M+ +YYA+
Sbjct  6    HTHPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAM  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            VK +V  LITIN  G   ETIY+ +YF YA K+ R+     VL+ N GV GLI+ LT  L
Sbjct  66   VKTNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQIL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G KR +++GWI    S+ VF APLSIM +VIRTKSVE+MPFNLSL LT+ AV+W LYG
Sbjct  126  CQGTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
            L ++D Y+A PN+ G   G++Q+ILY IYR+ K+  V
Sbjct  186  LLLKDVYVAVPNISGMILGVLQMILYGIYRNSKSNNV  222



>ref|XP_006366913.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=357

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            ++H L   FGILGN++SFMVF+AP+PTF+ I K+KSSEGFH LPY V LFS M+ +YYA+
Sbjct  6    HTHPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAM  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            VK +V  LITIN  G   ETIY+ +YF YA K+ R+     VL+ N GV GLI+ LT  L
Sbjct  66   VKTNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQIL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G KR +++GWI    S+ VF APLSIM +VIRTKSVE+MPFNLSL LT+ AV+W LYG
Sbjct  126  CQGTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
            L ++DFY+A PN+ G   G++Q+ILY IYR+ K+  V
Sbjct  186  LLLKDFYVAVPNISGMILGVLQMILYGIYRNSKSNNV  222



>ref|XP_009337947.1| PREDICTED: bidirectional sugar transporter NEC1-like [Pyrus x 
bretschneideri]
Length=267

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -2

Query  898  KMMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + +N+ QLA +FG+LGNI+SFMVFLAP+PTF+TIYK+KSS+GF  +PY VAL S  + LY
Sbjct  2    QFLNTEQLAFIFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSATLLLY  61

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            Y ++K +   +++INGIGI +E  YL+LY VYA K+ +I     +L+ N+   GL++ +T
Sbjct  62   YGVLKTNAYLIVSINGIGIVIEVTYLILYIVYASKKDKITTLSLILLVNVATFGLVLAVT  121

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL  G  R+  VGWI +V ++ VFAAPLSIM +VIRTKSVE+MPF+LSLFLTLCA +W 
Sbjct  122  VFLLGGTARICAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWF  181

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
             YGL  +D+YIA PNVLGF  G+ Q+ILY  Y++
Sbjct  182  FYGLFTKDYYIALPNVLGFLFGVAQMILYMTYKN  215



>ref|XP_008370771.1| PREDICTED: bidirectional sugar transporter NEC1-like [Malus domestica]
Length=267

 Score =   254 bits (648),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 175/256 (68%), Gaps = 2/256 (1%)
 Frame = -2

Query  898  KMMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + +N+ QLA VFG+LGNI+SFMVFLAP+PTF+TIYK+KSS+GF  +PY VAL S  + LY
Sbjct  2    QFLNTEQLAFVFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSATLLLY  61

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            Y ++K +   +++IN IGI +E  YL+LY VYA K+ +I     +L+ N+   GL++ +T
Sbjct  62   YGVLKTNAYLIVSINVIGIXIEVTYLILYIVYASKKDKITTLSLILLVNVAAFGLVLAVT  121

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL  G  RV  VGWI +V ++ VFAAPLSIM +VIRTKSVE+MPF+LSLFLTLCA +W 
Sbjct  122  VFLLGGTARVCAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWF  181

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR-KTAAVVAPNGGIQGVAIVVDATAA  182
             YGL  +D+YIA PNVLGF  GI Q+ILY  Y++  K   V      ++ ++        
Sbjct  182  FYGLFTKDYYIALPNVLGFLFGIAQMILYMTYKNSGKDVEVKKSTMEMKKLSSTNRPNLT  241

Query  181  EMLQKGT-DDEIHETT  137
              + K +  DE+ +TT
Sbjct  242  GSVNKNSRSDELKQTT  257



>ref|XP_004297512.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   254 bits (650),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 185/271 (68%), Gaps = 4/271 (1%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H L   FG+LGNIISFMVFLAP+PTF+ IYK+K++EGF  LPY+VALFSCM+ +YYAL+K
Sbjct  5    HPLTLAFGLLGNIISFMVFLAPMPTFYKIYKKKTTEGFQALPYAVALFSCMLWIYYALLK  64

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
            Q   FLITIN +G  +ET+YL ++  Y+ K+ RI     +L+ N+   GL++VLT FL++
Sbjct  65   QDATFLITINSVGCVIETVYLAIFLFYSPKKARISTVKFLLLLNVLGYGLMLVLTLFLAK  124

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G  R+K+VGWI  V ++ VFAAPL I+ KVIRTKSVE+MPF LS FLTL AV+W  YG  
Sbjct  125  GEIRLKVVGWICLVFNLTVFAAPLCILKKVIRTKSVEFMPFPLSFFLTLGAVMWFFYGFL  184

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVA--IVVDATAAEMLQ  170
            ++D+ IA PN+LGF  GI Q++LY +Y++ K   ++     +Q ++  I+     + M+ 
Sbjct  185  LKDYNIAFPNILGFMFGIAQMVLYIVYKNAKKVVLLEEPSKVQELSDHIIEVMKISTMVC  244

Query  169  KGTDDEIHETTPSSVVVDMKKVVEMQQGKVV  77
                  + +  P+ + +D+ +V+ +    VV
Sbjct  245  PDLTPVVLQ--PNDINIDLIEVIPLDPNNVV  273



>ref|XP_006366912.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            ++H L   FGILGN++SFMVF+AP+PTF+ I K+KSSEGFH LPY V LFS M+ +YYA+
Sbjct  6    HTHPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAM  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            VK +V  LITIN  G   ETIY+ +YF YA K+ R+     VL+ N GV GLI+ LT  L
Sbjct  66   VKTNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQIL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G KR +++GWI    S+ VF APLSIM +VIRTKSVE+MPFNLSL LT+ AV+W LYG
Sbjct  126  CQGTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
            L ++D Y+A PN+ G   G++Q+ILY IYR+ K+  V
Sbjct  186  LLLKDIYVAVPNIPGMILGVLQMILYGIYRNFKSNNV  222



>ref|XP_009379704.1| PREDICTED: bidirectional sugar transporter NEC1-like [Pyrus x 
bretschneideri]
Length=267

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = -2

Query  898  KMMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + +N+ QLA +FG+LGNI+SFM FLAP+PTF+TIYK+KSS+GF  +PY +AL S  + LY
Sbjct  2    QFLNTEQLAFIFGLLGNIVSFMTFLAPIPTFYTIYKKKSSKGFQSIPYVIALLSATLLLY  61

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            Y  +K +   +I+IN IG  +E  YL+LY VYA K  +I   + +L+ N+  LGL+V +T
Sbjct  62   YGALKTNAYLIISINSIGTVIEVTYLILYIVYASKNDKITTLIWILLVNVAALGLVVAVT  121

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            +FL  G  R+  VGWI +V ++ VFAAPLSIM +VIRTKSVE+MPF+LS FLTLCA +W 
Sbjct  122  FFLLGGTVRISTVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSFFLTLCATMWF  181

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
             YGL  +D+YIA PNVLGF  GI Q+ILY  Y++
Sbjct  182  FYGLFTKDYYIALPNVLGFLFGIAQMILYMTYKN  215



>gb|EYU30738.1| hypothetical protein MIMGU_mgv1a012552mg [Erythranthe guttata]
Length=246

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            +++ +L  +FG+LGNIISF+VFL+PLPTF+TI+K+KSS+GF  +PYSVA FS  + LYYA
Sbjct  4    LSAKELEFIFGLLGNIISFLVFLSPLPTFYTIWKQKSSKGFQSIPYSVAFFSASLLLYYA  63

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             +K +   +++INGIG  +E IYL++Y +YA K+ +I     ++ FNIG LGL+  ++  
Sbjct  64   FLKTNAYMIVSINGIGCVIEAIYLLIYLMYAPKKSKIFTMRLIVFFNIGGLGLMTAVSQL  123

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
              +G KRV  VGW+ +++++ VFAAPLSIM +VIRTKSVE+MPF LS FLTLCA+ W  Y
Sbjct  124  GFKGPKRVSFVGWVCAIVNIAVFAAPLSIMRQVIRTKSVEFMPFTLSFFLTLCAITWFFY  183

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
            G  +RD+YIA PNVLGF  GI Q+ILY IY++ K
Sbjct  184  GFFVRDYYIAMPNVLGFLFGIAQMILYMIYKNAK  217



>ref|XP_004297511.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Fragaria 
vesca subsp. vesca]
Length=310

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  895  MMNSHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            M +SH  LA  FGILGNI+SF+VFLAP+PTF+ +YK+KS+EGF  +PY  ALFS  I +Y
Sbjct  1    MTSSHSPLAFAFGILGNIVSFIVFLAPVPTFYRVYKKKSTEGFQSIPYIFALFSATIWIY  60

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA +K   + LITING G  +ETIY+ +Y  YA K+ R+     +L+ N G   LI+ L+
Sbjct  61   YASLKSDEMLLITINGFGCVIETIYIAMYITYAPKKARVNTLRLLLLVNFGGFCLILFLS  120

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            +FL++G  RVK++GW+    SV VFAAPLSIM  VIRTKSVE+MPF+LS FLTL A++WL
Sbjct  121  HFLTQGPTRVKVLGWVCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAIMWL  180

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
             YGL ++D Y+A PN+LGF+ G+VQ+ILYA YR++KT  V
Sbjct  181  FYGLLLKDLYVAAPNILGFSFGVVQMILYAAYRNKKTVLV  220



>gb|KHG20984.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=289

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/282 (47%), Positives = 180/282 (64%), Gaps = 11/282 (4%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M + H LA VFGILGNIIS +VFLAP+PTF  IYK+KS+E F  LPY VALFSCM+ LYY
Sbjct  4    MADHHSLAVVFGILGNIISVLVFLAPVPTFCRIYKKKSTESFQSLPYQVALFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K+    LITIN  G  VETIY+ ++  YA K  R+      +  N+G+   I++LT+
Sbjct  64   ALIKKGAFLLITINSFGCVVETIYISMFLAYASKNSRMSAMKLFISMNLGLFSFILILTH  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            FL + + R++++GWI   ISV VFAAPL+IM +VIRTKSVE+MPF LS FLTL AV+W  
Sbjct  124  FLLKSSIRIQVLGWICVAISVSVFAAPLNIMARVIRTKSVEFMPFTLSFFLTLSAVMWFA  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA---PNGGIQGVAIVVDATA  185
            YGL I+D  +A PNVLGF  G++Q++LYAIYR  +   +     P   ++ + +V+    
Sbjct  184  YGLFIKDLCVALPNVLGFILGMLQMLLYAIYRHSEKVNIEEKKLPAEQMKSINVVLTTLG  243

Query  184  AE-----MLQKGTDDEIHETTPSSVVV---DMKKVVEMQQGK  83
            A      +L   TDD   E   ++      D +  V+M+   
Sbjct  244  ASEVHPVVLDIHTDDTKEEDNKNNEPTGEPDKQTDVKMEDAN  285



>ref|XP_006844581.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
 gb|ERN06256.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
Length=282

 Score =   252 bits (643),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 160/213 (75%), Gaps = 0/213 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H  A  FG+LGNIISFMV+L+PLPTFH +YK+KS+EGF  +PY VALFS M+ +YYAL+K
Sbjct  8    HPWAFTFGLLGNIISFMVYLSPLPTFHRVYKKKSTEGFQSVPYVVALFSAMLWIYYALLK  67

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
                 LITIN +G  +E+IY+ +Y +YA K+ +I  A  V++ N+GV  +I++LT F  +
Sbjct  68   TDGYLLITINTLGCIIESIYITMYIIYAPKKAKIATAKLVVLLNLGVFCMILLLTLFFVQ  127

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G KRV+++GW+    SVCVFAAPLSIM  VI+TKSVE+MPF+LS  LTL AV+W  YGL 
Sbjct  128  GPKRVRVLGWVCVTFSVCVFAAPLSIMRLVIQTKSVEFMPFSLSFSLTLSAVMWFSYGLL  187

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTA  245
             +DFYIA PNVLGF  GI+Q++LY IY+  K A
Sbjct  188  TKDFYIALPNVLGFIFGIIQMVLYIIYKGTKKA  220



>ref|XP_007205793.1| hypothetical protein PRUPE_ppa010594mg [Prunus persica]
 gb|EMJ06992.1| hypothetical protein PRUPE_ppa010594mg [Prunus persica]
Length=244

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 165/228 (72%), Gaps = 2/228 (1%)
 Frame = -2

Query  898  KMMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            K +++ QLA VFG+LGNI+SFMVFLAP+PTF+TIYK+KSS+GF  +PY VAL S M+ LY
Sbjct  2    KFLSNEQLAFVFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSAMLLLY  61

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            Y ++K +   +I+INGIG  +E IYL+ Y V+A K+ +I     +L+ N+   GL++ +T
Sbjct  62   YGVLKTNAFLIISINGIGCVIEIIYLIFYIVHASKKDKITTMSLILLVNVAAFGLVMAVT  121

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL    KRV  VGW+ +V ++ VFAAPLSI+ +VIRTKSVEYMPF+LS FLTLCA +W 
Sbjct  122  LFLLGEAKRVSAVGWMCAVFNIAVFAAPLSIVRQVIRTKSVEYMPFSLSFFLTLCATMWF  181

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQ  215
             YGL  +D+YIA PNVLGF  G+ Q+ILY  Y++  +    A N G Q
Sbjct  182  FYGLFTKDYYIALPNVLGFLLGVAQMILYLKYKN--SGKNDAENKGSQ  227



>ref|XP_008392764.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=283

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/261 (51%), Positives = 172/261 (66%), Gaps = 22/261 (8%)
 Frame = -2

Query  853  GNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFLITIN  674
            GNI+SF+VFLAPLPTF  +YK+KS+EGF  +PY  ALFS MI +YYA +K HV+ LITIN
Sbjct  3    GNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSHVILLITIN  62

Query  673  GIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRVKIVGW  494
              G  +ETIY+ +Y  YA K  R+     +L+ N G   LI++L++FLS+G  RV+++GW
Sbjct  63   SFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFLSQGPTRVEVLGW  122

Query  493  ILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYIATPN  314
            +    SV VFAAPLS+M  VIRTKSVE+MPFNLS FLTL AV+WL YGL ++D Y+ATPN
Sbjct  123  VCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGLLLKDLYVATPN  182

Query  313  VLGFACGIVQLILYAIYRDRKT----------AAVV--------APNGGIQGVAIVVDAT  188
            +LGF+ G+VQ+ LYA YR+ KT          A VV         P   +Q  A V   T
Sbjct  183  ILGFSFGVVQMALYAKYRNTKTIVEEKLPEHKADVVKQIKILTTTPEVEVQVQAPVTSDT  242

Query  187  ----AAEMLQKGTDDEIHETT  137
                A +  ++GTD  +H  T
Sbjct  243  NSTDAHQNSERGTDQYVHAQT  263



>sp|Q9FPN0.1|NEC1_PETHY RecName: Full=Bidirectional sugar transporter NEC1; AltName: 
Full=NEC1 [Petunia x hybrida]
 gb|AAG34696.1| NEC1 [Petunia x hybrida]
Length=265

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/255 (49%), Positives = 174/255 (68%), Gaps = 10/255 (4%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            + +  L+ +FG+LGNI+SFMVFLAP+PTF+ IYKRKSSEG+  +PY VALFS  + LYYA
Sbjct  4    LRADDLSFIFGLLGNIVSFMVFLAPVPTFYKIYKRKSSEGYQAIPYMVALFSAGLLLYYA  63

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             ++++   +++ING G  +E  Y+ L+  YA ++ +I     +L+  +G LG+++ +TY 
Sbjct  64   YLRKNAYLIVSINGFGCAIELTYISLFLFYAPRKSKIFTGWLMLL-ELGALGMVMPITYL  122

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L+EG+ RV IVGWI + I+V VFAAPLSIM +VI+TKSVE+MPF LSLFLTLCA +W  Y
Sbjct  123  LAEGSHRVMIVGWICAAINVAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWFFY  182

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYR------DRKTAAVVAPNGGIQGVAIVV--  197
            G   +DFYIA PN+LGF  GIVQ++LY +Y+      D K+  V       +GV I++  
Sbjct  183  GFFKKDFYIAFPNILGFLFGIVQMLLYFVYKDSKRIDDEKSDPVREATKSKEGVEIIINI  242

Query  196  -DATAAEMLQKGTDD  155
             D  +   LQ    D
Sbjct  243  EDDNSDNALQSMEKD  257



>ref|XP_004952573.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Setaria 
italica]
Length=319

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/252 (50%), Positives = 170/252 (67%), Gaps = 3/252 (1%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A  FGILGNIIS MVFL+PLPTF+ +Y++KS+EGF   PY V LFSCM+ ++YA
Sbjct  6    MEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            L+K   + L+TING+G  +ET+Y+ +Y VYA +  R+L A  +L  N+GV GL+ ++T  
Sbjct  66   LLKTGAVLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVSLVTMV  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            LS GN RV ++GWI   +++ VFAAPLSIM +VIRTKSVE+MPF+LS FL L AV+W  Y
Sbjct  126  LSNGNLRVHVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPFSLSFFLVLSAVIWFAY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEML  173
            G   +D ++A PNVLGF  G+ Q+ LY  YR+RK AA V     ++    V +  AA + 
Sbjct  186  GALKKDVFVAFPNVLGFVFGLAQMALYMAYRNRKPAAAVVMVEEVKLPEHVKEVAAAPVA  245

Query  172  QKGTDD---EIH  146
             +G      E+H
Sbjct  246  HEGRASCGAEVH  257



>ref|XP_010534707.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Tarenaya 
hassleriana]
Length=300

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 174/264 (66%), Gaps = 10/264 (4%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H +A  FG+LGN ISF+VFLAP PTF+ IYK+KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MINHHFMAVTFGVLGNAISFLVFLAPAPTFYRIYKKKSTESFRSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K++   LITIN  G  +ET+Y+ L+F Y+ K  RI      +  N+G+  LI+ +T+
Sbjct  64   ALLKRNAFLLITINSFGCVIETLYIALFFAYSSKDKRISAMKLFMAMNVGLFSLILSVTH  123

Query  535  FL-SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            FL    N R+ ++GWI   ISV VFAAPL+++ +VIRTKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FLVKNPNSRIVVLGWICVSISVSVFAAPLTVVARVIRTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA--PNGGIQGVAIVVDAT-  188
             YGL +RD  IA PNVLGFA G+VQ+ILY IYR+ +   +    P+   Q   IVV +  
Sbjct  184  AYGLFLRDICIAIPNVLGFALGMVQMILYGIYRNSEKPNLEKKVPDQQQQLKTIVVSSPL  243

Query  187  ------AAEMLQKGTDDEIHETTP  134
                    ++  +   DE  + TP
Sbjct  244  GVSEVYPVDVTSQSDGDEGEKVTP  267



>ref|XP_010242697.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=276

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 176/263 (67%), Gaps = 13/263 (5%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            NSH L   FGILGNI+S  V+LAP+PTF+ IYK+KS+EGF  +PY VALFS M+ +YYAL
Sbjct  5    NSHTLVFAFGILGNIVSCAVYLAPVPTFYRIYKKKSTEGFQSIPYVVALFSAMLWIYYAL  64

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K +V  LITINGIG  +ETIY+ LY VYA K  +I     +L+ N+G  GLI++L++  
Sbjct  65   LKTNVTMLITINGIGCTIETIYITLYLVYAPKGTKIFTVKLLLLLNMGAYGLILLLSFLF  124

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G  RV +VGW+ +  SV VFAAPLSIM +VIRTKSVE+MP +LS FLTLCAV W  YG
Sbjct  125  FKGFGRVTVVGWVCAGFSVIVFAAPLSIMRRVIRTKSVEFMPISLSFFLTLCAVFWFFYG  184

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT------------AAVVAPN-GGIQGV  209
            + ++D YIA PNVLGFA G+ Q+ILY IYRD K              +++ P+       
Sbjct  185  ILMKDLYIAIPNVLGFALGVAQMILYIIYRDSKKHLIVELKLPELDPSIIKPSTTEAPKT  244

Query  208  AIVVDATAAEMLQKGTDDEIHET  140
               ++  AAE     T+ +I +T
Sbjct  245  QSTINLPAAEPQHNETNHQIPKT  267



>ref|XP_004302124.1| PREDICTED: bidirectional sugar transporter NEC1-like [Fragaria 
vesca subsp. vesca]
Length=257

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            + QLA  FG+LGNI+SFMVFLAP+PTF+ IYK+KSSEGF  +PY VAL S M+ LYY ++
Sbjct  6    TEQLAFSFGLLGNIVSFMVFLAPMPTFYRIYKKKSSEGFQSIPYVVALLSAMLLLYYGVI  65

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K + + +I+IN  GI +E  YL+ Y  YA K+ RI     +L+ N+   GL +  T FL 
Sbjct  66   KTNAILIISINAFGIVIEVAYLIFYLTYAPKKQRIFTLNLILLVNVA-FGLTLAATIFLL  124

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G KRV  VGWI +V ++ VFAAPLSIM +VIRTKSVE+MPF LSLFLTLCA  W  YGL
Sbjct  125  SGTKRVAAVGWICAVFNIAVFAAPLSIMREVIRTKSVEFMPFGLSLFLTLCATTWFFYGL  184

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRD  257
              +D+YIA PNVLGF  GI Q+ILY +YR+
Sbjct  185  FTKDYYIALPNVLGFLFGIAQMILYMVYRN  214



>ref|XP_011085139.1| PREDICTED: bidirectional sugar transporter NEC1-like [Sesamum 
indicum]
Length=262

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 181/272 (67%), Gaps = 22/272 (8%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            +++   LA +FG+LGN++SF+VFLAP+PTF+TI+K+KSSEGF  +PYSVA  S  + LYY
Sbjct  3    LLSVEHLAVLFGLLGNLVSFLVFLAPMPTFYTIWKKKSSEGFQSIPYSVAFLSASLLLYY  62

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            A +K +   +++INGIG  +E IYL++Y  YA K+ R+     V++FN G +GL+++++ 
Sbjct  63   AFLKTNAYMIVSINGIGCVIEMIYLLIYITYAPKKARMFTIKLVVLFNFGGMGLVMLVSL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
               +G+KRV +VGW  ++ ++ VFAAPLSIM +VIRTKSVE+MPF LS FLTLCA +W  
Sbjct  123  LAYKGSKRVSLVGWACAIFNLAVFAAPLSIMRRVIRTKSVEFMPFTLSFFLTLCATMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YG  ++D+YIA PNVLGF  GI Q+ILY IY++ K                 V++   E 
Sbjct  183  YGFFVKDYYIALPNVLGFLFGIAQMILYFIYKNAKKE---------------VESKNVE-  226

Query  175  LQKGTDDEIHETTPSSVVVDMKKVVEMQQGKV  80
            L+   D E+  +       D++K +E++   V
Sbjct  227  LETSKDVELETSK------DVEKNLELKDQAV  252



>ref|XP_008386620.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Malus 
domestica]
Length=300

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 171/262 (65%), Gaps = 8/262 (3%)
 Frame = -2

Query  877  LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQH  698
            LA VFGILGNI+SFMV LAPLPTF+ I+K+KS+EGF  +PY+VALFS M+ LYYA +K H
Sbjct  9    LASVFGILGNIVSFMVLLAPLPTFYRIFKKKSTEGFQSIPYAVALFSAMLMLYYAFLKGH  68

Query  697  VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN  518
               LITIN I   +ET YLV+Y +YA  + RI  A  + +FN+G  G+I+  T  +++  
Sbjct  69   AFMLITINSIACVIETSYLVIYMIYAPAKIRIYTAKLLTLFNVGAYGVILFATSLITDPY  128

Query  517  KRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIR  338
             R+KIVGW   V SVCVFAAPLSIM  VI+T+SVEYM F LS  LTLCAV+W  YGL +R
Sbjct  129  LRIKIVGWTNVVFSVCVFAAPLSIMRLVIKTRSVEYMSFPLSFCLTLCAVMWFFYGLLLR  188

Query  337  DFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA------PNGGIQGVAIVVDATAAEM  176
            D ++A PN+LGF  GI Q+I+Y +++  K A +        PN    GVA   +    E 
Sbjct  189  DLFVAAPNILGFGFGIAQMIMYLVFKKSKKAVLPQYILKEIPNEN--GVAENDNQLKEED  246

Query  175  LQKGTDDEIHETTPSSVVVDMK  110
                  +++   + +S V D +
Sbjct  247  TNDSKVEDVCSESMTSKVEDAR  268



>ref|XP_004490502.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=270

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 157/219 (72%), Gaps = 1/219 (0%)
 Frame = -2

Query  892  MNSH-QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M  H  LA VFGILGNIISFMVFLAPLPTF+ I+K+KS++GF  LPY VALFS M+ LYY
Sbjct  1    MEKHIHLAFVFGILGNIISFMVFLAPLPTFYRIWKKKSTQGFQSLPYLVALFSSMLWLYY  60

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            A+VK +   LITIN  G  +ETIY+V+Y +YA K  RIL     +V N+G   LI   T 
Sbjct  61   AIVKTNARLLITINSFGCVIETIYIVIYTIYATKDARILTVKLFMVMNVGSFALIFFTTQ  120

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            F   G+ RV+++GWI    +VCVFAAPL I+ KVIRTKSVE+MPFNLS FLTL A++W  
Sbjct  121  FGMHGSLRVQVLGWICVSFAVCVFAAPLCIVAKVIRTKSVEFMPFNLSFFLTLSAIMWFA  180

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
            YGL ++D  IA PNVLGF  G++Q++LYAIY      ++
Sbjct  181  YGLLLKDICIALPNVLGFTLGLLQMLLYAIYNKGSKVSI  219



>ref|XP_004235340.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=295

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 173/258 (67%), Gaps = 4/258 (2%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M +H LA VFG+LGNI+SFMV+LAP+PTF+ IYK+KS+EGF  +PY V LFS M+ +YYA
Sbjct  1    MTTH-LAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYA  59

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             +K     LITIN +G F++T Y+  +  YA K+ ++     +L  N+  LGLI+ LT F
Sbjct  60   FLKPDTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTMKLLLSMNVVGLGLIIFLTQF  119

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
             ++G+ R +IVGWI  + S CVF APL ++ +VIRTKSVEYMPF LS FLTL AV+W LY
Sbjct  120  FAKGSNRAQIVGWICLIFSFCVFVAPLGVLRQVIRTKSVEYMPFQLSFFLTLSAVMWFLY  179

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEML  173
            GL  +D+ IA PNVLGF+ G++Q+ LY IY++ K    V     ++   IV D    ++ 
Sbjct  180  GLLRKDYNIAIPNVLGFSLGVIQMTLYLIYKNAKK---VTKEVKLEVTEIVADDKELKLS  236

Query  172  QKGTDDEIHETTPSSVVV  119
            ++   D+I +    S +V
Sbjct  237  EEILKDQIIDVVKLSAIV  254



>ref|XP_008374287.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=298

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 156/218 (72%), Gaps = 0/218 (0%)
 Frame = -2

Query  901  SKMMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITL  722
            S   + H LA  FG+LGNI SF+VFLAPLPTF  +YK+KS+EGF  +PY  ALF+  I +
Sbjct  2    SASTSHHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWI  61

Query  721  YYALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVL  542
            YYA +K + + LITIN  G  +ETIY+ +Y  YA K+ R+     + + N G   LI++L
Sbjct  62   YYAFLKSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLTLLFLVNFGGFCLILLL  121

Query  541  TYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVW  362
             +FLS+G  RV ++GW+    SV VFAAPLS M  VIRTKSVE+MPFNLS FLTL AV+W
Sbjct  122  AHFLSQGPTRVAVLGWVCVTFSVSVFAAPLSAMKMVIRTKSVEFMPFNLSFFLTLSAVMW  181

Query  361  LLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT  248
            L YGL ++D Y+ATPN++GF+ G+VQ+ LYA YR+ KT
Sbjct  182  LSYGLLLKDLYVATPNIVGFSFGLVQMALYAKYRNNKT  219



>ref|XP_002284244.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
 emb|CBI15714.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 174/263 (66%), Gaps = 6/263 (2%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H L  +FGILGN+ISFMV+LAPLPTF+ IYKRKS+EGF  +PY VALFS M+ +YYA + 
Sbjct  8    HPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLWIYYAFLN  67

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
                 LITIN +G  +ET Y+V++ VYA K+ RI     V + NI   G I++LT  L+E
Sbjct  68   TDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILLLTLLLAE  127

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G  RV+I+GW+  V S+ VF APL IM +VIRTKSVEYMPF LS FLTL AV+W  YGL 
Sbjct  128  GANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLM  187

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKT--AAVVAPNGGIQGVAIVVDAT----AA  182
            ++DFYIA PN+LGF  GIVQ++LY IYR+RK        P    Q + +V  +T      
Sbjct  188  LKDFYIAGPNILGFVFGIVQMVLYLIYRNRKKVLENEKLPELSEQIIDVVKLSTMVCSEV  247

Query  181  EMLQKGTDDEIHETTPSSVVVDM  113
             +  +   +E H TT   V+V +
Sbjct  248  NLTNQQHSNEGHGTTGLEVIVAL  270



>ref|XP_007159040.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
 gb|ESW31034.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
Length=273

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 174/261 (67%), Gaps = 13/261 (5%)
 Frame = -2

Query  895  MMNSH-QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            ++N+H  LA  FG+LGNIISFMV+LAPLPTF+ IYK+KS+EGF  LPY VALFS M+ LY
Sbjct  3    ILNTHNHLALAFGLLGNIISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLY  62

Query  718  YALVKQ-HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVL  542
            YA++K      LITIN +G  +ET+Y+VL+ VYA    R L     +V N+G   LI ++
Sbjct  63   YAVLKPADATLLITINSVGTVIETVYIVLFTVYATTDARKLTVKLFVVMNVGSFALIFLV  122

Query  541  TYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVW  362
            T+F   G  R+++VGW+   ISV VFAAPLSI+ +VIRTK+VE+MPFNLSLFLTL A+ W
Sbjct  123  TFFTMHGALRIQVVGWVCVAISVGVFAAPLSIVTQVIRTKNVEFMPFNLSLFLTLSAITW  182

Query  361  LLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTA-----------AVVAPNGGIQ  215
              YG  ++D  IA PNVLGF  G+VQ++LYA+YR+ K+             VV+P G  +
Sbjct  183  FSYGFFLKDICIAIPNVLGFTLGLVQMLLYAMYRNGKSKIVTEEEAMKNVVVVSPLGTCE  242

Query  214  GVAIVVDATAAEMLQKGTDDE  152
            G  + +     E    G + E
Sbjct  243  GYPVQIMDEEKEKGIYGREKE  263



>ref|XP_002453892.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
 gb|EES06868.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
Length=336

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 155/217 (71%), Gaps = 0/217 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A  FGILGNIIS MVFL+PLPTF+ +Y++KS+EGF   PY V LFSCM+ ++YA
Sbjct  6    MEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            L+K     L+TING+G  +ET+YL +Y +YA K  R+L A  +L  N+GV GL+ ++T  
Sbjct  66   LLKSGAELLVTINGVGCVIETVYLGMYLLYAPKAARVLTAKMLLGLNVGVFGLVALVTMV  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            LS G  RVK++GWI   +++ VFAAPLSIM +VIRTKSVE+MP +LS FL L AV+W  Y
Sbjct  126  LSNGGLRVKVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAVIWFAY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAA  242
            G   +D ++A PNVLGF  G+ Q+ LY  YR++K AA
Sbjct  186  GALKKDVFVAAPNVLGFVFGLAQMALYMAYRNKKPAA  222



>ref|XP_006347632.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=294

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 180/282 (64%), Gaps = 14/282 (5%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M +H LA VFG+LGNI+SFMV+LAP+PTF+ IYK+KS+EGF  +PY V LFS M+ +YYA
Sbjct  1    MMTH-LAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYA  59

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             +K     LITIN +G F++T Y+  +  YA K+ ++     +L  N+  LGLI++LT F
Sbjct  60   FLKPDTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTVKLLLSMNVVGLGLIILLTQF  119

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
             S+G+ R +IVGWI  + S CVF APL ++ +VIR+KSVEYMPF LS FLTL AV+W  Y
Sbjct  120  FSKGSNRAQIVGWICLIFSFCVFVAPLGVLRQVIRSKSVEYMPFQLSFFLTLSAVMWFFY  179

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDAT---AA  182
            GL  +D+ IA PNVLGF+ G++Q+ LY IY++ K    V     ++    VVD     + 
Sbjct  180  GLLRKDYNIAIPNVLGFSLGVIQMTLYLIYKNAKK---VTKEVRLENTETVVDEELKLSE  236

Query  181  EMLQKGTDDEIH-------ETTPSSVVVDMKKVVEMQQGKVV  77
            EML++   D +        E  P     ++K  + + Q  V+
Sbjct  237  EMLKEQIIDVVKLSAMVCSEIIPMVTAHELKNEINLPQLNVI  278



>ref|XP_004489106.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Cicer 
arietinum]
Length=254

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/267 (48%), Positives = 179/267 (67%), Gaps = 19/267 (7%)
 Frame = -2

Query  901  SKMM--NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMI  728
            SKM   + H++  +FG+LGNI+SF+VFLAPLPTF++I K+K+SEGF  +PY VAL S M+
Sbjct  2    SKMFTFSDHEMVLIFGLLGNIVSFLVFLAPLPTFYSICKKKTSEGFQSIPYVVALLSAML  61

Query  727  TLYYALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIV  548
             LYY L+K + + +ITIN IG  +E +YL++Y +YA ++ +I     +LV ++G LGL +
Sbjct  62   LLYYGLLKTNAILIITINCIGCVIEVLYLIIYIIYAPRKLKISTLALILVADLGGLGLTL  121

Query  547  VLTYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAV  368
            ++T F+ +   RV  VG I ++ ++ VFAAPLSIM KVI+T+SVEYMPF LSLFLTLCA 
Sbjct  122  IITNFIVKSYYRVHAVGLICAIFNIAVFAAPLSIMRKVIKTRSVEYMPFFLSLFLTLCAT  181

Query  367  VWLLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDAT  188
            +W  YGL  +D YI  PNVLGF  GI Q+ILY IY++ K                 V+A 
Sbjct  182  MWFFYGLFDKDNYIMLPNVLGFLFGISQMILYLIYKNAKNK---------------VEAN  226

Query  187  AAEMLQKGTDDEIHETTPSSVVVDMKK  107
            + E  + G DD   E  PS  +V+MK+
Sbjct  227  SNEQQEYGDDDGNKEDFPS--IVEMKE  251



>ref|XP_011023930.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Populus 
euphratica]
Length=276

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 172/254 (68%), Gaps = 8/254 (3%)
 Frame = -2

Query  865  FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFL  686
            FG+LGN +SF+VFLAP+PTF  I ++KS+EGF  LPY VALFS MI LYYA +K   L L
Sbjct  14   FGLLGNFVSFVVFLAPIPTFSRICRKKSTEGFQSLPYVVALFSAMIWLYYASLKSDALLL  73

Query  685  ITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRVK  506
            ITIN +G F+E IY+ LY  YA K+ RI     +++ N G    +++L++F  +G+ RVK
Sbjct  74   ITINSVGCFIEIIYIALYVAYAPKQARIATLRILILLNFGGFCAVLLLSHFFVKGSNRVK  133

Query  505  IVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYI  326
            ++GW+  + SV VFAAPLSIM  VIRT+SVE+MPF LS FLTL A++WL YG+ ++DFYI
Sbjct  134  VLGWVCVIFSVSVFAAPLSIMRIVIRTRSVEFMPFTLSFFLTLSAIMWLFYGVLLKDFYI  193

Query  325  ATPNVLGFACGIVQLILYAIYRDRKTAAVVAP------NGGIQGVAIVVDATAAEMLQKG  164
            A PN+LGF  G++Q++LY IY++ KTA  + P      N   +  +I  +   A   Q  
Sbjct  194  AIPNILGFIFGVLQMVLYVIYKNSKTAVPMEPTLPQNSNDIAKLSSISCEMKPAVCPQSN  253

Query  163  TDDEIHETT--PSS  128
             +D+  E +  PS+
Sbjct  254  EEDDHTENSKDPSN  267



>emb|CAN71371.1| hypothetical protein VITISV_023352 [Vitis vinifera]
Length=273

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H L  +FGILGN+ISFMV+LAPLPTF+ IYKRKS+EGF  +PY VALFS M+ +YYA + 
Sbjct  8    HPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLWIYYAFLN  67

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
                 LITIN +G  +ET Y+V++ VYA K+ RI     V + NI   G I++LT  L+E
Sbjct  68   TDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILLLTLLLAE  127

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G  RV+I+GW+  V S+ VF APL IM +VIRTKSVEYMPF LS FLTL AV+W  YGL 
Sbjct  128  GANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLM  187

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
            ++DFYIA PN+LGF  GIVQ++LY IYR+RK
Sbjct  188  LKDFYIAGPNILGFVFGIVQMVLYLIYRNRK  218



>gb|KHN23963.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=258

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 172/252 (68%), Gaps = 1/252 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            +N    A +FG+LGN+ISFMVFLAPLPTF+ IYK+KS++GF  LPY VALFS M+ +YYA
Sbjct  3    INHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSTDGFQSLPYIVALFSSMLWIYYA  62

Query  712  LVKQHV-LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            LVK+   L LITIN  G  +ETIYL ++ +YA  + R+     +L+ N+   G +++ T 
Sbjct  63   LVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +L+ G+KR+ ++GWI  V+++ VFAAPL IM +VI+TKSVE+MPF+LS FLT+ AV+W  
Sbjct  123  YLTTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YGL ++D+YIA PN LGF  GI+Q++LY IYR+ K   +  P    +    ++D      
Sbjct  183  YGLLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEEPTKVQELNGHIIDVVKPNH  242

Query  175  LQKGTDDEIHET  140
            + K     + ET
Sbjct  243  VTKNGPVPVIET  254



>ref|XP_003531061.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=274

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -2

Query  892  MNSH-QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            +NSH  LA  FG+LGN+ISFMV+LAPLPTF+ IYK+KS+EGF  LPY VALFS M+ LYY
Sbjct  3    LNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYY  62

Query  715  ALVKQ-HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            A +K      LITIN +G  +E +Y+V++ +YA K  R L     +V N+G   LI ++T
Sbjct  63   ASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFLVT  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            YF   G+ RV++VGW+   I+V VFAAPLSI+ +VIRTK+VE+MPFNLSLFLTL AV+W 
Sbjct  123  YFAIHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTLSAVMWF  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT  248
             YGL ++D  IA PN+LGF  G++Q++LYAIYR+ KT
Sbjct  183  FYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKT  219



>gb|KHN39181.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=274

 Score =   244 bits (622),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -2

Query  892  MNSH-QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            +NSH  LA  FG+LGN+ISFMV+LAPLPTF+ IYK+KS+EGF  LPY VALFS M+ LYY
Sbjct  3    LNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYY  62

Query  715  ALVKQ-HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            A +K      LITIN +G  +E +Y+V++ +YA K  R L     +V N+G   LI ++T
Sbjct  63   ASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFLVT  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            YF   G+ RV++VGW+   I+V VFAAPLSI+ +VIRTK VE+MPFNLSLFLTL AV+W 
Sbjct  123  YFAIHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKDVEFMPFNLSLFLTLSAVMWF  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT  248
             YGL ++D  IA PN+LGF  G++Q++LYAIYR+ KT
Sbjct  183  FYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKT  219



>ref|XP_009393865.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   244 bits (622),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 156/216 (72%), Gaps = 0/216 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FGILGNIISFMV+LAPLPTF+ + +RKS+EGFH +PY VALFS  + ++YA +
Sbjct  7    DHPWAFTFGILGNIISFMVYLAPLPTFYRVCRRKSTEGFHSVPYVVALFSATLWIFYAFL  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   LITIN +G  +ET Y+V+YF YA K  ++  A  VL+ N+G+ GLI+VLT   +
Sbjct  67   KTNAGLLITINAVGCVIETAYVVVYFTYAPKAAKMFTAKLVLLVNVGMFGLILVLTLLFA  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G KRV+++GWI    SV VF APLSI+  VIRTKSVE+MPF+LS FLT  AVVW  YGL
Sbjct  127  RGAKRVEVLGWICMSFSVSVFVAPLSIIRLVIRTKSVEFMPFSLSFFLTWSAVVWFGYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
              +D Y+A PNVLGF  G++Q++LY  YR++  A V
Sbjct  187  LTKDLYVALPNVLGFIFGVLQMVLYVAYRNKDKAMV  222



>ref|XP_006347635.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=286

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 128/280 (46%), Positives = 184/280 (66%), Gaps = 10/280 (4%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S   A VFG+LGNIISF+VFL+P+PTF+ IYK+KS+EG+  +PY +ALFSCM+ +YYA +
Sbjct  4    SGHWAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYYAFL  63

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   LITIN  G+ +ETIY+ L+  YA K+ R+     +L+  +G  G I+V+T F+ 
Sbjct  64   KTNTTLLITINSFGMLIETIYVGLFLYYAPKKARVNTVKMLLLTVVGGFGAIIVVTQFVF  123

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R +IVGWI  + S+CVF APL I+ +VI+TKSVEYMP  LS+FLT+ AV+W  YGL
Sbjct  124  KGVVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWFFYGL  183

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQK  167
             ++D  IA PN+LGF  GI+Q+ILYA+YR +    +V  N  +Q   I++D         
Sbjct  184  LLKDVNIAAPNILGFIFGILQMILYAMYRKKDNKPIVNVNVEVQNPVIILD---------  234

Query  166  GTDDEIHETTPSSVVVDMKKVVEMQQGKVV*ATSLRYNLA  47
              + +I E T   ++  +K    +  GK+  A++L  N A
Sbjct  235  -DNKKIPELTEEQIIDIVKLGKLVCSGKIQMASTLNQNAA  273



>ref|XP_007030240.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
 gb|EOY10742.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
Length=301

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 182/267 (68%), Gaps = 3/267 (1%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            HQLA +FG+LGNI+SF+VFLAP+PTF+ I K+K++EG+H +PY VAL S M+ LYY ++K
Sbjct  8    HQLAFIFGLLGNIVSFLVFLAPVPTFYQICKKKTAEGYHSIPYMVALSSAMMLLYYGILK  67

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
             + + +I+IN IG  +E +YLVLY +YA KR ++     +L+FN+G  GLI++LT  L+E
Sbjct  68   TNAVLIISINVIGCAIEIVYLVLYIIYAPKREKVSTMKFILLFNMGGYGLIILLTNLLTE  127

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G+KRV ++GWI +V +V VFA+PLSIM  V+RTKSVE+MPF+LSLFLTLCA +W  YGL 
Sbjct  128  GSKRVTVMGWICAVYNVAVFASPLSIMRHVVRTKSVEHMPFSLSLFLTLCATMWFFYGLF  187

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGI---QGVAIVVDATAAEML  173
            + DF+IA PNVLGF  GI Q+ILY  Y++      +     I   QG    V+   A+  
Sbjct  188  MMDFFIALPNVLGFLFGIAQMILYVTYKNANKDVEMQKEVDIELKQGSLEDVNPCKADQQ  247

Query  172  QKGTDDEIHETTPSSVVVDMKKVVEMQ  92
            QK  + +I+ T        M  V   Q
Sbjct  248  QKMKEIKINVTEKPVESDKMNNVWSRQ  274



>gb|KEH21559.1| bidirectional sugar transporter [Medicago truncatula]
Length=253

 Score =   243 bits (619),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/261 (49%), Positives = 178/261 (68%), Gaps = 15/261 (6%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            + H++  +FG+LGNI+SFMVFLAPLPTF++IYK+KSSEG+  +PY VAL S ++ LYY  
Sbjct  5    SDHEMVLIFGLLGNIVSFMVFLAPLPTFYSIYKKKSSEGYQSIPYVVALLSALLLLYYGF  64

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K + + +ITIN IG  +E  YL++Y +YA K+ +I   V +LV ++G  GL +++T+F+
Sbjct  65   LKTNAILIITINCIGCVIEVAYLIMYIIYAPKKLKISTLVFILVADLGGFGLTMIITFFV  124

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             + + RV  VG I ++ ++ VFAAPLSIM KVIRT+SVEYMPF+LSLFLTLCA +W  YG
Sbjct  125  VKSSFRVHAVGLICAIFNIAVFAAPLSIMRKVIRTRSVEYMPFSLSLFLTLCATMWFFYG  184

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L  +D YI  PNVLGF  G+ Q+ILY IY++ K                 V+  + E  +
Sbjct  185  LFDKDNYIMLPNVLGFLFGVSQMILYLIYKNAKNK---------------VETNSTEEQE  229

Query  169  KGTDDEIHETTPSSVVVDMKK  107
             G DD   +  PS VVV+MK+
Sbjct  230  HGCDDGNKQDFPSVVVVEMKE  250



>ref|XP_006479044.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Citrus 
sinensis]
 gb|KDO45545.1| hypothetical protein CISIN_1g042377mg [Citrus sinensis]
Length=255

 Score =   243 bits (620),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 172/262 (66%), Gaps = 11/262 (4%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            ++  HQLA +FG+LGNI+SF+VFLAP+PTF  IYK+KSSEG+H +PY +AL S  + LYY
Sbjct  3    ILTPHQLAFIFGLLGNIVSFLVFLAPVPTFLIIYKKKSSEGYHSIPYVIALSSATLLLYY  62

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             L+K + + +ITIN IG  +E IYL+LY +YA ++ +      +LVFN+G   L++V+  
Sbjct  63   GLLKSNAVLIITINSIGCVIEVIYLMLYLIYAPQKQKSFTIKLILVFNVGAFALMMVIVN  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            F  +G  RV  VG + +V +V VF+APLSIM +VI+TKSVEYMPF+LS FLTLCA +W  
Sbjct  123  FFVKGPNRVTAVGCVCAVYNVAVFSAPLSIMRRVIKTKSVEYMPFSLSFFLTLCATMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YGL ++D  IA PNVLGF  GI Q+ILY +Y+ +K       N   Q           EM
Sbjct  183  YGLFVKDMVIALPNVLGFLFGIAQMILYLVYKGKKG------NESNQK-----QQECTEM  231

Query  175  LQKGTDDEIHETTPSSVVVDMK  110
                T+D+   T  ++   D++
Sbjct  232  KMNLTEDDKAYTKDNNQPTDLQ  253



>ref|XP_010027132.1| PREDICTED: bidirectional sugar transporter NEC1-like [Eucalyptus 
grandis]
Length=268

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 175/265 (66%), Gaps = 6/265 (2%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            N  +LA +FG+LGNI+SF+VFLAP+PTF+ I+K+KSS+G+  +PY VAL S  + LYY +
Sbjct  5    NEKELAFIFGLLGNIVSFLVFLAPIPTFYAIFKKKSSDGYQSIPYVVALSSASLLLYYGV  64

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K +   +I+IN IGI +E  YL+L+ +YA  + ++ +A  +LVFN+G  G+++ LT FL
Sbjct  65   LKTNATMIISINAIGIVIELTYLILFLIYASTKEKMYVAKLMLVFNVGGFGVMMALTIFL  124

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G +RV  VGWI +  ++ VFAAPLSIM +VI+TKSVE+MPF LS FLTLCA  W  YG
Sbjct  125  LKGPQRVDAVGWICAAFNLAVFAAPLSIMRRVIKTKSVEFMPFTLSFFLTLCATAWFFYG  184

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYR-DRKTAAVVAPNGGIQGVAIVVDATAAEML  173
            L ++D +IA PN LGF  GI Q+ILY IY+   K  A        Q V++ ++  A+   
Sbjct  185  LFVKDMFIALPNTLGFLFGIAQMILYMIYKYGNKKLAETDKGSNQQEVSLDMEKMASI--  242

Query  172  QKGTDDEIHETTPSSVVVDMKKVVE  98
               +  + H T+     V   K VE
Sbjct  243  ---SSAQQHPTSQHQPQVTAGKPVE  264



>ref|XP_008234052.1| PREDICTED: bidirectional sugar transporter NEC1-like [Prunus 
mume]
Length=213

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 154/213 (72%), Gaps = 0/213 (0%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M ++ QLA +FG++GNI+S MVFLAP+PTF+ IYK KSSEGF   PY VAL S M+ L+Y
Sbjct  1    MKSNEQLAFIFGLIGNIVSVMVFLAPIPTFYKIYKNKSSEGFQSTPYVVALLSAMLLLFY  60

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             ++K +   +I+IN IG  +E  YL+ YFVYA K+ +I   + +LV N+ V GL+V +T+
Sbjct  61   GVLKTNAALIISINVIGCVIEITYLIFYFVYASKKDKITTMIQILVLNVAVFGLVVAVTF  120

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
             L   +KRV  VGWI +V  V VFAAPL IM  VI+TKSVEYMPF LS  LT+CA +W L
Sbjct  121  LLVGEDKRVSTVGWICAVFGVAVFAAPLLIMRIVIQTKSVEYMPFYLSFSLTICATLWFL  180

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
            YGL ++D+YIA PNVLGF  GI Q+ILY  Y+D
Sbjct  181  YGLFVKDYYIAFPNVLGFLLGIAQMILYFKYKD  213



>emb|CDX77928.1| BnaC03g52910D [Brassica napus]
Length=285

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 184/274 (67%), Gaps = 8/274 (3%)
 Frame = -2

Query  895  MMNSHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG++GN+ISF VFL+P+PTF+ ++K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  YA K+ R+L    +L+ N G   LI++L 
Sbjct  63   YATQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+ KVI+T+SVEYMPF+LSL LT+ AVVWL
Sbjct  123  QFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRKVIKTRSVEYMPFSLSLTLTISAVVWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGV-AIVVDATAA  182
            LYGL ++D Y+A PNVLGFA G +Q+ILY +Y+  KT     P+ G + V A  +   + 
Sbjct  183  LYGLALKDIYVAFPNVLGFALGALQMILYVVYKYCKT----PPHLGEKEVEAAKLPEVSL  238

Query  181  EMLQKGT--DDEIHETTPSSVVVDMKKVVEMQQG  86
            ++L+ GT    E+ +    +   D +  VE  Q 
Sbjct  239  DILKLGTVSSPEVRQANKCTCGNDRRPEVEDGQN  272



>ref|XP_009121791.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
SWEET15 [Brassica rapa]
Length=298

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 154/214 (72%), Gaps = 1/214 (0%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA VFGILGN ISF+VFLAP+PTF+ IYK+KS+E F  LPY V+LFSCMI LYY
Sbjct  4    MINHHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMIXLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL KQH   LITIN  G  VETIY+ ++F YA K  RI      L  N+    LI+++T+
Sbjct  64   ALTKQHAFLLITINSFGCVVETIYIAMFFTYATKDKRIAAMKLFLTINVAFFSLILMVTH  123

Query  535  F-LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F +   + +V ++GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FAVKRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
             YGL + D  IA PNV+GF  G+VQ++LY IYR+
Sbjct  184  AYGLFLHDICIAIPNVVGFILGMVQMLLYGIYRN  217



>ref|XP_009783143.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
sylvestris]
Length=263

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            +++  +LA +FG+LGNI+SFMVFLAP+PTF+ IYK+ SSEGF  +PY VALFS  + LYY
Sbjct  3    LLSVQELAFLFGLLGNIVSFMVFLAPVPTFYKIYKKGSSEGFQAIPYVVALFSAGLLLYY  62

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            A + ++ + ++TIN  G  +E IY++L+  YA K+ + +  V +++ ++G LG++++ +Y
Sbjct  63   AYLTKNAILIVTINAFGCVIELIYILLFLFYASKKSK-MTTVWLMLLDVGALGIVMLFSY  121

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
              ++G+KRV+IVGWI + +++ VFAAPLSIM +VI+TKSVE+MPF LSLFLTLCA +W  
Sbjct  122  LFAKGSKRVEIVGWICATVNIAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWFF  181

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYR  260
            YG   +D+YIA PNVLGF  GIVQ+ILY +Y+
Sbjct  182  YGYFKKDYYIALPNVLGFLLGIVQMILYIVYK  213



>ref|XP_004161952.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=294

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/270 (48%), Positives = 175/270 (65%), Gaps = 15/270 (6%)
 Frame = -2

Query  889  NSHQLAG-VFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            N+H  A   FG+LGNIISF+VFLAP+PTF  IYK+KS+EGF  +PY VALFS M+ LYYA
Sbjct  6    NTHNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
                +   LITIN +G  +ETIYL ++ V+A K+ R+     VL+ N G   +I+++T+F
Sbjct  66   SFNPNETLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHF  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L  G+ RVK+VGWI    S+ VFAAPL+I+  VIRTKSVE+MPF LS FLTL A  WLLY
Sbjct  126  LVHGSNRVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA-PNGGIQGVAIVVDATAAEM  176
            G+ ++D YIA PN+ GF  GI Q+ILY IY+ R+TA  +  P        IV  AT ++ 
Sbjct  186  GVFLKDIYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQHSTDNTVIVSAATNSDK  245

Query  175  LQKGT-------------DDEIHETTPSSV  125
             ++ +             DD++  TT + +
Sbjct  246  QKQHSSSLPSNNLVGAAVDDDVTTTTKNGI  275



>ref|NP_001239695.1| uncharacterized protein LOC100777741 [Glycine max]
 gb|ACU24541.1| unknown [Glycine max]
 gb|KHN03191.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=268

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 175/262 (67%), Gaps = 5/262 (2%)
 Frame = -2

Query  886  SHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            SH  LA  FG+LGN+ISF+VFLAP+ TF+ I+K+KS+EGF  LPY VALFS M+ LYYAL
Sbjct  4    SHSTLAFAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLYYAL  63

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K+  + L+TIN  G  +E IY++LY  YA +  R L        N+G   LI+++T+F 
Sbjct  64   LKKDAMLLLTINSFGCVIEVIYIILYITYATRDARNLTLKLFFAMNVGAFALILLVTHFA  123

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
              G+ RV+++GWI   +S+ VFAAPLSI+ +V+RTKSVE+MPFNLS  LTL A++W  YG
Sbjct  124  VHGSLRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYG  183

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYR--DRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            L ++D  IA PNVLGFA G++Q++LYAIYR  ++K   ++     ++ +  VV  T  E 
Sbjct  184  LFLKDICIALPNVLGFALGLLQMLLYAIYRNGNKKVDKIMEKKAPLEPLKTVVIETGLEE  243

Query  175  LQKG--TDDEIHETTPSSVVVD  116
             Q+G  + +   E   S    D
Sbjct  244  KQQGKKSKENSEEKEKSDEPND  265



>ref|XP_009601079.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Nicotiana 
tomentosiformis]
Length=272

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 168/263 (64%), Gaps = 19/263 (7%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M +H L   FGILGNI SFMVF++P+PTF+ I K+KS+EGF  +PY VALFS M+ +YYA
Sbjct  1    MANHPLIFAFGILGNIFSFMVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYA  60

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            +VK +   +ITIN  G   ETIY+ +YF YA K  R+     VL+ N G  GLI+ LT  
Sbjct  61   MVKTNETLIITINSFGCIAETIYVAIYFAYATKNARMQTLRLVLLLNFGGFGLILFLTQI  120

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L +G KR ++VGWI    S+ VF APLSIM +VIRTKSVE+MPFNLSL LTL AV+W LY
Sbjct  121  LCKGPKRAEVVGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLY  180

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEML  173
            GL +RD Y+  PN+ G   G++Q++LY IYR+ K      PN              AE  
Sbjct  181  GLLLRDIYVTVPNIAGIILGMLQMVLYGIYRNAK------PN-------------EAEEK  221

Query  172  QKGTDDEIHETTPSSVVVDMKKV  104
            +  T  ++ E  P++V  ++  V
Sbjct  222  KLPTVVKLEEQQPTTVNSEVNPV  244



>ref|XP_002443167.1| hypothetical protein SORBIDRAFT_08g013840 [Sorghum bicolor]
 gb|EES17005.1| hypothetical protein SORBIDRAFT_08g013840 [Sorghum bicolor]
Length=302

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 185/278 (67%), Gaps = 10/278 (4%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISF+ FLAP+PTF+ IYK KS+EGF  +PY VALFS M+ ++YAL+
Sbjct  7    QHPWAFAFGLLGNLISFLTFLAPIPTFYRIYKTKSTEGFQSVPYVVALFSAMLWIFYALI  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +  FLITIN  G  +ETIY+V+YFVYA K+ ++  A  +L+ N+GV G+I+++T  L 
Sbjct  67   KSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILLVTLLLF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G+KRV ++GWI    SV VF APLSIM +VI+TKS+EYMPF+LSL LTL AVVW LYGL
Sbjct  127  KGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSMEYMPFSLSLSLTLSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA--------PNGGIQGVAIVVDA  191
             I+D Y+A PN+LGF  G+VQ++LY +Y ++   AV          P+ G + V + +  
Sbjct  187  LIKDKYVALPNILGFTFGMVQMVLYVLYMNKTPVAVAEGKDAGGKLPSAGDKHVLVNIAK  246

Query  190  TAAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV  77
             +  + ++ +   +H  T  S V       E    KV+
Sbjct  247  LSPALPERSSG--VHRATQMSAVPAKSCAAEATAPKVM  282



>ref|XP_004153501.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64433.1| hypothetical protein Csa_1G051710 [Cucumis sativus]
Length=295

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 168/247 (68%), Gaps = 2/247 (1%)
 Frame = -2

Query  889  NSHQLAG-VFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            N+H  A   FG+LGNIISF+VFLAP+PTF  IYK+KS+EGF  +PY VALFS M+ LYYA
Sbjct  6    NTHNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
                +   LITIN +G  +ETIYL ++ V+A K+ R+     VL+ N G   +I+++T+F
Sbjct  66   SFNPNETLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHF  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L  G+ RVK+VGWI    S+ VFAAPL+I+  VIRTKSVE+MPF LS FLTL A  WLLY
Sbjct  126  LVHGSNRVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA-PNGGIQGVAIVVDATAAEM  176
            G+ ++D YIA PN+ GF  GI Q+ILY IY+ R+TA  +  P      + IV  AT ++ 
Sbjct  186  GVFLKDIYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQHSTDNIVIVSAATNSDK  245

Query  175  LQKGTDD  155
             ++ +  
Sbjct  246  QKQHSSS  252



>ref|XP_010556111.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Tarenaya 
hassleriana]
Length=307

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 156/218 (72%), Gaps = 1/218 (0%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA  FGILGN ISF+VFLAP+PTF+ IYK+KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MINQHLLAVTFGILGNAISFLVFLAPVPTFYRIYKKKSTESFRSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+KQ+   LITIN  G  VET Y+ ++  YA K  RI      +  N+    LI+++T+
Sbjct  64   ALLKQNAFLLITINSFGCVVETFYIAMFIAYAAKDKRISAMKLFMAMNVTFFSLILIVTH  123

Query  535  FL-SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            FL    + ++ I+GWI   ISV VFAAPLS++ +VIRTKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FLVKNSSHQIVILGWICVAISVSVFAAPLSVVARVIRTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTA  245
             YGL + D  IA PNVLGFA G+VQ+ILY IYR+ + +
Sbjct  184  AYGLFLHDICIAIPNVLGFALGMVQMILYGIYRNSEKS  221



>sp|A2X5B4.1|SWT15_ORYSI RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Indica Group]
 gb|EAY86024.1| hypothetical protein OsI_07385 [Oryza sativa Indica Group]
Length=319

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A  FGILGN+IS MVFL+PLPTF+ +Y++KS+EGF   PY V LFSCM+ +YYA
Sbjct  6    MERSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             VK     L+TING+G  +ET+YL +Y  YA K  R+L A  +L  NIG+ G+I ++T  
Sbjct  66   FVKSGAELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVTLL  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            LS G  RV ++GWI   +S+ VFAAPLSI+  VIRTKSVE+MPF+LS FL L AV+W LY
Sbjct  126  LSRGELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFLY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
            GL  +D ++A PNVLGF  G+ Q+ LY  YR +K
Sbjct  186  GLLKKDVFVALPNVLGFVFGVAQMALYMAYRSKK  219



>ref|NP_001046944.1| Os02g0513100 [Oryza sativa Japonica Group]
 sp|Q6K602.1|SWT15_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Japonica Group]
 dbj|BAD23245.1| putative nodulin 3 [Oryza sativa Japonica Group]
 dbj|BAF08858.1| Os02g0513100 [Oryza sativa Japonica Group]
 dbj|BAG95984.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57067.1| hypothetical protein OsJ_06889 [Oryza sativa Japonica Group]
Length=319

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A  FGILGN+IS MVFL+PLPTF+ +Y++KS+EGF   PY V LFSCM+ +YYA
Sbjct  6    MERSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             VK     L+TING+G  +ET+YL +Y  YA K  R+L A  +L  NIG+ G+I ++T  
Sbjct  66   FVKSGAELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVTLL  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            LS G  RV ++GWI   +S+ VFAAPLSI+  VIRTKSVE+MPF+LS FL L AV+W LY
Sbjct  126  LSRGELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFLY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
            GL  +D ++A PNVLGF  G+ Q+ LY  YR +K
Sbjct  186  GLLKKDVFVALPNVLGFVFGVAQMALYMAYRSKK  219



>gb|KFK27668.1| hypothetical protein AALP_AA8G413300 [Arabis alpina]
Length=288

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 133/279 (48%), Positives = 182/279 (65%), Gaps = 17/279 (6%)
 Frame = -2

Query  889  NSHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            N+H   A VFG+LGN+ISF VFL+P+PTF+ I+K+K++EGF  LPY VALFS M+ LYYA
Sbjct  5    NTHNTWAFVFGMLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLWLYYA  64

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
              K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+L    +L+ N G   LI++L  F
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYISIFIAFANKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L++G+ R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LSL LT+ AVVW LY
Sbjct  125  LAKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWFLY  184

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEML  173
            GL +RD Y+A PNVLGF  G +Q+ILY +Y+  KT++ +      +  A  +   + +ML
Sbjct  185  GLALRDIYVAFPNVLGFVLGALQMILYVVYKYCKTSSDLVEQ---ELEAAKLPEVSIDML  241

Query  172  QKGTDDEIHETTPSSVVV----------DMKKVVEMQQG  86
            + GT        P+ + V          D K  +E  QG
Sbjct  242  KLGTH---ASPKPAEITVVRSLNTCLCNDRKAEIENGQG  277



>ref|XP_009347840.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=327

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 155/218 (71%), Gaps = 0/218 (0%)
 Frame = -2

Query  901  SKMMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITL  722
            S   + H LA  FG+LGNI SF+VFLAPLPTF  +YK+KS+EGF  +PY  ALF+  I +
Sbjct  2    SASTSHHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWI  61

Query  721  YYALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVL  542
            YYA +K + + LITIN  G  +ETIY+ +Y  YA K+ R+     + + N G    I++L
Sbjct  62   YYAFLKSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLFLVNFGGFCFILLL  121

Query  541  TYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVW  362
             +FLS+G  RV ++GW+    SV VFAAPLS+M  VI TKSVE+MPFNLS FLTL AV+W
Sbjct  122  AHFLSQGPTRVAVLGWVCVTFSVSVFAAPLSVMKMVIHTKSVEFMPFNLSFFLTLSAVMW  181

Query  361  LLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT  248
            L YGL ++D Y+ATPN++GF+ G+VQ+ LYA YR+ KT
Sbjct  182  LSYGLLLKDLYVATPNIVGFSFGLVQMALYAKYRNNKT  219



>ref|XP_004138979.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
sativus]
Length=274

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 157/216 (73%), Gaps = 0/216 (0%)
 Frame = -2

Query  898  KMMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            K ++ HQL  +FG+LGNIISFMVFLAP+PTF T+YK+K+SEGF  +PY VAL S M+ LY
Sbjct  2    KGLSVHQLQFIFGLLGNIISFMVFLAPVPTFWTVYKKKTSEGFQCIPYVVALMSAMLLLY  61

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA++K +   LI+IN  G  +E IY+ LYF YA K+ +I     +++ N+G  G++V  T
Sbjct  62   YAVLKTNAYLLISINSFGCVIELIYIALYFYYAPKKLKIFTLKLLMILNLGSYGVMVGGT  121

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
              +  GNKR   VGWI +  ++ VFA+PL+IM +VI TKSVEYMPF+LS FLTL A +W 
Sbjct  122  MLILHGNKRTHAVGWICAAFNLAVFASPLAIMKRVITTKSVEYMPFSLSFFLTLSATMWF  181

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
             YG  I+D +IA PN++GF  G+VQ+I+Y IY+DRK
Sbjct  182  FYGFFIKDLFIALPNIVGFLLGMVQMIMYMIYKDRK  217



>ref|XP_009150178.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Brassica 
rapa]
Length=285

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 183/274 (67%), Gaps = 8/274 (3%)
 Frame = -2

Query  895  MMNSHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG++GN+ISF VFL+P+PTF+ ++K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  YA K+ R+L    +L+ N G   LI++L 
Sbjct  63   YATQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AVVWL
Sbjct  123  QFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGV-AIVVDATAA  182
            LYGL ++D Y+A PNVLGFA G +Q+ILY +Y+  KT     P+ G + V A  +   + 
Sbjct  183  LYGLALKDIYVAFPNVLGFALGALQMILYVVYKYCKT----PPHLGEKEVEAAKLPEVSL  238

Query  181  EMLQKGT--DDEIHETTPSSVVVDMKKVVEMQQG  86
            ++L+ GT    E+ +    +   D +  VE  Q 
Sbjct  239  DILKLGTVSSPEVRQANKCTCGNDRRPEVEDGQN  272



>emb|CDX83046.1| BnaA01g20460D [Brassica napus]
Length=286

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/280 (47%), Positives = 184/280 (66%), Gaps = 13/280 (5%)
 Frame = -2

Query  895  MMNSHQL-AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG++GN+ISF VFL+P+PTF+ ++K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+L    +L+ N G   LI++L+
Sbjct  63   YATQKKDVFLLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILLLS  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AVVWL
Sbjct  123  QFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGV-AIVVDATAA  182
            LYGL ++D Y+A PNVLGFA G +Q+ILY +YR  KT     P  G + V A  +   + 
Sbjct  183  LYGLALKDIYVAFPNVLGFALGALQMILYVVYRYCKT----PPQLGEKEVEAAKLPEVSL  238

Query  181  EMLQKGTDDE------IHETTPSSVVVDMKKVVEM-QQGK  83
            +ML+ GT         + +T   +   D +   E  Q GK
Sbjct  239  DMLKLGTVSSPEPIAFVRQTNKCTCGNDQRSETEDGQNGK  278



>ref|XP_002442119.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
 gb|EES15957.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
Length=302

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 180/263 (68%), Gaps = 10/263 (4%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISF+ FLAP+PTF+ IYK KS+EGF  +PY VALFS M+ ++YAL+
Sbjct  7    QHPWAFAFGLLGNVISFLTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYALI  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +  FLITIN  G  +ETIY+V+YFVYA K+ ++  A  +L+ N+GV G+I+++T  L 
Sbjct  67   KSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILLVTLLLF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G+KRV ++GWI    SV VF APLSIM +VI+TKSVEYMPF+LSL LTL AVVW LYGL
Sbjct  127  KGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDR--------KTAAVVAPNGGIQGVAIVVDA  191
             I+D Y+A PN+LGF  G+VQ++LY +Y ++        K A V  P+   + V + +  
Sbjct  187  LIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAVAEGKDAGVKLPSAADEHVLVNITK  246

Query  190  TAAEMLQKGTDDEIHETTPSSVV  122
             +  +  + +   +H  T  + V
Sbjct  247  LSPALPDRSSG--VHRATQMAAV  267



>ref|XP_010674202.1| PREDICTED: bidirectional sugar transporter NEC1-like [Beta vulgaris 
subsp. vulgaris]
Length=262

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/264 (47%), Positives = 174/264 (66%), Gaps = 10/264 (4%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
              LA +FGILGNI+S  VFL+P+PTF+ IYKRKSSEG+  LPY+V LFS M+ LYY  +K
Sbjct  7    QTLAAIFGILGNIVSVGVFLSPVPTFYRIYKRKSSEGYKSLPYAVGLFSAMMLLYYGSLK  66

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
               + LITIN  G F+E IYLV++ VYA K  +      +L+FN+G   L+++LT  L +
Sbjct  67   PGGILLITINSFGCFIEVIYLVIFLVYAPKESKYFTLKLILLFNLGACSLVMLLTTLLCK  126

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G+KR+ +VGWI +VI++CVFAAP+SIM +VI+T+SVE+MP +LSL LTL A +W  YG  
Sbjct  127  GSKRITVVGWINAVINLCVFAAPMSIMRQVIKTRSVEFMPISLSLALTLNACMWFFYGFF  186

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKG  164
            ++D++IA PN+LGF  GIVQ+ LY  Y+   +      N          D T+ E     
Sbjct  187  LKDYFIAGPNILGFLLGIVQMTLYIFYKWCNSKIGQDSNH---------DETSKESNHDD  237

Query  163  TDDEIHETTPSSVVVDMKKVVEMQ  92
            T  ++   +  +V+ D ++ VE+Q
Sbjct  238  TSQDLKLQSVDNVIKDNQQ-VELQ  260



>ref|XP_008441812.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
melo]
Length=262

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 152/214 (71%), Gaps = 0/214 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            +++HQL  +FG+LGNIISF+VFLAP+PTF TIYK+K+SEGF  +PY VAL S M+ LYYA
Sbjct  4    LSAHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLLYYA  63

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             +K     LI+IN  G  +E IY+ LY  YA K+ +I      ++FN+G  G++V  T  
Sbjct  64   ALKTDAYLLISINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGCSGVMVGGTMV  123

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
               G KR   VGWI +  ++ VFA+PLSIM +VIRTKSVEYMPF LS FLTL A +W  Y
Sbjct  124  FLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVIRTKSVEYMPFFLSFFLTLSATMWFFY  183

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
            G  I+D +IA PNV+GF  G+VQ+I+Y IY+DRK
Sbjct  184  GFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDRK  217



>ref|NP_001131289.1| mtN3-like protein [Zea mays]
 gb|ACF79630.1| unknown [Zea mays]
 gb|ACG31892.1| mtN3-like protein [Zea mays]
 gb|AFW60846.1| mtN3-like protein [Zea mays]
Length=293

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 161/209 (77%), Gaps = 0/209 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H +A  FG+LGNIISFM +LAPLPTF+ IYK KS+EGF  +PY VALFS M+ +YYAL+K
Sbjct  8    HPMAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTEGFQSVPYVVALFSAMLWIYYALLK  67

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
             + L LITIN  G  +ET+Y+ +Y +YA K+ ++  A  +L+ N+GV GLI++LT  LS 
Sbjct  68   SNELLLITINSAGCVIETLYIAMYLLYAPKKAKLFTAKILLLLNVGVFGLILLLTLLLSA  127

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G +RV ++GW+    SV VF APLSI+ +V+RT+SVE+MPF+LSL LT+ AVVW LYGL 
Sbjct  128  GQRRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVVWFLYGLL  187

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRD  257
            I+D Y+A PNV+GF+ G+VQ+ LYA+YR+
Sbjct  188  IKDKYVALPNVIGFSFGVVQMGLYALYRN  216



>emb|CDX91144.1| BnaC02g04530D [Brassica napus]
Length=297

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/295 (45%), Positives = 178/295 (60%), Gaps = 21/295 (7%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA +FGILGN ISF+VFLAP+PTF+ IYK KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MVNHHLLAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL KQ    LITIN  G  VETIY+ ++F YA K  ++      L  N+    LI+++T+
Sbjct  64   ALTKQDAFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIKLFLTMNVAFFSLIIMVTH  123

Query  535  F-LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F +   + +V ++GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FAVKSPSLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR-----------------KTAAVVAP  230
             YG  + D  IA PNV+GF  G+VQ++LY +YR+                  KT  V++P
Sbjct  184  AYGAFLHDICIAIPNVVGFILGLVQMVLYGVYRNSGDKLDIGKKKNSSSEQLKTIVVMSP  243

Query  229  NGGIQGVAIVVDATAAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV*ATS  65
             G  +   + V  T   +    T   +H   PS +  + +   E +QG V  A S
Sbjct  244  LGLSEMHPVDVTVTEPVIPLSYT---VHHEDPSKITKEEEPSTEARQGHVETAPS  295



>dbj|BAJ94651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 177/262 (68%), Gaps = 11/262 (4%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISFM +LAPLPTF+ IYK KS++GF  +PY VALFS M+ +YYAL+
Sbjct  7    QHPWAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYALL  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K     LITIN  G  +ETIY+VLY  YA K+ R+  A  +L+ N+GV GLI++LT  L+
Sbjct  67   KSDEYLLITINTAGCVIETIYIVLYLAYAPKQARLFTAKILLLLNVGVFGLILLLTLLLT  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G +RV ++GW+    SVCVF APLS++  V+RT+SVE+MPF+LSL LT  AVVW LYGL
Sbjct  127  AGERRVVMLGWVCVGFSVCVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRD-------RKTAAVVAPNGGIQGVAIVVD--  194
             I+D Y+A PN+LGFA G++Q+ LYA+YR+       ++  A  + +G ++    VV+  
Sbjct  187  LIKDKYVALPNILGFAFGVIQMGLYALYRNATPIPAPKEMDAPESEDGAVKAPEHVVNIA  246

Query  193  --ATAAEMLQKGTDDEIHETTP  134
               TAA  ++  T+  +    P
Sbjct  247  KLGTAAAAIELNTNHPVEPPPP  268



>ref|XP_008464393.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
melo]
Length=296

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 160/212 (75%), Gaps = 0/212 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            ++   LA VFG+LGNIISFMVFLAPLPTF+ IYK+KS+EG+  +PY VALFS M+ +YYA
Sbjct  3    ISPQTLAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIYYA  62

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            L+K +  FLITIN  G  +E++Y++L+ +YA  + R   A  + + N+   GL++ LT  
Sbjct  63   LLKTNATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLALTLV  122

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L++G KR+K++GWI  V ++ VFAAPL IM KVI+TKSVEYMPF LS FLTL AV+W  Y
Sbjct  123  LAKGEKRLKVLGWICLVFNLSVFAAPLLIMGKVIKTKSVEYMPFALSFFLTLNAVMWFFY  182

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
            GL ++D+YIA PNV+GF  GI+Q+ILY I ++
Sbjct  183  GLLLKDYYIALPNVVGFVFGIIQMILYVIVKN  214



>ref|XP_010696414.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Beta 
vulgaris subsp. vulgaris]
Length=335

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 167/253 (66%), Gaps = 14/253 (6%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H+L  +FGILGNI+SF V+LAPLPTF  I+K+KS++GF  +PYSVALFS M+ LYYA +K
Sbjct  9    HELTVIFGILGNIVSFGVYLAPLPTFWRIFKKKSTQGFQSIPYSVALFSAMLLLYYAFIK  68

Query  703  Q-HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF--  533
            + +   +ITIN IG  +E  YL++Y +YA K+ ++  A  + +FN+G  GLIV+ T    
Sbjct  69   EKNGTMIITINTIGCAIEGSYLIVYLIYAPKKAKVYTAKLLGLFNVGFFGLIVLTTMLFV  128

Query  532  --------LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTL  377
                    LS+G  R  +VGWI  + SVCVFAAPLS +  VIRTKSVE+MPF LSL LTL
Sbjct  129  RGIDQHKMLSKGGMRENVVGWICGIFSVCVFAAPLSAIRMVIRTKSVEFMPFWLSLSLTL  188

Query  376  CAVVWLLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVV  197
            CAV+W  YG  I+DFYIA PN+LGF  GI Q+ILY IY+D         N  I G  ++ 
Sbjct  189  CAVMWFFYGFLIKDFYIALPNILGFGFGIAQMILYIIYKDSTKK---KQNNNINGDLVIK  245

Query  196  DATAAEMLQKGTD  158
            +    ++ +   D
Sbjct  246  ETDIMQLQELAVD  258



>ref|XP_008340254.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
 ref|XP_008353052.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=305

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 176/273 (64%), Gaps = 6/273 (2%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H LA  FGILGN+IS MV+L+P+PTF+ IY++KS+EGFH +PY VALFS M+ LYYALVK
Sbjct  9    HPLAFTFGILGNLISTMVYLSPVPTFYRIYRKKSTEGFHSVPYLVALFSSMLWLYYALVK  68

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
            ++ + LITIN  G FVE IY+V++ VYA K  R L      + N+G+  +I+V+++FL  
Sbjct  69   KNAMMLITINSFGSFVEIIYIVMFXVYAPKEARKLTVKLFGIMNVGLFTMILVVSHFLVG  128

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
               RV I+GWI   IS  VF APLSI+ +VIRT+SVE+MPF LS FLTL AV+W  YG  
Sbjct  129  SAYRVPILGWINVAISTSVFVAPLSIVAQVIRTRSVEFMPFGLSFFLTLSAVIWFAYGYL  188

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGV------AIVVDATAA  182
            ++D  +A PN LGF  G++Q++LY IYR+R+   +      + G        IV+ AT A
Sbjct  189  LKDICVAIPNFLGFVLGLLQMLLYGIYRNREQVIIDDHEKKLPGAIHEDVKNIVIIATLA  248

Query  181  EMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGK  83
                   DD+ +     + V +   V + ++ +
Sbjct  249  ASEVHPVDDQPNNRNNDTDVNNNAAVRDAKEXE  281



>ref|XP_002264875.1| PREDICTED: bidirectional sugar transporter N3 [Vitis vinifera]
 emb|CBI38167.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 152/213 (71%), Gaps = 0/213 (0%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M N H L  +FGILGNIISF+V+ AP PTF+ IYKRKS+EGFH LPY VALFS M+ LYY
Sbjct  5    MANHHTLGLIFGILGNIISFLVYFAPAPTFYRIYKRKSAEGFHSLPYIVALFSAMLWLYY  64

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K+    LITIN  G  +E+ Y++LYF YA  + +      V+  N+GV  ++VVL  
Sbjct  65   ALLKKDAFLLITINSFGCAIESFYILLYFFYAPMQAKKQTLKVVISLNVGVFSILVVLIQ  124

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            FL +G+ R+ + GWI +  SV VFAAPLSI+ KVIRTKSVE+MPF+LS FLTL A++W  
Sbjct  125  FLLKGSNRINVFGWICASFSVAVFAAPLSIVAKVIRTKSVEFMPFSLSFFLTLSAIMWFA  184

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
            YGL   D  +A PN+LG   G+VQ++LY  YR+
Sbjct  185  YGLLKNDPCVAIPNILGVILGLVQMVLYGFYRN  217



>ref|XP_009412768.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=284

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 173/263 (66%), Gaps = 4/263 (2%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H L   FG+LGN+ISFMVFLAP+PTF+ +Y++KS+EGFH +PY VALFSCM+ +YYA V
Sbjct  7    QHPLPFAFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSVPYVVALFSCMLWIYYAFV  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K + + LITIN  G+F+ETIY+ +Y +YA K+ RI      ++ ++     IV+LT  + 
Sbjct  67   KTNSMLLITINSFGLFIETIYITIYLIYAPKKARIFCIQIFVLLDVVAFAAIVLLTQLVF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G+ RV ++GWI    S+ VFAAPLS++  VIRTKSVE+MPF LS FLTL A+ W  YGL
Sbjct  127  KGSNRVTVLGWICVGFSISVFAAPLSVIRLVIRTKSVEFMPFFLSFFLTLSAIAWFGYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN--GGIQGVAIVVDATAAEM-  176
              +D Y+  PNVLGF  GI Q++LY IY+ +K   VV P     I  +A ++   A+E+ 
Sbjct  187  FTKDIYVQLPNVLGFVFGIAQMLLYIIYKKKKN-VVVEPTVPEHILKIAELITTPASELQ  245

Query  175  LQKGTDDEIHETTPSSVVVDMKK  107
            +    +D   +    +  VD  K
Sbjct  246  VSIEENDRKKKANEDAEGVDNGK  268



>gb|AGL98401.1| sucrose transporter SWEET9 [Nicotiana attenuata]
Length=272

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 161/212 (76%), Gaps = 1/212 (0%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            +++  +LA +FG+LGNI+SFMVFLAP+PTF+ IYK+ SSEGF  +PY VALFS  + LYY
Sbjct  3    LLSVQELAFLFGLLGNIVSFMVFLAPVPTFYKIYKKGSSEGFQAIPYVVALFSAGLLLYY  62

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            A + ++   ++TIN  G  +E  Y+ L+  YA K+ + +  V +++ ++G LG++++ +Y
Sbjct  63   AYLTKNAFLIVTINAFGCVIELTYIFLFLFYASKKSK-MTTVWLMLLDVGALGIVMLFSY  121

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
              ++G KRV+IVGWI +++++ VFAAPLSIM +VI+TKSVE+MPF LSLFLTLCA +W  
Sbjct  122  LFAKGTKRVEIVGWICAIVNIAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWFF  181

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYR  260
            YG   +D+YIA PNVLGF  GIVQ+ILY +Y+
Sbjct  182  YGYFKKDYYIALPNVLGFLLGIVQMILYIVYK  213



>ref|XP_004145147.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=295

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/247 (51%), Positives = 168/247 (68%), Gaps = 2/247 (1%)
 Frame = -2

Query  889  NSHQLAG-VFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            N+H  A   FG+LGNIISF+VFLAP+PTF  IYK+KS+EGF  +PY VALFS M+ LYYA
Sbjct  6    NTHNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
                +   LITIN +G  +ETIYL ++ V+A K+ R+     VL+ N G   +I+++T+F
Sbjct  66   SFNPNETLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHF  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L  G+ +VK+VGWI    S+ VFAAPL+I+  VIRTKSVE+MPF LS FLTL A  WLLY
Sbjct  126  LVHGSNQVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA-PNGGIQGVAIVVDATAAEM  176
            G+ ++D YIA PN+ GF  GI Q+ILY IY+ R+TA  +  P      + IV  AT ++ 
Sbjct  186  GVFLKDIYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQHSTDNIVIVSAATNSDK  245

Query  175  LQKGTDD  155
             ++ +  
Sbjct  246  QKQHSSS  252



>ref|XP_003615405.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AES98363.1| bidirectional sugar transporter [Medicago truncatula]
Length=269

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 151/215 (70%), Gaps = 3/215 (1%)
 Frame = -2

Query  892  MNSH---QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITL  722
            M+ H   +LA +FGILGNIIS MV+LAPLPTF+ I+K+KS+EGF  LPY VALFS M+ L
Sbjct  1    MDPHDHDRLAFIFGILGNIISSMVYLAPLPTFYRIWKKKSTEGFQSLPYLVALFSSMLWL  60

Query  721  YYALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVL  542
            YY  VK+H   LITIN  G  +ETIY+V Y +YA K  RIL     +  N+    LIV+ 
Sbjct  61   YYGFVKKHAFLLITINSAGCVIETIYIVTYLIYATKDARILTIKLFMAMNVACSVLIVLT  120

Query  541  TYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVW  362
            T     G  RV ++GWI +  ++CVFAAPL+IM KVIRTKSVE+MP NLS FLTL A+VW
Sbjct  121  TQLAMHGKLRVHVLGWICTSFAICVFAAPLTIMAKVIRTKSVEFMPINLSFFLTLSAIVW  180

Query  361  LLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
              YGL + D  IA PNVLGF  G++Q++LYAIY  
Sbjct  181  FFYGLLLHDICIAIPNVLGFILGLLQMLLYAIYNK  215



>ref|XP_010243612.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=270

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 158/211 (75%), Gaps = 0/211 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H LA  FG+LGNI+SFMV+LAP+PTF+ IYK+KS+EGF  +PY VAL S M+ +YYA++K
Sbjct  8    HTLAFAFGLLGNIVSFMVYLAPVPTFYRIYKKKSTEGFQSIPYVVALLSAMLWIYYAMLK  67

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
                 L TINGIG  +E IY+ +Y VYA K  R+     +L+ N+G  GLI++LT+ L+ 
Sbjct  68   NEGAMLETINGIGCSIEAIYITIYLVYAPKEARVFTLKLLLLLNVGAYGLILLLTFLLTN  127

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G+++V +VGWI +  S+ VFA+PLSIM +VIRTKSVE+MPF LS FLTLCAV+W  YGL 
Sbjct  128  GSRQVMVVGWICAGFSISVFASPLSIMRQVIRTKSVEFMPFLLSFFLTLCAVLWFCYGLL  187

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
              D YIA PNVLGFA GI Q+ILY +Y+D K
Sbjct  188  KNDLYIAIPNVLGFAFGITQMILYMVYKDTK  218



>ref|XP_008389921.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=305

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 181/281 (64%), Gaps = 12/281 (4%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H LA  FG+LGN++S MV+LAP+PTF+ IY++KS+EGFH +PY VA+FS M+ LYYA +K
Sbjct  9    HPLAFTFGVLGNLVSTMVYLAPVPTFYRIYRKKSTEGFHSVPYLVAMFSSMLWLYYASLK  68

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
            ++ + LITIN  G F E IY+V++ VYA K  R L      + N+G+  LI+V+++FL  
Sbjct  69   KNAMLLITINSFGSFAEMIYIVIFVVYAPKDARKLTVKLFGIMNVGLFTLILVVSHFLVS  128

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
               RV ++GWI   IS  VFAAPLSI+ +VIRT+SVE+MPF LS FLTL A++W  YGL 
Sbjct  129  RAYRVPVLGWINVAISTSVFAAPLSIVSQVIRTRSVEFMPFRLSFFLTLSAIMWFAYGLF  188

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV--------VAPNGGIQGVAIVVDAT  188
            ++D  +A PNVLGF  G++Q++LYA+YR+RK   +         A    ++ + I+    
Sbjct  189  LKDICVAIPNVLGFVLGLLQMLLYAMYRNRKQVIIEDHEKKLPAATPDHVKNIVIIATLA  248

Query  187  AAEM----LQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV  77
            A+E+     Q    ++  +   ++ V + K+  +    + V
Sbjct  249  ASEVHPADAQPNNRNDDGDVNNNAAVTEAKEHEQTDDHRHV  289



>ref|XP_008677256.1| PREDICTED: LOC100282648 isoform X1 [Zea mays]
 gb|AFW62434.1| MTN3 isoform 1 [Zea mays]
 gb|AFW62435.1| MTN3 isoform 2 [Zea mays]
Length=304

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 153/229 (67%), Gaps = 0/229 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A  FGILGNI+S MVFL+PLPTF+ +Y+ KS+EGF   PY V LFSCM+ + YA
Sbjct  6    MEQQTWAFTFGILGNIVSLMVFLSPLPTFYRVYRNKSTEGFQSTPYVVTLFSCMLWILYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            L+K     L+TING+G  VET+YL +Y VYA K  R+L A  +L  N+ V GL+ ++T  
Sbjct  66   LLKPGAELLVTINGVGCVVETVYLAMYLVYAPKAARVLAAKMLLGLNVAVFGLVALVTML  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            LS+   RV ++GWI   +S+ VFAAPLSIM +VIRTKSVE+MP +LS FL L AVVW  Y
Sbjct  126  LSDAGLRVHVLGWICVSVSLSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAVVWFAY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVA  206
            G   +D ++A PNVLGF  G+ Q+ LY  YR    A V+ P    + VA
Sbjct  186  GALKKDVFVAFPNVLGFVFGLAQMALYMAYRKPAAALVIIPEQSKEEVA  234



>ref|XP_003523161.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31282.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=258

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 172/257 (67%), Gaps = 2/257 (1%)
 Frame = -2

Query  895  MMNSHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            M  SH+  A +FG+LGN+ISFMVFLAPLPTF+ IYK+KSSEGF  LPY VALFS M+ +Y
Sbjct  1    MAISHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIY  60

Query  718  YALVKQHV-LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVL  542
            YALVK+   L LITIN  G  +ETIYL ++ VYA  + R+     +L+ N+   G +++ 
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLS  120

Query  541  TYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVW  362
            T +L+ G+KR+ ++GWI  V ++ VFAAPL IM +VI+T+SVE+MPF+LSL LT+ AV+W
Sbjct  121  TLYLTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSLSLTINAVMW  180

Query  361  LLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAA  182
              YGL ++D+YIA PN LGF  GI+Q++LY +YR+ K   +  P    +    ++D    
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAKPQTLEEPTKVQELNGHIIDVVKP  240

Query  181  EMLQKGTDDEIHETTPS  131
                K     + E   S
Sbjct  241  NHATKNGHVPVIEIASS  257



>ref|XP_007209422.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
 gb|EMJ10621.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
Length=293

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 157/227 (69%), Gaps = 4/227 (2%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M   H L   FG+LGNIISF+VFLAP+PTF+TIYKRK++EGF  LPY +AL S M+ +YY
Sbjct  1    MAIQHPLTLSFGLLGNIISFLVFLAPVPTFYTIYKRKTAEGFQALPYVIALLSSMLYIYY  60

Query  715  ALVKQH----VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIV  548
            AL+K+       FLITIN  G  VET+Y+ L+  YA K+ RI     V + N+   GL++
Sbjct  61   ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNLFGFGLMM  120

Query  547  VLTYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAV  368
            +LT+FL+ G  R+KIVGWI  V S+ VF APL ++ +VIRTKSVE+MPF LS FLTL AV
Sbjct  121  LLTHFLATGEMRLKIVGWICLVFSLSVFVAPLGVLRRVIRTKSVEFMPFPLSFFLTLGAV  180

Query  367  VWLLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN  227
             W  YGL I+D+ IA PN+LGF  GI Q++LY +Y++ K      P 
Sbjct  181  TWFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKKVLEEQPK  227



>gb|AFK47472.1| unknown [Lotus japonicus]
Length=260

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 16/268 (6%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            +  ++  +FG+LGNI+SFMVFLAPLPTF+TIYK+K SEGF  +PY VAL S M+ LYY  
Sbjct  5    SEREMVLIFGLLGNIVSFMVFLAPLPTFYTIYKKKPSEGFQSIPYVVALLSAMLLLYYGF  64

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K + L +ITIN IG  +E  YL++Y +YA K+ +I   + +L+ +IG LGL +++T F+
Sbjct  65   LKTNALLIITINCIGCAIEVSYLMMYIIYAPKKQKISTLLLILMADIGGLGLTMIITMFV  124

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +  +RV  VG I ++ ++ VFAAPLS M KVI+T+SVEYMPF+LSLFLTLCA +W  YG
Sbjct  125  VKSAERVHAVGLICAIFNIAVFAAPLSTMRKVIKTRSVEYMPFSLSLFLTLCATMWFFYG  184

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L  +D YI  PNVLGF  GI Q+ILY IY++ K                 V+  A E  +
Sbjct  185  LFDKDNYIMMPNVLGFLFGISQMILYIIYKNAKKK---------------VEVEATEQQE  229

Query  169  KG-TDDEIHETTPSSVVVDMKKVVEMQQ  89
             G T+     +   +  + +  VVEM++
Sbjct  230  WGNTEKPAQHSNDGNNKLVLPSVVEMKE  257



>ref|XP_011073105.1| PREDICTED: bidirectional sugar transporter NEC1-like [Sesamum 
indicum]
Length=290

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 154/214 (72%), Gaps = 0/214 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S  LA VFG+LGNIISFMVFLAP+PTF+ IYKRKS+EGF  LPY V LFS M+ +YYA +
Sbjct  2    SANLAFVFGLLGNIISFMVFLAPIPTFYQIYKRKSTEGFQSLPYVVGLFSAMLLIYYAFL  61

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
                  LITIN  G F+ET+Y+  Y  YA K  R+  A  +L+ N+  +GLIVVLT+FL+
Sbjct  62   LPDSTLLITINSFGCFIETLYICFYLFYAPKTARLQTATLLLLLNVVGMGLIVVLTHFLA  121

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            + + R  IVGWI  V SV VF APL ++ +VIRTKSVEYMPF LS FLTL AV+W  YGL
Sbjct  122  KDSTRAHIVGWICLVFSVSVFVAPLCVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGL  181

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTA  245
              +D+ IA PN+LGF  G++Q+ LY +Y++ K A
Sbjct  182  LRKDYNIAIPNILGFIFGVLQMALYLVYKNAKKA  215



>ref|XP_004138032.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 ref|XP_004161361.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 gb|KGN63458.1| hypothetical protein Csa_1G001300 [Cucumis sativus]
Length=292

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 163/228 (71%), Gaps = 11/228 (5%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            ++   LA VFG+LGNIISFMVFLAPLPTF+ IYK+KS+EG+  +PY VALFS M+ +YYA
Sbjct  3    ISPQTLAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIYYA  62

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            L+K +  FLITIN  G  +E++Y++L+ +YA  + R   A  + + N+   GL++ LT  
Sbjct  63   LLKTNATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLALTLV  122

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L++G KR+K++GWI  V ++ VFAAPL IM KVI+TKSVEYMPF LS FLTL AV+W  Y
Sbjct  123  LAKGEKRLKVLGWICLVFNLSVFAAPLFIMGKVIKTKSVEYMPFALSFFLTLNAVMWFFY  182

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAI-----------YRDRKTAA  242
            GL ++D+YIA PNV+GF  GI+Q+ILY I            +D K AA
Sbjct  183  GLLLKDYYIALPNVVGFVFGIIQMILYVIVKHIGNKSRIPVKDEKAAA  230



>ref|XP_010678287.1| PREDICTED: bidirectional sugar transporter SWEET12 [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 165/248 (67%), Gaps = 6/248 (2%)
 Frame = -2

Query  868  VFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLF  689
            +FG+LGN ISFMVFL+P+PTF+ IYK+KS+E F  +PY VA FS M+ L YA VK  V+F
Sbjct  15   IFGLLGNTISFMVFLSPIPTFYRIYKKKSTEEFQSIPYVVAFFSAMLWLLYAYVKTDVIF  74

Query  688  LITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNK-R  512
            L+TIN  G+F+ETIYLV++ VYA K  RI     +L+FN+   G+IV  T  +++  + R
Sbjct  75   LVTINCFGLFIETIYLVIFLVYANKEARISAIKQLLLFNVFGFGVIVFFTAVIAKTTRVR  134

Query  511  VKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDF  332
            + I+GW+  V S CVF APL +M KVIRTKSVEYMPF LS FLTL AVVW  YGL  RD 
Sbjct  135  LLILGWVCLVFSFCVFVAPLGVMRKVIRTKSVEYMPFFLSFFLTLSAVVWFFYGLLKRDV  194

Query  331  YIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKGTDDE  152
            Y+A PNVLGF  GIVQ+ILY +YR+ K        G  +       +T    +++    +
Sbjct  195  YVAVPNVLGFTFGIVQMILYMMYRNAKPVEKDIEVGKTKD-----SSTDQIFVEEPVKPQ  249

Query  151  IHETTPSS  128
               TTP++
Sbjct  250  PKNTTPTN  257



>ref|XP_007043874.1| Senescence-associated gene 29 [Theobroma cacao]
 gb|EOX99705.1| Senescence-associated gene 29 [Theobroma cacao]
Length=287

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 165/240 (69%), Gaps = 1/240 (0%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M + H  A  FG+ GNIIS +V+LAP+PTF+ IY++KS+E F  LPY VALFS M+ LYY
Sbjct  4    MGDHHSWAVAFGVFGNIISVLVYLAPVPTFYRIYRKKSTESFQSLPYQVALFSSMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K+    LITIN  G  VET+Y+ +Y  YA K  R+      +  N+G+  LI++LT 
Sbjct  64   ALIKKDAFLLITINSFGCIVETMYISIYIAYASKNSRMSAMKLFVGMNVGLFSLILILTR  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            FL + + R++++GWI   ISV VFAAPL+I+ +VIRT SVE+MPFNLS FLTL A++W  
Sbjct  124  FLVKSSIRIQLLGWICVAISVSVFAAPLNIVARVIRTGSVEFMPFNLSFFLTLSAIMWFA  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTA-AVVAPNGGIQGVAIVVDATAAE  179
            YGL I+D  +A PNVLGF  G++Q++LYA+YR+ K A     P   ++ V ++    A+E
Sbjct  184  YGLFIKDICVALPNVLGFVLGMLQMLLYAVYRNTKKAIEEKKPPEQLKTVVVLSTIGASE  243



>ref|XP_004235339.1| PREDICTED: bidirectional sugar transporter SWEET10 [Solanum lycopersicum]
Length=282

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 183/274 (67%), Gaps = 11/274 (4%)
 Frame = -2

Query  874  AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHV  695
            A VFG+LGNIISF+VFL+P+PTF+ IYK+KS+EG+  +PY +ALFSCM+ +YYA +K + 
Sbjct  8    AFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYYAFLKTNT  67

Query  694  LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNK  515
              LITIN  G+ +ETIY+ L+  YA K+ R+     +L+  +G  G I+++T FL +G  
Sbjct  68   TLLITINSFGMLIETIYVSLFLYYAPKKARVNTVKMLLLTVVGGFGAIILVTQFLFKGVV  127

Query  514  RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRD  335
            R +IVGWI  + S+CVF APL I+ +VI+TKSVEYMP  LS+FLT+ AV+W  YGL ++D
Sbjct  128  RGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWFFYGLLLKD  187

Query  334  FYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKGTDD  155
              IA PN+LGF  GI+Q+ILYA+YR +K   +V  N  +Q   I++D           + 
Sbjct  188  VNIAAPNILGFIFGILQMILYAMYR-KKHKPIVNVNVEVQNPVIILD----------DNK  236

Query  154  EIHETTPSSVVVDMKKVVEMQQGKVV*ATSLRYN  53
            +I E T   ++  +K    +  GK+  A++L  N
Sbjct  237  KIPELTEEQIIDIVKLGKLVCSGKIQMASTLNQN  270



>ref|XP_011020821.1| PREDICTED: bidirectional sugar transporter N3-like [Populus euphratica]
Length=285

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 177/274 (65%), Gaps = 10/274 (4%)
 Frame = -2

Query  880  QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQ  701
             LA  FGILGNIIS MVFLAP+PTF  I+K+KS+E F  LPY +ALFS M+ LYYA++K+
Sbjct  8    HLAFTFGILGNIISTMVFLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWLYYAMLKK  67

Query  700  HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEG  521
              + L+TIN  G  +ET Y+ +Y VYA +  R+     ++  N+G+  LI++L +FL  G
Sbjct  68   DTILLVTINSFGCLIETTYIAIYIVYATRESRVSTIKLLISMNMGLFSLILLLAHFLVSG  127

Query  520  NKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCI  341
            + RVK++GW+   +SVCVFAAPL+I+ +VIRTKSVE+MPF LS FLTL AV+W  YGL +
Sbjct  128  SVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVMWFAYGLLL  187

Query  340  RDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIV-------VDATAA  182
            +D  +A PN+LGF  G++Q++LY IYR+ +          ++ + I+       +    A
Sbjct  188  KDLCVALPNILGFILGLLQMVLYGIYRNAQKVEEKKKLPALKSIVILSAVGGPGIYPVDA  247

Query  181  EMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKV  80
            E    G  +E  +T  S    + +K +E  Q K+
Sbjct  248  EPDVNGGAEEHDQTEESK---EDEKSMEASQDKL  278



>ref|XP_002322282.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
 gb|EEF06409.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
Length=276

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 158/213 (74%), Gaps = 0/213 (0%)
 Frame = -2

Query  865  FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFL  686
            FG+LGN +SF+VFLAP+PTF  I ++K++EGF  LPY VALFS MI LYYA +K  VL L
Sbjct  14   FGLLGNFVSFVVFLAPIPTFLRICRKKTTEGFQSLPYVVALFSAMIWLYYASLKSDVLLL  73

Query  685  ITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRVK  506
            ITIN +G F+E IY+ LY  YA K+ RI     +++FN G    I++L++F  +G+ RVK
Sbjct  74   ITINSVGCFIEMIYIALYVAYAPKQARIATLRILILFNFGGFCSILLLSHFFVKGSNRVK  133

Query  505  IVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYI  326
            ++GW   + SV VFAAPL+IM  VIRTKSVE+MPF LS FLTL A+ WL+YG+ ++D+YI
Sbjct  134  VLGWACVIFSVSVFAAPLNIMRIVIRTKSVEFMPFTLSFFLTLSAITWLVYGVLVKDYYI  193

Query  325  ATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN  227
            A PN++GF  G++Q++LY IY++ KTA  + P 
Sbjct  194  AIPNIVGFIFGVLQMVLYVIYKNFKTAVPMEPK  226



>ref|XP_004962649.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Setaria 
italica]
Length=300

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 162/246 (66%), Gaps = 14/246 (6%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISFM FLAP+PTF+ IYK KS+EGF  +PY VALFS M+ ++YAL+
Sbjct  7    QHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYALI  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K + + LITIN  G  +E+IY++LYFVYA K+ R   A  +L  N+G  G I++ T  + 
Sbjct  67   KSNEVLLITINVAGFVIESIYVILYFVYADKKARWFTAKIMLGLNVGFFGAILLFTLLVF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G+KR+  +GWI    SV VF APLSI+ +VI+T+SVEYMPF+LSL LTL AVVW LYGL
Sbjct  127  HGDKRIVTLGWICVAFSVGVFVAPLSIIKRVIQTRSVEYMPFSLSLTLTLSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQK  167
             I+D Y+A PN+LGF  G+VQ++LY  Y ++                +V D   A  L  
Sbjct  187  LIKDKYVALPNILGFTFGVVQMVLYVFYMNK--------------TPVVADGKEAGKLPT  232

Query  166  GTDDEI  149
              D+ +
Sbjct  233  AADEHV  238



>ref|XP_003524088.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
 gb|KHN22921.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=283

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 160/216 (74%), Gaps = 2/216 (1%)
 Frame = -2

Query  889  NSH-QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            N H  LA  FG+LGN+ISFMV+LAPLPTF+ IYK+KS+EGF  LPY VALFS M+ LYYA
Sbjct  5    NGHNHLALGFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYA  64

Query  712  LVKQ-HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             +K      LITIN +G  +E +Y++++ +YA K  R L     +V N+G   LI ++TY
Sbjct  65   SLKPADATLLITINSLGCVIEIVYIIMFTIYATKDARNLTVKLFMVMNVGSFALIFLVTY  124

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            F   G+ RV++VGW+   I+V VFAAPLSI+ +VIRTK+VE+MPFNLSLFLT+ AV+W  
Sbjct  125  FAMHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTISAVMWFF  184

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT  248
            YGL ++D  IA PN+LGF  G++Q++LYAIYR+ KT
Sbjct  185  YGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKT  220



>gb|KHN03192.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=271

 Score =   238 bits (608),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 171/262 (65%), Gaps = 15/262 (6%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            ++ H LA  FG+LGN+ISF+VFLAP+PTF+ IYK+KS+E F  LPY VALFS M+ LYYA
Sbjct  3    ISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYA  62

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            ++K+  + LITIN  G  +E IY+VLY  YA +  R L        N+    LI+++T+F
Sbjct  63   MLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVTHF  122

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
               G  RV+++GWI   ISV VFAAPLSI+ +V+RTKSVE+MPFNLS  LTL A++W  Y
Sbjct  123  AVHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGY  182

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYR---------DR------KTAAVVAPNGGI  218
            GL ++D  IA PNVLGF  G++Q++LY IYR         D+      K+ AVV P G  
Sbjct  183  GLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNDKSPVEPLKSIAVVNPLGTG  242

Query  217  QGVAIVVDATAAEMLQKGTDDE  152
            +   +  D  AA+  Q   DD+
Sbjct  243  EVFPVEEDEQAAKKSQGDGDDK  264



>ref|NP_001242732.1| uncharacterized protein LOC100810962 [Glycine max]
 gb|ACU20322.1| unknown [Glycine max]
Length=258

 Score =   238 bits (606),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 170/252 (67%), Gaps = 1/252 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            +N    A +FG+LGN+ISFMVFLA LPT + IYK+KS++GF  LPY VALFS M+ +YYA
Sbjct  3    INHETWAFIFGLLGNVISFMVFLASLPTLYQIYKKKSTDGFQSLPYIVALFSSMLWIYYA  62

Query  712  LVKQHV-LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            LVK+   L LITIN  G  +ETIYL ++ +YA  + R+     +L+ N+   G +++ T 
Sbjct  63   LVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +L+ G+KR+ ++GWI  V+++ VFAAPL IM +VI+TKSVE+MPF+LS FLT+ AV+W  
Sbjct  123  YLTTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YGL ++D+YIA PN LGF  GI+Q++LY IYR+ K   +  P    +    ++D      
Sbjct  183  YGLLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEEPTKVQELNGHIIDVVKPNH  242

Query  175  LQKGTDDEIHET  140
            + K     + ET
Sbjct  243  VTKNGPVPVIET  254



>gb|KGN61326.1| hypothetical protein Csa_2G083730 [Cucumis sativus]
Length=262

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 150/211 (71%), Gaps = 0/211 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            HQL  +FG+LGNIISF+VFLAP+PTF TIYK+K+SEGF  +PY VAL S M+ LYYA +K
Sbjct  7    HQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLLYYAALK  66

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
             +   L++IN  G  +E IY+ LY  YA K+ +I      ++FN+G  G++V  T F   
Sbjct  67   TNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGFSGVMVGGTMFFLH  126

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G KR   VGWI +  ++ VFA+PLSIM +VI TKSVEYMPF+LS FLTL A +W  YG  
Sbjct  127  GMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMWFFYGFF  186

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
            I+D +IA PNV+GF  G+VQ+I+Y IY+D K
Sbjct  187  IKDLFIALPNVVGFLLGMVQMIMYMIYKDSK  217



>ref|XP_003551863.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=271

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 171/262 (65%), Gaps = 15/262 (6%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            ++ H LA  FG+LGN+ISF+VFLAP+PTF+ IYK+KS+E F  LPY VALFS M+ LYYA
Sbjct  3    ISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYA  62

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            ++K+  + LITIN  G  +E IY+VLY  YA +  R L        N+    LI+++T+F
Sbjct  63   MLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVTHF  122

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
               G  RV+++GWI   ISV VFAAPLSI+ +V+RTKSVE+MPFNLS  LTL A++W  Y
Sbjct  123  AVHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGY  182

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYR--DRKTA-------------AVVAPNGGI  218
            GL ++D  IA PNVLGF  G++Q++LY IYR  ++KT              AVV P G  
Sbjct  183  GLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNEKSPVEPLKSIAVVNPLGTG  242

Query  217  QGVAIVVDATAAEMLQKGTDDE  152
            +   +  D  AA+  Q   DD+
Sbjct  243  EVFPVEEDEQAAKKSQGDGDDK  264



>emb|CDX68492.1| BnaC01g25700D [Brassica napus]
Length=286

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/280 (47%), Positives = 183/280 (65%), Gaps = 13/280 (5%)
 Frame = -2

Query  895  MMNSHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG++GN+ISF VFL+P+PTF+ ++K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+L    +L+ N G   LI++L 
Sbjct  63   YATQKKDVFLLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AVVWL
Sbjct  123  QFLAKGITRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGV-AIVVDATAA  182
            LYGL ++D Y+A PNVLGFA G +Q+ILY +YR  KT     P  G + V A  +   + 
Sbjct  183  LYGLALKDMYVAFPNVLGFALGALQMILYVVYRYCKT----PPQLGEKEVEAAKLPEVSL  238

Query  181  EMLQKGTDDE------IHETTPSSVVVDMKKVVEM-QQGK  83
            +ML+ GT         + +T   +   D +   E  Q GK
Sbjct  239  DMLKLGTVSSPEPIAVVRQTNKCTCGNDQRSETEDGQNGK  278



>ref|NP_001141106.1| uncharacterized protein LOC100273190 [Zea mays]
 gb|ACF85414.1| unknown [Zea mays]
Length=295

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 169/246 (69%), Gaps = 13/246 (5%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISFM FLAP+PTF+ IYK KS+EGF  +PY VALFS M+ ++YAL+
Sbjct  7    QHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYALI  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +  FLITIN  G  +ET+Y+V+YFVYA K+GR+  A  +L+ N+G  G I++LT  L 
Sbjct  67   KSNETFLITINAAGCVIETVYVVMYFVYATKKGRMFTAKIMLLLNVGAFGAILLLTLLLF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G+KRV ++GWI    SV VF APLSIM +VI+TKSVEYMPF+LSL LTL AVVW LYGL
Sbjct  127  KGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQK  167
             I+D Y+A PN+LGF  G+VQ++LY +Y ++                 V D  AA  L  
Sbjct  187  LIKDKYVALPNILGFTFGVVQMVLYVVYMNKTPLP-------------VADGKAAGKLPS  233

Query  166  GTDDEI  149
              D+ +
Sbjct  234  AADEHV  239



>ref|XP_006647263.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Oryza 
brachyantha]
Length=319

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 172/276 (62%), Gaps = 15/276 (5%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M  +  A  FGILGNIIS MVFL+PLPTF+ +Y++KS+EGF   PY V LFSCM+ +YYA
Sbjct  6    MERNTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             VK     L+TING+G  +ET+YL +Y  YA K  R+L    +L  N+G+ GLI ++T  
Sbjct  66   FVKSGAELLVTINGVGCVIETVYLAMYLAYAAKSTRMLTTRMLLGLNVGLFGLIALVTLL  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L +G  RV ++GW+   +S+ VFAAPLSI+  VIRTKSVE+MPF+LS FL L AV+W  Y
Sbjct  126  LPQGALRVHVLGWVCVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFGY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA-----------PNGGIQGVA  206
            GL  +D ++A PNVLGF  G+ Q+ LY  YR +K  A  +           P    +   
Sbjct  186  GLLKKDVFVALPNVLGFVFGVAQMALYMAYRTKKPPASSSSSAAAGQEIKLPEHVKEVTT  245

Query  205  IVVDATAAEMLQKGT-DDEIH---ETTPSSVVVDMK  110
            IV  A AA    + +   E+H   +  P+  VV++K
Sbjct  246  IVAKAGAAPPEGRASCGAEVHPIDDALPAPTVVEVK  281



>ref|NP_196821.1| senescence-associated protein 29 [Arabidopsis thaliana]
 sp|Q9FY94.1|SWT15_ARATH RecName: Full=Bidirectional sugar transporter SWEET15; Short=AtSWEET15; 
AltName: Full=Senescence-associated protein 29 [Arabidopsis 
thaliana]
 emb|CAC05445.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
 gb|AAK76623.1| putative senescence-associated protein SAG29 [Arabidopsis thaliana]
 gb|AAM44982.1| putative senescence-associated protein SAG29 [Arabidopsis thaliana]
 gb|AED91859.1| senescence-associated protein 29 [Arabidopsis thaliana]
Length=292

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 180/277 (65%), Gaps = 8/277 (3%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA +FGILGN+ISF+VFLAP+PTF+ IYKRKS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MINHHFLAFIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K+    LITIN  G  VET+Y+ ++F YA +  RI      +  N+    LI+++T+
Sbjct  64   ALIKKDAFLLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILMVTH  123

Query  535  FLSEGNK-RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F+ +    +V ++GWI   ISV VFAAPL I+ +VI+TKSVEYMPF LS FLT+ AV+W 
Sbjct  124  FVVKTPPLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYR--DRKTAAVVAPNGGIQGVAIVVDATA  185
             YGL + D  IA PNV+GF  G++Q++LY +YR  + K   + +    ++ + ++     
Sbjct  184  AYGLFLNDICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEQQLKSIVVMSPLGV  243

Query  184  AEMLQKGTD--DEIHETTPSSVVVDMKKVVEMQQGKV  80
            +E+    T+  D + E        D+ KV ++++  +
Sbjct  244  SEVHPVVTESVDPLSEAVHHE---DLSKVTKVEEPSI  277



>gb|EMT22394.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=296

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 181/274 (66%), Gaps = 9/274 (3%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISFM +LAPLPTF+ IYK KS++GF  +PY VALFS M+ +YYAL+
Sbjct  7    QHPWAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYALL  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K     LITIN  G  +ETIY+VLY  YA K+ RI  A  +L+ N+GV GLI++LT  L+
Sbjct  67   KSDEYLLITINSAGCVIETIYIVLYLAYAHKQARIFTAKILLLLNVGVFGLILLLTLLLT  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G +R+ ++GW+    SV VF APLS++  V+RT+SVE+MPF+LSL LT  AVVW LYGL
Sbjct  127  AGERRIVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRD-------RKTAAVVAPNGGIQGVAIVVDAT  188
             I+D Y+A PN+LGFA G++Q+ LYA+YR+       ++  A V+ +G ++    VV+  
Sbjct  187  LIKDKYVALPNILGFAFGVIQMGLYALYRNATPRPAPKEVDAPVSDDGAVKPSEHVVN--  244

Query  187  AAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQG  86
             A++    T  E++   P      MK+    + G
Sbjct  245  IAKLGPAATAIELNTHYPVDPPPSMKEGAAKENG  278



>ref|XP_008222221.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=282

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 174/277 (63%), Gaps = 5/277 (2%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            + H  A  FGILGN+ISF+V+LAP+PTF+ IYK+KS++GF  +PY VALFS M+  YYAL
Sbjct  7    SHHPWAFTFGILGNVISFLVYLAPMPTFYGIYKKKSTQGFQSVPYLVALFSGMLWFYYAL  66

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K++ + LITIN  G  +ETIY+V++  YA K  R          N+G+   I+VL++F 
Sbjct  67   LKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVLSHFA  126

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
                 RV ++GWI   ISV VFAAPLSI+ +VIRT+SVE+MPF+LS FLTL AV+W  YG
Sbjct  127  VRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAVMWFSYG  186

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L ++D  IA PNVLGF  G++Q++LYAIYR+R+   +      I   A   D     ++ 
Sbjct  187  LFLKDICIAIPNVLGFILGLLQMLLYAIYRNREQVIIEDDEKKIPAAA-AADQHVKNVVG  245

Query  169  KGT--DDEIHETTPSSVVVDMKKVVEMQQGKVV*ATS  65
              T    E+H   P     D  K VE+  G    A S
Sbjct  246  LTTLATSEVHPVDPPP--HDHDKSVEVDSGSHTAAAS  280



>ref|NP_001149028.1| LOC100282648 [Zea mays]
 gb|ACG33879.1| MTN3 [Zea mays]
Length=307

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 169/270 (63%), Gaps = 18/270 (7%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A  FGILGNI+S MVFL+PLPTF+ +Y+ KS+EGF   PY V LFSCM+ + YA
Sbjct  6    MEQQTWAFTFGILGNIVSLMVFLSPLPTFYRVYRNKSTEGFQSTPYVVTLFSCMLWILYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            L+K     L+TING+G  VET+YL +Y VYA K  R+L A  +L  N+ V GL+ ++T  
Sbjct  66   LLKPGAELLVTINGVGCVVETVYLAMYLVYAPKAARVLAAKMLLGLNVAVFGLVALVTML  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            LS+   RV ++GWI   +S+ VFAAPLSIM +VIRTKSVE+MP +LS FL L AVVW  Y
Sbjct  126  LSDAGLRVHVLGWICVSVSLSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAVVWFAY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIY-RDRKTAA--VVAPNGGIQGVAIVVDATAA  182
            G   +D ++A PNVLGF  G+ Q+ LY  Y R+RK AA  V+ P    +         AA
Sbjct  186  GALKKDVFVAFPNVLGFVFGLAQMALYMAYSRNRKPAAALVILPEQSKE--------EAA  237

Query  181  EMLQKGTDDEIHETTPSSVVVDMKKVVEMQ  92
            E        E+H        +D+ +V ++Q
Sbjct  238  EGKASCGGAEVHP-------IDIAEVHDLQ  260



>ref|XP_008441813.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
NEC1-like [Cucumis melo]
Length=264

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 163/248 (66%), Gaps = 5/248 (2%)
 Frame = -2

Query  880  QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQ  701
            QL  +FG+LGNIIS MVFLAP+PTF  IYK+K+SEGF  +PY VAL S M+ LYYA++K 
Sbjct  8    QLQFIFGLLGNIISLMVFLAPVPTFWRIYKKKTSEGFQCIPYVVALMSAMLLLYYAVLKT  67

Query  700  HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEG  521
            +   LI+IN  G  +E IY+ LYF YA K+ +I     +++ N+G  G++V  T  +  G
Sbjct  68   NAYLLISINSFGCVIELIYIALYFYYAPKKLKIFTLKLLMILNLGSYGVMVGGTMLILHG  127

Query  520  NKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCI  341
            NKR   VGWI +  ++ VFA+PL+IM +VIRTKSVEYMPF LS FLTL A +W  YG  I
Sbjct  128  NKRTHAVGWICAAFNLAVFASPLTIMKRVIRTKSVEYMPFFLSFFLTLSATMWFFYGFFI  187

Query  340  RDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA--PNGGIQGVAIVVDATAAEMLQK  167
            +D +IA PN++GF  G+VQ+I+Y IY+DRK  ++      GG       VD  +   ++K
Sbjct  188  KDLFIALPNIVGFLLGMVQMIMYMIYKDRKGNSLEEKLEEGGKN---YEVDDQSLSKVKK  244

Query  166  GTDDEIHE  143
                E  E
Sbjct  245  SNQSETKE  252



>ref|XP_009150896.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Brassica 
rapa]
Length=288

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 181/275 (66%), Gaps = 10/275 (4%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
              +  A  FG+LGNIISF VFL+P+PTF+ I+K+K++E F  LPY VALFS M+ LYYA 
Sbjct  6    TQNTWAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYAT  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
             K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+L    +L+ N G   LI++L  FL
Sbjct  66   QKKDVFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
            ++G+ R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LSL LT+ AVVWLLYG
Sbjct  126  AKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L +RD Y+A PNV+GFA G +Q+ILY +++  KT + +      +  A  +   + +ML+
Sbjct  186  LALRDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEK---ELEAAKLPEVSIDMLK  242

Query  169  KGT--DDEIHETT--PSS---VVVDMKKVVEMQQG  86
             GT    E  E T  P++   +  D K   E  QG
Sbjct  243  LGTLASPEPAEITVVPTANKCICNDRKAETENGQG  277



>gb|ACG28570.1| MTN3 [Zea mays]
Length=295

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 169/246 (69%), Gaps = 13/246 (5%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISFM FLAP+PTF+ IYK KS+EGF  +PY VALFS M+ ++YAL+
Sbjct  7    QHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYALI  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +  FLITIN  G  +ET+Y+V+YFVYA K+GR+  A  +L+ N+G  G I++LT  L 
Sbjct  67   KSNETFLITINAAGCVIETVYVVMYFVYATKKGRMFTAKIMLLLNVGAFGSILLLTLLLF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G+KRV ++GWI    SV VF APLSIM +VI+TKSVEYMPF+LSL LTL AVVW LYGL
Sbjct  127  KGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQK  167
             I+D Y+A PN+LGF  G+VQ++LY +Y ++                 V D  AA  L  
Sbjct  187  LIKDKYVALPNILGFTFGVVQMVLYVVYMNKTPLP-------------VADGKAAGKLPS  233

Query  166  GTDDEI  149
              D+ +
Sbjct  234  AADEHV  239



>ref|XP_011083538.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=278

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 153/212 (72%), Gaps = 0/212 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            +QLA VFG+LGN++SFMVFLAP+PTF+ IYK+KS+EGF  +PY V LFS M+ +YYA +K
Sbjct  2    NQLAFVFGLLGNVVSFMVFLAPIPTFYQIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLK  61

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
                 LITIN +G F+++ Y+  Y  +A +  R+     +L+ N    GLI+VLTYFL++
Sbjct  62   PDTTLLITINSVGCFIQSAYICFYLFFAPRNARVQTVKLLLLLNTVGFGLIMVLTYFLAK  121

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G+ R   VGWI  V S+CVF APL ++ +V+RTKS EYMPF LS FLT+ A+VW  YG  
Sbjct  122  GSNRANFVGWICLVFSLCVFVAPLCVVRQVLRTKSAEYMPFLLSFFLTISAIVWFFYGFL  181

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKT  248
             +D+ IA PNVLGF  G++Q++LY IYR+ KT
Sbjct  182  RKDYNIAIPNVLGFIFGVLQMVLYLIYRNGKT  213



>ref|XP_006436901.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
 gb|ESR50141.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
Length=285

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 171/258 (66%), Gaps = 5/258 (2%)
 Frame = -2

Query  865  FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFL  686
            FG+LGNI+SF+VFLAP+PTF+ + K+KS+EGF  LPY VALFS M+ +YYA++K+    L
Sbjct  14   FGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKDAFLL  73

Query  685  ITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN-KRV  509
            ITIN  G  +ETIYL LY  +A K+ R+     +L+ N G  G I++L++FL++G+  R+
Sbjct  74   ITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSAARL  133

Query  508  KIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFY  329
            +++GWI  V SV VFAAPLSIM  V+RTKSVE+MPF LSLFLTL AV+W  YGL ++D Y
Sbjct  134  RLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFLKDVY  193

Query  328  IATPNVLGFACGIVQLILYAIYRDRKTAAVVA----PNGGIQGVAIVVDATAAEMLQKGT  161
            +A PNVLGF  G+VQ+ILYAIYR+ +   V      P   +  V +  +   A   Q  +
Sbjct  194  VAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEHTVDVVKLSTNNMTASEEQTNS  253

Query  160  DDEIHETTPSSVVVDMKK  107
             +   +        D  +
Sbjct  254  RNNFDDKNEHEQANDQHE  271



>ref|XP_008239523.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=296

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 167/266 (63%), Gaps = 26/266 (10%)
 Frame = -2

Query  865  FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFL  686
            FGILGN++SF+VFLAP+PTF  IYK+KS+EGF  +PY  ALFS MI +YYA +K     L
Sbjct  14   FGILGNVVSFVVFLAPVPTFWRIYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSDEFLL  73

Query  685  ITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRVK  506
            ITIN  G  +ETIY+ +Y  YA K+ R+     +L+ N G   LI++L++FL++G  RV+
Sbjct  74   ITINAFGCIIETIYISMYITYAPKQARVFALRLLLLVNFGGFCLILLLSHFLAQGPTRVE  133

Query  505  IVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYI  326
            ++GW+    SV VFAAPLSIM  VIRTKS   MPF+LS FLTL AV+WL YGL ++D Y+
Sbjct  134  VLGWVCVAFSVSVFAAPLSIMRVVIRTKS---MPFSLSFFLTLSAVMWLFYGLLLKDLYV  190

Query  325  ATPNVLGFACGIVQLILYAIYRDRKTAAV--------------------VAPNGGIQGVA  206
            A PN+LGF  G+ Q+ILYAIYR++KT  V                      P   IQ  A
Sbjct  191  ACPNILGFTFGVAQMILYAIYRNKKTVLVEDQKLPVHKGDVVKQIQILSTTPEVEIQVQA  250

Query  205  IVVDA---TAAEMLQKGTDDEIHETT  137
              V +   T  E  ++  D  +H  T
Sbjct  251  AAVSSHANTDNENCEQNKDQYVHPQT  276



>ref|XP_006493253.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X2 [Citrus sinensis]
Length=285

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 171/258 (66%), Gaps = 5/258 (2%)
 Frame = -2

Query  865  FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFL  686
            FG+LGNI+SF+VFLAP+PTF+ + K+KS+EGF  LPY VALFS M+ +YYA++K+    L
Sbjct  14   FGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKDAFLL  73

Query  685  ITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN-KRV  509
            ITIN  G  +ETIYL LY  +A K+ R+     +L+ N G  G I++L++FL++G+  R+
Sbjct  74   ITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSAARL  133

Query  508  KIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFY  329
            +++GWI  V SV VFAAPLSIM  V+RTKSVE+MPF LSLFLTL AV+W  YGL ++D Y
Sbjct  134  RLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFLKDVY  193

Query  328  IATPNVLGFACGIVQLILYAIYRDRKTAAVVA----PNGGIQGVAIVVDATAAEMLQKGT  161
            +A PNVLGF  G+VQ+ILYAIYR+ +   V      P   +  V +  +   A   Q  +
Sbjct  194  VAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEHTVDVVKLSTNNMTASEEQTNS  253

Query  160  DDEIHETTPSSVVVDMKK  107
             +   +        D  +
Sbjct  254  RNNFDDKNEHEQANDQHE  271



>ref|XP_009758166.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 168/248 (68%), Gaps = 2/248 (1%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S   A  FG+LGNI+SF+VFL+PLPTF+ IYK+KS+EG+  +PY VALFS M+ +YYA +
Sbjct  5    SGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFL  64

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   +ITIN  G F+ETIY+  Y  YA K+ R+     +L+  +G  G+IV++T FL 
Sbjct  65   KTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLVTQFLF  124

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R + VGWI  V S+CVF APL I+ KVI+TKSVEYMP  LS+FLTL AV+W  YGL
Sbjct  125  KGAARGQAVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAP--NGGIQGVAIVVDATAAEML  173
             ++D  IA PNVLGF  GI Q++LY IY  ++ A +     +  IQ   I+VD    + L
Sbjct  185  LVKDINIAIPNVLGFILGIFQMVLYIIYNKKEKAILKEQKLSEKIQNHVIIVDENNNQKL  244

Query  172  QKGTDDEI  149
             + T+++I
Sbjct  245  PELTEEQI  252



>ref|XP_009125890.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Brassica 
rapa]
Length=297

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 176/295 (60%), Gaps = 21/295 (7%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA +FGILGN ISF+VFLAP+PTF+ IYK KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MVNHHLLAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL KQ    LITIN  G  VETIY+ ++F YA K  ++      L  N+    LI+++T+
Sbjct  64   ALTKQDAFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIKLFLTMNVAFFSLIIMVTH  123

Query  535  F-LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F +   + +V ++GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FAVKRPSLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR-----------------KTAAVVAP  230
             YG  + D  IA PNV+GF  G+VQ++LY +YR+                  KT  V++P
Sbjct  184  AYGAFLHDICIAIPNVVGFILGLVQMVLYGVYRNSGEKLDIGKKNNSSSEQLKTIVVMSP  243

Query  229  NGGIQGVAIVVDATAAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV*ATS  65
             G  +   + V  T   +    T   +H   PS +  + +   E  Q  V  A S
Sbjct  244  LGLSEMHPVDVTVTEPVIPLSYT---VHHEDPSKITKEEETSTEAAQSHVETAPS  295



>ref|XP_006402062.1| hypothetical protein EUTSA_v10014273mg [Eutrema salsugineum]
 gb|ESQ43515.1| hypothetical protein EUTSA_v10014273mg [Eutrema salsugineum]
Length=289

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 175/275 (64%), Gaps = 12/275 (4%)
 Frame = -2

Query  877  LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQH  698
            LA VFGILGNIISF+V LAP+PTF  IYKRKSSEG+  +PY + LFS M+ +YYA++K++
Sbjct  8    LATVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIGLFSAMLWIYYAMIKKN  67

Query  697  VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN  518
            V+ LITIN +   ++  Y+ +Y  YA K+ + L    VL  N+   GLI VLTYFL  GN
Sbjct  68   VMILITINAVSFVIQIFYIAVYLFYAPKKEKTLTVKLVLFVNVFAFGLIFVLTYFLLHGN  127

Query  517  KRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIR  338
            KRV ++G++  V ++CVF APL I+ KVI+TKS E+MPF LS FLTL AV+W  YGL  +
Sbjct  128  KRVTVLGYVCMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLNK  187

Query  337  DFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAI-VVDAT-------AA  182
            D  +A PNVLGF  G++Q++LY IY+   T  +  P   +Q ++  VVD         ++
Sbjct  188  DMNVALPNVLGFVFGVLQMVLYLIYKKPGTKVLEPPGIKLQDISDHVVDVVRLSSMVCSS  247

Query  181  EML----QKGTDDEIHETTPSSVVVDMKKVVEMQQ  89
            +M     Q   D E        +  DM+K  E ++
Sbjct  248  QMRTLVPQDSADMEATIDIDEKIKGDMEKFKEDKE  282



>ref|XP_003576036.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Brachypodium 
distachyon]
Length=300

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 158/216 (73%), Gaps = 0/216 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISFM +LAPL TF+ IYK KS++GF  +PY VALFS M+ +YYAL+
Sbjct  7    QHPWAFAFGLLGNVISFMTYLAPLSTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYALL  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K     LITIN  G  +ETIY+V+Y  YA K+ ++  A  +L+ N+GV G+I++LT  LS
Sbjct  67   KSDGCLLITINTAGCVIETIYIVVYLAYAPKQAKLFTAKILLLLNVGVFGMILLLTLLLS  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            EG KRV ++GW+    SV VF APLS++  V+RT+SVE+MPFNLSL LTL AVVW LYGL
Sbjct  127  EGEKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFNLSLSLTLSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
             I+D Y+A PN+LGFA G++Q+ LYA+YR+     V
Sbjct  187  LIKDKYVALPNILGFAFGVIQMGLYALYRNSTPRPV  222



>ref|XP_010929602.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
 ref|XP_010929603.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
Length=295

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 154/215 (72%), Gaps = 0/215 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FGILGNIISFMV+LAPLPTF+ +YK+KS+EGF  +PY VALFS M+ +YYA +
Sbjct  7    DHPWAFTFGILGNIISFMVYLAPLPTFYRVYKKKSTEGFQSVPYVVALFSAMLWIYYAFI  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K     L+TIN IG  +ET+Y+V+Y  YA K+ RI  A  +L+ N+G+ GLIV++T  ++
Sbjct  67   KADAYLLVTINSIGCVIETMYIVMYLSYAPKKARIFTAQVLLLLNVGLFGLIVLVTLMVA  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G +RV ++GW+    S+ VF APLSI+  VIRTKSVE+MPF LS FLT+ A+ W  YGL
Sbjct  127  KGPERVHVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTMSAIAWFSYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAA  242
              +D Y+A PN+LGF  G+VQ+ +Y  Y+  +  A
Sbjct  187  LTKDIYVALPNILGFIFGVVQMGIYIAYKGTEKVA  221



>ref|XP_009586714.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
tomentosiformis]
Length=264

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/253 (47%), Positives = 176/253 (70%), Gaps = 14/253 (6%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            +++  +LA +FG+LGNI+SFMVFLAP+PTF+ IYK+ SS+GF  +PY VA FS  + LYY
Sbjct  3    LLSVQELAFLFGLLGNIVSFMVFLAPIPTFYKIYKKGSSDGFQAIPYVVAFFSAGLLLYY  62

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
              + ++ + ++TIN  G  +E  YL L+  YA K+ ++   V +++ ++G LG++++L+Y
Sbjct  63   GYLIKNAILIVTINAFGCVIEVAYLFLFLFYASKKTKV-TTVWLMLLDVGALGIVMLLSY  121

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
              ++G KRV+IVGWI +++++ VFAAPLSIM +VI+TKSVE+MPF LS+FLTLCA +W  
Sbjct  122  LFAKGAKRVEIVGWICAIVNIAVFAAPLSIMRQVIKTKSVEFMPFTLSIFLTLCATMWFF  181

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGG---IQGVAI------  203
            YG   +D+YIA PNVLGF  GIVQ+ILY +Y+  K+     P  G   ++GV I      
Sbjct  182  YGYFKKDYYIAFPNVLGFVLGIVQMILYIVYKYAKS----RPYKGEWELEGVDIGDFENK  237

Query  202  VVDATAAEMLQKG  164
             V +T    L+ G
Sbjct  238  FVSSTKKPSLENG  250



>ref|XP_002443163.1| hypothetical protein SORBIDRAFT_08g013620 [Sorghum bicolor]
 gb|EES17001.1| hypothetical protein SORBIDRAFT_08g013620 [Sorghum bicolor]
Length=304

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 165/216 (76%), Gaps = 0/216 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISFM FLAP+PTF+ IYK KS+EGF  +PY VALFS M+ ++YAL+
Sbjct  7    QHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKTKSTEGFQSVPYVVALFSAMLWIFYALI  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +  FLITIN  G  +ETIY+++YFVYA K+G++  A  +L+ N+G+ G+I++LT  L 
Sbjct  67   KSNETFLITINAAGCVIETIYIIMYFVYAPKKGKMFTAKIMLLLNVGIFGVILLLTLLLF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G+KRV ++GWI    SV VF APLSIM +VI+TKSVEYMPF+LSL LTL AVVW LYGL
Sbjct  127  KGDKRVVMLGWICVGFSVSVFVAPLSIMKRVIQTKSVEYMPFSLSLSLTLSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
             I+D Y+A PN+LGF  G+VQ++LY +Y ++   AV
Sbjct  187  LIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAV  222



>emb|CDX69663.1| BnaA10g20120D [Brassica napus]
Length=298

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 171/276 (62%), Gaps = 5/276 (2%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA VFGILGN ISF+VFLAP+PTF+ IYK+KS+E F  LPY V+LFSCM+ L Y
Sbjct  4    MINHHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLCY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+KQ    LITIN  G  VETIY+ ++F YA K  RI      L  N+    LI+++T+
Sbjct  64   ALIKQDAFLLITINSFGCVVETIYIAMFFTYATKDKRIAAMKLFLTINVAFFSLILMVTH  123

Query  535  F-LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F +   + +V ++GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FAVKRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR----KTAAVVAPNGGIQGVAIVVDA  191
             YGL + D  IA PNV+GF  G+VQ++LY IYR+      T   + P+       +V+  
Sbjct  184  AYGLFLHDICIAIPNVVGFILGMVQMLLYGIYRNPGEKLDTEKKMNPSDQQLKSVVVMSP  243

Query  190  TAAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGK  83
                 +    D+      P S  V  K   ++ + K
Sbjct  244  LGVSEVHPIDDNMTEPVDPFSDAVQHKDPSKVTKEK  279



>ref|XP_009336454.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=305

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 179/281 (64%), Gaps = 12/281 (4%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H LA  FG+LGN++S MV+LAP+PTF+ IY++KS+EGFH +PY VA+FS M+  YYA +K
Sbjct  9    HPLAFTFGVLGNLVSTMVYLAPVPTFYRIYRKKSTEGFHSVPYLVAMFSSMLWFYYASLK  68

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
            ++ + LITIN  G F E  Y+V++ VYA +  R L      + N+G+  LI+V+++FL  
Sbjct  69   KNAMLLITINSFGSFAEMTYIVIFVVYAPRDARKLTVKLFGIMNVGLFTLILVVSHFLVS  128

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
               RV ++GWI   IS  VFAAPLSI+ +VIRT+SVE+MPF LS FLTL AV+W  YGL 
Sbjct  129  RAYRVPVLGWINVAISTSVFAAPLSIVAQVIRTRSVEFMPFRLSFFLTLSAVMWFAYGLF  188

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV--------VAPNGGIQGVAIVVDAT  188
            ++D  IA PNVLGF  G++Q++LYA+YR+RK   +         A    +  + I+    
Sbjct  189  LKDICIAIPNVLGFVLGLLQMLLYAMYRNRKQEILEDHEKKLPAATPDHVNNIVIIATLA  248

Query  187  AAEM----LQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV  77
            A+E+     Q    ++  +   ++VV + K+  +    + V
Sbjct  249  ASEVHPVDAQPNNRNDDGDVNNNAVVTEAKEHEQTDDHRHV  289



>gb|EYU43030.1| hypothetical protein MIMGU_mgv1a011435mg [Erythranthe guttata]
Length=282

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 166/246 (67%), Gaps = 3/246 (1%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            +QLA VFG+LGN++SFMVFLAP+PTF+TI+K+KS++GF  +PY V LFS M+ +YYA +K
Sbjct  2    NQLAFVFGLLGNVVSFMVFLAPIPTFYTIFKKKSTQGFQSVPYVVGLFSAMLWIYYAFLK  61

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
                 LITIN +G FV++ Y+  Y  +A K  RI     +L+ N+   GLI+VLT+F + 
Sbjct  62   PETTLLITINTVGCFVQSTYICFYLFFASKNARIQTVKLILLLNVVGFGLIIVLTHFWAN  121

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
             + R  IVGWI  V S+CVF APL ++ +VIRTKSVEYMPF LS FLTL AV+W  YGL 
Sbjct  122  DSNRDDIVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLL  181

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVA---IVVDATAAEML  173
             +D+ IA PNVLGF  G+VQ++LY +Y++  +  VV     I  +    IV+D      L
Sbjct  182  RKDYNIAIPNVLGFLFGVVQMVLYVMYKNTNSKKVVKEKKEISEIETKIIVLDENKLPEL  241

Query  172  QKGTDD  155
            ++   D
Sbjct  242  KEQIID  247



>gb|EYU42078.1| hypothetical protein MIMGU_mgv1a010705mg [Erythranthe guttata]
Length=304

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 155/215 (72%), Gaps = 0/215 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H  A  FG+LGNIIS  V+LAPLPTF  I+K KS+ GF  LPY+VALFS M+ LYYA +K
Sbjct  8    HPWAFTFGVLGNIISIFVYLAPLPTFRRIFKEKSTMGFDSLPYAVALFSAMLWLYYAFLK  67

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
             + + LI+IN  G  VETIY+ ++  YA K+ R   A  + V N+GVL LI V+T+F+ +
Sbjct  68   TNAVLLISINTFGCIVETIYISMFLFYASKKARGRTAKLLGVVNVGVLSLIFVVTFFIFK  127

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G  RV +VGWI   +SVCVFAAPLSI+ +V+RT+SVE+MPF LS FLTL AV+W  YGL 
Sbjct  128  GQNRVHVVGWICVAVSVCVFAAPLSIVFQVVRTRSVEFMPFPLSFFLTLSAVMWFGYGLF  187

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
             +D  +A PNVLGF  G++Q++LY I+R+ K  A+
Sbjct  188  EKDLCVAVPNVLGFILGVLQMVLYGIFRNVKAEAI  222



>ref|XP_003532478.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN16865.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=254

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 162/222 (73%), Gaps = 1/222 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M+    A VFG++GNIISF VFLAPLPTF+ IYK+KS+EGF  LPY VALFS M+ +YYA
Sbjct  3    MHRESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYA  62

Query  712  LVKQHV-LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             VK+   L LITIN  GI VE+IYL ++ +YA ++ R+     +L+ N+   G +++ T 
Sbjct  63   FVKRETALLLITINTFGIVVESIYLSIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +LS+G KR+ I+GWI  V ++ VFAAPL I+ +VI+T+SVEYMPF LS+FLT+ AV+W  
Sbjct  123  YLSKGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAP  230
            YGL +RD+Y+A PN LGF  GI+Q+++Y +YR+    A+  P
Sbjct  183  YGLLLRDYYVALPNTLGFVFGIIQMVMYLMYRNATPVALEEP  224



>ref|NP_001241307.1| uncharacterized protein LOC100810946 [Glycine max]
 gb|ACU19376.1| unknown [Glycine max]
 gb|KHN17481.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=257

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 173/257 (67%), Gaps = 6/257 (2%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M+    A VFG++GNIISF VFLAPLPTF+ IYK+KS+EGF  LPY VALFS M+ +YYA
Sbjct  3    MHRESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYA  62

Query  712  LVKQHV-LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             VK+   L LITIN  GI VE+IYL ++ +YA ++ R+     +L+ N+   G +++ T 
Sbjct  63   FVKREAALLLITINTFGIVVESIYLAIFLLYAPRKPRLTTIKLLLLLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +LS+G KR+ I+GWI  V ++ VFAAPL I+ +VI+T+SVEYMPF LS+FLT+ AV+W  
Sbjct  123  YLSKGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YGL +RD+Y+A PN LGF  GI+Q+ +Y +YR+    A+  P    +    ++D      
Sbjct  183  YGLLLRDYYVALPNTLGFVFGIIQMGMYLMYRNATPVALEEPVKAQELNGHIIDVG----  238

Query  175  LQKGTDDEIHETTPSSV  125
             + GT +  H  T  +V
Sbjct  239  -KMGTMEPNHAATAGAV  254



>ref|XP_008356571.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Malus 
domestica]
Length=295

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 157/228 (69%), Gaps = 4/228 (2%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M   H L+  FG+LGNIIS +VFLAP+PTF+TIYK+K++EGF  LPY + L S M+ +YY
Sbjct  1    MALQHTLSLAFGLLGNIISLLVFLAPVPTFYTIYKKKTTEGFQALPYVIGLLSSMLYIYY  60

Query  715  ALVKQHVLF----LITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIV  548
            AL+K+ + +    LITIN +G  +ET+Y+ L+  YA K+ RI  A  + + N     ++V
Sbjct  61   ALLKEEIKYDATLLITINSVGSVIETLYISLFLFYAPKKARISNATLLFLLNGFSYAVMV  120

Query  547  VLTYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAV  368
            VLT FL+ G  R+KIVGWI  V S+ VF APL ++ +V RTKSVE+MPF LS FLTL AV
Sbjct  121  VLTRFLATGEMRIKIVGWICLVFSISVFVAPLGVLRQVXRTKSVEFMPFPLSFFLTLGAV  180

Query  367  VWLLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNG  224
             W  YG  I+DFYIA PN+LGF  G+VQ+++Y +Y++ K      P G
Sbjct  181  AWFFYGFLIKDFYIALPNILGFFLGVVQMVVYIVYKNAKEVLEDQPKG  228



>emb|CDY05867.1| BnaC08g20440D [Brassica napus]
Length=289

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/247 (51%), Positives = 173/247 (70%), Gaps = 6/247 (2%)
 Frame = -2

Query  895  MMNSHQL-AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG++GN+ISF VFL+P+PTF+ ++K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  YA K+ R+L    +L+ N G   LI++L 
Sbjct  63   YATQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AVVWL
Sbjct  123  QFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGV-AIVVDATAA  182
            LYGL ++D Y+A PNV+GFA G +Q+ILY +Y+  KT     P+ G + V A  +     
Sbjct  183  LYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKT----PPHLGEKEVEAAKLPEVTL  238

Query  181  EMLQKGT  161
            +ML+ GT
Sbjct  239  DMLKLGT  245



>ref|XP_010235464.1| PREDICTED: bidirectional sugar transporter SWEET15 [Brachypodium 
distachyon]
Length=309

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 153/219 (70%), Gaps = 0/219 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M  H  A  FGILGNIIS MVFL+PLPTF+ +Y++KS+EGF   PY V LFSC++ +YYA
Sbjct  6    MEQHTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCLLWMYYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             +K     L+TING+G  +ET+Y+ +Y +YA K  R+L A   L  ++G+ GLI ++T  
Sbjct  66   FLKSGAELLLTINGVGCGIETLYIAMYLIYAPKSARLLTAKLFLGLDVGLFGLIALVTML  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            +S G  RV+IVGWI   +++ VFAAPLSI+  VIRTKSVE+MP +LS FL L AV+W  Y
Sbjct  126  VSAGTLRVQIVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPISLSFFLVLSAVIWFAY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVV  236
            GL  +D ++A PNVLGF  G+ Q+ LY  YR++  A  V
Sbjct  186  GLLKKDVFVAVPNVLGFVFGVAQMALYMAYRNKSPAITV  224



>ref|XP_009779208.1| PREDICTED: bidirectional sugar transporter SWEET12-like, partial 
[Nicotiana sylvestris]
Length=264

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 148/205 (72%), Gaps = 0/205 (0%)
 Frame = -2

Query  865  FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFL  686
            FGILGNIISF VF++P+PTF+ I K+KS+EGF  +PY VALFS M+ +YYA+ K +   +
Sbjct  4    FGILGNIISFTVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMTKTNETLI  63

Query  685  ITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRVK  506
            ITIN  G   ETIY+ +YF YA K+ R+     VL+ N G  GLI+ LT  L +G KR +
Sbjct  64   ITINSFGCIAETIYIAIYFAYATKKTRMQTLRLVLLLNFGGFGLILFLTQILCKGAKRAE  123

Query  505  IVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYI  326
            ++GWI    S+ VF APLSIM +VIRTKSVE+MPFNLSL LTL AV+W LYGL +RD Y+
Sbjct  124  VIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLYGLLLRDIYV  183

Query  325  ATPNVLGFACGIVQLILYAIYRDRK  251
              PN+ G   G++Q++LY IYR+ K
Sbjct  184  TVPNIAGMVLGVLQMVLYGIYRNAK  208



>ref|XP_009405955.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 165/243 (68%), Gaps = 4/243 (2%)
 Frame = -2

Query  874  AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHV  695
            A  FGILGNIISFMV+LAPLPTF+ +YKRKS+EGF  +PY VALFS M+ + YA +K   
Sbjct  12   AFTFGILGNIISFMVYLAPLPTFYRVYKRKSTEGFQSVPYVVALFSAMLWISYAFLKTDA  71

Query  694  LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNK  515
              LITIN +G  +ET+Y+V    YA K  +I  A  VL+  + + GLI++LT  LSEG K
Sbjct  72   CLLITINSVGCAIETVYIV----YAPKATKIFTAKLVLLVIVAMFGLILLLTLLLSEGAK  127

Query  514  RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRD  335
            RV+I+GWI    SV VF APLS++  VIRTKSVE+MPF+LS FLTL AVVW  YGL IRD
Sbjct  128  RVEILGWICVSFSVSVFVAPLSVIRLVIRTKSVEFMPFSLSFFLTLSAVVWFAYGLLIRD  187

Query  334  FYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKGTDD  155
             Y++ PNVLGF  GI+Q+ LY  Y+DRK AAVV        + I    TA + ++     
Sbjct  188  LYVSLPNVLGFIFGILQMALYVAYKDRKKAAVVEQEPPEHVLPITNRDTAQKAVEVHRTV  247

Query  154  EIH  146
            E H
Sbjct  248  ETH  250



>emb|CDX80379.1| BnaC07g30650D [Brassica napus]
Length=288

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 181/275 (66%), Gaps = 10/275 (4%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
              +  A  FG++GNIISF VFL+P+PTF+ I+K+K++E F  LPY VALFS M+ LYYA 
Sbjct  6    TQNTWAFAFGLVGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYAT  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
             K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+L    +L+ N G   LI++L  FL
Sbjct  66   QKKDVFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
            ++G+ R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LSL LT+ AVVWLLYG
Sbjct  126  AKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L +RD Y+A PNV+GFA G +Q+ILY +++  KT + +      +  A  +   + +ML+
Sbjct  186  LALRDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEK---ELEAAKLPEVSIDMLK  242

Query  169  KGT--DDEIHETT--PSS---VVVDMKKVVEMQQG  86
             GT    E  E T  P++   +  D K   E  QG
Sbjct  243  LGTLASPEPAEITVVPTANKCICNDRKAETENGQG  277



>emb|CDX85668.1| BnaA02g01450D [Brassica napus]
Length=297

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 176/295 (60%), Gaps = 21/295 (7%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA +FGILGN ISF+VFLAP+PTF+ IYK KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MVNHHLLAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL KQ    LITIN  G  VETIY+ ++F YA K  ++      L  N+    LI+++T+
Sbjct  64   ALTKQDAFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIKLFLTMNVAFFSLIIMVTH  123

Query  535  F-LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F +   + +V ++GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FAVKRPSLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR-----------------KTAAVVAP  230
             YG  + D  IA PNV+GF  G+VQ++LY +YR+                  KT  V++P
Sbjct  184  AYGAFLHDICIAIPNVVGFILGLVQMVLYGVYRNSGEKLDIGKRNNSSSEQLKTIVVMSP  243

Query  229  NGGIQGVAIVVDATAAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV*ATS  65
             G  +   + V  T   +    T   +H   PS +  + +   E  Q  V  A S
Sbjct  244  LGLSEMHPVDVTVTEPVIPLSYT---VHHEDPSKITKEEEPSTEAGQSHVETAPS  295



>sp|B8BKP4.1|SWT14_ORYSI RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Indica Group]
 gb|EEC68230.1| hypothetical protein OsI_36230 [Oryza sativa Indica Group]
Length=303

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 175/268 (65%), Gaps = 5/268 (2%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M   H  A  FG+LGNIISFM +LAPLPTF+ IYK KS++GF  +PY VALFS M+ +YY
Sbjct  4    MSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K     LITIN  G  +ETIY+ +Y VYA K+ ++  A  +L+ N+GV GLI++LT 
Sbjct  64   ALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILLLTL  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
             LS G++R+ ++GW+    SV VF APLSI+  V+RTKSVE+MPF+LS  LT+ AVVW L
Sbjct  124  LLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVVWFL  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YGL I+D Y+A PNVLGF+ G++Q+ LYA+YR+    AV+             D +AA  
Sbjct  184  YGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPKAVLTKEVEAATATGDDDHSAA--  241

Query  175  LQKGTDDEIHETTPSSVVVDMKKVVEMQ  92
               G  + +      S  VD+ K  E+ 
Sbjct  242  ---GVKEHVVNIAKLSAAVDVVKTREVH  266



>ref|NP_001067955.1| Os11g0508600 [Oryza sativa Japonica Group]
 sp|Q2R3P9.1|SWT14_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Japonica Group]
 gb|ABA93969.1| nodulin MtN3 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28318.1| Os11g0508600 [Oryza sativa Japonica Group]
 gb|EAZ18482.1| hypothetical protein OsJ_34008 [Oryza sativa Japonica Group]
 dbj|BAG95290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=303

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 175/268 (65%), Gaps = 5/268 (2%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M   H  A  FG+LGNIISFM +LAPLPTF+ IYK KS++GF  +PY VALFS M+ +YY
Sbjct  4    MSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K     LITIN  G  +ETIY+ +Y VYA K+ ++  A  +L+ N+GV GLI++LT 
Sbjct  64   ALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILLLTL  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
             LS G++R+ ++GW+    SV VF APLSI+  V+RTKSVE+MPF+LS  LT+ AVVW L
Sbjct  124  LLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVVWFL  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YGL I+D Y+A PNVLGF+ G++Q+ LYA+YR+    AV+             D +AA  
Sbjct  184  YGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPKAVLTKEVEAATATGDDDHSAA--  241

Query  175  LQKGTDDEIHETTPSSVVVDMKKVVEMQ  92
               G  + +      S  VD+ K  E+ 
Sbjct  242  ---GVKEHVVNIAKLSAAVDVVKTREVH  266



>gb|KDP22572.1| hypothetical protein JCGZ_26403 [Jatropha curcas]
Length=289

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/259 (49%), Positives = 172/259 (66%), Gaps = 20/259 (8%)
 Frame = -2

Query  874  AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHV  695
            A  FG+LGNI SF+VFLAP+PTF  + K+KS+EGF   PY V+LFS  I LYYA +K   
Sbjct  11   AFAFGLLGNITSFVVFLAPIPTFIRVCKKKSTEGFQSFPYLVSLFSASILLYYATLKTDG  70

Query  694  LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEG-N  518
             FL+TIN  G F+ETIY+ L+ VYA K+ R+     +L+F+ G   LI++L++FL++G +
Sbjct  71   FFLMTINSFGCFIETIYIALFIVYAPKQARMSTLRILLLFDFGGFCLILLLSHFLAKGPS  130

Query  517  KRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIR  338
             R++++GW+  V S  VFAAPLSIM  VI+TKSVE++PF LS FLTL A++WL YG+ ++
Sbjct  131  ARIQMLGWVNVVFSFAVFAAPLSIMRVVIKTKSVEFLPFPLSFFLTLSAIMWLFYGILVK  190

Query  337  DFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKGTD  158
            D YIA PNVLGF CG+VQ+IL+ IYR+ K A V               A   E+ Q   D
Sbjct  191  DLYIAGPNVLGFLCGVVQMILFVIYRNHKPATV---------------AKDPELQQNSVD  235

Query  157  DEIHETTPSSVVVDMKKVV  101
            D   E    S+  +M++ V
Sbjct  236  DIKLE----SITCEMQEAV  250



>ref|XP_010492063.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 185/298 (62%), Gaps = 29/298 (10%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M++ H LA +FGILGN ISF+VFLAP+PTF+ IYK+KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MIDHHLLAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+KQ    LITIN  G  VETIY+ ++F YA +  RI      +  N+ V  LI+++T+
Sbjct  64   ALIKQDAFLLITINSFGCVVETIYIAMFFAYATRDKRISAMKLFITINVAVFSLILMVTH  123

Query  535  FLSEGNK-RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F+ +    +V ++GWI   ISV VFAAPL I+ +VI+T+SVE+MPF LS FLT+ AV+W 
Sbjct  124  FVVKTPTLQVSVLGWICVAISVSVFAAPLMIVARVIKTRSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR-----------------KTAAVVAP  230
             YGL + D  IA PNV+GF  G++Q++LY +YR+                  K+  V++P
Sbjct  184  AYGLFLHDICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKIHLSEQQLKSIVVMSP  243

Query  229  NG-------GIQGVAIVVDATAAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV  77
             G         + V  + DA   E L K T+++  E  PS  + + K  VE  + + V
Sbjct  244  LGVSEVHPVVTEPVGPLSDAVHHEDLSKVTNEK--EEEPS--IENGKSHVETTRPETV  297



>ref|XP_002873602.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49861.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=295

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 172/273 (63%), Gaps = 25/273 (9%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA +FGILGN+ISF+VFLAP+PTF+ IYK+KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MINHHLLAFIFGILGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K+    LITIN  G  VET+Y+ ++F YA K  RI      +  N+    LI+++T+
Sbjct  64   ALIKKDAFLLITINSFGCVVETLYIAMFFAYATKDKRISALKLFIAMNVAFFSLILMVTH  123

Query  535  FLSEGNK-RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F+ E    +V ++GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FVVETPTLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR-----------------KTAAVVAP  230
             YGL + D  IA PNV+GF  G++Q++LY +YR+                  K+  V++P
Sbjct  184  AYGLFLNDICIAIPNVVGFVLGLLQMVLYGVYRNSNEKPEMEKKINSSEQQLKSIVVMSP  243

Query  229  NG-------GIQGVAIVVDATAAEMLQKGTDDE  152
             G         + V  + DA   E L K T  E
Sbjct  244  LGVSEVHPVVTESVDPLSDAVHHEDLSKATKVE  276



>ref|XP_009385515.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/271 (47%), Positives = 171/271 (63%), Gaps = 5/271 (2%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
               L  +FGILGNIISFMVFL+PLPTF+ IY++KS+EGF  +PY VAL SCM+ +YYALV
Sbjct  7    EQPLPFIFGILGNIISFMVFLSPLPTFYRIYRKKSTEGFQSVPYVVALSSCMLLIYYALV  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K + + LITIN  G F+ET Y+ +Y +YA K+ RI      ++ N+     IV+LT    
Sbjct  67   KTNAVLLITINSFGCFIETAYITIYLIYATKKARIFCIQIFVLLNVVAFAAIVLLTRLAF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G  RV +VGWI    S+CVFAAPLSI+  VIRTKSVE+MPF LS FLTL A+ W  YG 
Sbjct  127  TGPDRVTVVGWICVGFSLCVFAAPLSIIRLVIRTKSVEFMPFYLSFFLTLNAIAWFGYGF  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYR---DRKTAAVVAPNGGIQGVAIVVDATAAEM  176
              +D Y+  PNVLGF  G+VQ+++Y +Y+   ++K AAV A       +A +  A A+E+
Sbjct  187  FTKDLYVELPNVLGFVFGVVQMVVYMLYKNNNNKKDAAVAAVPEHRVKIAELSSAPASEL  246

Query  175  -LQKGTDDEIHETTPSSVVVDMKKVVEMQQG  86
             +     D+   +   S   D K     ++G
Sbjct  247  QVSLEEKDQNKRSMEDSQDTD-KNETAYEEG  276



>ref|XP_004491680.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=257

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 165/262 (63%), Gaps = 9/262 (3%)
 Frame = -2

Query  886  SH-QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            SH  LA  FG+LGN+ISFMVFLAP+ TF+ IYK+KS+E F  LPY VALFS M+ LYYAL
Sbjct  4    SHATLAFGFGMLGNVISFMVFLAPMTTFYRIYKKKSTEQFQSLPYLVALFSSMLWLYYAL  63

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            VK +   LITIN  G  VE IY++LY  YA K  R L    +L  N+G  GLI+ +T++ 
Sbjct  64   VKTNEFLLITINSFGCLVEIIYILLYITYAPKDARKLTLKLLLAMNMGSFGLILSVTHYA  123

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
              G  RV+++GWI   ISV VFAAPL+I+ +V+RTKSVE+MPFNLS  LTL A++W  YG
Sbjct  124  MHGALRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYG  183

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L ++D  IA PNVLGF  G+VQ+ILY IYR+    A +          +V      E+  
Sbjct  184  LFLKDICIALPNVLGFVLGLVQMILYGIYRNGNKKATLK--------TVVSSLENGEVFP  235

Query  169  KGTDDEIHETTPSSVVVDMKKV  104
               D EI           M+ V
Sbjct  236  VQEDHEIGNKNKEEKNKSMETV  257



>ref|XP_009605549.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 167/248 (67%), Gaps = 2/248 (1%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S   A  FG+LGNI+SF+VFL+PLPTF+ IYK+KS+EG+  +PY VALFS M+ +YYA +
Sbjct  5    SGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFL  64

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   +ITIN  G F+ETIY+  Y  YA K+ R+     +L+  +G  G+IV++T FL 
Sbjct  65   KTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLVTQFLF  124

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R + VGWI  V S+CVF APL I+ +VI+TKSVEYMP  LS+FLTL AV+W  YGL
Sbjct  125  KGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN--GGIQGVAIVVDATAAEML  173
             ++D  IA PNVLGF  GI Q++LY IY  ++ A +        IQ   I+VD   ++ L
Sbjct  185  LVKDINIAIPNVLGFILGIFQMVLYIIYNKKEKANLKEQKLPEKIQNHVIIVDENNSQKL  244

Query  172  QKGTDDEI  149
             + T++ I
Sbjct  245  PELTEERI  252



>ref|XP_008239633.1| PREDICTED: bidirectional sugar transporter SWEET10 [Prunus mume]
Length=291

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 157/227 (69%), Gaps = 4/227 (2%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M   H L   FG+LGNIISF+VFLAP+PTF+T+YKRK++EGF  LPY +AL S M+ +YY
Sbjct  1    MAIQHPLTLAFGLLGNIISFLVFLAPVPTFYTVYKRKTAEGFQALPYVIALLSSMLYIYY  60

Query  715  ALVKQH----VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIV  548
            AL+K+       FLITIN  G  VET+Y+ L+  YA K+ RI     V + N+   GL++
Sbjct  61   ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNVFGYGLMM  120

Query  547  VLTYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAV  368
            +LT+FL+ G  R+KIVGWI  V S+ VF APL ++ +VIRTKSVE+MPF LS FLTL AV
Sbjct  121  MLTHFLATGEIRLKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAV  180

Query  367  VWLLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN  227
             W  YGL I+D+ IA PN+LGF  GI Q++LY +Y++ K      P 
Sbjct  181  TWFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKKVLEEQPK  227



>gb|AAM65389.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
Length=292

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 180/277 (65%), Gaps = 8/277 (3%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            ++N H LA +FGILGN+ISF+VFLAP+PTF+ IYKRKS+E F  LPY V+LFSCM+ LYY
Sbjct  4    IINHHFLAFIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K+    LITIN  G  VET+Y+ ++F YA +  RI      +  N+    LI+++T+
Sbjct  64   ALIKKDAFLLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILMVTH  123

Query  535  FLSEGNK-RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F+ +    +V ++GWI   ISV VFAAPL I+ +VI+TKSVEYMPF LS FLT+ AV+W 
Sbjct  124  FVVKTPPLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYR--DRKTAAVVAPNGGIQGVAIVVDATA  185
             YGL + D  IA PNV+GF  G++Q++LY +YR  + K   + +    ++ + ++     
Sbjct  184  AYGLFLNDICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEEQLKSIVVMSPLGV  243

Query  184  AEMLQKGTD--DEIHETTPSSVVVDMKKVVEMQQGKV  80
            +E+    T+  D + E        D+ KV ++++  +
Sbjct  244  SEVHPVVTESVDPLSEAVHHE---DLSKVTKVEEPSI  277



>ref|XP_006663471.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Oryza 
brachyantha]
Length=310

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 157/213 (74%), Gaps = 0/213 (0%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M   H  A  FG+LGNIISFM +LAPLPTF+ IYK KS++GF  +PY VALFS M+ +YY
Sbjct  4    MSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSIPYVVALFSAMLWIYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K     LITIN  G  +ET+Y+ +Y VYA K+ R+  A  +L+ N+GV GLI++LT 
Sbjct  64   ALLKSDECLLITINSAGCVIETLYIAVYLVYAPKKARVFTARLLLLVNVGVFGLILLLTL  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
             LS G +RV ++GW+    SV VF APLSIM  V+RTKSVE+MPF+LSL LT+ AVVW L
Sbjct  124  LLSAGPRRVVVLGWVCVGFSVSVFVAPLSIMRLVVRTKSVEFMPFSLSLSLTVSAVVWFL  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
            YGL I+D Y+A PNVLGF  G++Q+ LYA+YR+
Sbjct  184  YGLLIKDKYVALPNVLGFTFGVIQMGLYAMYRN  216



>ref|XP_002877629.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53888.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 176/262 (67%), Gaps = 8/262 (3%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
              +  A VFG+LGN+ISF VFL+P+PTF+ I+K+K++EGF  +PY VALFS  + LYYA 
Sbjct  6    TENTWAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYAT  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
             K+ V  L+TIN  G F+ETIY+ ++  YA K  R+L    +L+ N G   +I++L  FL
Sbjct  66   QKKDVFLLVTINAFGCFIETIYIAMFLAYATKPARMLTVKTLLLMNFGGFCVILLLCQFL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AV+WLLYG
Sbjct  126  VKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGV-AIVVDATAAEML  173
            L ++D Y+A PNV+GFA G +Q+ILY +Y+  KT    +P+ G + V A  +   + +ML
Sbjct  186  LALKDIYVAFPNVIGFALGALQMILYVVYKYCKT----SPHLGEKEVEAAKLPEVSLDML  241

Query  172  QKGTDDEIHETTPSSVVVDMKK  107
            + GT   +    P SVV    K
Sbjct  242  KLGT---VSSPEPISVVRQANK  260



>ref|XP_010093933.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
 gb|EXB54896.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
Length=295

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 161/223 (72%), Gaps = 0/223 (0%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M + H L   FG+LGNI+SFMVFLAP+PTFH IYK+KS+EGF  LPY +AL S M+ +YY
Sbjct  1    MASHHYLTLAFGLLGNIVSFMVFLAPIPTFHKIYKKKSAEGFQSLPYVIALLSSMLWIYY  60

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K+  L LITIN +G  +ET+Y+ L+  YA K+ RI     +L+ N+   GL++VLT 
Sbjct  61   ALLKKDALLLITINSVGCVIETVYIALFLFYAPKKTRIETVKLLLMLNVVGYGLMLVLTI  120

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            FL+EG KR++ VGWI    ++ VFAAPL IM +VIRTKSVE+MPF LS FLTL AV+W  
Sbjct  121  FLAEGEKRLQAVGWICLAFNLSVFAAPLCIMRQVIRTKSVEFMPFPLSFFLTLGAVMWFF  180

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN  227
            YGL ++D+ IA PNVLGF  GI Q+ LY +Y++ K   ++ P 
Sbjct  181  YGLLLKDYNIAFPNVLGFFFGIAQMALYIVYKNAKKTILLEPK  223



>ref|XP_007159993.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
 gb|ESW31987.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
Length=258

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 172/250 (69%), Gaps = 6/250 (2%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M+    A VFG+LGNIISF VFLAPLPTF+ IYK+KS+EGF  LPY VALFS M+ +YYA
Sbjct  3    MHRESWAFVFGLLGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYA  62

Query  712  LVKQHV-LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             VK+   L LITIN  GI VE+IYL ++ +YA ++ R+     +L+ N+   G +++ T 
Sbjct  63   FVKREAALLLITINTFGIVVESIYLTIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +L++G KR+ I+GWI  V ++ VFAAPL I+ +VI+T+SVEYMPF LS+FLT+ AV+W  
Sbjct  123  YLTKGAKRLAIIGWICLVFNISVFAAPLFIISRVIKTRSVEYMPFTLSMFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YGL +RD+Y+A PN LGF  GI+Q+ +Y +YR+    A+  P  G +    +V A     
Sbjct  183  YGLLLRDYYVALPNTLGFVFGIIQMGMYLMYRNATPVALEEPVKGQESNGHIVGA-----  237

Query  175  LQKGTDDEIH  146
            ++ GT +  H
Sbjct  238  VKMGTIEPNH  247



>ref|XP_009605550.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 167/248 (67%), Gaps = 2/248 (1%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S   A  FG+LGNI+SF+VFL+PLPTF+ IYK+KS+EG+  +PY VALFS M+ +YYA +
Sbjct  5    SGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFL  64

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   +ITIN  G F+ETIY+  Y  YA K+ R+     +++  +G  G IV++T FL 
Sbjct  65   KTNTTLIITINSFGCFIETIYVSFYLFYAPKKARVQTVKMLVLSVVGGFGAIVLVTQFLF  124

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R + VGWI  V S+CVF APL I+ +VI+TKSVEYMP  LS+FLTL AV+W  YGL
Sbjct  125  KGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN--GGIQGVAIVVDATAAEML  173
             ++D  IA PNVLGF  GI+Q++LY IY  ++ A +        IQ   I+VD    + L
Sbjct  185  LVKDINIAIPNVLGFILGILQIVLYVIYNKKEKAILKEQKLPAKIQNHVIIVDENNNQKL  244

Query  172  QKGTDDEI  149
             + T+++I
Sbjct  245  PELTEEQI  252



>ref|NP_001237418.1| N3 protein [Glycine max]
 gb|ABT17358.1| N3 protein [Glycine max]
 gb|KHN23962.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=260

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 159/216 (74%), Gaps = 1/216 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            +N    A VFG+LGN+ISFMVFLAPLPTF+ IYK+KS+E F  LPY VALFS M+ +YYA
Sbjct  3    INHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIYYA  62

Query  712  LVKQHV-LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            LVK+   L LITIN  G  +ETIYL ++ +YA  + R+     +L+ N+   G +++ T 
Sbjct  63   LVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +L+ G+KR+ ++GWI  V ++ VFAAPL I+ +VI+TKSVE+MPF+LS FLT+ AV+W  
Sbjct  123  YLTTGSKRLTVIGWICLVFNISVFAAPLCIIKRVIKTKSVEFMPFSLSFFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT  248
            YGL ++D+Y+A PN LGF   I+Q++LY IYR+ KT
Sbjct  183  YGLLLKDYYVALPNTLGFLFSIIQMVLYLIYRNAKT  218



>ref|XP_010112742.1| Bidirectional sugar transporter NEC1 [Morus notabilis]
 gb|EXC34700.1| Bidirectional sugar transporter NEC1 [Morus notabilis]
Length=254

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 174/248 (70%), Gaps = 13/248 (5%)
 Frame = -2

Query  859  ILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK--QHVLFL  686
            +LGNI+SF+V+LAPLPTF+ I+++KS+EGF  +PYSVALFS M+TLYY ++K   + + +
Sbjct  2    VLGNIVSFLVYLAPLPTFYRIFRKKSTEGFQAIPYSVALFSAMLTLYYGILKGLPNGVMI  61

Query  685  ITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRVK  506
            ITIN IG  +E+IYL+++ +YA  + RI     +++FN+G  GLI++ T F+ + ++RV 
Sbjct  62   ITINSIGCAIESIYLIVFLIYAPGKVRIYTIKLLVLFNMGAYGLILLSTSFVGKISQRVT  121

Query  505  IVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYI  326
            +VGWI +V SVCVFAAPLSI+  VI+T+SVEYMPF LS  LTLCAV+W  YGL + DF+I
Sbjct  122  VVGWICAVFSVCVFAAPLSIIRLVIKTRSVEYMPFALSFCLTLCAVMWFFYGLLVNDFFI  181

Query  325  ATPNVLGFACGIVQLILYAIYRDRKTAAV-------VAPNGGIQGVAI----VVDATAAE  179
            A+PN+LGF  GI Q+ILY ++++ K   +       + PN   Q  A+    V++     
Sbjct  182  ASPNILGFLFGIAQMILYLVFKNSKKEVLPEFKLQEMPPNVAAQANAVQEATVINGNNIP  241

Query  178  MLQKGTDD  155
              ++  +D
Sbjct  242  SSERNNND  249



>emb|CDX88041.1| BnaA06g26320D [Brassica napus]
Length=288

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/275 (47%), Positives = 181/275 (66%), Gaps = 10/275 (4%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
              +  A  FG+LGNIISF VFL+P+PTF+ I+K+K++E F  LPY VALFS M+ LYYA 
Sbjct  6    TQNTWAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYAT  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
             K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+L    +L+ N G   LI++L  FL
Sbjct  66   QKKDVFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
            ++G+ R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LSL LT+ AVVWLLYG
Sbjct  126  AKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L +RD Y+A PNV+GFA G +Q+ILY +++  KT + +      +  A  +   + +ML+
Sbjct  186  LALRDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEK---ELEAAKLPEVSIDMLK  242

Query  169  KGT--DDEIHE----TTPSSVVVDMKKVVEMQQGK  83
             GT    E  E     T +  + + +K  E + G+
Sbjct  243  LGTLASPEPAEITVVPTANKCICNARK-AETENGQ  276



>ref|XP_004979336.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=296

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 158/210 (75%), Gaps = 0/210 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H LA  FG+LGNIISFM +LAPLPTF+ IYK KS++GF  +PY VALFS M+ +YYAL+
Sbjct  7    QHPLAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYALL  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   LITIN  G  +ET+Y+ +Y  YA K+ ++  A  +L+ N+GV GLI++LT  LS
Sbjct  67   KSNECLLITINAAGCVIETLYIAMYLTYAPKKAKLFTAKILLLLNVGVFGLILLLTLLLS  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G  R+ I+GW+    SV VF APLSI+ +V+RT+SVE+MPF+LSL LT+ AVVW LYGL
Sbjct  127  AGQNRLVILGWVCVGFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRD  257
             I+D Y+A PNVLGF+ G++Q+ LYA+YR+
Sbjct  187  LIKDKYVALPNVLGFSFGVIQMGLYALYRN  216



>ref|XP_009597195.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=291

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 168/249 (67%), Gaps = 4/249 (2%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S   A  FG+LGNI+SF+VFL+PLPTF+ IYK+KS+EG+  +PY VALFS M+ +YYA +
Sbjct  2    SGHWAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAFL  61

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   LITIN  G+F+ETIY+  Y  YA K+ R+     +L+  +G  G IV++T FL 
Sbjct  62   KTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTMKMLLLSVVGGFGAIVLVTQFLF  121

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R ++VGWI  V S+CVF APL I+ KVI+TKSVEYMP  LS+FLTL AV+W  YGL
Sbjct  122  KGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  181

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN-GGIQGVAIVVDATAAEMLQ  170
             ++D  IA PNVLGF  GIVQ++LY IY  ++ A +  P    IQ  A++V     E + 
Sbjct  182  LLKDINIAAPNVLGFIFGIVQIVLYVIYSKKEKANLKEPKLPEIQKPAVIV---VDENMN  238

Query  169  KGTDDEIHE  143
            K    E+ +
Sbjct  239  KKKIPELTQ  247



>ref|XP_004155149.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
NEC1-like [Cucumis sativus]
Length=262

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 149/211 (71%), Gaps = 0/211 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            HQL  +FG+LGNIISF+VFLAP+PTF TIYK+K+SEGF  +PY VAL S M+ LYYA +K
Sbjct  7    HQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLLYYAALK  66

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
             +   L++IN  G  +E IY+ LY  YA K+ +I      ++FN+G  G++V  T     
Sbjct  67   TNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGFSGVMVGGTXVFLH  126

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G KR   VGWI +  ++ VFA+PLSIM +VI TKSVEYMPF+LS FLTL A +W  YG  
Sbjct  127  GMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMWFFYGFF  186

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
            I+D +IA PNV+GF  G+VQ+I+Y IY+D K
Sbjct  187  IKDLFIALPNVVGFLLGMVQMIMYMIYKDSK  217



>ref|XP_004235333.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
lycopersicum]
Length=296

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 182/276 (66%), Gaps = 8/276 (3%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            ++   A VFG+LGNI+SF+VFL+PLPTF+TIYK+K++EG+  +PY VALFS M+ +YYA 
Sbjct  4    SADHWAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIYYAF  63

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K +   LITIN  G+FVETIY+V Y +YA K+ R+     + +F +G  G I+++T FL
Sbjct  64   LKTNTTLLITINTFGVFVETIYVVFYLIYAPKKSRVQTIKMLSLFVVGGFGAIILVTQFL  123

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G  R ++VGWI  + S+CVF APL I+ KVI+TKSVEYMP  LS+FLTL AV+W  YG
Sbjct  124  FKGVIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  183

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN-GGIQ-GVAIVVDATAAEM  176
            L ++D  IA PN+LGF  G++Q+ILY IY  ++ A +       IQ G  IV D      
Sbjct  184  LLLKDINIAAPNILGFIFGVLQMILYVIYSKKEKAILKEQKLPEIQKGEVIVKDENM---  240

Query  175  LQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV*AT  68
                 D +  E T   ++  ++  + + +GKV  AT
Sbjct  241  ---NADKKFPELTQEQIIDIVRLGLMVCKGKVHVAT  273



>ref|XP_006399805.1| hypothetical protein EUTSA_v10014234mg [Eutrema salsugineum]
 gb|ESQ41258.1| hypothetical protein EUTSA_v10014234mg [Eutrema salsugineum]
Length=297

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/285 (45%), Positives = 176/285 (62%), Gaps = 21/285 (7%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA VFG LGN ISF+VFLAP+PTF+ IYK+KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MINHHLLAIVFGALGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+KQ+   LITIN  G  VET+Y+ ++F YA K  RI      +  N+    LI+++T+
Sbjct  64   ALIKQNAFLLITINSFGCVVETLYIAMFFAYATKDKRIAAMKLFITMNVAFFSLILMVTH  123

Query  535  FLSEGNK-RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F+ +    +V ++GW+   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FVVKSPTLQVSVIGWVCVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR-----------------KTAAVVAP  230
             YGL + D  IA PNV+GF  G+VQ++LY +YR+                  K+  V++P
Sbjct  184  AYGLFLHDICIAIPNVVGFILGMVQMVLYGVYRNSGEKLDIEKKVNTSDQQLKSIVVMSP  243

Query  229  NGGIQGVAIVVDATAAEMLQKGTDD-EIHETTPSSVVVDMKKVVE  98
             G  +   I  D    E +    D    HE  PS V  + +  +E
Sbjct  244  LGVSEVHPI--DVKMTESVDPLPDAVHHHEEEPSKVTKEEEPSLE  286



>ref|NP_190443.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
 sp|Q9SMM5.1|SWT11_ARATH RecName: Full=Bidirectional sugar transporter SWEET11; Short=AtSWEET11 
[Arabidopsis thaliana]
 gb|AAK32837.1|AF361825_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAL31891.1|AF419559_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 emb|CAB62363.1| MTN3-like protein [Arabidopsis thaliana]
 gb|AAL49908.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AAL77742.1| AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAM20244.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AEE78451.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
Length=289

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 175/262 (67%), Gaps = 8/262 (3%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
              +  A VFG+LGN+ISF VFL+P+PTF+ I+K+K++EGF  +PY VALFS  + LYYA 
Sbjct  6    TENTWAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYAT  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
             K+ V  L+TIN  G F+ETIY+ ++  YA K  R+L    +L+ N G    I++L  FL
Sbjct  66   QKKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKMLLLMNFGGFCAILLLCQFL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AV+WLLYG
Sbjct  126  VKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGV-AIVVDATAAEML  173
            L ++D Y+A PNVLGFA G +Q+ILY +Y+  KT    +P+ G + V A  +   + +ML
Sbjct  186  LALKDIYVAFPNVLGFALGALQMILYVVYKYCKT----SPHLGEKEVEAAKLPEVSLDML  241

Query  172  QKGTDDEIHETTPSSVVVDMKK  107
            + GT   +    P SVV    K
Sbjct  242  KLGT---VSSPEPISVVRQANK  260



>ref|XP_006438820.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
 ref|XP_006483041.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Citrus 
sinensis]
 gb|ESR52060.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
Length=305

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 169/256 (66%), Gaps = 3/256 (1%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M + HQ    FGILGNIISF+V+LAP+PTF+ IY++KS+E F  LPY VALFS M+  YY
Sbjct  4    MFDHHQWGVAFGILGNIISFLVYLAPVPTFYRIYRKKSTESFQSLPYLVALFSSMLWFYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            ALVKQ+   L+TIN  G  +ETIY++L+  YA K  R       +  N+GV  LI++LT+
Sbjct  64   ALVKQNAFLLVTINCFGCVIETIYIILFITYAPKGSRNSTVKLFVSMNVGVFSLILLLTH  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            FL+  + R+ I+GWI   +SV VFAAPLSI+ +VIRTKSVE+MPF LS FLTL A++W  
Sbjct  124  FLATDSTRILILGWICVAVSVSVFAAPLSIVAQVIRTKSVEFMPFILSFFLTLSAIMWFA  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA---PNGGIQGVAIVVDATA  185
            YGL  +D  +A PN++GF  G+ Q++LY IY++     +     P   ++ + ++ +  A
Sbjct  184  YGLFQKDICVALPNIVGFLLGLTQMLLYVIYKNANKVIIEEKKLPEAQLKSIVVLSNLGA  243

Query  184  AEMLQKGTDDEIHETT  137
            +E+       +  +TT
Sbjct  244  SEVYPVDIHPDDADTT  259



>ref|XP_006578712.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31281.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=282

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 156/209 (75%), Gaps = 1/209 (0%)
 Frame = -2

Query  874  AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHV  695
            A VFG+LGN+ISFMVFLAPLPTF+ IYK+KSSEGF  LPY VALFS M+ +YYA VK+  
Sbjct  9    AFVFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYAFVKKDA  68

Query  694  -LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN  518
             L LITIN  G  +ETIYL ++ VYA  + R+     +L+ N+   G +++ T +L+ G+
Sbjct  69   SLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYLTTGS  128

Query  517  KRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIR  338
            KR+ ++GWI  V ++ VFAAPL IM +VI+TKSVE+MPF+LS  LT+ AV+W  YGL ++
Sbjct  129  KRLTVIGWICLVFNISVFAAPLCIMKRVIKTKSVEFMPFSLSFSLTINAVMWFFYGLLLK  188

Query  337  DFYIATPNVLGFACGIVQLILYAIYRDRK  251
            D+YIA PN LGF  GI+Q++LY IYR+ K
Sbjct  189  DYYIALPNTLGFLFGIIQMVLYLIYRNAK  217



>gb|EYU43032.1| hypothetical protein MIMGU_mgv1a010677mg [Erythranthe guttata]
Length=305

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 155/215 (72%), Gaps = 0/215 (0%)
 Frame = -2

Query  901  SKMMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITL  722
            +++   +QLA VFG+LGN+ISFMVFLAP+PTF+TI+K+KS+EGF  +PY V LFS  + +
Sbjct  25   NQLREMNQLAFVFGLLGNVISFMVFLAPIPTFYTIFKKKSTEGFQSVPYVVGLFSAQLWI  84

Query  721  YYALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVL  542
            YYA +K     LITIN +G FV++ Y+  Y  +A K  RI     +L+ N+   GLI+VL
Sbjct  85   YYAFLKPETTLLITINTVGCFVQSAYICFYLFFATKNARIQTVKLILLLNVVGFGLIIVL  144

Query  541  TYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVW  362
            T+F +  + R  IVGWI  V S+CVF APL ++ +VIRTKSVEYMPF LS FLTL AV+W
Sbjct  145  THFWANDSNRDDIVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMW  204

Query  361  LLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
              YGL  +D+ IA PNVLGF  G++Q++LY +Y++
Sbjct  205  FFYGLLRKDYNIAIPNVLGFLFGVIQMVLYVMYKN  239



>ref|XP_009796436.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=297

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 171/249 (69%), Gaps = 3/249 (1%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S   A  FG+LGNI+SF+VFL+PLPTF++I+K+KS+EG+  +PY VALFS M+ +YYAL+
Sbjct  5    SGHWAFAFGVLGNIVSFIVFLSPLPTFYSIFKKKSTEGYQSIPYVVALFSSMLWIYYALL  64

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   LITIN  G+F+ETIY+  Y  YA K+ ++     +L+  +G  G IV++T FL 
Sbjct  65   KTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLF  124

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R +IVGWI  V S+CVF APL I+ KVI+TKSVEYMP  LS+FLTL AV+W  YGL
Sbjct  125  KGAVRGQIVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA---PNGGIQGVAIVVDATAAEM  176
             ++D  IA PNVLGF  GI+Q++LYAIY  ++ A +     P      V +V +   ++ 
Sbjct  185  LLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKAILKEQKLPEIQKPAVIVVDENMNSKK  244

Query  175  LQKGTDDEI  149
            L + T ++I
Sbjct  245  LPELTQEQI  253



>gb|ACU23483.1| unknown [Glycine max]
Length=258

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 170/254 (67%), Gaps = 2/254 (1%)
 Frame = -2

Query  886  SHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            SH+  A +FG+LGN+ISFMVFLAPLPTF+ IYK+KSSEGF  LPY VALFS M+ +YYAL
Sbjct  4    SHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYAL  63

Query  709  VKQHV-LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            VK+   L LITIN  G  +ETI+L ++ VYA  + R+     +L+ N+   G +++ T +
Sbjct  64   VKKDASLLLITINSFGCVIETIHLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLSTLY  123

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L+ G+KR+ ++GWI  V ++ VFAAPL IM +VI+T+SVE+MPF+LS  LT+ AV+W  Y
Sbjct  124  LTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSSSLTINAVMWFFY  183

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEML  173
            GL ++D+YIA PN LGF  GI+Q++LY +YR+ K   +  P    +    ++D       
Sbjct  184  GLLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAKPQTLEEPTKVQELNGHIIDVVKPNHA  243

Query  172  QKGTDDEIHETTPS  131
             K     + E   S
Sbjct  244  TKNGHVPVIEIASS  257



>emb|CDY08093.1| BnaA06g16330D [Brassica napus]
Length=289

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 160/217 (74%), Gaps = 1/217 (0%)
 Frame = -2

Query  895  MMNSHQL-AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG++GN+ISF VFL+P+PTF+ ++K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  YA K+ R+L    +L+ N G   LI++L 
Sbjct  63   YATQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AVVWL
Sbjct  123  QFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT  248
            LYGL ++D Y+A PNV+GFA G +Q+ILY +Y+  KT
Sbjct  183  LYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKT  219



>ref|XP_009149800.1| PREDICTED: bidirectional sugar transporter SWEET11 [Brassica 
rapa]
Length=289

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 160/217 (74%), Gaps = 1/217 (0%)
 Frame = -2

Query  895  MMNSHQL-AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG++GN+ISF VFL+P+PTF+ ++K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  YA K+ R+L    +L+ N G   LI++L 
Sbjct  63   YATQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AVVWL
Sbjct  123  QFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKT  248
            LYGL ++D Y+A PNV+GFA G +Q+ILY +Y+  KT
Sbjct  183  LYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKT  219



>ref|XP_006404221.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
 gb|ESQ45674.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
Length=291

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 178/265 (67%), Gaps = 7/265 (3%)
 Frame = -2

Query  895  MMNSHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG++GN+ISF VFL+P+PTF+ ++K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ +Y  YA K  ++L    +L+ N G   LI+++ 
Sbjct  63   YATQKKDVFLLVTINAFGCFIETIYISMYLAYAPKTAKMLTVKLLLLMNFGGFCLILLIC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL +G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AV+WL
Sbjct  123  QFLFKGPTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGV-AIVVDATAA  182
            LYGL ++DFY+A PNV+GF  G +Q+ILY +Y+  KT     P+ G + V A  +   + 
Sbjct  183  LYGLALKDFYVAFPNVIGFVLGALQMILYVVYKYCKT----PPHLGEKEVEAAKLPEVSL  238

Query  181  EMLQKGTDDEIHETTPSSVVVDMKK  107
            +ML+ GT     E  P +VV    K
Sbjct  239  DMLKLGTISS-PEPAPIAVVRQANK  262



>ref|XP_009591687.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=297

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 177/274 (65%), Gaps = 28/274 (10%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S   A  FG+LGNIISF+VFL+PLPTF+ IYK+KS+EG+  +PY VALFS M+ +YYAL+
Sbjct  5    SGHWAFAFGVLGNIISFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYALL  64

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   LITIN  G+F+ETIY+  Y  YA K+ ++     +L+  +G  G IV++T FL 
Sbjct  65   KTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLF  124

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R ++VGWI  V S+CVF APL I+ KVI+TKSVEYMP  LS+FLTL AV+W  YGL
Sbjct  125  KGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQK  167
             ++D  IA PNVLGF  GI+Q++LYAIY  ++ A                      +L++
Sbjct  185  LLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKA----------------------ILKE  222

Query  166  GTDDEIHETTPSSVVVD----MKKVVEMQQGKVV  77
                EI +  P  +VVD     KK+ E+ Q +++
Sbjct  223  QKLPEIQK--PEVIVVDENMNSKKLPELTQEQII  254



>gb|EYU23059.1| hypothetical protein MIMGU_mgv1a019104mg [Erythranthe guttata]
Length=278

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = -2

Query  853  GNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFLITIN  674
            GNI+SFMVFLAPLPTFH IYKRKSSEGF  +PY V LFS M+ +YYAL+K     LITIN
Sbjct  5    GNIVSFMVFLAPLPTFHQIYKRKSSEGFQSVPYVVGLFSAMLWIYYALLKPDTTLLITIN  64

Query  673  GIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRVKIVGW  494
             +G F++T Y+  Y  YA K  R+     V + N+  +GLIVVLT F+++G  R  IVGW
Sbjct  65   SVGCFIQTTYICFYLFYAPKSARLQTLALVFLLNVVGMGLIVVLTQFVAKGYNRAAIVGW  124

Query  493  ILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYIATPN  314
            I  V S+CVF APL ++ +V+RTKSVEYMPF LS FLTL AV+W  YGL  +D+ IA PN
Sbjct  125  ICLVFSLCVFIAPLCVVRQVVRTKSVEYMPFLLSFFLTLSAVMWFFYGLIRKDYNIAIPN  184

Query  313  VLGFACGIVQLILYAIYRDRK  251
            VLGF  G++Q++LY +Y++ K
Sbjct  185  VLGFIFGVIQMMLYVMYKNTK  205



>ref|XP_007137870.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
 gb|ESW09864.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
Length=264

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/260 (47%), Positives = 172/260 (66%), Gaps = 4/260 (2%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            ++    A VFG+LGN+ISFMVFLAPLPTF+ IYK+K++EGF  LPY VALFS M+ +YYA
Sbjct  3    IHHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSMLWIYYA  62

Query  712  LVKQHV-LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            LVK+   L LITIN  G  +E+IYL ++ +YA  + R+     +L+ N+   G +++ T 
Sbjct  63   LVKKDASLLLITINSFGCVIESIYLAIFLLYAPSKTRLCTIKLLLLLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            + + G+KR+ ++GWI  V ++ VFAAPL IM +VI+TKSVEYMPF+LS FLT+ AV+W  
Sbjct  123  YFTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTKSVEYMPFSLSFFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YGL ++D+YIA PN LGF  GI+Q++LY +YR+ K   +  P    +    +VD      
Sbjct  183  YGLLLKDYYIALPNTLGFLFGIIQMMLYLVYRNAKPKTLEEPTKLQELNGHIVDVVK---  239

Query  175  LQKGTDDEIHETTPSSVVVD  116
            L      E +  T S  V +
Sbjct  240  LGTMAPSEPNHVTKSGAVTE  259



>gb|KHN24976.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=272

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 170/263 (65%), Gaps = 16/263 (6%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H LA  FG+LGN+ISF+VFLAP+PTF+ IYK+KS+E F  LPY VALFS M+ LYYAL+K
Sbjct  6    HTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYALLK  65

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
            +  + LITIN  G  +E IY+VLY  YA +  R L        N+    +I+++T+F   
Sbjct  66   RDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLVTHFGVH  125

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G  RV+++GWI   ISV VFAAPLSI+ +V+RTKSVE+MPFNLS  LTL A++W  YGL 
Sbjct  126  GPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGLF  185

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYR--DRKTA--------------AVVAPNGGIQG  212
            ++D  IA PNVLGF  G++Q++LY IYR  ++KT               AVV P G  + 
Sbjct  186  LKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTNTNEKSLSVKPLKNIAVVNPLGTGEV  245

Query  211  VAIVVDATAAEMLQKGTDDEIHE  143
              +  D  AA+  Q   +D+  E
Sbjct  246  FPVEEDEQAAKKSQGDGEDKKAE  268



>ref|XP_003530901.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=272

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 170/263 (65%), Gaps = 16/263 (6%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H LA  FG+LGN+ISF+VFLAP+PTF+ IYK+KS+E F  LPY VALFS M+ LYYAL+K
Sbjct  6    HTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYALLK  65

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
            +  + LITIN  G  +E IY+VLY  YA +  R L        N+    +I+++T+F   
Sbjct  66   RDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLVTHFGVH  125

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G  RV+++GWI   ISV VFAAPLSI+ +V+RTKSVE+MPFNLS  LTL A++W  YGL 
Sbjct  126  GPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGLF  185

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYR--DRKTA--------------AVVAPNGGIQG  212
            ++D  IA PNVLGF  G++Q++LY IYR  ++KT               AVV P G  + 
Sbjct  186  LKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTNTNEKSLSVKPLKNIAVVNPLGTGEV  245

Query  211  VAIVVDATAAEMLQKGTDDEIHE  143
              +  D  AA+  Q   +D+  E
Sbjct  246  FPVEEDEQAAKKSQGDGEDKKAE  268



>ref|XP_009758167.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 168/248 (68%), Gaps = 2/248 (1%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S   A  FG+LGNI+SF+VFL+PLPTF+ IYK+KS+EG+  +PY VALFS M+ +YYA +
Sbjct  5    SGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWVYYAFL  64

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   +ITIN  G F+ETIY+  Y  YA K+ RI     +++  +G  G+IV++T FL 
Sbjct  65   KTNTTLIITINSFGCFIETIYVGFYLFYAPKKARIQTVKMLVLSVVGGFGVIVLVTQFLF  124

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R + VGWI  V S+CVF APL I+ +VI+TKSVEYMP  LS+FLTL AV+W  YGL
Sbjct  125  KGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN--GGIQGVAIVVDATAAEML  173
             ++D  IA PNVLGF  GI+Q++LY IY  ++ A +        IQ   I+VD    + L
Sbjct  185  LVKDINIAIPNVLGFVLGILQIVLYVIYNKKEKAILKEEKVPEKIQNHVIIVDDYNNQKL  244

Query  172  QKGTDDEI  149
             + T+++I
Sbjct  245  PELTEEQI  252



>ref|XP_010442555.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X1 [Camelina sativa]
 ref|XP_010442556.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X2 [Camelina sativa]
Length=288

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 173/264 (66%), Gaps = 4/264 (2%)
 Frame = -2

Query  877  LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQH  698
            LA VFGILGNIISF V LAP+PTF  IYKRKSSEG+  +PY ++LFS M+ LYYA++K+ 
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKD  67

Query  697  VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN  518
             + LITIN     V+ +Y+ LYF YA K+ +IL    VL  ++   GLI +LTYFL+ GN
Sbjct  68   AMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKCVLFVDVFAFGLIFLLTYFLTHGN  127

Query  517  KRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIR  338
            KRV+++G+I  V S+ VF APL I+ KVI+TKS E+MPF LS FLTL A++W  YGL ++
Sbjct  128  KRVQVLGYICMVFSLSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLK  187

Query  337  DFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAI-VVDATAAEMLQKGT  161
            D  IA PNVLGF  G++Q+IL+ IY+   T  +      +Q ++  VVD      +    
Sbjct  188  DKNIALPNVLGFIFGVLQMILFVIYKKPGTKVLEPSVIKLQDISEHVVDVVRLSSMV--C  245

Query  160  DDEIHETTPSSVVVDMKKVVEMQQ  89
            + ++    P     DM+  +++ +
Sbjct  246  NSQMRTLVPQD-SADMEDTIDLDE  268



>ref|XP_002511126.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51728.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 174/276 (63%), Gaps = 15/276 (5%)
 Frame = -2

Query  889  NSHQLA-GVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            N+H  +  VFG+LGNI+SF+VFLAP+PTF  + K+KS+EGF   PY V+LFS M+ LYYA
Sbjct  5    NTHNPSVFVFGLLGNIVSFVVFLAPVPTFLRVCKKKSTEGFQSFPYVVSLFSAMLWLYYA  64

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             +K     LITIN +G  +ETIY+ L+  YA K+ RI     +L+ N G   LI++L++F
Sbjct  65   SLKSDAFLLITINSVGCLIETIYITLFITYAPKQARITTLKILLLLNFGGFCLILLLSHF  124

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L++G++R  I+GW+  + SV VFAAPLS+M  VIRTKSVE+MPF LS FLTL A++WL Y
Sbjct  125  LAKGSERATILGWVCVIFSVSVFAAPLSVMRIVIRTKSVEFMPFYLSFFLTLSAIMWLFY  184

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA--PNGGIQGVAIV------V  197
            GL ++D YIA PN+LG   G++Q+ILY IY++ KT       P   +  V +       V
Sbjct  185  GLLLKDLYIAVPNILGLVFGVLQMILYVIYKNVKTVVEEPKLPEHNVDNVKLSAVITCEV  244

Query  196  DATAAEMLQKGTDDEIH------ETTPSSVVVDMKK  107
                    Q   DD  H         P++ V + ++
Sbjct  245  QQEVCSQSQPNGDDGAHNKEQKMHDNPANAVTEYQR  280



>ref|XP_007222479.1| hypothetical protein PRUPE_ppa009789mg [Prunus persica]
 gb|EMJ23678.1| hypothetical protein PRUPE_ppa009789mg [Prunus persica]
Length=277

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 172/277 (62%), Gaps = 10/277 (4%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            + H  A  FGILGN+ISF+V+LAP+PTF+ IYK+KS++GF  +PY VALFS M+  YYAL
Sbjct  7    SHHPWAFTFGILGNVISFLVYLAPVPTFYGIYKKKSTQGFQSVPYLVALFSGMLWFYYAL  66

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K++ + LITIN  G  +ETIY+V++  YA K  R          N+G+   I+VL++F 
Sbjct  67   LKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVLSHFA  126

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
                 RV ++GWI   ISV VFAAPLSI+ +VIRT+SVE+MPF+LS FLTL AV+W  YG
Sbjct  127  VRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAVMWFSYG  186

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN--GGIQGVAIVVDATAAEM  176
            L ++D  IA PNVLGF  G++Q++LYAIYR+RK             Q V  VV  T    
Sbjct  187  LFLKDICIAIPNVLGFILGLLQMLLYAIYRNRKPIEDDEKKIPAADQHVKNVVGLTTL--  244

Query  175  LQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV*ATS  65
                   E+H   P     D  K VE+  G    A S
Sbjct  245  ----ATSEVHPVDPPP--RDHDKSVEVDAGSHTAAAS  275



>ref|XP_010454652.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 183/283 (65%), Gaps = 15/283 (5%)
 Frame = -2

Query  895  MMNSHQL-AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG+LGN+ISF VFL+P+PTF+ I K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+L    +L+ N+G    I++L 
Sbjct  63   YATQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LSL LT+ AV+WL
Sbjct  123  QFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAE  179
            LYGL ++D Y+A PNV+GF  G +Q+ILY +Y+  KT + +         A + D  + +
Sbjct  183  LYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKE--LETAKLPDEVSID  240

Query  178  MLQKGTDDEIHETTPSSVVV----------DMKKVVEMQQGKV  80
            ML+ GT   I    P+++ V          D K  +E  QG V
Sbjct  241  MLKLGT--LIASPEPAAITVVRPVNMCNCNDRKADIENGQGLV  281



>ref|XP_009758165.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 167/248 (67%), Gaps = 2/248 (1%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S   A  FG+LGNIISF+VFL+PLPTF+ IYK+KS+EG+  +PY VALFS M+ +YYA +
Sbjct  5    SGHWAFAFGVLGNIISFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFL  64

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   +ITIN  G F+ETIY+  Y  YA K+ R+     +L+  +G  G+IV++T FL 
Sbjct  65   KTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTLKMLLLSVVGGFGVIVLVTQFLF  124

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R + VGWI  V S+CVF APL I+ +VI+TKSVEYMP  LS+FLTL AV+W  YGL
Sbjct  125  KGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN--GGIQGVAIVVDATAAEML  173
             ++D  IA PN+LGF  GI+Q++LY IY  ++ A +        IQ   I+VD    + L
Sbjct  185  LVKDINIAIPNILGFILGILQIVLYIIYNKKEKAILKEQKLPEKIQNHVIIVDENNNQKL  244

Query  172  QKGTDDEI  149
             + T++ I
Sbjct  245  PELTEEHI  252



>gb|KHG03157.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=286

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 178/273 (65%), Gaps = 2/273 (1%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M + H LA  FG+LGNIIS +V+LAPLPTF+ IYK+KS+E F  LPY VALFS M+ LYY
Sbjct  4    MADHHSLAVAFGVLGNIISVLVYLAPLPTFYRIYKKKSTESFQSLPYQVALFSSMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K+    LITIN  G  VETIY+ +Y  YA K  R+      +  N+ +   I++LT+
Sbjct  64   ALMKKGAFLLITINSFGCVVETIYIAIYIAYATKNSRVSAIKLFVAMNVALFSFIIILTH  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            FL +G+ RV+++GWI   ISV VFAAPL+++ +VIRTKSVE+MPFNLS FLTL AV+W  
Sbjct  124  FLVKGSIRVQVLGWICVAISVSVFAAPLNVVARVIRTKSVEFMPFNLSFFLTLSAVMWFA  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRD-RKTAAVVAPNGGIQGVAIVVDATAAE  179
            YGL ++D  +A PNV+GF  G++Q++LYAIYR+  K          ++GV ++     +E
Sbjct  184  YGLFMKDLCVALPNVIGFVLGMLQMLLYAIYRNSEKVIEEKKIPEQMKGVVVLSTLGPSE  243

Query  178  MLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKV  80
            +   G D E  +  P     + ++  E  +  V
Sbjct  244  VYPVGVDIE-PDVKPKEDTTENEQTGEPDKNDV  275



>emb|CDY53626.1| BnaC03g71480D [Brassica napus]
Length=291

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/267 (48%), Positives = 166/267 (62%), Gaps = 11/267 (4%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA +FGILGN ISF VFLAPLPTF+ IYK KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MINHHLLAIIFGILGNAISFCVFLAPLPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+KQ    LITIN  G  VETIY+ L+F YA +  RI         N+    LI+++T+
Sbjct  64   ALIKQDAFLLITINSFGCIVETIYIALFFAYATRGKRIAAMKLFFTINVAFFSLILMVTH  123

Query  535  F-LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F +   + +V I+GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LSLFLT+ AV+W 
Sbjct  124  FAVKSPSLQVSIIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSLFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR--KTAAVVAPNGGIQGVAIVV----  197
             YG  + D  IA PNV+GF  G++Q++LY +YR+   K  A    N   Q +  +V    
Sbjct  184  AYGAFLHDICIAIPNVVGFILGMLQMVLYGVYRNSGVKIDAEKKINSLDQQLKTIVVISQ  243

Query  196  ----DATAAEMLQKGTDDEIHETTPSS  128
                +    ++      D +H   PS 
Sbjct  244  LGVSEVHPVDITVDPLSDAVHHEDPSK  270



>ref|XP_002450786.1| hypothetical protein SORBIDRAFT_05g018110 [Sorghum bicolor]
 gb|EES09774.1| hypothetical protein SORBIDRAFT_05g018110 [Sorghum bicolor]
Length=291

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 160/212 (75%), Gaps = 2/212 (1%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPL--PTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
             H +A  FG+LGNIISFM +LAPL  PTF+ IYK KS++GF  +PY VALFS M+ +YYA
Sbjct  7    QHPMAFAFGLLGNIISFMTYLAPLYRPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIYYA  66

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            L+K +   LITIN  G  +ET+Y+V+Y +YA K+ ++  A  +L+ N+GV GLI++LT  
Sbjct  67   LLKSNEFLLITINSAGCVIETLYIVMYLLYAPKKAKLFTAKILLLLNVGVFGLILLLTLL  126

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            LS G  RV ++GW+    SV VF APLSI+ +V+RT+SVE+MPF+LSL LT+ AVVW LY
Sbjct  127  LSAGQHRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVVWFLY  186

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
            GL I+D Y+A PNVLGF+ G+VQ+ LYA+YR+
Sbjct  187  GLLIKDKYVALPNVLGFSFGVVQMGLYALYRN  218



>ref|XP_010421173.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 183/283 (65%), Gaps = 15/283 (5%)
 Frame = -2

Query  895  MMNSHQL-AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG+LGN+ISF VFL+P+PTF+ I K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+L    +L+ N+G    I++L 
Sbjct  63   YATQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LSL LT+ AV+WL
Sbjct  123  QFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAE  179
            LYGL ++D Y+A PNV+GF  G +Q+ILY +Y+  KT + +         A + D  + +
Sbjct  183  LYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKE--LETAKLHDEVSID  240

Query  178  MLQKGTDDEIHETTPSSVVV----------DMKKVVEMQQGKV  80
            ML+ GT   I    P+++ V          D K  +E  QG V
Sbjct  241  MLKLGT--LIASPEPAAITVVRPVNMCNCNDRKAEIENGQGLV  281



>ref|XP_004980522.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=299

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 166/234 (71%), Gaps = 4/234 (2%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H LA  FG+LGNIISFM +LAPLPTF+ IYK KS+EGF  +PY VALFS M+ +YYAL+
Sbjct  7    DHPLAFTFGLLGNIISFMTYLAPLPTFYRIYKTKSTEGFQSVPYVVALFSAMLWIYYALL  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K     LIT+N  G  +ET+Y+ +Y  YA K+ ++  A+ +L+ N+GV GLI++LT  L+
Sbjct  67   KSDEFLLITVNAAGCVIETLYITMYLAYAPKKAKLFTAMILLLLNVGVFGLILLLTMLLA  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G KRV ++GW+    +V VF APLSI+ +V+RT+SVE+MPF LSL LT+ AVVW LYGL
Sbjct  127  AGEKRVVLLGWVCVGFAVSVFVAPLSIIRQVVRTRSVEFMPFFLSLSLTVSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGV-AIVVDAT  188
             I+D Y+A PNV+GF  G++Q+ LYA+YR+   A    P   +  V A VVD T
Sbjct  187  LIKDKYVALPNVIGFTFGVIQMGLYALYRN---ATPRVPAKEVADVKATVVDDT  237



>emb|CDX97233.1| BnaC09g43920D [Brassica napus]
Length=298

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 153/214 (71%), Gaps = 1/214 (0%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA VFGILGN ISF+VFLAP+PTF+ IYK+KS+E F  LPY V+LFSCM+ L Y
Sbjct  4    MINHHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLCY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+KQ    LITIN  G  VETIY+ ++F YA K  R+      L  N+    LI+++T+
Sbjct  64   ALIKQDAFLLITINSFGCVVETIYIAMFFTYATKDKRVAAMKLFLTINVAFFSLILMVTH  123

Query  535  F-LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F +   + +V ++GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FAVKRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
             YGL + D  IA PNV+GF  G++Q++LY IYR+
Sbjct  184  AYGLFLHDICIAIPNVVGFILGMIQMVLYGIYRN  217



>ref|XP_002322281.2| N3 like family protein [Populus trichocarpa]
 gb|EEF06408.2| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 157/224 (70%), Gaps = 0/224 (0%)
 Frame = -2

Query  865  FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFL  686
            FG+LGN IS +V LAPLPTF+ I K+K+S+GFH +PY +ALFS M+ L+YAL K+  L L
Sbjct  11   FGLLGNFISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFYALFKEDALLL  70

Query  685  ITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRVK  506
            ITIN    F+E  Y+ +Y +YA K+ +IL    +L+FN+   GLI VLT FL++  KRV+
Sbjct  71   ITINSFTFFMEIGYIFMYLLYATKKDKILTFKLLLLFNVFGFGLICVLTRFLTQRQKRVQ  130

Query  505  IVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYI  326
            ++GWI    S+CVF APL I+ KVIRTKSVE+MPF+LS FLTL AV+W  YG   +D ++
Sbjct  131  VLGWICMTFSLCVFVAPLFIVRKVIRTKSVEFMPFSLSFFLTLSAVMWFFYGFLKKDQFV  190

Query  325  ATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVD  194
            A PN+LG   GI+Q++LY IYR+ K   VV P   +     VVD
Sbjct  191  AVPNILGLLFGILQMVLYMIYRNSKKVVVVEPKLKLDISEHVVD  234



>ref|XP_009411801.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 170/255 (67%), Gaps = 4/255 (2%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H L   FG+LGN+ISFMVFLAP+PTF+ +Y++KS+EGFH LPY VA+FSCM+ +YYA V
Sbjct  7    QHPLPFTFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSLPYVVAVFSCMLWIYYAYV  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K   + LITIN  G+F+ET Y+ +Y +YA K+ RI+     ++ N+ V   I++LT  L 
Sbjct  67   KTDSILLITINSFGVFIETAYITIYLIYAPKKTRIMSMRIFVLLNVVVFAAIILLTQLLF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G+ R+K++GWI    SV VFAAPLS++  VIRTKSVE++PF LS FLTL A+ W  YGL
Sbjct  127  TGSIRLKVLGWICVGFSVSVFAAPLSVIRLVIRTKSVEFLPFYLSFFLTLSAIAWFGYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNG--GIQGVAIVVDATAAEML  173
              +D Y+  PNVLGF  G+ Q++LY I   +K   VV P G   I  +A +  A A+E L
Sbjct  187  FTKDIYVQLPNVLGFLFGVAQMVLY-IVYKKKKNVVVEPAGIEHIVRIAELAIAPASE-L  244

Query  172  QKGTDDEIHETTPSS  128
            Q G ++  H    S 
Sbjct  245  QAGVEENDHRKKASE  259



>gb|EMS46194.1| Bidirectional sugar transporter SWEET15 [Triticum urartu]
Length=345

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 170/273 (62%), Gaps = 11/273 (4%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M  H  A  FGILGNIIS MVFL+PLPTF+ +Y++KS+EGF   PY V LFSC++ +YYA
Sbjct  6    MEQHTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYLVTLFSCLLWMYYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
             +K     L+TIN +G  +E++Y+ +Y VYA K  R+L A   +  ++G+ GLI ++T  
Sbjct  66   FLKSGSELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAKLFIGLDVGLFGLIALVTML  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
             S G  RV++VGWI   +++ VFAAPLSI+  VIRTKSVE+MPF+LS FL L AV+W  Y
Sbjct  126  ASHGPLRVQVVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFAY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV----VAPNGGIQGVAIVVDAT-  188
            G   +D ++A PNVLGF  G+ Q+ LY  YR++K A V      P    +    V   T 
Sbjct  186  GALKKDIFVAMPNVLGFLFGVAQMALYMAYRNKKPATVAVIDTTPRQRQRCTMPVGRQTR  245

Query  187  -----AAEMLQKGTDDEIHE-TTPSSVVVDMKK  107
                 A E  +  T+D +    TPS+  V  K+
Sbjct  246  RHKPFATEKNRGSTNDALKRGMTPSATDVKSKR  278



>ref|XP_004310113.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Fragaria 
vesca subsp. vesca]
Length=305

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 153/211 (73%), Gaps = 0/211 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H  A  FGILGN+ISFMV+LAP+PTF+ I+K+KS+EGF  +PY VALFS  + LYYA++K
Sbjct  9    HPWAFTFGILGNLISFMVYLAPVPTFYRIFKKKSTEGFQSVPYLVALFSATLWLYYAMLK  68

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
            Q+ + LITIN  G  +ET+Y+ +Y VYA K  R      +   N+G+  LI+V+  +   
Sbjct  69   QNAVLLITINTFGSVIETLYIAMYIVYATKASRKFTIKLLGFMNLGLFSLILVILQYAFH  128

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
               R  ++GWI   ISVCVFAAPLSI+  VIRTKSVE+MPF+LS FLTL AV+W  YGL 
Sbjct  129  SEYRAPVLGWINVAISVCVFAAPLSIVAHVIRTKSVEFMPFSLSFFLTLSAVMWFAYGLF  188

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
            ++D  IA PNVLGF  G++Q++LYAIYR+RK
Sbjct  189  LKDICIALPNVLGFILGLLQMLLYAIYRNRK  219



>gb|AFW71563.1| hypothetical protein ZEAMMB73_472818 [Zea mays]
Length=333

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 149/218 (68%), Gaps = 0/218 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A  FGILGNIIS MVFL+PLPTF+ +Y++KS+EGF   PY V LFSCM+ ++YA
Sbjct  6    MEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYA  65

Query  712  LVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
            L+K     L+TING+G  +E  YL  Y VYA K  R L A  +L  N+GV GL  + T  
Sbjct  66   LLKSGAELLVTINGVGCVIEAAYLAAYLVYAPKAARALTAKMLLGLNVGVFGLAALATMV  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            +S    RV+++GWI   +++ VFAAPLSIM +V+RTKSVE+MP +LS FL L AV+W  Y
Sbjct  126  VSSAGLRVRVLGWICVSVALSVFAAPLSIMRQVVRTKSVEFMPISLSFFLVLSAVIWFAY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
            G   RD ++A PNVLGF  G+ Q+ LY  YR+++ AAV
Sbjct  186  GALKRDVFVAFPNVLGFVFGVAQIALYMAYRNKEPAAV  223



>emb|CAC44123.1| N3 like protein [Medicago truncatula]
Length=255

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 173/250 (69%), Gaps = 10/250 (4%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A VFGI+GNIISF VFL+PLPTF+ I+K+KS+EGF  LPY VALFS M+ +YYA
Sbjct  3    MTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYA  62

Query  712  LVKQH-VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             VK+   L LITIN  GI VE+ Y++++ +YA K+ R+     +L+ N+   G +++ T 
Sbjct  63   FVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +LS+G KR+ I+GWI  V ++ VFAAPL ++ KVIR++SVEYMPF LS FLT+ AV+W  
Sbjct  123  YLSKGAKRLAIIGWICLVFNISVFAAPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGG--IQGVAIVVDATAA  182
            YGL +RD+Y+A PN LGF  GI+Q+++Y IYR+  T  V AP  G  + G  I+      
Sbjct  183  YGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRN-ATPVVEAPMKGQELSGGHII------  235

Query  181  EMLQKGTDDE  152
            ++++ GTD  
Sbjct  236  DVVKIGTDSN  245



>emb|CDX78511.1| BnaA03g04230D [Brassica napus]
Length=292

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 129/292 (44%), Positives = 173/292 (59%), Gaps = 16/292 (5%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M+N H LA +FGILGN ISF VFLAPLPTF+ IYK KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MINHHLLAIIFGILGNAISFCVFLAPLPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+KQ    LITIN  G  VETIY+ L+F YA +  RI         N+    LI+++T+
Sbjct  64   ALIKQDAFLLITINSFGCIVETIYIALFFAYATRDKRIAAMKLFFTINVAFFSLILMITH  123

Query  535  F-LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F +   + +V ++GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FAVRSPSLQVSVIGWICVSISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR--KTAAVVAPNGGIQGVAIVV----  197
             YG  + D  IA PNV+GF  G++Q++LY IYR+   K       N   Q +  +V    
Sbjct  184  AYGAFLHDICIAIPNVVGFILGMLQMVLYGIYRNSGVKIDTEKKINSSEQQLKTIVVMSQ  243

Query  196  ----DATAAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV*ATSLRYN  53
                +    ++      + +H   PS      +K   ++ GK    T  R+ 
Sbjct  244  LGVSEVHPVDITVDPLSETVHHEDPSK-----QKEPSIEDGKCHVGTVARFE  290



>ref|XP_003552719.1| PREDICTED: bidirectional sugar transporter NEC1-like [Glycine 
max]
Length=262

 Score =   233 bits (594),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 176/272 (65%), Gaps = 15/272 (6%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            + + H+L  +FG+LGNI+SFMVFLAPLPTF+TIYK KSSEGF  +PY VAL S ++ LYY
Sbjct  3    LFSDHELVLIFGLLGNIVSFMVFLAPLPTFYTIYKNKSSEGFQSIPYVVALLSALLLLYY  62

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
              +K +   +ITIN IG  +E  YL +Y +YA ++ +I   V +L+ +IG  GL +++T 
Sbjct  63   GFIKTNATLIITINCIGCVIEVSYLAMYIIYAPRKQKISTLVMILIADIGGFGLTMLITT  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            F  +G  RV  VGWI ++ ++ VFAAPLSIM +VI+TKSVE+MPF+LSLFLTLCA +W  
Sbjct  123  FAVKGINRVHAVGWICAIFNIAVFAAPLSIMRRVIKTKSVEFMPFSLSLFLTLCATMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YG   +D +I  PNVLGF  GI Q+ILY IY++ K       NG I       + T  + 
Sbjct  183  YGFFDKDNFIMLPNVLGFLFGISQMILYMIYKNAK------KNGEI-------NCTEQQE  229

Query  175  LQKGTDDEIHETTPSSVVVDMKKVVEMQQGKV  80
                 + + H    +   +D   +VEM++ ++
Sbjct  230  RDGTVNSKQHSCNGNK--LDFSSLVEMKENQL  259



>ref|XP_006394628.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
 gb|ESQ31914.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
Length=288

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 179/278 (64%), Gaps = 16/278 (6%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
              +  A  FG+LGN+ISF VFL+P+PTF+ I+K+K++EGF  LPY VALFS M+ LYYA 
Sbjct  6    TQNTWAFAFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLWLYYAT  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
             K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+     +L+ N G   LI++L  FL
Sbjct  66   QKKDVFLLVTINSFGCFIETIYIAIFVAFAPKKARMFTVKLLLLMNFGGFCLILLLCQFL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
            ++G  R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LS+ LTL AVVWLLYG
Sbjct  126  AKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSVSLTLSAVVWLLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L ++D Y+A PNV+GF  G +Q+ILY +++  KT + +      +  A  +   + +ML+
Sbjct  186  LALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLMEK---ELEAAKLPEVSIDMLK  242

Query  169  KGTDDEIHETTPSSVVV----------DMKKVVEMQQG  86
             GT   +    P+++ V          D K  +E  QG
Sbjct  243  LGT---LASPEPAAITVVRSVNTCVCNDRKAEIENGQG  277



>gb|KFK25541.1| hypothetical protein AALP_AA8G128400 [Arabis alpina]
Length=299

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 178/292 (61%), Gaps = 22/292 (8%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M++ H LA +FGILGN ISF VFLAP+PTF+ I+K+KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MIDHHLLANIFGILGNFISFCVFLAPVPTFYRIFKKKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+K+    LITIN  G  VETIY+ ++  YA K  +       +  N+     I+++T+
Sbjct  64   ALLKKGAFLLITINCFGCVVETIYIAMFLTYATKDKKTSAMKLFMAMNVAFFSSILLMTH  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            F  +   +V ++GWI   ISV VFAAPL ++ +VI+TKSVE+MPF+LS FLT+ AV+W  
Sbjct  124  FFVKSPLKVSVLGWICVAISVSVFAAPLMVVARVIKTKSVEFMPFSLSFFLTISAVMWGA  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYR---------DRKTAAVVAPNGGIQGVAI  203
            YGL + D  IA PNV+GF  G+VQ++LY IY+         ++K  +  +    ++ V +
Sbjct  184  YGLFLHDICIAIPNVVGFLLGMVQMVLYGIYKNSKGEFEINEKKVNSSTSSEQQLKSVVV  243

Query  202  V----------VDATAAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV  77
            +          VD T  E ++    D  HE  PS    +M+  +E  +  VV
Sbjct  244  MSPLGVSEVHPVDVTVTETVEVPLSDHDHEEDPSK---EMEPSIEDGKCHVV  292



>gb|KEH20983.1| bidirectional sugar transporter [Medicago truncatula]
Length=255

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 163/227 (72%), Gaps = 2/227 (1%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A VFGI+GNIISF VFL+PLPTF+ I+K+KS+EGF  LPY VALFS M+ +YYA
Sbjct  3    MTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYA  62

Query  712  LVKQH-VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             VK+   L LITIN  GI VE+ Y++++ +YA K+ R+     +L+ N+   G +++ T 
Sbjct  63   FVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +LS+G KR+ I+GWI  V ++ VFAAPL ++ KVIR++SVEYMPF LS FLT+ AV+W  
Sbjct  123  YLSKGAKRLAIIGWICLVFNISVFAAPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQ  215
            YGL +RD+Y+A PN LGF  GI+Q+++Y IYR+  T  V AP  G +
Sbjct  183  YGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRN-ATPVVEAPMKGQE  228



>ref|XP_011036129.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Populus 
euphratica]
Length=282

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 172/268 (64%), Gaps = 12/268 (4%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M   H LA  FGILGNIISFMV+LAP+PTF  I ++KS+E F  LPY VALFS M+ LYY
Sbjct  4    MNMQHPLAFTFGILGNIISFMVYLAPVPTFIRILRKKSTEDFQSLPYLVALFSSMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            A++K   + L+TIN  G  +E+IY+ +Y  YA +  R+     ++  N+G+  LI++LT+
Sbjct  64   AMLKNDAILLVTINSFGCVIESIYIAIYIAYATRESRVSTIKLLVSMNMGLFSLILLLTH  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            FL+ G+ RVK +GW+    SVCVFAAPLSI+ ++IRTKSVE+MPF LS FLTL AV+W  
Sbjct  124  FLASGSTRVKALGWLCVAFSVCVFAAPLSIVKQIIRTKSVEFMPFTLSFFLTLSAVMWFA  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAP------------NGGIQG  212
            YGL I+D  +A PN+LGF  G++Q++LY IYR+ K   + A                +  
Sbjct  184  YGLFIKDLCVALPNILGFVLGLLQMLLYGIYRNAKKKKIPAEILKSSVILSTLGASEVYP  243

Query  211  VAIVVDATAAEMLQKGTDDEIHETTPSS  128
            V    D +AAE  Q     E  ++T +S
Sbjct  244  VDAQPDVSAAEHDQTEESKENEKSTDAS  271



>ref|XP_010493487.1| PREDICTED: bidirectional sugar transporter SWEET12 [Camelina 
sativa]
Length=289

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 183/283 (65%), Gaps = 15/283 (5%)
 Frame = -2

Query  895  MMNSHQL-AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG+LGN+ISF VFL+P+PTF+ I K+K++EGF  LPY VALFS  + LY
Sbjct  3    LFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+L    +L+ N+G    I++L 
Sbjct  63   YATQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LSL LT+ AV+WL
Sbjct  123  QFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAE  179
            LYGL ++D Y+A PNV+GF  G +Q+ILY +Y+  KT + +         A + D  + +
Sbjct  183  LYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKE--LETAKLPDEVSID  240

Query  178  MLQKGTDDEIHETTPSSVVV----------DMKKVVEMQQGKV  80
            ML+ GT   I    P+++ V          D K  +E  QG V
Sbjct  241  MLKLGT--LIASPEPAAITVVRPVNMCNCNDRKVEIENGQGLV  281



>ref|XP_011023931.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
 ref|XP_011023932.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=258

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 162/248 (65%), Gaps = 12/248 (5%)
 Frame = -2

Query  865  FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFL  686
            FG+LGNIIS +V LAPLPTF+ I K+K+S+GFH +PY +ALFS M+ L+YAL K+  L L
Sbjct  11   FGLLGNIISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFYALYKEDALLL  70

Query  685  ITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRVK  506
            ITIN    F+E  Y+ +Y  YA K+ +IL    +L+FN+   GLI VLT FL++  KRV+
Sbjct  71   ITINSFTFFMEIGYIFMYLFYATKKDKILTFKLLLLFNVFGFGLICVLTRFLTQRQKRVQ  130

Query  505  IVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYI  326
            ++GWI    S+CVF APL I+ KVI+TKSVE+MPF+LS FLTL AV+W  YG   +D ++
Sbjct  131  VLGWICMTFSLCVFVAPLFIVRKVIKTKSVEFMPFSLSFFLTLSAVMWFFYGFLKKDQFV  190

Query  325  ATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVD------------ATAA  182
            A PN+LG   GI+Q++LY IYR+ K   VV P   +     VVD            AT  
Sbjct  191  AVPNILGLLFGILQMVLYMIYRNSKKVVVVEPKLQLDISEHVVDLEKFGATICSEIATGI  250

Query  181  EMLQKGTD  158
              L  G D
Sbjct  251  PKLNDGGD  258



>ref|XP_010250599.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nelumbo 
nucifera]
Length=287

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 154/211 (73%), Gaps = 0/211 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H     FG+LGN+ISFMV+LAPLPTF  IYK+KS+EGF  +PY VALFS M+ +YYA +K
Sbjct  8    HPWTFTFGLLGNLISFMVYLAPLPTFFRIYKKKSTEGFQSVPYVVALFSAMLWIYYAFLK  67

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
                 LITIN  G F+ET+Y+V++ +YA K+ RI     +L+ N+G   LI++LT FL+ 
Sbjct  68   PDAHLLITINSFGCFIETVYIVMFMIYASKKVRIETIKLLLLLNVGTFCLILLLTLFLAH  127

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G KR +IVGW+    SV VFAAPLSIM  VIRTKSVE+MPF+LS FLTL AV+W  YG  
Sbjct  128  GTKRAQIVGWLCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAVMWFSYGFL  187

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
             +D Y+A PN+LGF  GI+Q++LY IY+D K
Sbjct  188  QKDLYVALPNILGFIFGILQMLLYVIYKDSK  218



>ref|XP_010442345.1| PREDICTED: bidirectional sugar transporter SWEET10 [Camelina 
sativa]
Length=289

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 157/217 (72%), Gaps = 1/217 (0%)
 Frame = -2

Query  877  LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQH  698
            LA VFGILGNIISF V LAP+PTF  IYKRKSSEG+  +PY ++LFS M+ LYYA++K+ 
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKD  67

Query  697  VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN  518
             + LITIN     V+ +Y+ LYF YA K+ +IL    VL  ++   GLI +LTYFL+ GN
Sbjct  68   AMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLLTYFLTHGN  127

Query  517  KRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIR  338
            KRV+++G+I  V ++ VF APL I+ KVI+TKS E+MPF LS FLTL A++W  YGL ++
Sbjct  128  KRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLK  187

Query  337  DFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN  227
            D  IA PNVLGF  G++Q+IL+ IY+   T  V+ P+
Sbjct  188  DKNIALPNVLGFIFGVLQMILFVIYKKPGT-KVLEPS  223



>ref|XP_010039121.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
 gb|KCW49070.1| hypothetical protein EUGRSUZ_K02670 [Eucalyptus grandis]
Length=284

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 175/274 (64%), Gaps = 12/274 (4%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             +  A  FG+LGN+ISFMVFLAP+PTF+ + KRKS+EGF  +PY V+L S M+ LYYA +
Sbjct  7    DNPWAFAFGLLGNLISFMVFLAPVPTFYGVCKRKSTEGFQSVPYVVSLLSAMLWLYYASI  66

Query  706  --KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYF  533
              + +   L+T+N +G  +ETIY+ LY  YA K+ +I  A  ++V   G     ++L+ F
Sbjct  67   NSESNDFLLVTVNSVGCVIETIYVALYLAYAPKKAKIFTA-KLMVMGFGGFCSFILLSRF  125

Query  532  LSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLY  353
            L+EG+ RV+++GW+    SV VFAAPLS+M  VIRTKSVE+MPF+LS FLTL AV WLLY
Sbjct  126  LTEGSTRVQLLGWLCVGFSVIVFAAPLSVMRMVIRTKSVEFMPFSLSFFLTLSAVTWLLY  185

Query  352  GLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN--GGIQGVAIVVDATAAE  179
            G+ ++D +IA PNVLGF  G++Q+ LY IYR R    +  P+  GG + +A     + A 
Sbjct  186  GIFLKDIHIAVPNVLGFILGVLQMGLYLIYRKRNIMVLEKPDYLGGAKPIANTQSCSIAS  245

Query  178  MLQ-------KGTDDEIHETTPSSVVVDMKKVVE  98
                      K   +++HE   SS   D ++V  
Sbjct  246  NDNVIHVDEVKERKEDVHEGEKSSEASDNEQVAN  279



>gb|AFK48645.1| unknown [Lotus japonicus]
Length=247

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 156/213 (73%), Gaps = 1/213 (0%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A VFG++GN+ISFMVFLAPLPTF+ IYK+K++EGF  LPY VALFS M+ +YYA
Sbjct  3    MTRESWAFVFGLMGNVISFMVFLAPLPTFYQIYKKKTAEGFQALPYVVALFSAMLWIYYA  62

Query  712  LVKQH-VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             VK+   L LITIN  GI VE+IY+  +  YA K+ R+     +L+ N+   G +++ T 
Sbjct  63   FVKRESALLLITINTFGIVVESIYIAFFLFYAPKKSRLSTIKLLLLLNVFGFGAMLLATL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +LS+G KR++I+GWI  V ++ VFAAPL I+ KVIRT+SVEYMPF LS  LT+ AV+W  
Sbjct  123  YLSKGAKRLQIIGWICLVFNISVFAAPLFIISKVIRTRSVEYMPFFLSFSLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRD  257
            YG+ +RD+Y+A PN LGF  GI+Q+++Y IYR+
Sbjct  183  YGMLLRDYYVALPNTLGFVFGIIQMVVYLIYRN  215



>ref|XP_006288378.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
 gb|EOA21276.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
Length=287

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 161/219 (74%), Gaps = 1/219 (0%)
 Frame = -2

Query  895  MMNSHQL-AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG+LGN+ISF VFL+P+PTF+ I K+K++EGF  +PY VALFS M+ LY
Sbjct  3    LFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  +A K  R+L    +L+ N+G    I++L 
Sbjct  63   YATQKKDVFLLVTINSFGCFIETIYISIFLAFATKNARMLTVKLLLLMNVGGFCAILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LSL LT+ AV+WL
Sbjct  123  QFLAKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAA  242
            LYGL ++D Y+A PNV+GFA G +Q+ILY +Y+  KT++
Sbjct  183  LYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTSS  221



>ref|XP_010453373.1| PREDICTED: bidirectional sugar transporter SWEET15 [Camelina 
sativa]
Length=296

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 171/273 (63%), Gaps = 25/273 (9%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M++   LA +FGILGN ISF+VFLAP+PTF+ IYK+KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    MIDHQLLAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+KQ    LITIN  G  VETIY+ ++F YA +  RI      +  N+    LI+++T+
Sbjct  64   ALIKQDAFLLITINSFGCVVETIYIAMFFAYATREKRISAMKLFIAINVAFFSLILMVTH  123

Query  535  FLSEGNK-RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F+ +    +V ++GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FVVKTPTLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR-----------------KTAAVVAP  230
             YGL + D  IA PNV+GF  G++Q++LY IYR+                  K+  V++P
Sbjct  184  AYGLFLHDICIAIPNVVGFVLGMLQMVLYGIYRNSSEKPEMEKKINSSEQQLKSIVVMSP  243

Query  229  NG-------GIQGVAIVVDATAAEMLQKGTDDE  152
             G         + V  + DA   E L K T +E
Sbjct  244  LGVSEVHPVVTEPVGPLSDAVHHEDLSKVTKEE  276



>emb|CDP21121.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 161/238 (68%), Gaps = 1/238 (0%)
 Frame = -2

Query  880  QLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQ  701
            QLA +FG+LGNI+SFMV+LAPLPTF++IYK+KS+EGF  +PY V LFS M+ +YYA +K 
Sbjct  3    QLAFIFGLLGNIVSFMVYLAPLPTFYSIYKKKSTEGFQSVPYVVGLFSAMLRIYYAFLKP  62

Query  700  HVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEG  521
                 ITIN +G F +T+YL  Y  YA +R RI  A  + +  +   G I++LT  LS G
Sbjct  63   DTTLRITINSVGCFFQTVYLCYYLFYAPRRARIQTAKLLALLVVMGFGSIILLTQLLSTG  122

Query  520  NKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCI  341
              R +IVGWI  V+S+CVF APL+I+ +VI TKSVEYMPF  S FLTL A++W  YG   
Sbjct  123  KTRARIVGWIGLVLSLCVFVAPLAIVRQVILTKSVEYMPFLPSFFLTLSAIMWFFYGFLR  182

Query  340  RDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQK  167
            +D+ IA PN+LGF  GI+Q++LY IY++ K  AV      IQ   IV++      LQ+
Sbjct  183  QDYNIAIPNILGFFFGILQMVLYLIYKNAK-KAVEQKLPEIQNQVIVLEEHKLPELQE  239



>ref|NP_197755.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
 sp|O82587.1|SWT12_ARATH RecName: Full=Bidirectional sugar transporter SWEET12; Short=AtSWEET12; 
AltName: Full=MtN3-like protein [Arabidopsis thaliana]
 gb|AAC64192.1| MTN3 homolog [Arabidopsis thaliana]
 dbj|BAA97235.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL09814.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAL15214.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAM47150.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AED93195.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
Length=285

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 160/219 (73%), Gaps = 1/219 (0%)
 Frame = -2

Query  895  MMNSHQL-AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG+LGN+ISF VFL+P+PTF+ I K+K++EGF  +PY VALFS M+ LY
Sbjct  3    LFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+ETIY+ ++  +A K+ R+L    +L+ N G   LI++L 
Sbjct  63   YATQKKDVFLLVTINSFGCFIETIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LSL LT+ AV+WL
Sbjct  123  QFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAA  242
            LYGL ++D Y+A PNV+GF  G +Q+ILY +Y+  KT +
Sbjct  183  LYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPS  221



>gb|EMT20808.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=290

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/266 (47%), Positives = 164/266 (62%), Gaps = 3/266 (1%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISF   LAP+PTF+ I+K KS+EGF  +PY VALFS M+ ++YALV
Sbjct  7    EHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALV  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K     LI+IN  G  +ET+Y+V+Y VYA ++ +I  A  V++ NI   GLI +LT F  
Sbjct  67   KTGEGLLISINAAGCVIETVYIVMYLVYADRKAKIFTAKIVVLLNIAGFGLIFLLTLFAF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G  RV  +GWI    SVCVF APLSI+ +VI+TKSVEYMPF LSL LTL A+VW LYGL
Sbjct  127  HGETRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQK  167
             I+D Y+A PN+LGF  G++Q++LY  Y ++   A     G     A   D      + K
Sbjct  187  LIKDKYVALPNILGFTFGVIQMVLYVFYMNKTPVASQVKEGKEAWKAPAEDHVVVINVGK  246

Query  166  GTDDEIHETTPSSVVVDMKKVVEMQQ  89
                   E  P   V +M   V++ +
Sbjct  247  ADKSSCAEVRP---VTEMAGAVDVPR  269



>gb|EMT03611.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=294

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/266 (47%), Positives = 164/266 (62%), Gaps = 3/266 (1%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISF   LAP+PTF+ I+K KS+EGF  +PY VALFS M+ ++YALV
Sbjct  7    EHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALV  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K     LI+IN  G  +ET+Y+V+Y VYA ++ +I  A  V++ NI   GLI +LT F  
Sbjct  67   KTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNIAGFGLIFLLTLFAF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G  RV  +GWI    SVCVF APLSI+ +VI+TKSVEYMPF LSL LTL A+VW LYGL
Sbjct  127  HGETRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQK  167
             I+D Y+A PN+LGF  G++Q++LY  Y ++   A     G     A   D      + K
Sbjct  187  LIKDKYVALPNILGFTFGVIQMVLYVFYMNKTPMASQVKEGKEAWKAPAEDHVVVINVGK  246

Query  166  GTDDEIHETTPSSVVVDMKKVVEMQQ  89
                   E  P   V +M   V++ +
Sbjct  247  ADKSSCAEVRP---VTEMAGAVDVPR  269



>ref|XP_010503515.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Camelina 
sativa]
Length=294

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 174/261 (67%), Gaps = 5/261 (2%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
              +  A VFG+LGN+ISF VFL+P+PTF+ I+K+K++EGF  LPY VALFS  + LYYA 
Sbjct  6    TENTWAFVFGLLGNVISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSATLWLYYAT  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
             K+ V  L+TIN  G F+ETIY+ ++  YA K  R+L    +L+ N G   +I+++  FL
Sbjct  66   QKKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKILLLMNFGGFCIILLICQFL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AV+WLLYG
Sbjct  126  VKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L ++D Y+A PNV+GF  G +Q+ILY +Y+  KT+  +     ++   +  + T  +ML+
Sbjct  186  LALKDIYVAFPNVIGFGLGALQMILYIVYKYCKTSPHIG-EKEVEAAKLPAEVT-LDMLK  243

Query  169  KGTDDEIHETTPSSVVVDMKK  107
             GT   I    P+ +V+   K
Sbjct  244  LGT---ISSPEPAPLVLQANK  261



>ref|XP_010419882.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/298 (44%), Positives = 183/298 (61%), Gaps = 29/298 (10%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            +++ H LA +FGILGN ISF+VFLAP+PTF+ IYK+KS+E F  LPY V+LFSCM+ LYY
Sbjct  4    IIDHHLLAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            AL+KQ    LITIN  G  VETIY+ ++F YA +  RI      +  N+    +I+++T+
Sbjct  64   ALIKQDAFLLITINSFGCVVETIYIAMFFAYATRDKRISAMKLFIAINVAFFSMILMVTH  123

Query  535  FLSEGNK-RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
            F+      +V ++GWI   ISV VFAAPL I+ +VI+TKSVE+MPF LS FLT+ AV+W 
Sbjct  124  FVVRTPTIQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWF  183

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDR-----------------KTAAVVAP  230
             YGL + D  IA PNV+GF  G++Q++LY +YR+                  K+  V++P
Sbjct  184  AYGLFLHDICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKINLSEQQLKSIVVMSP  243

Query  229  NG-------GIQGVAIVVDATAAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGKVV  77
             G         + V  + DA   E L K T+++  E  PS  + + K  VE  + + V
Sbjct  244  LGVSEVHPVVTEPVGPLSDAVHHEDLSKVTNEK--EEEPS--IENGKSHVETTRPETV  297



>ref|XP_006493252.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X1 [Citrus sinensis]
Length=290

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 169/256 (66%), Gaps = 5/256 (2%)
 Frame = -2

Query  859  ILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFLIT  680
            I+GNI+SF+VFLAP+PTF+ + K+KS+EGF  LPY VALFS M+ +YYA++K+    LIT
Sbjct  21   IIGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKDAFLLIT  80

Query  679  INGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN-KRVKI  503
            IN  G  +ETIYL LY  +A K+ R+     +L+ N G  G I++L++FL++G+  R+++
Sbjct  81   INAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSAARLRL  140

Query  502  VGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYIA  323
            +GWI  V SV VFAAPLSIM  V+RTKSVE+MPF LSLFLTL AV+W  YGL ++D Y+A
Sbjct  141  LGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFLKDVYVA  200

Query  322  TPNVLGFACGIVQLILYAIYRDRKTAAVVA----PNGGIQGVAIVVDATAAEMLQKGTDD  155
             PNVLGF  G+VQ+ILYAIYR+ +   V      P   +  V +  +   A   Q  + +
Sbjct  201  VPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEHTVDVVKLSTNNMTASEEQTNSRN  260

Query  154  EIHETTPSSVVVDMKK  107
               +        D  +
Sbjct  261  NFDDKNEHEQANDQHE  276



>ref|NP_001149087.1| MTN3 [Zea mays]
 gb|ACF85462.1| unknown [Zea mays]
 gb|ACG34136.1| MTN3 [Zea mays]
 gb|AFW56330.1| MTN3 [Zea mays]
Length=302

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 163/218 (75%), Gaps = 0/218 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISFM FLAP+PTF+ IYK KS+EGF  +PY VALFS M+ ++YAL+
Sbjct  7    QHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYALI  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +  FLITIN  G  +ETIY+V+YFVYA K+ ++  A  +++ N GV G+I++LT  L 
Sbjct  67   KSNETFLITINAAGCVIETIYVVMYFVYAPKKAKLFTAKIMVLLNGGVFGVILLLTLLLF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G+KRV ++GWI    SV VF APLSIM +VI+TKSVEYMPF+LSL LTL AVVW LYGL
Sbjct  127  KGSKRVVLLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA  233
             I+D Y+A PN+LGF  G+VQ++LY +Y ++   A  A
Sbjct  187  LIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAATA  224



>ref|XP_002299333.2| hypothetical protein POPTR_0001s13410g [Populus trichocarpa]
 gb|EEE84138.2| hypothetical protein POPTR_0001s13410g [Populus trichocarpa]
Length=282

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 172/268 (64%), Gaps = 12/268 (4%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            M   H LA  FGILGNIISFMV+LAP+PTF  I ++KS+E F  LPY VALFS M+ LYY
Sbjct  4    MNMQHPLAFTFGILGNIISFMVYLAPVPTFIRILRKKSTEDFQSLPYLVALFSSMLWLYY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            A++K   + L+TIN  G  +ETIY+ +Y  YA +  ++     +L  N+G+  LI++LT+
Sbjct  64   AMLKNDEILLVTINSFGCVIETIYIAIYIAYATRESKVSTIKLLLSMNMGLFSLIILLTH  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            FL+ G+ RVK +GW+    SVCVFAAPL+I+ ++IRTKSVE+MPF LS FLTL AV+W  
Sbjct  124  FLASGSTRVKALGWLCVAFSVCVFAAPLNIVKQIIRTKSVEFMPFTLSFFLTLSAVIWFA  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN------------GGIQG  212
            YGL I+D  +A PN+LGF  G++Q++LY IYR+ +   + A N              +  
Sbjct  184  YGLFIKDMCVALPNILGFVLGLLQMLLYGIYRNAEKKKIPAENLKSIVILGTLGASEVYP  243

Query  211  VAIVVDATAAEMLQKGTDDEIHETTPSS  128
            V    D +AAE  Q     E  ++  +S
Sbjct  244  VDPQPDVSAAEHDQTEESKENEKSMEAS  271



>ref|XP_008392727.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=295

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 154/215 (72%), Gaps = 4/215 (2%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H L+  FG+LGNIIS +VFLAP+PTF+T+YK+K++EGF  LPY + L S M+ +YYAL+K
Sbjct  5    HTLSLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYVYYALLK  64

Query  703  QHV----LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            + +      +ITIN +G  +ETIY+ L+  YA K+ RI  A  + + N+   G++VVLT 
Sbjct  65   EELKEDATLVITINSVGCVIETIYIXLFLFYAPKKARISTATLLFLLNLFSYGMMVVLTR  124

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            FL+ G  R KIVGWI  V S+ VF APL ++ +VIRTKSVE+MPF LS FLTL AV W  
Sbjct  125  FLATGETRFKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAVAWFF  184

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRK  251
            YG  I+D+YIA PN+LGF  G+VQ+ +Y +Y++ K
Sbjct  185  YGFLIKDYYIAFPNILGFFFGVVQMAVYVVYKNAK  219



>ref|XP_009132693.1| PREDICTED: bidirectional sugar transporter SWEET10 [Brassica 
rapa]
Length=289

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 175/275 (64%), Gaps = 12/275 (4%)
 Frame = -2

Query  877  LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQH  698
            L  VFGILGNIISF+V LAP+PTF  IYKRKSSEG+  +PY +ALFS M+ +YYA++K +
Sbjct  8    LRTVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYAMIKTN  67

Query  697  VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN  518
            V+ +ITIN + + ++  Y+  Y  YA K+ + L    VL  ++   G I  LTYFL  G 
Sbjct  68   VVIMITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYFLLHGQ  127

Query  517  KRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIR  338
            KRV+I+G+I  V S+CVF APL I+ KVI+T+S E+MPF LS FLTL AV+W  YGL ++
Sbjct  128  KRVQILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFYGLLLK  187

Query  337  DFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAI-VVDAT-------AA  182
            D  IA PNVLGF  G++Q+ILY IY+   T  +  P   +Q ++  VVD         ++
Sbjct  188  DMNIALPNVLGFIFGVLQMILYMIYKKPGTKVLEPPVINLQEISDHVVDVVRLSSMVCSS  247

Query  181  EML----QKGTDDEIHETTPSSVVVDMKKVVEMQQ  89
            +M     Q   D E   T    +  D++K+ E ++
Sbjct  248  QMRTLVPQDSADMEDTITIDEKIKGDIEKMKESKE  282



>gb|KDP26857.1| hypothetical protein JCGZ_18015 [Jatropha curcas]
Length=293

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/268 (45%), Positives = 177/268 (66%), Gaps = 4/268 (1%)
 Frame = -2

Query  892  MNSHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            +++HQ LA  FG+LGNIIS +V+LAP+PTF  IY++KS+EGFH LPY VALFS M+ L+Y
Sbjct  4    LSTHQPLAFAFGLLGNIISVLVYLAPVPTFLRIYRKKSTEGFHSLPYLVALFSSMLWLHY  63

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
            A++K+ V  L+TIN  G  +ETIY+ LY  YA K  R+     ++  NI +   IV+ T+
Sbjct  64   AMLKKDVFLLVTINVFGCAIETIYIFLYMFYASKEIRVSTFRLLVSMNIALFSSIVLFTH  123

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            FL +G+ RV+++GWI   +SV VFA+PLSI+ +V+RT+SVE+MPF LS FLTL AV+W  
Sbjct  124  FLMKGSIRVQVLGWICVAVSVSVFASPLSIVAQVVRTRSVEFMPFTLSFFLTLSAVMWFA  183

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA--PNGGIQGVAIVVDATAA  182
            YG   ++  +A PN+LGF  G++Q++LYAIYR  K   +    P   ++ + I+     +
Sbjct  184  YGFTTKNMCVALPNILGFILGLLQMLLYAIYRKAKVVVIEEKLPEKNLKSIVILSTLGNS  243

Query  181  EMLQKGTDDEIHETTPSSVVVDMKKVVE  98
            E+       E  E   + V  + +++ E
Sbjct  244  EVYPVDVRPE-SEPDENKVAKEQEQIEE  270



>ref|XP_004145146.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 ref|XP_004153502.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=291

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 172/260 (66%), Gaps = 9/260 (3%)
 Frame = -2

Query  865  FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLFL  686
            FG+LGNIISF+VFLAP+PTF  IYK+KS+EGF  +PY VALFS M+ LYYA    +   L
Sbjct  14   FGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSVPYVVALFSAMLWLYYASFNSNETLL  73

Query  685  ITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRVK  506
            ITIN +G  +ET+Y+ ++ V+A K+ R+     VL+ N G   +I+++T+FL  G+ +VK
Sbjct  74   ITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSNQVK  133

Query  505  IVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFYI  326
            +VGWI    SV VFAAPL+IM  VIRTKSVE+MPF+LS FLTL A+ WLLYG+ ++D Y+
Sbjct  134  VVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAITWLLYGVFLKDIYV  193

Query  325  ATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKGTDDEIH  146
            A PNVLGF  G+ Q+ILY IYR  + A        I     + + T  +++ K   D   
Sbjct  194  ALPNVLGFIFGVAQMILYLIYRKYEIA--------IAKEMKLPEQTTVDIVMKQKQDSSV  245

Query  145  ETTPSSVVVDMKKVVEMQQG  86
            E     +  ++++ +E+  G
Sbjct  246  EAIEVIIKTNIEE-IELSNG  264



>ref|XP_006347634.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/257 (47%), Positives = 170/257 (66%), Gaps = 6/257 (2%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            ++   A VFG+LGNI+SF+VFL+PLPTF+TIYK+K++EG+  +PY VALFS M+ +YYA 
Sbjct  4    SADHWAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIYYAF  63

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K +   LITIN  G+F+ETIY+  Y  YA K+ R+     + +F +G  G I+++T FL
Sbjct  64   LKTNTTLLITINTFGVFIETIYVGFYLFYAPKKSRVQTIKMLSLFVVGGFGAIILVTEFL  123

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G  R ++VGWI  + S+CVF APL I+ KVI+TKSVEYMP  LS+FLTL AV+W  YG
Sbjct  124  FKGAIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  183

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN-GGIQGVAIVVDATAAEML  173
            L ++D  IA PN+LGF  GI+Q+ILY IY  ++ A +       IQ   ++V        
Sbjct  184  LLLKDINIAAPNILGFIFGILQMILYVIYSKKEKAILKEQKLPEIQKAEVIVKDE-----  238

Query  172  QKGTDDEIHETTPSSVV  122
               T+ +  E T   ++
Sbjct  239  NMNTNKKFPELTQEQII  255



>gb|KHN17298.1| Bidirectional sugar transporter NEC1 [Glycine soja]
Length=262

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 175/272 (64%), Gaps = 15/272 (6%)
 Frame = -2

Query  895  MMNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYY  716
            + + H+L  +FG+LGNI+SFMVFLAPLPTF+TIYK KSSEGF  +PY VAL S ++ LYY
Sbjct  3    LFSDHELVLIFGLLGNIVSFMVFLAPLPTFYTIYKNKSSEGFQSIPYVVALLSALLLLYY  62

Query  715  ALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
              +K +   +ITIN IG  +E  YL +Y +YA ++ +I   V +L+ +IG  GL +++T 
Sbjct  63   GFIKTNATLIITINCIGCVIEVSYLAMYIIYAPRKQKISTLVMILIADIGGFGLTMLITT  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            F  +G  RV  VGWI ++ ++ VFAAPLSIM +VI+TKSVE+MPF+LSLFLTLCA +W  
Sbjct  123  FAVKGINRVHAVGWICAIFNIAVFAAPLSIMRRVIKTKSVEFMPFSLSLFLTLCATMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEM  176
            YG    D +I  PNVLGF  GI Q+ILY IY++ K       NG I       + T  + 
Sbjct  183  YGFFDEDNFIMLPNVLGFLFGISQMILYMIYKNAKK------NGEI-------NCTEQQE  229

Query  175  LQKGTDDEIHETTPSSVVVDMKKVVEMQQGKV  80
                 + + H    +   +D   +VEM++ ++
Sbjct  230  RDGTVNSKQHSCNGNK--LDFPSLVEMKENQL  259



>ref|XP_009794695.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 177/274 (65%), Gaps = 28/274 (10%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S   A  FG+LGNI+SF+VFL+PLPTF+ IYK+KS+EG+  +PY VALFS M+ +YYA +
Sbjct  5    SGHWAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAFL  64

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +   LITIN  G+F+ETIY+ +Y  YA K+ R+     +L+  +G  G IV++T FL 
Sbjct  65   KTNTTLLITINSFGVFIETIYVGVYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFLF  124

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R ++VGWI  V S+CVF APL I+ KVI+TKSVEYMP  LS+FLTL AV+W  YGL
Sbjct  125  KGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQK  167
             ++D  IA PNVLGF  GI+Q++LY IY  ++ A                      +L++
Sbjct  185  LLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKA----------------------ILKE  222

Query  166  GTDDEIHETTPSSVVVD----MKKVVEMQQGKVV  77
                EI +  P+ +VVD     KK+ E+ Q +++
Sbjct  223  QKLPEIQK--PAVIVVDENMNKKKLPELTQEQII  254



>gb|EYU43031.1| hypothetical protein MIMGU_mgv1a011488mg [Erythranthe guttata]
Length=280

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 152/209 (73%), Gaps = 0/209 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            +QLA VFG+LGN++SFMVFLAP+PTF+ I+K+KS+EGF  +PY+V LFS M+ +YYA +K
Sbjct  2    NQLAFVFGLLGNVVSFMVFLAPIPTFYQIFKKKSTEGFQSVPYAVGLFSAMLWIYYAFLK  61

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
                 LITIN +G  +++ Y+  Y  +A K  RI     +L+ N+   GLI+VLT+F + 
Sbjct  62   PETTLLITINSVGCVIQSAYICFYLFFATKNARIQTVKLILLLNVVGFGLIIVLTHFWAN  121

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
             + R  +VGWI  V S+CVF APL ++ +VIRTKSVEYMPF LS FLTL AV+W  YGL 
Sbjct  122  DSNRDDVVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLL  181

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRD  257
             +D+ IA PNVLGF  G++Q++LY +Y++
Sbjct  182  RKDYNIAIPNVLGFMFGVIQMVLYVMYKN  210



>gb|KHG02402.1| Bidirectional sugar transporter SWEET10 -like protein [Gossypium 
arboreum]
Length=273

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 159/218 (73%), Gaps = 0/218 (0%)
 Frame = -2

Query  868  VFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLF  689
            VFGILGN +SFMV LAPLPTF+ I+K+K+SEGF  +PY V+LFS M+ +YYAL+K+  +F
Sbjct  10   VFGILGNAVSFMVSLAPLPTFYQIFKKKTSEGFQSIPYVVSLFSAMLWIYYALLKKDAIF  69

Query  688  LITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRV  509
            LITIN   +F++T Y+V YF Y  K+ +I+    +L+FN+   G+I + TYFL   + R+
Sbjct  70   LITINTFCVFIQTFYIVTYFYYGPKKEKIVTVKLMLLFNVFGFGVIFLATYFLKNPSLRL  129

Query  508  KIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFY  329
             I+G+I    ++ VF APL+I+ KVI+TKSVEYMPF LS+FLTL AV+W  YGLC++D  
Sbjct  130  LILGYICMAFALAVFVAPLAIVRKVIKTKSVEYMPFTLSVFLTLGAVMWFFYGLCLKDMN  189

Query  328  IATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQ  215
            +A PN+LGF  G++Q+ILYA+Y++     V   +  +Q
Sbjct  190  VAVPNILGFIFGVLQMILYAVYKNHPKKTVEESDPKLQ  227



>ref|XP_004235326.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=300

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 172/246 (70%), Gaps = 4/246 (2%)
 Frame = -2

Query  874  AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHV  695
            A  FG+LGNIISF+VFL+P+PTF++IYK+KS+EG+  +PY VALFS M+ +YYAL+K ++
Sbjct  9    AFAFGVLGNIISFIVFLSPIPTFYSIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKSNM  68

Query  694  LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNK  515
              LITIN  G+F+ETIY+  Y  YA K+ R+     +++  +G  G IV++T FL +G  
Sbjct  69   PLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFKGVV  128

Query  514  RVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRD  335
            R +IVGWI  + S+CVF APL I+ +VI+TKSVEYMP  LS+FLTL AV+W  YGL ++D
Sbjct  129  RGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKD  188

Query  334  FYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPN-GGIQGVAIVV---DATAAEMLQK  167
              IA PNVLGF  GI+Q+ILYAIY  ++ + +       IQ   ++V   +  A + L +
Sbjct  189  INIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQKLPEIQKTEVIVKDENMNANKKLPE  248

Query  166  GTDDEI  149
             T ++I
Sbjct  249  LTQEQI  254



>ref|XP_009349481.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=305

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 177/275 (64%), Gaps = 10/275 (4%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H LA  FGILGN+IS MV+L+P+PTF+ IY++KS+EGFH +PY VALFS M+  YYALVK
Sbjct  9    HPLAFTFGILGNLISAMVYLSPVPTFYRIYRKKSTEGFHSVPYLVALFSSMLWFYYALVK  68

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
             + + LITIN  G FVE IY+V++ VYA K  R L      + N+G+  +I+++++FL  
Sbjct  69   TNAMMLITINSFGSFVEIIYIVMFVVYAPKEARKLTVKLFGIMNVGLFTMILIVSHFLVG  128

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
               RV I+GWI   IS  VF APLSI+ +VIRT+SVE+MPF LS FLTL AV+W  YGL 
Sbjct  129  SAYRVPILGWINVAISTGVFVAPLSIVAQVIRTRSVEFMPFGLSFFLTLSAVMWFAYGLL  188

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV--------VAPNGGIQGVAIVVDAT  188
            ++D  +  PNVLGF  G++Q++LY I R+R+   +         A +  ++ + I+    
Sbjct  189  LKDICVVIPNVLGFVLGLLQILLYGICRNREQVIIDDHEKKLPAATHENVKNIVIIAILA  248

Query  187  AAEMLQKGTDDEIHETTPSSVVVDMKKVVEMQQGK  83
            A+E+     DD+ +     + V +   V + ++ +
Sbjct  249  ASEV--HPVDDQPNNCNNDTDVNNNAAVRDAKEHE  281



>gb|AFK35161.1| unknown [Medicago truncatula]
Length=255

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 162/227 (71%), Gaps = 2/227 (1%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A VFGI+GNIISF VFL+PLPTF+ I+K+KS+EGF  LPY VALFS M+ +YYA
Sbjct  3    MTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYA  62

Query  712  LVKQH-VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             VK+   L LITIN  GI VE+ Y++++ +YA K+ R+     +L+ N+   G +++ T 
Sbjct  63   FVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +LS+G KR+ I+GWI  V ++ VFA PL ++ KVIR++SVEYMPF LS FLT+ AV+W  
Sbjct  123  YLSKGAKRLAIIGWICLVFNISVFATPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQ  215
            YGL +RD+Y+A PN LGF  GI+Q+++Y IYR+  T  V AP  G +
Sbjct  183  YGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRN-ATPVVEAPMKGQE  228



>emb|CDX84877.1| BnaA03g13530D [Brassica napus]
Length=272

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 164/244 (67%), Gaps = 2/244 (1%)
 Frame = -2

Query  877  LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQH  698
            L  VFGILGNIISF+V LAP+PTF  IYKRKSSEG+  +PY +ALFS M+ +YYA++K +
Sbjct  8    LRTVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYAMIKTN  67

Query  697  VLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGN  518
            V+ +ITIN + + ++  Y+  Y  YA K+ + L    VL  ++   G I  LTYFL  G 
Sbjct  68   VVIMITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYFLLHGQ  127

Query  517  KRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIR  338
            KRV+I+G+I  V S+CVF APL I+ KVI+T+S E+MPF LS FLTL AV+W  YGL ++
Sbjct  128  KRVQILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFYGLLLK  187

Query  337  DFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAI-VVDATA-AEMLQKG  164
            D  IA PNVLGF  G++Q+ILY IY+   T  +  P   +Q ++  VVD    + M+   
Sbjct  188  DMNIALPNVLGFIFGVLQMILYMIYKKPGTKVLEPPVINLQEISDHVVDVVRLSSMVYTI  247

Query  163  TDDE  152
            T DE
Sbjct  248  TIDE  251



>gb|EMS51422.1| Bidirectional sugar transporter SWEET13 [Triticum urartu]
Length=290

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 164/263 (62%), Gaps = 3/263 (1%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISF   LAP+PTF+ I+K KS+EGF  +PY VALFS M+ ++YALV
Sbjct  7    EHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALV  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K     LI+IN  G  +ET+Y+V+Y VYA ++ +I  A  V++ NI   GLI +LT F  
Sbjct  67   KTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNITGFGLIFLLTLFAF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G  RV  +GWI    SVCVF APLSI+ +VI+TKSVEYMPF LSL LTL A+VW LYGL
Sbjct  127  HGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATA---AEM  176
             I+D Y+A PN+LGF  G++Q++LY  Y ++   A     G     A   D         
Sbjct  187  LIKDKYVALPNILGFTFGVIQMVLYVFYMNKTPVASEVKEGKEAWKAPAEDHVVVINVGK  246

Query  175  LQKGTDDEIHETTPSSVVVDMKK  107
              KG+  E+   T  +  VD+ +
Sbjct  247  TDKGSCAEVRPVTEMASAVDVPR  269



>ref|XP_010045482.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Eucalyptus 
grandis]
 gb|KCW83109.1| hypothetical protein EUGRSUZ_B00063 [Eucalyptus grandis]
Length=279

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 172/273 (63%), Gaps = 8/273 (3%)
 Frame = -2

Query  892  MNSHQLAGV---FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITL  722
            M +H +  V   FG+LGNI+SFM FLAPLPTF+ IYK K ++GF  +PY V+L S M+ L
Sbjct  1    MATHHVPTVAFAFGLLGNIVSFMTFLAPLPTFYGIYKTKKTQGFQSIPYVVSLLSAMLLL  60

Query  721  YYALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVL  542
            YY LVK+  L LITINGIG  +ET Y+  Y +YA K  R+L     L+ N+   G+++  
Sbjct  61   YYGLVKKDTL-LITINGIGCVIETAYVAAYLIYASKNDRVLTLKLFLIMNVLGYGVVLST  119

Query  541  TYFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVW  362
            T+FLS+G KR  I+GWI    S+ VF APL I+ KVI+T+SVE+MP  LS+FLTL A+VW
Sbjct  120  TFFLSKGAKRAWIIGWICMTFSLGVFVAPLCILKKVIKTRSVEFMPITLSIFLTLGAIVW  179

Query  361  LLYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAA  182
              YG  ++DF+IA PNVLGF  G++Q++LYA Y++  T  V   +   +    ++D    
Sbjct  180  FFYGFLLKDFFIAVPNVLGFVLGVIQMVLYATYKNANTVEVERNSQQQEPREEIIDVMKL  239

Query  181  EMLQKGTDDEIHETTPSSVVVD----MKKVVEM  95
                   +  +  T   +V+ D     +++VEM
Sbjct  240  SAAACPENKPVLPTQLKAVLKDGVGEDEQIVEM  272



>ref|XP_009421186.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 151/216 (70%), Gaps = 0/216 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A   GILGNIIS MVFLAPLPTF+ +Y RKS+EGF  +PY VALFSCM+   YA +
Sbjct  7    DHPWAFTIGILGNIISLMVFLAPLPTFYRVYTRKSTEGFQSVPYVVALFSCMLWFCYAFL  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K     LITIN IG  +ET+Y+V+Y  YA K  +I  A  VLV N+G+ GLI++LT  L+
Sbjct  67   KTDAYLLITINSIGCAIETVYIVIYLTYAPKVAKIFTAKLVLVVNVGMFGLILLLTLLLA  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            EG+KRV   GWI    SV VF APLS++  V+RTKSVE+MP +LS FLTL A+VW  YGL
Sbjct  127  EGSKRVGAFGWICVSFSVSVFVAPLSVIRLVMRTKSVEFMPVSLSFFLTLSAIVWFAYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
              +D Y+  PNV+GF  GI+Q++LY  YRD+   A+
Sbjct  187  LTKDIYVGLPNVVGFIFGILQMVLYVAYRDKNRVAI  222



>ref|XP_010249453.1| PREDICTED: bidirectional sugar transporter SWEET12 [Nelumbo nucifera]
Length=292

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 154/215 (72%), Gaps = 0/215 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H     FG+LGNIIS MV+LAP+PTF  IYK+KS+EGF  +PY VALFS M+ +YY L+K
Sbjct  8    HPWTFAFGLLGNIISLMVYLAPVPTFIRIYKKKSTEGFQSVPYVVALFSAMLWIYYGLLK  67

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
                 LITIN +G  +ET Y+ ++ VYA K+ R+L    +L+ N+G    I++ T FL++
Sbjct  68   PDAHLLITINSVGCVIETSYITMFMVYAPKKARVLAIKLLLLLNVGTFCSILLFTLFLAK  127

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G+ RV+++G I    SV VFAAPLSIM  VIR+KSVE+MPF+LS FLTL AV+W  YG  
Sbjct  128  GSNRVRVLGSICVAFSVSVFAAPLSIMRLVIRSKSVEFMPFSLSFFLTLSAVMWFSYGFL  187

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAV  239
            ++DFYIA PN+LGF  G+ Q++LYAIY+D   + +
Sbjct  188  LKDFYIALPNILGFIFGVAQMVLYAIYKDANRSNI  222



>gb|EMT20480.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=287

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 156/208 (75%), Gaps = 0/208 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISFM +LAPLPTF+ IY+ KS++GF  +PY VALFS M+ +YYAL+
Sbjct  7    QHPWAFAFGLLGNVISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLWIYYALL  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K   L LITIN  G  +ETIY+V+Y  YA K+ +I  A  +L+ N+GV GLI++LT  L+
Sbjct  67   KSDELLLITINSAGCIIETIYIVMYLAYAPKQAKIFTAKILLLLNVGVFGLILLLTLLLA  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
             G KRV ++GW+    SV VF APLSI+  V+RT+SVE+MPF+LSL LT+ AVVW LYGL
Sbjct  127  GGEKRVVMLGWVCVGFSVSVFVAPLSIIRLVVRTRSVEFMPFSLSLSLTVSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIY  263
             I+D Y+A PN+LGFA G++Q+ LYAIY
Sbjct  187  LIKDKYVALPNILGFAFGVIQMGLYAIY  214



>ref|XP_009803865.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=288

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 176/255 (69%), Gaps = 3/255 (1%)
 Frame = -2

Query  865  FGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV--KQHVL  692
            FG+LGNI+SFMVFL+PLPTF++IYK+KS+EG+  +PY VALFSC++ +YYAL+  + +++
Sbjct  13   FGVLGNIVSFMVFLSPLPTFYSIYKKKSTEGYQSIPYVVALFSCVLWIYYALLMPQSNLI  72

Query  691  FLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKR  512
            F+ITIN IG F+ET Y+ +Y  YA K+ R+     +L+  +G  G +V++  FL +G  R
Sbjct  73   FIITINTIGCFIETFYVGIYLFYAPKKARVQTVKMLLLLVVGGFGAMVLVIQFLFKGAVR  132

Query  511  VKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDF  332
             +IVGWI  V SVC FAAPL I+ KVI+TKSVEYMPF LSLFLTL AV+W  YGL  R+ 
Sbjct  133  GQIVGWICLVFSVCTFAAPLCILRKVIKTKSVEYMPFLLSLFLTLNAVMWFFYGLLKRNK  192

Query  331  YIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKGTDDE  152
             +A PN+LGF  GI+Q+ILY +Y ++K   V+      +    V+ +   + L + T+++
Sbjct  193  IVAIPNILGFTFGILQMILYVVY-NKKEKNVIKEQKLRELQNHVIISDEQKKLPQLTEEQ  251

Query  151  IHETTPSSVVVDMKK  107
            I +      +V  +K
Sbjct  252  IIDIVKLGAIVYSEK  266



>ref|XP_009614917.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=286

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 172/245 (70%), Gaps = 1/245 (0%)
 Frame = -2

Query  883  HQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVK  704
            H  A  FG+LG+I+SF+VFL+PLPTF+TIYK+KS+EG+  +PY VALFSC++ +YYAL+ 
Sbjct  7    HVWASAFGVLGDIVSFIVFLSPLPTFYTIYKKKSTEGYQSIPYVVALFSCILWIYYALLM  66

Query  703  QHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSE  524
             +++F+ITIN  G F+ETIY+  Y  YA K+ R+     +L+  +G  G IV++T FL +
Sbjct  67   SNMIFIITINTFGCFIETIYVGFYLFYAPKKARVQTVKMLLLLVLGGFGAIVLVTQFLFK  126

Query  523  GNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLC  344
            G  R +IVGWI  V S+C FAAPL I+ KVI+TKSVEYMPF LS FLTL AV+W  YGL 
Sbjct  127  GAVRGQIVGWICLVFSLCTFAAPLCIVRKVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  186

Query  343  IRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQKG  164
            I+D  +A PN+LGF  GI+Q+ILY IY ++K   ++      +    VV +   + L + 
Sbjct  187  IKDKNVAIPNILGFIFGILQMILYVIY-NKKEKNIIKEQKLRELQNHVVISEEQKNLPQL  245

Query  163  TDDEI  149
            T+++I
Sbjct  246  TEEQI  250



>ref|XP_006347633.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/252 (47%), Positives = 170/252 (67%), Gaps = 8/252 (3%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
            S+  A  FG+LGNI+SF+VFL+P+PTF+ IYK+KS+EG+  +PY VALFS M+ +YYAL+
Sbjct  5    SNHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALL  64

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K ++  LITIN  G+F+ETIY+ LY  YA K+ R+     +++  +G  G I+++T  L 
Sbjct  65   KTNMPLLITINSFGMFIETIYVGLYLFYAPKKARVQTVKMLMLSVVGGFGAIILVTELLF  124

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G  R ++VGWI  + S+CVF APL I+ KVI+TKSVEYMP  LS+FLTL AV+W  YGL
Sbjct  125  KGAIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIY--------RDRKTAAVVAPNGGIQGVAIVVDA  191
             ++D  IA PNVLGF  GI+Q++LYAIY        +++K   +  P   ++   +  + 
Sbjct  185  LLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKVILKEQKLPEIQTPGVIVKDENMHTNK  244

Query  190  TAAEMLQKGTDD  155
               E+ Q+   D
Sbjct  245  KLPELTQEQIID  256



>ref|NP_001141654.1| hypothetical protein [Zea mays]
 gb|ACF86797.1| unknown [Zea mays]
 gb|AFW56326.1| hypothetical protein ZEAMMB73_553683 [Zea mays]
Length=301

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 164/223 (74%), Gaps = 1/223 (0%)
 Frame = -2

Query  886  SHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALV  707
             H  A  FG+LGN+ISFM FLAP+PTF+ IYK KS+EGF  +PY VALFS M+ ++YAL+
Sbjct  7    EHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYALI  66

Query  706  KQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLS  527
            K +  FLITIN  G  +ETIY+V+YFVYA K+ ++  A  + + N GV G+I++LT  L 
Sbjct  67   KSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMALLNGGVFGVILLLTLLLF  126

Query  526  EGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGL  347
            +G+KRV ++GWI    SV VF APLSIM +VI+TKSVEYMPF+LSL LTL AVVW LYGL
Sbjct  127  KGSKRVVLLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVVWFLYGL  186

Query  346  CIRDFYIATPNVLGFACGIVQLILYAIYRDR-KTAAVVAPNGG  221
             I+D Y+A PNVLGF  G+VQ++LY  Y ++   AA V  + G
Sbjct  187  LIKDKYVALPNVLGFIFGVVQMVLYVFYMNKTPVAAAVGKDAG  229



>emb|CDY16863.1| BnaA09g05190D [Brassica napus]
Length=277

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 179/277 (65%), Gaps = 10/277 (4%)
 Frame = -2

Query  895  MMNSHQ-LAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + N+H   A  FG+LGN+ISF VFL+P+PTF+ I K+K++EGF  LPY VALFS M+ LY
Sbjct  3    IFNTHNTWAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G  +ETIY+ ++  +A K  R+L    +L+ N G   LI++L 
Sbjct  63   YATQKKDVFLLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+TKSV+YMPF+LSL LT+ AVVWL
Sbjct  123  QFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVKYMPFSLSLTLTISAVVWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAE  179
            LYGL ++D Y+A PNV+GF  G +Q+ILY +++  KT + +      +  A  +   + +
Sbjct  183  LYGLALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEK---ELEAAKLPEVSID  239

Query  178  MLQKGT---DDEIHETT---PSSVVVDMKKVVEMQQG  86
            ML+ GT     E+   T   P S+ V   K  E + G
Sbjct  240  MLKLGTLVGSPELAVNTVVRPVSMCVCNDKKAEAENG  276



>ref|XP_010426372.1| PREDICTED: bidirectional sugar transporter SWEET11 [Camelina 
sativa]
Length=292

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 173/261 (66%), Gaps = 5/261 (2%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
              +  A VFG+LGN+ISF VFL+P+PTF+ I+K+K++EGF  LPY VALFS  + LYYA 
Sbjct  6    TENTWAFVFGLLGNVISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSATLWLYYAT  65

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
             K+ V  L+TIN  G F+ETIY+ ++  YA K  R+L    +L+ N G   +I+++  FL
Sbjct  66   QKKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKILLLMNFGGFCIILLICQFL  125

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G  R KI+G I    SVCVFAAPLSI+  VI+T+SVEYMPF+LSL LT+ AV+WLLYG
Sbjct  126  VKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYG  185

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAEMLQ  170
            L ++D Y+A PNV+GF  G +Q+ILY +Y+  KT+  +     ++   +  + T  +ML+
Sbjct  186  LALKDIYVAFPNVIGFGLGALQMILYIVYKYCKTSPHLG-EKEVEAAKLPAEVT-LDMLK  243

Query  169  KGTDDEIHETTPSSVVVDMKK  107
             GT   I    P+ +V    K
Sbjct  244  LGT---ISSPEPAPLVRQANK  261



>ref|XP_009587580.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=298

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 175/265 (66%), Gaps = 3/265 (1%)
 Frame = -2

Query  889  NSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYAL  710
            ++   A  FG+LGNI+SF+VFL+P+PTF+ IYK+KS+EG+  +PY +ALFS M+ +YYA 
Sbjct  5    STDHWAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWIYYAF  64

Query  709  VKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFL  530
            +K +   LITIN  G+F+ETIY+  Y  YA K+ R+     +L+  +G  G IV++T FL
Sbjct  65   LKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFL  124

Query  529  SEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYG  350
             +G  R ++VGWI  V S+CVF APL I+ KVI+TKSVEYMP  LS+FLTL AV+W  YG
Sbjct  125  FKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  184

Query  349  LCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVA---PNGGIQGVAIVVDATAAE  179
            L ++D  IA PNVLGF  GI+Q++LY IY  ++ A +     P      V ++ +    +
Sbjct  185  LLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQKLPEIQKPSVILLDENMNNK  244

Query  178  MLQKGTDDEIHETTPSSVVVDMKKV  104
             L + T ++I +    S++V   KV
Sbjct  245  KLPELTQEQIIDIVKLSLLVCSDKV  269



>ref|XP_002877428.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53687.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 176/260 (68%), Gaps = 7/260 (3%)
 Frame = -2

Query  895  MMNSHQL-AGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLY  719
            + ++H   A VFG+LGN+ISF VFL+P+PTF+ I K+K++EGF  +PY VALFS M+ LY
Sbjct  3    LFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLY  62

Query  718  YALVKQHVLFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLT  539
            YA  K+ V  L+TIN  G F+E IY+ ++  +A K+ R+L    +L+ N G   LI++L 
Sbjct  63   YATQKKDVFLLVTINSFGCFIEIIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILLLC  122

Query  538  YFLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWL  359
             FL++G  R KI+G I    SVCVFAAPLSI+  VI+TKSVEYMPF+LSL LT+ AV+WL
Sbjct  123  QFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWL  182

Query  358  LYGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAE  179
            LYGL ++D Y+A PNV+GF  G +Q+ILY +Y+  KT + +      +  A  +   + +
Sbjct  183  LYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEK---ELEAAKLPEVSID  239

Query  178  MLQKGTDDEIHETTPSSVVV  119
            ML+ GT   +    P+++ V
Sbjct  240  MLKLGT---LTSPEPAAITV  256



>ref|XP_004503778.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Cicer 
arietinum]
Length=255

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 164/228 (72%), Gaps = 4/228 (2%)
 Frame = -2

Query  892  MNSHQLAGVFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYA  713
            M     A VFG+LGNIISF VFL+PLPTF+ I+K+KS+EGF  LPY VALFS M+ +YYA
Sbjct  3    MTRESWAFVFGLLGNIISFAVFLSPLPTFYLIFKKKSTEGFQSLPYVVALFSAMLWIYYA  62

Query  712  LVKQHV-LFLITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTY  536
             VK+   L LITIN  GI VE+ YL+++ +YA K+ R+     +L+ N+   G +++ T 
Sbjct  63   FVKREAALLLITINTFGIVVESCYLIVFLIYATKKSRLSTIKLLLLLNVFGFGAMLLSTL  122

Query  535  FLSEGNKRVKIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLL  356
            +L++G KR+ I+GWI  V ++ VFAAPL I+ +VIRT+SVEYMPF LS FLT+ AV+W  
Sbjct  123  YLAKGAKRLAIIGWICLVFNITVFAAPLFIISRVIRTRSVEYMPFFLSFFLTINAVMWFF  182

Query  355  YGLCIRDFYIATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQG  212
            YGL ++D+Y+A PN LGF  GI+Q+++Y IYR+   A  V  +G ++G
Sbjct  183  YGLLLKDYYVALPNTLGFVFGIIQMVMYLIYRN---ATPVPLDGPVKG  227



>ref|XP_010093935.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
 gb|EXB54898.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
Length=304

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 161/230 (70%), Gaps = 3/230 (1%)
 Frame = -2

Query  868  VFGILGNIISFMVFLAPLPTFHTIYKRKSSEGFHFLPYSVALFSCMITLYYALVKQHVLF  689
            +FG+LGN+ S +VFLAP+PTF+ +YK+KS+EGF  +PY VALFS M+ LYYA +K  ++ 
Sbjct  13   IFGLLGNVTSLIVFLAPVPTFYRVYKKKSTEGFQSVPYVVALFSAMMWLYYATLKSDLIL  72

Query  688  LITINGIGIFVETIYLVLYFVYAKKRGRILMAVAVLVFNIGVLGLIVVLTYFLSEGNKRV  509
            LITIN +G  +ETIY+ LY  YA K+ RI     +L+ N G   LI++L++FL++G+ R 
Sbjct  73   LITINSVGCVIETIYIALYIAYATKQARIFTLRLILLLNFGGFCLILLLSHFLAKGSLRA  132

Query  508  KIVGWILSVISVCVFAAPLSIMMKVIRTKSVEYMPFNLSLFLTLCAVVWLLYGLCIRDFY  329
             ++GW+ +  +V VFAAPLSI+  VIRTKSVE+MP  LS FLTL A +WL+YGL ++D  
Sbjct  133  TVLGWVCTSFAVSVFAAPLSIIRVVIRTKSVEFMPLPLSFFLTLSATMWLMYGLMLKDLC  192

Query  328  IATPNVLGFACGIVQLILYAIYRDRKTAAVVAPNGGIQGVAIVVDATAAE  179
            +A PNV+G   G++Q++LY IYR  KT  V+     +Q   I  D   AE
Sbjct  193  VAIPNVMGLIFGVLQMVLYVIYRKNKT--VLVEEQKVQE-QIKADIEKAE  239



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2370525164544