BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c37247_g1_i1 len=662 path=[1:0-661]

Length=662
                                                                      Score     E

ref|XP_004247202.1|  PREDICTED: BEACH domain-containing protein lvsA    110   1e-23   
ref|XP_009593686.1|  PREDICTED: BEACH domain-containing protein l...    107   2e-22   
ref|XP_009593684.1|  PREDICTED: BEACH domain-containing protein l...    107   2e-22   
ref|XP_009786683.1|  PREDICTED: BEACH domain-containing protein l...    105   7e-22   
ref|XP_009786682.1|  PREDICTED: BEACH domain-containing protein l...    105   7e-22   
ref|XP_006349729.1|  PREDICTED: BEACH domain-containing protein l...    102   7e-21   
ref|XP_002520949.1|  conserved hypothetical protein                     100   2e-20   Ricinus communis
ref|XP_006479640.1|  PREDICTED: WD repeat and FYVE domain-contain...  96.3    8e-19   
gb|KDO68621.1|  hypothetical protein CISIN_1g000024mg                 96.3    8e-19   
ref|XP_006479639.1|  PREDICTED: WD repeat and FYVE domain-contain...  96.3    8e-19   
ref|XP_006479638.1|  PREDICTED: WD repeat and FYVE domain-contain...  96.3    8e-19   
emb|CDP03677.1|  unnamed protein product                              96.3    8e-19   
ref|XP_006443969.1|  hypothetical protein CICLE_v100184262mg          95.9    9e-19   
ref|XP_011079923.1|  PREDICTED: BEACH domain-containing protein l...  95.1    2e-18   
ref|XP_011079922.1|  PREDICTED: BEACH domain-containing protein l...  95.1    2e-18   
ref|XP_009412348.1|  PREDICTED: BEACH domain-containing protein l...  94.7    2e-18   
ref|XP_006383677.1|  hypothetical protein POPTR_0005s23680g           94.7    3e-18   
ref|XP_011032632.1|  PREDICTED: BEACH domain-containing protein l...  94.7    3e-18   
gb|KDP21396.1|  hypothetical protein JCGZ_21867                       94.0    4e-18   
emb|CDY37442.1|  BnaC08g45800D                                        92.0    2e-17   
gb|AAD25803.1|AC006550_11  Similar to gb|U70015 lysosomal traffic...  91.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171805.1|  WD/BEACH domain protein SPIRRIG                     91.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892146.1|  hypothetical protein ARALYDRAFT_311407           91.7    2e-17   
ref|XP_009393053.1|  PREDICTED: BEACH domain-containing protein l...  91.7    3e-17   
ref|XP_010501297.1|  PREDICTED: BEACH domain-containing protein l...  91.3    3e-17   
ref|XP_010480329.1|  PREDICTED: BEACH domain-containing protein l...  91.3    4e-17   
ref|XP_010457315.1|  PREDICTED: BEACH domain-containing protein l...  89.7    5e-17   
ref|XP_006306566.1|  hypothetical protein CARUB_v10008059mg           90.5    6e-17   
ref|XP_006386255.1|  hypothetical protein POPTR_0002s04860g           90.5    7e-17   
ref|XP_006418269.1|  hypothetical protein EUTSA_v10006519mg           89.7    1e-16   
ref|XP_006418270.1|  hypothetical protein EUTSA_v10006519mg           89.7    1e-16   
emb|CDY32496.1|  BnaA09g51000D                                        89.4    1e-16   
ref|XP_009118717.1|  PREDICTED: BEACH domain-containing protein l...  89.4    1e-16   
gb|EYU46527.1|  hypothetical protein MIMGU_mgv1a000007mg              89.0    2e-16   
ref|XP_010679128.1|  PREDICTED: BEACH domain-containing protein lvsA  88.6    3e-16   
ref|XP_007144670.1|  hypothetical protein PHAVU_007G175300g           88.2    4e-16   
ref|XP_009392389.1|  PREDICTED: LOW QUALITY PROTEIN: BEACH domain...  87.4    7e-16   
ref|XP_011026093.1|  PREDICTED: BEACH domain-containing protein l...  87.0    1e-15   
ref|XP_011026095.1|  PREDICTED: BEACH domain-containing protein l...  86.7    1e-15   
ref|XP_011082587.1|  PREDICTED: BEACH domain-containing protein l...  86.7    1e-15   
ref|XP_007050471.1|  Beige/BEACH domain,WD domain, G-beta repeat ...  86.3    1e-15   
ref|XP_010556769.1|  PREDICTED: BEACH domain-containing protein l...  85.9    2e-15   
ref|XP_010556770.1|  PREDICTED: BEACH domain-containing protein l...  85.9    2e-15   
ref|XP_003590569.1|  WD repeat and FYVE domain-containing protein     84.7    5e-15   
gb|AES60820.2|  beige/BEACH and WD40 domain protein                   84.7    5e-15   
gb|KGN44772.1|  hypothetical protein Csa_7G379100                     84.7    5e-15   
ref|XP_004162191.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  84.7    6e-15   
ref|XP_004146964.1|  PREDICTED: uncharacterized protein LOC101220609  84.7    6e-15   
emb|CDY18146.1|  BnaC05g01690D                                        84.3    6e-15   
ref|XP_009119578.1|  PREDICTED: LOW QUALITY PROTEIN: BEACH domain...  84.3    6e-15   
ref|XP_008813229.1|  PREDICTED: LOW QUALITY PROTEIN: BEACH domain...  84.3    7e-15   
ref|XP_008451640.1|  PREDICTED: LOW QUALITY PROTEIN: BEACH domain...  84.3    7e-15   
ref|XP_004290636.1|  PREDICTED: WD repeat and FYVE domain-contain...  84.3    7e-15   
emb|CDX89916.1|  BnaA10g01660D                                        83.2    8e-15   
ref|XP_010646132.1|  PREDICTED: BEACH domain-containing protein lvsA  84.0    8e-15   
ref|XP_007201780.1|  hypothetical protein PRUPE_ppa000010mg           84.0    9e-15   
emb|CAN62237.1|  hypothetical protein VITISV_014688                   84.0    9e-15   Vitis vinifera
ref|XP_008235353.1|  PREDICTED: BEACH domain-containing protein lvsA  84.0    1e-14   
ref|XP_010424656.1|  PREDICTED: LOW QUALITY PROTEIN: BEACH domain...  83.2    1e-14   
ref|NP_192175.3|  Beige/BEACH and WD40 domain-containing protein      82.8    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KHG15673.1|  WD repeat and FYVE domain-containing 3                82.8    2e-14   
ref|XP_010467060.1|  PREDICTED: uncharacterized protein LOC104747170  82.4    2e-14   
ref|XP_010917623.1|  PREDICTED: BEACH domain-containing protein l...  81.6    5e-14   
ref|XP_010917624.1|  PREDICTED: BEACH domain-containing protein l...  81.6    5e-14   
ref|XP_010456000.1|  PREDICTED: BEACH domain-containing protein l...  81.6    5e-14   
ref|XP_010456002.1|  PREDICTED: BEACH domain-containing protein l...  81.3    6e-14   
gb|EPS69873.1|  hypothetical protein M569_04889                       81.3    6e-14   
ref|XP_010270013.1|  PREDICTED: BEACH domain-containing protein l...  81.3    7e-14   
ref|XP_010270012.1|  PREDICTED: BEACH domain-containing protein l...  81.3    7e-14   
ref|XP_004981810.1|  PREDICTED: BEACH domain-containing protein l...  80.5    1e-13   
ref|XP_004495161.1|  PREDICTED: BEACH domain-containing protein l...  80.5    1e-13   
ref|XP_004495163.1|  PREDICTED: BEACH domain-containing protein l...  80.5    1e-13   
ref|XP_004495162.1|  PREDICTED: BEACH domain-containing protein l...  80.5    1e-13   
ref|XP_003518902.2|  PREDICTED: BEACH domain-containing protein l...  80.1    2e-13   
ref|XP_008368709.1|  PREDICTED: BEACH domain-containing protein l...  80.1    2e-13   
ref|XP_006286875.1|  hypothetical protein CARUB_v10000019mg           79.7    2e-13   
gb|KHN18853.1|  WD repeat and FYVE domain-containing protein 3        79.3    2e-13   
ref|XP_010038055.1|  PREDICTED: BEACH domain-containing protein l...  79.3    3e-13   
ref|XP_010038056.1|  PREDICTED: BEACH domain-containing protein l...  79.3    3e-13   
ref|XP_009370829.1|  PREDICTED: BEACH domain-containing protein lvsA  78.6    5e-13   
ref|NP_001167861.1|  uncharacterized protein LOC100381565             74.3    5e-13   Zea mays [maize]
ref|XP_010275218.1|  PREDICTED: BEACH domain-containing protein l...  77.4    1e-12   
ref|XP_010275219.1|  PREDICTED: WD repeat and FYVE domain-contain...  77.4    1e-12   
tpg|DAA51286.1|  TPA: hypothetical protein ZEAMMB73_996940            75.5    5e-12   
ref|XP_006838926.1|  hypothetical protein AMTR_s00002p00270160        74.3    9e-12   
ref|XP_006651808.1|  PREDICTED: BEACH domain-containing protein l...  73.2    2e-11   
ref|XP_006588647.1|  PREDICTED: BEACH domain-containing protein l...  72.4    4e-11   
gb|KHN03827.1|  WD repeat and FYVE domain-containing protein 3        72.4    4e-11   
ref|XP_002463893.1|  hypothetical protein SORBIDRAFT_01g008410        72.0    5e-11   Sorghum bicolor [broomcorn]
gb|EMT33621.1|  WD repeat and FYVE domain-containing protein 3        71.2    9e-11   
ref|XP_010230072.1|  PREDICTED: BEACH domain-containing protein lvsA  71.2    9e-11   
gb|AAP12994.1|  putative beige protein                                69.7    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEE59913.1|  hypothetical protein OsJ_12537                        69.7    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001173640.1|  Os03g0744650                                     69.3    4e-10   
emb|CDY69186.1|  BnaAnng29620D                                        68.6    5e-10   
ref|XP_009134417.1|  PREDICTED: BEACH domain-containing protein lvsA  65.9    5e-09   
gb|KHG10466.1|  BEACH domain-containing lvsA                          63.9    1e-08   
ref|XP_002982237.1|  hypothetical protein SELMODRAFT_116002           57.4    3e-06   
ref|XP_002993431.1|  hypothetical protein SELMODRAFT_137112           57.0    3e-06   
ref|XP_001762140.1|  predicted protein                                54.3    3e-05   
ref|XP_001764972.1|  predicted protein                                53.9    4e-05   
ref|XP_001768814.1|  predicted protein                                51.6    2e-04   
ref|XP_001774708.1|  predicted protein                                50.1    8e-04   



>ref|XP_004247202.1| PREDICTED: BEACH domain-containing protein lvsA [Solanum lycopersicum]
Length=3587

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 63/87 (72%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDE---SPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             +W+MVHCS ED     P  NPT GL LG+R+PE +L LHKVLK HKHPVTALH TSD+K 
Sbjct  3501  IWRMVHCSCEDSGQSKPSGNPTGGLGLGDRVPEYRLILHKVLKFHKHPVTALHLTSDLKQ  3560

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL E+ +KS  SRG
Sbjct  3561  LLSGDSGGHLLSWTLSEEGLKSMTSRG  3587



>ref|XP_009593686.1| PREDICTED: BEACH domain-containing protein lvsA isoform X2 [Nicotiana 
tomentosiformis]
Length=3594

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 66/88 (75%), Gaps = 5/88 (6%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS----NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +WKMVHCS E ES  S    NPT GL LG+R+PE +L LHKVLK HKHPVT+LH TSD+K
Sbjct  3508  IWKMVHCSCE-ESAQSKSSGNPTGGLGLGDRVPEYRLILHKVLKFHKHPVTSLHLTSDLK  3566

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASRG  411
              L SGD GG L  WT+ E+S+K+A SRG
Sbjct  3567  QLLSGDSGGHLLSWTVSEESLKTAISRG  3594



>ref|XP_009593684.1| PREDICTED: BEACH domain-containing protein lvsA isoform X1 [Nicotiana 
tomentosiformis]
Length=3595

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 66/88 (75%), Gaps = 5/88 (6%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS----NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +WKMVHCS E ES  S    NPT GL LG+R+PE +L LHKVLK HKHPVT+LH TSD+K
Sbjct  3509  IWKMVHCSCE-ESAQSKSSGNPTGGLGLGDRVPEYRLILHKVLKFHKHPVTSLHLTSDLK  3567

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASRG  411
              L SGD GG L  WT+ E+S+K+A SRG
Sbjct  3568  QLLSGDSGGHLLSWTVSEESLKTAISRG  3595



>ref|XP_009786683.1| PREDICTED: BEACH domain-containing protein lvsA isoform X2 [Nicotiana 
sylvestris]
Length=3594

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 5/88 (6%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS----NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +WKMVHCS E ES  S    NPT GL LG+R+PE +L LHKVLK HKHPVT+LH T+D+K
Sbjct  3508  IWKMVHCSCE-ESAQSKSSGNPTGGLGLGDRVPEYRLILHKVLKFHKHPVTSLHLTTDLK  3566

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASRG  411
              L SGD GG L  WTL E+S+K+A S+G
Sbjct  3567  QLLSGDSGGHLLSWTLSEESLKTAISQG  3594



>ref|XP_009786682.1| PREDICTED: BEACH domain-containing protein lvsA isoform X1 [Nicotiana 
sylvestris]
Length=3595

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 5/88 (6%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS----NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +WKMVHCS E ES  S    NPT GL LG+R+PE +L LHKVLK HKHPVT+LH T+D+K
Sbjct  3509  IWKMVHCSCE-ESAQSKSSGNPTGGLGLGDRVPEYRLILHKVLKFHKHPVTSLHLTTDLK  3567

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASRG  411
              L SGD GG L  WTL E+S+K+A S+G
Sbjct  3568  QLLSGDSGGHLLSWTLSEESLKTAISQG  3595



>ref|XP_006349729.1| PREDICTED: BEACH domain-containing protein lvsA-like [Solanum 
tuberosum]
Length=3590

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 63/87 (72%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSED--ESPHS-NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             +W+MVHCS ED  +S  S +PT GL LG  +PE +L LHKVLK HKHPVTALH TSD+K 
Sbjct  3504  IWRMVHCSCEDSGQSKSSGSPTGGLGLGGSVPEYRLILHKVLKFHKHPVTALHLTSDLKQ  3563

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL E+ MKS  SRG
Sbjct  3564  LLSGDSGGHLLSWTLSEEGMKSMISRG  3590



>ref|XP_002520949.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41366.1| conserved hypothetical protein [Ricinus communis]
Length=3591

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDES---PHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHCS+++ +      NPT GL+LG++LPE +L LH+VLK HKHPVTALH TSD+K 
Sbjct  3505  VWQMVHCSNQESALSKSSGNPTAGLNLGDKLPEYRLILHRVLKSHKHPVTALHLTSDLKQ  3564

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL +++++++ ++G
Sbjct  3565  LLSGDSGGHLLSWTLPDETLRASFNQG  3591



>ref|XP_006479640.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
isoform X3 [Citrus sinensis]
Length=3576

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = -1

Query  662   VWKMVHCSSED------ESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSD  501
             VWKMVHC+ ++      +S  SN T GL+LG+  PE +L LHKVLK HKHPVTALH TSD
Sbjct  3487  VWKMVHCTEQETVITQSKSSSSNITGGLNLGDNAPEYRLVLHKVLKFHKHPVTALHLTSD  3546

Query  500   MKYLFSGDYGGSLHLWTLQEDSMKSAASRG  411
             +K L SGD GG L  WTL ++S++++ ++G
Sbjct  3547  LKQLLSGDSGGHLVSWTLPDESLRASINQG  3576



>gb|KDO68621.1| hypothetical protein CISIN_1g000024mg [Citrus sinensis]
Length=3609

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = -1

Query  662   VWKMVHCSSED------ESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSD  501
             VWKMVHC+ ++      +S  SN T GL+LG+  PE +L LHKVLK HKHPVTALH TSD
Sbjct  3520  VWKMVHCTEQETVITQSKSSSSNITGGLNLGDNAPEYRLVLHKVLKFHKHPVTALHLTSD  3579

Query  500   MKYLFSGDYGGSLHLWTLQEDSMKSAASRG  411
             +K L SGD GG L  WTL ++S++++ ++G
Sbjct  3580  LKQLLSGDSGGHLVSWTLPDESLRASINQG  3609



>ref|XP_006479639.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
isoform X2 [Citrus sinensis]
Length=3609

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = -1

Query  662   VWKMVHCSSED------ESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSD  501
             VWKMVHC+ ++      +S  SN T GL+LG+  PE +L LHKVLK HKHPVTALH TSD
Sbjct  3520  VWKMVHCTEQETVITQSKSSSSNITGGLNLGDNAPEYRLVLHKVLKFHKHPVTALHLTSD  3579

Query  500   MKYLFSGDYGGSLHLWTLQEDSMKSAASRG  411
             +K L SGD GG L  WTL ++S++++ ++G
Sbjct  3580  LKQLLSGDSGGHLVSWTLPDESLRASINQG  3609



>ref|XP_006479638.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
isoform X1 [Citrus sinensis]
Length=3610

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = -1

Query  662   VWKMVHCSSED------ESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSD  501
             VWKMVHC+ ++      +S  SN T GL+LG+  PE +L LHKVLK HKHPVTALH TSD
Sbjct  3521  VWKMVHCTEQETVITQSKSSSSNITGGLNLGDNAPEYRLVLHKVLKFHKHPVTALHLTSD  3580

Query  500   MKYLFSGDYGGSLHLWTLQEDSMKSAASRG  411
             +K L SGD GG L  WTL ++S++++ ++G
Sbjct  3581  LKQLLSGDSGGHLVSWTLPDESLRASINQG  3610



>emb|CDP03677.1| unnamed protein product [Coffea canephora]
Length=3590

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS---NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VWKMVHCS ED  P     N T GL+LG+ +PE +L LHKVLK HKHPVTALH TSD+K 
Sbjct  3505  VWKMVHCS-EDVVPTKMTGNLTGGLNLGDEVPEYRLVLHKVLKFHKHPVTALHLTSDLKQ  3563

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  W L ++S+KS+ ++G
Sbjct  3564  LLSGDSGGHLVSWMLPDESLKSSINQG  3590



>ref|XP_006443969.1| hypothetical protein CICLE_v100184262mg, partial [Citrus clementina]
 gb|ESR57209.1| hypothetical protein CICLE_v100184262mg, partial [Citrus clementina]
Length=2217

 Score = 95.9 bits (237),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = -1

Query  662   VWKMVHCSSED------ESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSD  501
             VWKMVHC+ ++      +S  SN T GL+LG+  PE +L LHKVLK HKHPVTALH TSD
Sbjct  2128  VWKMVHCTEQETVITQSKSSSSNITGGLNLGDNAPEYRLVLHKVLKFHKHPVTALHLTSD  2187

Query  500   MKYLFSGDYGGSLHLWTLQEDSMKSAASRG  411
             +K L SGD GG L  WTL ++S++++ ++G
Sbjct  2188  LKQLLSGDSGGHLVSWTLPDESLRASINQG  2217



>ref|XP_011079923.1| PREDICTED: BEACH domain-containing protein lvsA isoform X2 [Sesamum 
indicum]
Length=3612

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS--NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYL  489
             VWKMVH + E        NP+ GL+LG+++PE +L LHKVLK HK PVTA+H +SD+K+L
Sbjct  3527  VWKMVHSTEESAQIKQTGNPSGGLALGDKIPEYRLILHKVLKSHKFPVTAIHLSSDLKHL  3586

Query  488   FSGDYGGSLHLWTLQEDSMKSAASRG  411
              SGD GG L  WTL ++S++S+ +RG
Sbjct  3587  LSGDSGGHLISWTLPDESLRSSMNRG  3612



>ref|XP_011079922.1| PREDICTED: BEACH domain-containing protein lvsA isoform X1 [Sesamum 
indicum]
Length=3613

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS--NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYL  489
             VWKMVH + E        NP+ GL+LG+++PE +L LHKVLK HK PVTA+H +SD+K+L
Sbjct  3528  VWKMVHSTEESAQIKQTGNPSGGLALGDKIPEYRLILHKVLKSHKFPVTAIHLSSDLKHL  3587

Query  488   FSGDYGGSLHLWTLQEDSMKSAASRG  411
              SGD GG L  WTL ++S++S+ +RG
Sbjct  3588  LSGDSGGHLISWTLPDESLRSSMNRG  3613



>ref|XP_009412348.1| PREDICTED: BEACH domain-containing protein lvsA-like [Musa acuminata 
subsp. malaccensis]
Length=3577

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 60/83 (72%), Gaps = 3/83 (4%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCG---LSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVHCS+++ +   +PT G   L+LG RLPE  L LHKVLK HKHPVTALH TSDMK 
Sbjct  3495  VWNMVHCSTDEANRSKSPTNGSGLLNLGGRLPEYNLVLHKVLKSHKHPVTALHLTSDMKQ  3554

Query  491   LFSGDYGGSLHLWTLQEDSMKSA  423
             L SGD  G L  WTL ++S++++
Sbjct  3555  LLSGDSSGHLLSWTLSDNSLRAS  3577



>ref|XP_006383677.1| hypothetical protein POPTR_0005s23680g [Populus trichocarpa]
 gb|ERP61474.1| hypothetical protein POPTR_0005s23680g [Populus trichocarpa]
Length=3545

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDES---PHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVHCS+++ +     SN T GL+LG+++PE +L LHKVLK HKHPVT+LH TSD+K 
Sbjct  3459  VWHMVHCSNQESALSKSTSNLTGGLNLGDKVPEYRLLLHKVLKFHKHPVTSLHLTSDLKQ  3518

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL ++S+ ++++RG
Sbjct  3519  LLSGDSGGHLLSWTLPDESLLTSSNRG  3545



>ref|XP_011032632.1| PREDICTED: BEACH domain-containing protein lvsA-like [Populus 
euphratica]
Length=3600

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDES---PHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVHCS+++ +     SN T GL+LG+++PE +L LHKVLK HKHPVT+LH TSD+K 
Sbjct  3514  VWHMVHCSNQESALSKSTSNLTGGLNLGDKVPEYRLLLHKVLKFHKHPVTSLHLTSDLKQ  3573

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL ++S+ ++++RG
Sbjct  3574  LLSGDSGGHLLSWTLPDESLLTSSNRG  3600



>gb|KDP21396.1| hypothetical protein JCGZ_21867 [Jatropha curcas]
Length=2064

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDES---PHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVH S+++ +     SNPT GL LG+++PE +L LHKVLK HKHPVTALH TSD+K 
Sbjct  1978  VWQMVHISNQESNLSKSGSNPTVGLHLGDKVPEYRLVLHKVLKFHKHPVTALHLTSDLKQ  2037

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WTL ++S++S+ + G
Sbjct  2038  LLSGDSSGHLLSWTLPDESLRSSFNHG  2064



>emb|CDY37442.1| BnaC08g45800D [Brassica napus]
Length=2398

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +W+M+HC    S+E ++  SN T GL+LG+++PE KL LHKVLK HK PVTALH TSD+K
Sbjct  2300  IWRMIHCTDPLSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQPVTALHLTSDLK  2359

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASRG  411
              L SGD  G L  WTL +++++++  + 
Sbjct  2360  QLLSGDSAGQLLSWTLPDETLRASMKQA  2387



>gb|AAD25803.1|AC006550_11 Similar to gb|U70015 lysosomal trafficking regulator from Mus 
musculus and contains 2 PF|00400 WD40, G-beta repeats. ESTs 
gb|T43386 and gb|AA395236 come from this gene [Arabidopsis 
thaliana]
Length=3600

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             VW+M+HC    S+E ++  SN T GL+LG+++PE KL LHKVLK HK PVTALH TSD+K
Sbjct  3495  VWRMIHCTDPVSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQPVTALHLTSDLK  3554

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASRG  411
              L SGD  G L  WT+ +++++++  + 
Sbjct  3555  QLLSGDSAGQLLSWTVPDETLRASMKQA  3582



>ref|NP_171805.1| WD/BEACH domain protein SPIRRIG [Arabidopsis thaliana]
 gb|AEE27523.1| WD/BEACH domain protein SPIRRIG [Arabidopsis thaliana]
Length=3601

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             VW+M+HC    S+E ++  SN T GL+LG+++PE KL LHKVLK HK PVTALH TSD+K
Sbjct  3496  VWRMIHCTDPVSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQPVTALHLTSDLK  3555

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASRG  411
              L SGD  G L  WT+ +++++++  + 
Sbjct  3556  QLLSGDSAGQLLSWTVPDETLRASMKQA  3583



>ref|XP_002892146.1| hypothetical protein ARALYDRAFT_311407 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68405.1| hypothetical protein ARALYDRAFT_311407 [Arabidopsis lyrata subsp. 
lyrata]
Length=3606

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 62/84 (74%), Gaps = 4/84 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             VW+M+HC    S+E ++  SN T GL+LG+++PE KL LHKVLK HK PVTALH TSD+K
Sbjct  3501  VWRMIHCTDPVSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQPVTALHLTSDLK  3560

Query  494   YLFSGDYGGSLHLWTLQEDSMKSA  423
              L SGD  G L  WT+ +++++++
Sbjct  3561  QLLSGDSAGQLLSWTVPDETLRAS  3584



>ref|XP_009393053.1| PREDICTED: BEACH domain-containing protein lvsA-like [Musa acuminata 
subsp. malaccensis]
Length=3586

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 4/84 (5%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTC----GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             VW MVHCS+++ S  S  +     GL L  RLPE KL LHKVLK HKHPVTALH TSD+K
Sbjct  3503  VWNMVHCSTDEASGRSKSSAAGAGGLDLSGRLPEYKLLLHKVLKSHKHPVTALHLTSDLK  3562

Query  494   YLFSGDYGGSLHLWTLQEDSMKSA  423
              L SGD  G L  WT+ +DS++++
Sbjct  3563  QLLSGDSSGHLLSWTVSDDSLRAS  3586



>ref|XP_010501297.1| PREDICTED: BEACH domain-containing protein lvsA-like [Camelina 
sativa]
Length=2348

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 62/84 (74%), Gaps = 4/84 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             VW+M+HC    S+E ++  SN T GL+LG+++PE KL LHKVLK HK PVTAL+ TSD+K
Sbjct  2240  VWRMIHCTDPVSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQPVTALYLTSDLK  2299

Query  494   YLFSGDYGGSLHLWTLQEDSMKSA  423
              L SGD  G L  WTL +++++++
Sbjct  2300  QLLSGDSAGQLLSWTLPDETLRAS  2323



>ref|XP_010480329.1| PREDICTED: BEACH domain-containing protein lvsA-like [Camelina 
sativa]
Length=3780

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 62/84 (74%), Gaps = 4/84 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             VW+M+HC    S+E ++  SN T GL+LG+++PE KL LHKVLK HK PVTAL+ TSD+K
Sbjct  3677  VWRMIHCTDPLSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQPVTALYLTSDLK  3736

Query  494   YLFSGDYGGSLHLWTLQEDSMKSA  423
              L SGD  G L  WTL +++++++
Sbjct  3737  QLLSGDSAGQLLSWTLPDETLRAS  3760



>ref|XP_010457315.1| PREDICTED: BEACH domain-containing protein lvsA-like [Camelina 
sativa]
Length=738

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 62/84 (74%), Gaps = 4/84 (5%)
 Frame = -1

Query  662  VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
            VW+M+HC    S+E ++  SN T GL+LG+++PE KL LHKVLK HK PVTAL+ TSD+K
Sbjct  630  VWRMIHCTDPVSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQPVTALYLTSDLK  689

Query  494  YLFSGDYGGSLHLWTLQEDSMKSA  423
             L SGD  G L  WTL +++++++
Sbjct  690  QLLSGDSAGQLLSWTLPDETLRAS  713



>ref|XP_006306566.1| hypothetical protein CARUB_v10008059mg [Capsella rubella]
 ref|XP_006306567.1| hypothetical protein CARUB_v10008059mg [Capsella rubella]
 gb|EOA39464.1| hypothetical protein CARUB_v10008059mg [Capsella rubella]
 gb|EOA39465.1| hypothetical protein CARUB_v10008059mg [Capsella rubella]
Length=3594

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 4/84 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             VW+M+HC    S+E ++  SN T GL+LG+++PE KL LHKVLK HK P+TAL+ TSD+K
Sbjct  3496  VWRMIHCTDPVSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQPITALYLTSDLK  3555

Query  494   YLFSGDYGGSLHLWTLQEDSMKSA  423
              L SGD  G L  WTL +++++++
Sbjct  3556  QLLSGDSAGQLLSWTLPDETLRAS  3579



>ref|XP_006386255.1| hypothetical protein POPTR_0002s04860g [Populus trichocarpa]
 gb|ERP64052.1| hypothetical protein POPTR_0002s04860g [Populus trichocarpa]
Length=3419

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 65/87 (75%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH---SNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHCS++  +     S+ T GL+LG+++PE +L LHKVLK HKHPVT+LH TSD+K 
Sbjct  3333  VWQMVHCSNQVSALSKFISSSTGGLNLGDKVPEYRLLLHKVLKFHKHPVTSLHLTSDLKQ  3392

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL + S+ +++++G
Sbjct  3393  LLSGDSGGHLLSWTLPDQSLMASSNQG  3419



>ref|XP_006418269.1| hypothetical protein EUTSA_v10006519mg [Eutrema salsugineum]
 gb|ESQ36622.1| hypothetical protein EUTSA_v10006519mg [Eutrema salsugineum]
Length=3572

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 62/84 (74%), Gaps = 4/84 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +W+M+HC    S+E ++  +N T GL+LG+++PE KL LHKVLK HK PVTAL+ TSD+K
Sbjct  3474  IWRMIHCTDPVSAESKTSSTNRTGGLNLGDQVPEYKLILHKVLKFHKQPVTALYLTSDLK  3533

Query  494   YLFSGDYGGSLHLWTLQEDSMKSA  423
              L SGD  G L  WTL +++++++
Sbjct  3534  QLLSGDSAGQLLSWTLPDETLRAS  3557



>ref|XP_006418270.1| hypothetical protein EUTSA_v10006519mg [Eutrema salsugineum]
 gb|ESQ36623.1| hypothetical protein EUTSA_v10006519mg [Eutrema salsugineum]
Length=3601

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 62/84 (74%), Gaps = 4/84 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +W+M+HC    S+E ++  +N T GL+LG+++PE KL LHKVLK HK PVTAL+ TSD+K
Sbjct  3503  IWRMIHCTDPVSAESKTSSTNRTGGLNLGDQVPEYKLILHKVLKFHKQPVTALYLTSDLK  3562

Query  494   YLFSGDYGGSLHLWTLQEDSMKSA  423
              L SGD  G L  WTL +++++++
Sbjct  3563  QLLSGDSAGQLLSWTLPDETLRAS  3586



>emb|CDY32496.1| BnaA09g51000D [Brassica napus]
Length=3390

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 70/107 (65%), Gaps = 7/107 (7%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +W+M+HC    S+E ++  SN T GL+LG+++PE KL LHKVLK HK  VTALH TSD+K
Sbjct  3287  IWRMIHCTDPLSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQAVTALHLTSDLK  3346

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASRG*PAILHPSQLK*FCYNQSS  354
              L SGD  G L  WTL +++++++  +   A L  + LK     Q+S
Sbjct  3347  QLLSGDSAGQLLSWTLPDETLRASMKQ---ASLKQASLKQASMKQAS  3390



>ref|XP_009118717.1| PREDICTED: BEACH domain-containing protein lvsA-like [Brassica 
rapa]
Length=3601

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 70/107 (65%), Gaps = 7/107 (7%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +W+M+HC    S+E ++  SN T GL+LG+++PE KL LHKVLK HK  VTALH TSD+K
Sbjct  3498  IWRMIHCTDPLSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQAVTALHLTSDLK  3557

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASRG*PAILHPSQLK*FCYNQSS  354
              L SGD  G L  WTL +++++++  +   A L  + LK     Q+S
Sbjct  3558  QLLSGDSAGQLLSWTLPDETLRASMKQ---ASLKQASLKQASMKQAS  3601



>gb|EYU46527.1| hypothetical protein MIMGU_mgv1a000007mg [Erythranthe guttata]
Length=3523

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESP---HSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VWKMVH S+E+ +      +PT GL LG+++PE +L +HKVLK HK+PVTALH +SD+K 
Sbjct  3437  VWKMVHSSTEEAAQTKQSGSPTAGLELGSKVPEYRLIMHKVLKSHKYPVTALHLSSDLKQ  3496

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WTL ++S++ + ++G
Sbjct  3497  LLSGDSHGHLISWTLPDESLRYSINQG  3523



>ref|XP_010679128.1| PREDICTED: BEACH domain-containing protein lvsA [Beta vulgaris 
subsp. vulgaris]
Length=3599

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 4/87 (5%)
 Frame = -1

Query  662   VWKMVHCSSEDES---PHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VWKMVHC+ ++ +   P  N T GL+L +R PE KL LHKVLK HKHPVTAL+ T+D+K 
Sbjct  3514  VWKMVHCTDKESAQSKPTVNGTAGLAL-SRPPEYKLLLHKVLKSHKHPVTALYLTTDLKQ  3572

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WTL  DS++ ++S G
Sbjct  3573  LLSGDSAGHLLSWTLPGDSLRGSSSFG  3599



>ref|XP_007144670.1| hypothetical protein PHAVU_007G175300g [Phaseolus vulgaris]
 gb|ESW16664.1| hypothetical protein PHAVU_007G175300g [Phaseolus vulgaris]
Length=3602

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCG---LSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHCS+ D S   +   G   L+LG   PE KL L KVLK HKHPVTALH T+D+K 
Sbjct  3516  VWQMVHCSNPDSSLSKSGFGGAGVLNLGGTEPEYKLILRKVLKFHKHPVTALHLTTDLKQ  3575

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL E+S++ + +RG
Sbjct  3576  LLSGDSGGHLLSWTLPEESLRGSFNRG  3602



>ref|XP_009392389.1| PREDICTED: LOW QUALITY PROTEIN: BEACH domain-containing protein 
lvsA-like [Musa acuminata subsp. malaccensis]
Length=2589

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS----NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             VW MVHCS+++    S    N    L+L  RLPE KL +H+VLK HKHPVTALH TSD+K
Sbjct  2491  VWNMVHCSTDEAIGRSESLTNEVGRLNLNGRLPEYKLTMHRVLKSHKHPVTALHLTSDLK  2550

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASR  414
              L SGD  G L  W L EDS++++  +
Sbjct  2551  QLLSGDSSGHLLSWILLEDSLRASLGK  2577



>ref|XP_011026093.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X1 [Populus euphratica]
 ref|XP_011026094.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X2 [Populus euphratica]
Length=3599

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH---SNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVHCS+++ +     S+ T GL+LG+++PE +L LHKVLK HKHPVT+LH TSD K 
Sbjct  3513  VWHMVHCSNQESALSKFTSSSTGGLNLGDKVPEYRLLLHKVLKFHKHPVTSLHLTSDRKQ  3572

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASR  414
             L SGD GG L  WTL + S+ +++++
Sbjct  3573  LLSGDSGGHLLSWTLPDQSLMASSNQ  3598



>ref|XP_011026095.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X3 [Populus euphratica]
Length=3598

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH---SNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVHCS+++ +     S+ T GL+LG+++PE +L LHKVLK HKHPVT+LH TSD K 
Sbjct  3512  VWHMVHCSNQESALSKFTSSSTGGLNLGDKVPEYRLLLHKVLKFHKHPVTSLHLTSDRKQ  3571

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASR  414
             L SGD GG L  WTL + S+ +++++
Sbjct  3572  LLSGDSGGHLLSWTLPDQSLMASSNQ  3597



>ref|XP_011082587.1| PREDICTED: BEACH domain-containing protein lvsA-like [Sesamum 
indicum]
Length=3592

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = -1

Query  662   VWKMVHCSSEDES---PHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VWKMVH SSE+ +      NPT GL LG ++PE +L LHKVLK HK PVTAL  ++D+K 
Sbjct  3506  VWKMVHSSSEESAQIKETVNPTGGLGLGGKVPEYRLILHKVLKFHKFPVTALRLSNDLKQ  3565

Query  491   LFSGDYGGSLHLWTLQEDSMKSA  423
             L SGD  G L  WTL+++S++++
Sbjct  3566  LLSGDSDGHLVSWTLRDESLRAS  3588



>ref|XP_007050471.1| Beige/BEACH domain,WD domain, G-beta repeat protein [Theobroma 
cacao]
 gb|EOX94628.1| Beige/BEACH domain,WD domain, G-beta repeat protein [Theobroma 
cacao]
Length=3597

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = -1

Query  662   VWKMVHCSSEDES---PHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVHC+ E+ +     S+ T GL LG + PE +L LHKVLK HKHPVTALH TSD+K 
Sbjct  3512  VWHMVHCTDEESTISKSTSSGTGGLDLG-KSPEYRLVLHKVLKFHKHPVTALHLTSDLKQ  3570

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL ++S++++ ++G
Sbjct  3571  LLSGDSGGHLISWTLPDESLRASLNQG  3597



>ref|XP_010556769.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X1 [Tarenaya hassleriana]
Length=3601

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCS---SEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW M+HC+   S +    SN T GL+LG+++PE +L LHKVLK HK PVT+LH TSD+K 
Sbjct  3514  VWHMIHCTDPVSAESRTSSNRTGGLNLGDQVPEYRLLLHKVLKFHKQPVTSLHLTSDLKQ  3573

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WTL +++++++  +G
Sbjct  3574  LLSGDSTGHLLSWTLPDETLRNSLKKG  3600



>ref|XP_010556770.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X2 [Tarenaya hassleriana]
Length=3574

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCS---SEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW M+HC+   S +    SN T GL+LG+++PE +L LHKVLK HK PVT+LH TSD+K 
Sbjct  3487  VWHMIHCTDPVSAESRTSSNRTGGLNLGDQVPEYRLLLHKVLKFHKQPVTSLHLTSDLKQ  3546

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WTL +++++++  +G
Sbjct  3547  LLSGDSTGHLLSWTLPDETLRNSLKKG  3573



>ref|XP_003590569.1| WD repeat and FYVE domain-containing protein [Medicago truncatula]
Length=3617

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCG---LSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHCS  D S   +   G   L+LG + PE +L L KVLK HKHPVTALH T D+K 
Sbjct  3531  VWQMVHCSDPDSSLSKSGASGFRVLNLGAKEPEYRLILRKVLKFHKHPVTALHLTIDLKQ  3590

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL ++S++ + ++G
Sbjct  3591  LLSGDSGGHLLSWTLPDESLRGSLNQG  3617



>gb|AES60820.2| beige/BEACH and WD40 domain protein [Medicago truncatula]
Length=3612

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCG---LSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHCS  D S   +   G   L+LG + PE +L L KVLK HKHPVTALH T D+K 
Sbjct  3526  VWQMVHCSDPDSSLSKSGASGFRVLNLGAKEPEYRLILRKVLKFHKHPVTALHLTIDLKQ  3585

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL ++S++ + ++G
Sbjct  3586  LLSGDSGGHLLSWTLPDESLRGSLNQG  3612



>gb|KGN44772.1| hypothetical protein Csa_7G379100 [Cucumis sativus]
Length=3605

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS--NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYL  489
             VW+MVHCS+      S  +   GL+L N++ E +L LHKVLK HKHPVTALH TSD+K L
Sbjct  3519  VWQMVHCSNPASQIKSTGSSVVGLNLDNKVSEYRLVLHKVLKFHKHPVTALHLTSDLKQL  3578

Query  488   FSGDYGGSLHLWTLQEDSMKSAA  420
              SGD  G L  WTL  D++K+A+
Sbjct  3579  LSGDSNGHLVSWTLAGDNLKAAS  3601



>ref|XP_004162191.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101220609 
[Cucumis sativus]
Length=3611

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS--NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYL  489
             VW+MVHCS+      S  +   GL+L N++ E +L LHKVLK HKHPVTALH TSD+K L
Sbjct  3525  VWQMVHCSNPASQIKSTGSSVVGLNLDNKVSEYRLVLHKVLKFHKHPVTALHLTSDLKQL  3584

Query  488   FSGDYGGSLHLWTLQEDSMKSAA  420
              SGD  G L  WTL  D++K+A+
Sbjct  3585  LSGDSNGHLVSWTLAGDNLKAAS  3607



>ref|XP_004146964.1| PREDICTED: uncharacterized protein LOC101220609 [Cucumis sativus]
Length=3611

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS--NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYL  489
             VW+MVHCS+      S  +   GL+L N++ E +L LHKVLK HKHPVTALH TSD+K L
Sbjct  3525  VWQMVHCSNPASQIKSTGSSVVGLNLDNKVSEYRLVLHKVLKFHKHPVTALHLTSDLKQL  3584

Query  488   FSGDYGGSLHLWTLQEDSMKSAA  420
              SGD  G L  WTL  D++K+A+
Sbjct  3585  LSGDSNGHLVSWTLAGDNLKAAS  3607



>emb|CDY18146.1| BnaC05g01690D [Brassica napus]
Length=3465

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 4/84 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +W+M+HC    S+E ++  SN   GL+LG+++PE KL LHKVLK HK PVTAL+   D+K
Sbjct  3367  IWRMIHCTDPLSAESKTSSSNRNGGLNLGDQVPEYKLILHKVLKFHKQPVTALYLPGDLK  3426

Query  494   YLFSGDYGGSLHLWTLQEDSMKSA  423
              L SGD  G L  WTL +++++++
Sbjct  3427  QLLSGDSAGQLLSWTLPDETLRAS  3450



>ref|XP_009119578.1| PREDICTED: LOW QUALITY PROTEIN: BEACH domain-containing protein 
lvsA-like [Brassica rapa]
Length=3561

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 4/84 (5%)
 Frame = -1

Query  662   VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +W+M+HC    S+E ++  SN   GL+LG+++PE KL LHKVLK HK PVTAL+   D+K
Sbjct  3468  IWRMIHCTDPLSAESKTSSSNRNGGLNLGDQVPEYKLILHKVLKFHKQPVTALYLPGDLK  3527

Query  494   YLFSGDYGGSLHLWTLQEDSMKSA  423
              L SGD  G L  WTL +++++++
Sbjct  3528  QLLSGDSAGQLLSWTLPDETLRAS  3551



>ref|XP_008813229.1| PREDICTED: LOW QUALITY PROTEIN: BEACH domain-containing protein 
lvsA-like [Phoenix dactylifera]
Length=3509

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 59/88 (67%), Gaps = 7/88 (8%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH----SNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             +WKMVHCSS + S      +N   GL L  R PE +L LHKVLK HKHPVTALH  SD+K
Sbjct  3423  IWKMVHCSSSEASGRSSSPTNGVGGLGL-TRAPEYRLVLHKVLKSHKHPVTALHLASDLK  3481

Query  494   YLFSGDYGGSLHLWTLQEDSMKSAASRG  411
              L SGD GG L  WT+ EDS++  ASRG
Sbjct  3482  QLLSGDVGGHLLSWTIPEDSLR--ASRG  3507



>ref|XP_008451640.1| PREDICTED: LOW QUALITY PROTEIN: BEACH domain-containing protein 
lvsA [Cucumis melo]
Length=3554

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPT--CGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYL  489
             VW+MVHCS+      S  +   GL+L N++ E +L LHKVLK HKHPVTALH TSD+K L
Sbjct  3468  VWQMVHCSNPASQVKSTGSSMVGLNLDNKVAEYRLVLHKVLKFHKHPVTALHLTSDLKQL  3527

Query  488   FSGDYGGSLHLWTLQEDSMKSAA  420
              SGD  G L  WTL  D++K+A+
Sbjct  3528  LSGDSDGHLVSWTLAGDNLKAAS  3550



>ref|XP_004290636.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
[Fragaria vesca subsp. vesca]
Length=3607

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 5/83 (6%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH----SNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
             VW+MVH S+  ESP     S+ T GL+L ++ PE +  LHKVLK HKHPVTALH T D+K
Sbjct  3523  VWQMVHHSNH-ESPQQRSTSSGTSGLNLSDKAPEYRFVLHKVLKYHKHPVTALHLTVDLK  3581

Query  494   YLFSGDYGGSLHLWTLQEDSMKS  426
              L SGD GG L  WTLQ++S+K+
Sbjct  3582  QLLSGDSGGHLLSWTLQDESVKT  3604



>emb|CDX89916.1| BnaA10g01660D [Brassica napus]
Length=720

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 4/84 (5%)
 Frame = -1

Query  662  VWKMVHC----SSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMK  495
            +W+M+HC    S+E ++  SN   GL+LG+++PE KL LHKVLK HK PVTAL+   D+K
Sbjct  630  IWRMIHCTDPLSAESKTSSSNRNGGLNLGDQVPEYKLILHKVLKFHKQPVTALYLPGDLK  689

Query  494  YLFSGDYGGSLHLWTLQEDSMKSA  423
             L SGD  G L  WTL +++++++
Sbjct  690  QLLSGDSAGQLLSWTLPDETLRAS  713



>ref|XP_010646132.1| PREDICTED: BEACH domain-containing protein lvsA [Vitis vinifera]
Length=3611

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNP---TCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VWKMVHCS E  S   +      GL+LG +  E +L L KVLK HKHPVTALH T+D+K 
Sbjct  3525  VWKMVHCSDEGSSRSKSTNSGAAGLALGLKALEYRLVLQKVLKFHKHPVTALHLTTDLKQ  3584

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL ++S++++ + G
Sbjct  3585  LLSGDSGGHLISWTLPDESLRASLNHG  3611



>ref|XP_007201780.1| hypothetical protein PRUPE_ppa000010mg [Prunus persica]
 gb|EMJ02979.1| hypothetical protein PRUPE_ppa000010mg [Prunus persica]
Length=3493

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH---SNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVH S+ + S     SN   GL+L ++ PE +L LHKVLK HKHPVT+LH T+D+K 
Sbjct  3407  VWQMVHHSNHESSQQKSTSNGIGGLNLSDKAPEYRLVLHKVLKSHKHPVTSLHLTNDLKQ  3466

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WT+ ++S++++ ++G
Sbjct  3467  LLSGDSGGHLLSWTVPDESLRASMNQG  3493



>emb|CAN62237.1| hypothetical protein VITISV_014688 [Vitis vinifera]
Length=3508

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNP---TCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VWKMVHCS E  S   +      GL+LG +  E +L L KVLK HKHPVTALH T+D+K 
Sbjct  3422  VWKMVHCSDEGSSRSKSTNSGAAGLALGLKALEYRLVLQKVLKFHKHPVTALHLTTDLKQ  3481

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL ++S++++ + G
Sbjct  3482  LLSGDSGGHLISWTLPDESLRASFNHG  3508



>ref|XP_008235353.1| PREDICTED: BEACH domain-containing protein lvsA [Prunus mume]
Length=3612

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH---SNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVH S+ + S     SN   GL+L ++ PE +L LHKVLK HKHPVT+LH T+D+K 
Sbjct  3526  VWQMVHHSNHESSQQKSTSNGMGGLNLSDKAPEYRLVLHKVLKSHKHPVTSLHLTNDLKQ  3585

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WT+ ++S++++ ++G
Sbjct  3586  LLSGDSGGHLLSWTVPDESLRASMNQG  3612



>ref|XP_010424656.1| PREDICTED: LOW QUALITY PROTEIN: BEACH domain-containing protein 
lvsA-like [Camelina sativa]
Length=3751

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCS---SEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHC+   S +    SN T G+ LG+++PE KL LHK LK HK PVTALH T D+K 
Sbjct  3664  VWQMVHCTDLVSAENKTASNRTVGIHLGDQVPEYKLLLHKELKFHKKPVTALHLTIDLKQ  3723

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WT+ +D +K++  + 
Sbjct  3724  LLSGDSAGHLLSWTVPDDILKASLKKA  3750



>ref|NP_192175.3| Beige/BEACH and WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AEE82211.1| Beige/BEACH and WD40 domain-containing protein [Arabidopsis thaliana]
Length=3527

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH---SNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHC+     P    SN T GL+LGN+ PE KL LHK LK HK PVT+LH T+D+K 
Sbjct  3440  VWRMVHCTDPVSVPSKTPSNRTGGLNLGNQKPEYKLLLHKELKFHKQPVTSLHLTTDLKQ  3499

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WT+ ++ +K++  + 
Sbjct  3500  LLSGDSAGHLLSWTVPDEILKASLKKA  3526



>gb|KHG15673.1| WD repeat and FYVE domain-containing 3 [Gossypium arboreum]
Length=1905

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 4/87 (5%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNP---TCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVHC+ +D++   +    T GL LG + PE +L L KVLK HKHPVTALH TSD+K 
Sbjct  1820  VWHMVHCTDQDKTNSKSNMIGTGGLDLG-KSPEYRLVLQKVLKFHKHPVTALHLTSDLKQ  1878

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WTL ++S+KS+ ++G
Sbjct  1879  LLSGDSSGHLLSWTLPDESLKSSFNQG  1905



>ref|XP_010467060.1| PREDICTED: uncharacterized protein LOC104747170 [Camelina sativa]
Length=3035

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCS---SEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHC+   S +  P S+ T G+ LG+++PE KL LHK LK HK PVTALH T D+K 
Sbjct  2948  VWQMVHCTDPVSAENKPASDRTVGIHLGDQVPEYKLLLHKELKFHKKPVTALHLTIDLKQ  3007

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WT+ ++ +K++  + 
Sbjct  3008  LLSGDSDGHLLSWTVPDEILKASLKKA  3034



>ref|XP_010917623.1| PREDICTED: BEACH domain-containing protein lvsA isoform X1 [Elaeis 
guineensis]
Length=3598

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS-NPTCGLS-LG-NRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             +WKMVHCSSE+ S  S +P  G+  LG  R PE KL LHKVLK HKHPVTALH  SD+K 
Sbjct  3520  IWKMVHCSSEEASGRSLSPVNGMGGLGLTRAPEYKLVLHKVLKSHKHPVTALHLASDLKQ  3579

Query  491   LFSGDYGGSLHLWTLQE  441
             L SGD  G L  WT+ E
Sbjct  3580  LLSGDAVGHLLSWTVPE  3596



>ref|XP_010917624.1| PREDICTED: BEACH domain-containing protein lvsA isoform X2 [Elaeis 
guineensis]
Length=3498

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS-NPTCGLS-LG-NRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             +WKMVHCSSE+ S  S +P  G+  LG  R PE KL LHKVLK HKHPVTALH  SD+K 
Sbjct  3420  IWKMVHCSSEEASGRSLSPVNGMGGLGLTRAPEYKLVLHKVLKSHKHPVTALHLASDLKQ  3479

Query  491   LFSGDYGGSLHLWTLQE  441
             L SGD  G L  WT+ E
Sbjct  3480  LLSGDAVGHLLSWTVPE  3496



>ref|XP_010456000.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X1 [Camelina sativa]
 ref|XP_010456001.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X1 [Camelina sativa]
Length=3554

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCS---SEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHC+   S +    SN T G+ LG+++PE KL LHK LK HK PVTALH T D+K 
Sbjct  3468  VWQMVHCTDLVSAENKTASNRTVGIHLGDQVPEYKLLLHKELKFHKKPVTALHLTIDLKQ  3527

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WT+ ++ +K++  + 
Sbjct  3528  LLSGDSAGHLLSWTVPDEILKASLKKA  3554



>ref|XP_010456002.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X2 [Camelina sativa]
Length=3420

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCS---SEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHC+   S +    SN T G+ LG+++PE KL LHK LK HK PVTALH T D+K 
Sbjct  3334  VWQMVHCTDLVSAENKTASNRTVGIHLGDQVPEYKLLLHKELKFHKKPVTALHLTIDLKQ  3393

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WT+ ++ +K++  + 
Sbjct  3394  LLSGDSAGHLLSWTVPDEILKASLKKA  3420



>gb|EPS69873.1| hypothetical protein M569_04889, partial [Genlisea aurea]
Length=3496

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 6/86 (7%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS----NPTCGLSL-GNRLPECKLNLHKVLKGHKHPVTALHHTSDM  498
             +WKMVH SSE+ +  +     PT GL L G +LPE +L LHKVLK HK+PVT+L+ +SD+
Sbjct  3411  IWKMVHISSEESAEAAKHSRTPTAGLKLEGGKLPEYRLILHKVLKSHKNPVTSLYFSSDL  3470

Query  497   KYLFSGDYGGSLHLWTL-QEDSMKSA  423
             K L +GD  G L  WTL  E+S+KS+
Sbjct  3471  KQLLTGDSDGHLLSWTLPAEESIKSS  3496



>ref|XP_010270013.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X2 [Nelumbo nucifera]
Length=3568

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTC---GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVHCS E  S     T     L LG + PE KL LHKVLK HK PVTALH TSD K 
Sbjct  3482  VWHMVHCSEEASSQSKAATNWMGVLGLGGKAPEYKLVLHKVLKSHKFPVTALHLTSDQKQ  3541

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WTL  +S++++ ++G
Sbjct  3542  LLSGDSDGHLLSWTLPVESLRASINQG  3568



>ref|XP_010270012.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X1 [Nelumbo nucifera]
Length=3608

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTC---GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVHCS E  S     T     L LG + PE KL LHKVLK HK PVTALH TSD K 
Sbjct  3522  VWHMVHCSEEASSQSKAATNWMGVLGLGGKAPEYKLVLHKVLKSHKFPVTALHLTSDQKQ  3581

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WTL  +S++++ ++G
Sbjct  3582  LLSGDSDGHLLSWTLPVESLRASINQG  3608



>ref|XP_004981810.1| PREDICTED: BEACH domain-containing protein lvsA-like [Setaria 
italica]
Length=3585

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%), Gaps = 7/86 (8%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSN------PTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSD  501
             VWKMVHCSS DE+ +S       P+ GLSL  + PE +L L KVLK HKHPVTAL    D
Sbjct  3501  VWKMVHCSS-DEAVNSKSKSPAIPSGGLSLNGQTPEYRLLLQKVLKSHKHPVTALCIPPD  3559

Query  500   MKYLFSGDYGGSLHLWTLQEDSMKSA  423
             +K L SGD  G L  W+L++DS K +
Sbjct  3560  LKQLLSGDASGHLLSWSLKDDSFKGS  3585



>ref|XP_004495161.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X1 [Cicer arietinum]
Length=3595

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTC---GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHCS  D S   + +    GL+LG + PE +L L KVLK HKHPVTAL+ ++D+K 
Sbjct  3509  VWQMVHCSDPDSSLSKSGSGGFRGLNLGAKEPEYRLILRKVLKFHKHPVTALNLSTDLKQ  3568

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL ++S++ + ++G
Sbjct  3569  LLSGDSGGHLLSWTLPDESLRGSFNQG  3595



>ref|XP_004495163.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X3 [Cicer arietinum]
Length=3490

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTC---GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHCS  D S   + +    GL+LG + PE +L L KVLK HKHPVTAL+ ++D+K 
Sbjct  3404  VWQMVHCSDPDSSLSKSGSGGFRGLNLGAKEPEYRLILRKVLKFHKHPVTALNLSTDLKQ  3463

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL ++S++ + ++G
Sbjct  3464  LLSGDSGGHLLSWTLPDESLRGSFNQG  3490



>ref|XP_004495162.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X2 [Cicer arietinum]
Length=3600

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTC---GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHCS  D S   + +    GL+LG + PE +L L KVLK HKHPVTAL+ ++D+K 
Sbjct  3514  VWQMVHCSDPDSSLSKSGSGGFRGLNLGAKEPEYRLILRKVLKFHKHPVTALNLSTDLKQ  3573

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL ++S++ + ++G
Sbjct  3574  LLSGDSGGHLLSWTLPDESLRGSFNQG  3600



>ref|XP_003518902.2| PREDICTED: BEACH domain-containing protein lvsA-like [Glycine 
max]
Length=3605

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCG---LSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHCS+ D S   +   G   L+L    PE KL L KVLK HKHPVTALH T+D+K 
Sbjct  3519  VWQMVHCSNPDSSLSKSGFGGSGGLNLDGIEPEYKLVLRKVLKFHKHPVTALHLTTDLKQ  3578

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL E+S++ + ++G
Sbjct  3579  LLSGDSGGHLLSWTLPEESLRGSLNQG  3605



>ref|XP_008368709.1| PREDICTED: BEACH domain-containing protein lvsA-like [Malus domestica]
Length=3242

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVH---CSSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVH     S  +   SN   GL+L ++ PE +L LHKVLK HKHPVTAL  T+D+K 
Sbjct  3156  VWQMVHHTNJESSQQKSTSNGLGGLNLNDKAPEYRLVLHKVLKFHKHPVTALLLTNDLKQ  3215

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WT+ ++S++ + ++G
Sbjct  3216  LLSGDSGGHLLSWTVPDESLRXSMNQG  3242



>ref|XP_006286875.1| hypothetical protein CARUB_v10000019mg [Capsella rubella]
 gb|EOA19773.1| hypothetical protein CARUB_v10000019mg [Capsella rubella]
Length=3559

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCS---SEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHC+   S +    SN T G+ LG+++PE KL LHK LK HK PVTALH T D+K 
Sbjct  3472  VWQMVHCTDPLSAENKNASNRTRGIHLGDQVPEYKLLLHKELKFHKKPVTALHLTIDLKQ  3531

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD  G L  WT+ ++ +K++  + 
Sbjct  3532  LLSGDSAGHLLSWTIPDEILKASFKKA  3558



>gb|KHN18853.1| WD repeat and FYVE domain-containing protein 3 [Glycine soja]
Length=1727

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCG---LSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVHCS+ D S   +   G   L+L    PE KL L KVLK HKHPVTALH T+D+K 
Sbjct  1641  VWQMVHCSNPDSSLSKSGFGGSGGLNLDGIEPEYKLVLRKVLKFHKHPVTALHLTTDLKQ  1700

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL E+S++ + ++G
Sbjct  1701  LLSGDSGGHLLSWTLPEESLRGSLNQG  1727



>ref|XP_010038055.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X1 [Eucalyptus grandis]
Length=3586

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -1

Query  662   VWKMVHCS--SEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYL  489
             VW+M+HCS    +ES     + G +LG+R  E +L L KVLK HK PVTALH TSD+K L
Sbjct  3501  VWQMIHCSDLEAEESNLKGYSGGFNLGDRSSEYRLVLRKVLKFHKQPVTALHLTSDLKQL  3560

Query  488   FSGDYGGSLHLWTLQEDSMKSAASRG  411
              SGD  G L  WT+ ++ +K + +RG
Sbjct  3561  LSGDSNGHLLSWTIPDEVVKYSFNRG  3586



>ref|XP_010038056.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW49851.1| hypothetical protein EUGRSUZ_K03323 [Eucalyptus grandis]
Length=3585

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -1

Query  662   VWKMVHCS--SEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYL  489
             VW+M+HCS    +ES     + G +LG+R  E +L L KVLK HK PVTALH TSD+K L
Sbjct  3500  VWQMIHCSDLEAEESNLKGYSGGFNLGDRSSEYRLVLRKVLKFHKQPVTALHLTSDLKQL  3559

Query  488   FSGDYGGSLHLWTLQEDSMKSAASRG  411
              SGD  G L  WT+ ++ +K + +RG
Sbjct  3560  LSGDSNGHLLSWTIPDEVVKYSFNRG  3585



>ref|XP_009370829.1| PREDICTED: BEACH domain-containing protein lvsA [Pyrus x bretschneideri]
Length=3596

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVH---CSSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+MVH     S  +   SN   GL+L ++ PE  L LHKVLK HKHP+TAL  T+D+K 
Sbjct  3510  VWQMVHHTNLESSQQKSTSNGLGGLNLNDKAPEYGLVLHKVLKFHKHPITALLLTNDLKQ  3569

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WT+ ++S++++ ++G
Sbjct  3570  LLSGDSGGHLLSWTVPDESLRASMNQG  3596



>ref|NP_001167861.1| uncharacterized protein LOC100381565 [Zea mays]
 gb|ACN26329.1| unknown [Zea mays]
Length=209

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 5/83 (6%)
 Frame = -1

Query  662  VWKMVHCSSED--ESPHSNPTC---GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDM  498
            VWKM+HCSS++   S   +P     GLSL  + PE +L L KVLK HKHPVTAL    D+
Sbjct  125  VWKMLHCSSDEAVNSKSKSPAVSSGGLSLNGQAPEYRLLLQKVLKSHKHPVTALCIPPDL  184

Query  497  KYLFSGDYGGSLHLWTLQEDSMK  429
            K L SGD  G L  W+L++DS K
Sbjct  185  KQLLSGDGSGHLLSWSLKDDSFK  207



>ref|XP_010275218.1| PREDICTED: BEACH domain-containing protein lvsA-like isoform 
X1 [Nelumbo nucifera]
Length=3603

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH---SNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVH S E  S +   +N    + L  ++PE +L L+KVLK HK+PVTAL  TSD+K 
Sbjct  3517  VWHMVHSSDEASSLNKMATNWMGRVGLSGKVPEYRLVLYKVLKSHKYPVTALRLTSDLKQ  3576

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTLQ+++++++ ++G
Sbjct  3577  LLSGDSGGHLLSWTLQDENLRASFNQG  3603



>ref|XP_010275219.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like 
isoform X2 [Nelumbo nucifera]
Length=3516

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH---SNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW MVH S E  S +   +N    + L  ++PE +L L+KVLK HK+PVTAL  TSD+K 
Sbjct  3430  VWHMVHSSDEASSLNKMATNWMGRVGLSGKVPEYRLVLYKVLKSHKYPVTALRLTSDLKQ  3489

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTLQ+++++++ ++G
Sbjct  3490  LLSGDSGGHLLSWTLQDENLRASFNQG  3516



>tpg|DAA51286.1| TPA: hypothetical protein ZEAMMB73_996940 [Zea mays]
Length=2552

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 5/85 (6%)
 Frame = -1

Query  662   VWKMVHCSSED--ESPHSNPTC---GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDM  498
             VWKM+HCSS++   S   +P     GLSL  + PE +L L KVLK HKHPVTAL    D+
Sbjct  2468  VWKMLHCSSDEAVNSKSKSPAVSSGGLSLNGQAPEYRLLLQKVLKSHKHPVTALCIPPDL  2527

Query  497   KYLFSGDYGGSLHLWTLQEDSMKSA  423
             K L SGD  G L  W+L++DS K +
Sbjct  2528  KQLLSGDGSGHLLSWSLKDDSFKGS  2552



>ref|XP_006838926.1| hypothetical protein AMTR_s00002p00270160 [Amborella trichopoda]
 gb|ERN01495.1| hypothetical protein AMTR_s00002p00270160 [Amborella trichopoda]
Length=3592

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYLFS  483
             VW MVH S  +E+       GL LG +  E +L L+KVLK H+  VTALH TSDMK L S
Sbjct  3507  VWCMVHGS--EEAGEGRSIGGLGLGVKETEYRLVLYKVLKAHRQTVTALHLTSDMKQLLS  3564

Query  482   GDYGGSLHLWTLQEDSMKSAASR  414
             GD GG L  WTL +D MK  + +
Sbjct  3565  GDSGGHLISWTLPDDGMKGGSFK  3587



>ref|XP_006651808.1| PREDICTED: BEACH domain-containing protein lvsA-like, partial 
[Oryza brachyantha]
Length=3520

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 53/84 (63%), Gaps = 7/84 (8%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSN----PTC--GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSD  501
             VWKMVHC+S DE+ +S     PT   GL L  +  E +L L KVLK HKHPVTAL    D
Sbjct  3436  VWKMVHCTS-DEAANSKSKSPPTTFGGLGLNGQTLEYRLLLQKVLKAHKHPVTALCLPPD  3494

Query  500   MKYLFSGDYGGSLHLWTLQEDSMK  429
             +K L SGD  G L  W+L++DS K
Sbjct  3495  LKQLLSGDSSGHLFSWSLKDDSFK  3518



>ref|XP_006588647.1| PREDICTED: BEACH domain-containing protein lvsA-like [Glycine 
max]
Length=3609

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCGLSLGNRL---PECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+M+HCS+ D S   +   G    N     PE KL L KVLK HKH VTALH T+D+K 
Sbjct  3523  VWQMIHCSNPDSSLSKSGFGGSGGLNLGGLEPEYKLVLRKVLKFHKHSVTALHLTTDLKQ  3582

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL E+S++ + ++G
Sbjct  3583  LLSGDSGGHLLSWTLPEESLRGSLNQG  3609



>gb|KHN03827.1| WD repeat and FYVE domain-containing protein 3 [Glycine soja]
Length=4684

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCGLSLGNRL---PECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VW+M+HCS+ D S   +   G    N     PE KL L KVLK HKH VTALH T+D+K 
Sbjct  3518  VWQMIHCSNPDNSLSKSGFGGSGGLNLGGLEPEYKLVLRKVLKFHKHSVTALHLTTDLKQ  3577

Query  491   LFSGDYGGSLHLWTLQEDSMKSAASRG  411
             L SGD GG L  WTL E+S++ + ++G
Sbjct  3578  LLSGDSGGHLLSWTLPEESLRGSLNQG  3604



>ref|XP_002463893.1| hypothetical protein SORBIDRAFT_01g008410 [Sorghum bicolor]
 gb|EER90891.1| hypothetical protein SORBIDRAFT_01g008410 [Sorghum bicolor]
Length=3513

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCG---LSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
             VWKMVHCSS++     +P+     L+L  + PE +L L KVLK HKHPVTAL    D+K 
Sbjct  3431  VWKMVHCSSDEAVKSKSPSVSSGGLTLNGQTPEYRLLLQKVLKSHKHPVTALCIPPDLKQ  3490

Query  491   LFSGDYGGSLHLWTLQEDSMKSA  423
             L SGD  G L  W+L++DS K +
Sbjct  3491  LLSGDASGHLLSWSLKDDSFKGS  3513



>gb|EMT33621.1| WD repeat and FYVE domain-containing protein 3 [Aegilops tauschii]
Length=3572

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSN--PTC---GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDM  498
             VWKMVHC+S++ + + N  PT    G  L  +  E +L L KVLK HKHPVTAL    D+
Sbjct  3488  VWKMVHCTSDEAANNKNKSPTTTYGGPGLDVQTLEYRLILQKVLKSHKHPVTALCIPPDL  3547

Query  497   KYLFSGDYGGSLHLWTLQEDSMKSA  423
             K L SGD  G L  W+L++DS K +
Sbjct  3548  KQLLSGDANGHLFSWSLKDDSFKGS  3572



>ref|XP_010230072.1| PREDICTED: BEACH domain-containing protein lvsA [Brachypodium 
distachyon]
Length=3588

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = -1

Query  662   VWKMVHCSSEDESPH---SNPTC--GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDM  498
             VWKMVHC+S++ + +   S PT   G  L  +  E +L L KVLK HKHPVTAL    D+
Sbjct  3504  VWKMVHCTSDEAANNKSKSPPTSYGGPDLNGQTLEYRLLLQKVLKSHKHPVTALCLPPDL  3563

Query  497   KYLFSGDYGGSLHLWTLQEDSMKSA  423
             K L SGD  G L  W+L++DS K +
Sbjct  3564  KQLLSGDASGRLFSWSLKDDSFKGS  3588



>gb|AAP12994.1| putative beige protein [Oryza sativa Japonica Group]
Length=3590

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 7/84 (8%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSN----PTC--GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSD  501
             VWKMVH +S DE+ +S     P+   G+SL  +  E +L L KVLK HKHPVTAL    D
Sbjct  3506  VWKMVHYTS-DEAANSKSKSPPSTLGGMSLNGQTQEYRLLLQKVLKAHKHPVTALCLPPD  3564

Query  500   MKYLFSGDYGGSLHLWTLQEDSMK  429
             +K L SGD  G L  W+L++DS K
Sbjct  3565  LKQLLSGDASGHLFSWSLKDDSFK  3588



>gb|EEE59913.1| hypothetical protein OsJ_12537 [Oryza sativa Japonica Group]
Length=3589

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 7/84 (8%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSN----PTC--GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSD  501
             VWKMVH +S DE+ +S     P+   G+SL  +  E +L L KVLK HKHPVTAL    D
Sbjct  3505  VWKMVHYTS-DEAANSKSKSPPSTLGGMSLNGQTQEYRLLLQKVLKAHKHPVTALCLPPD  3563

Query  500   MKYLFSGDYGGSLHLWTLQEDSMK  429
             +K L SGD  G L  W+L++DS K
Sbjct  3564  LKQLLSGDASGHLFSWSLKDDSFK  3587



>ref|NP_001173640.1| Os03g0744650 [Oryza sativa Japonica Group]
 gb|ABF98825.1| WD-40 repeat family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH92368.1| Os03g0744650 [Oryza sativa Japonica Group]
Length=3582

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 7/84 (8%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSN----PTC--GLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSD  501
             VWKMVH +S DE+ +S     P+   G+SL  +  E +L L KVLK HKHPVTAL    D
Sbjct  3498  VWKMVHYTS-DEAANSKSKSPPSTLGGMSLNGQTQEYRLLLQKVLKAHKHPVTALCLPPD  3556

Query  500   MKYLFSGDYGGSLHLWTLQEDSMK  429
             +K L SGD  G L  W+L++DS K
Sbjct  3557  LKQLLSGDASGHLFSWSLKDDSFK  3580



>emb|CDY69186.1| BnaAnng29620D, partial [Brassica napus]
Length=986

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -1

Query  662  VWKMVHCSSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYLFS  483
            VW+MVHC+    +   + +      N +PE KL LHK L  HK PVTALH T+D+K L S
Sbjct  886  VWQMVHCTDPVGAEIKSASNRTGWTNLVPEYKLLLHKELDCHKQPVTALHLTADLKQLLS  945

Query  482  GDYGGSLHLWTLQEDSMKSA  423
            GD GG L  WT+ +  +K++
Sbjct  946  GDSGGRLISWTVPDQILKAS  965



>ref|XP_009134417.1| PREDICTED: BEACH domain-containing protein lvsA [Brassica rapa]
Length=3548

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHSNPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKYLFS  483
             VW+MVHC+    +   + +      N +PE KL  HK L  HK P+TALH T+D+K L S
Sbjct  3448  VWQMVHCTDPVGAEIKSASNRTGWTNLVPEYKLLPHKELDCHKQPITALHLTADLKQLLS  3507

Query  482   GDYGGSLHLWTLQEDSMKSA  423
             GD GG L  WT+ +  +K++
Sbjct  3508  GDSGGRLISWTVPDQILKAS  3527



>gb|KHG10466.1| BEACH domain-containing lvsA [Gossypium arboreum]
Length=567

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = -1

Query  662  VWKMVHCSSEDESPHSNP---TCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDMKY  492
            VW MVHC+  +   +S     T GL L +  PE +L LHKVL  HKHPVT+L  T+D+K 
Sbjct  492  VWHMVHCTDIETISNSTSVGTTGGLPL-DESPEYRLLLHKVLTFHKHPVTSLFLTTDLKQ  550

Query  491  LFSGDYGGSLHLWTL  447
            L SGD GG L  WTL
Sbjct  551  LLSGDSGGHLLSWTL  565



>ref|XP_002982237.1| hypothetical protein SELMODRAFT_116002, partial [Selaginella 
moellendorffii]
 gb|EFJ16905.1| hypothetical protein SELMODRAFT_116002, partial [Selaginella 
moellendorffii]
Length=3422

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  578   PECKLNLHKVLKGHKHPVTALHHTSDMKYLFSGDYGGSLHLWTL  447
             PE  L LHKVLK H  PVTALH + D+K L+SGD GG +  W L
Sbjct  3334  PEYHLVLHKVLKSHTQPVTALHLSPDLKQLYSGDAGGHVTSWVL  3377



>ref|XP_002993431.1| hypothetical protein SELMODRAFT_137112, partial [Selaginella 
moellendorffii]
 gb|EFJ05524.1| hypothetical protein SELMODRAFT_137112, partial [Selaginella 
moellendorffii]
Length=3416

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  578   PECKLNLHKVLKGHKHPVTALHHTSDMKYLFSGDYGGSLHLWTL  447
             PE  L LHKVLK H  PVTALH + D+K L+SGD GG +  W L
Sbjct  3328  PEYHLVLHKVLKSHTQPVTALHLSPDLKQLYSGDAGGHVTSWVL  3371



>ref|XP_001762140.1| predicted protein [Physcomitrella patens]
 gb|EDQ72932.1| predicted protein [Physcomitrella patens]
Length=3835

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  578   PECKLNLHKVLKGHKHPVTALHHTSDMKYLFSGDYGGSLHLWTLQEDSMKSAAS  417
             PE +L L+KVL  HK PVTAL   +D+K L SGD GG L  WTL +D  K   S
Sbjct  3667  PEYQLVLYKVLSWHKEPVTALSLGNDLKQLCSGDAGGHLVSWTLPDDGFKQTPS  3720



>ref|XP_001764972.1| predicted protein [Physcomitrella patens]
 gb|EDQ70188.1| predicted protein [Physcomitrella patens]
Length=3518

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  578   PECKLNLHKVLKGHKHPVTALHHTSDMKYLFSGDYGGSLHLWTLQEDSMKSAAS  417
             PE +L L+KVL  HK PVTAL   +D+K L SGD GG L  WTL +D  K   S
Sbjct  3459  PEYQLVLYKVLSWHKKPVTALSLGNDLKQLCSGDAGGHLVSWTLPDDGFKQTPS  3512



>ref|XP_001768814.1| predicted protein [Physcomitrella patens]
 gb|EDQ66367.1| predicted protein [Physcomitrella patens]
Length=3916

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  578   PECKLNLHKVLKGHKHPVTALHHTSDMKYLFSGDYGGSLHLWTLQEDSMKS  426
             PE +L L KVL  HK PVTAL   +D+K L SGD GG +  WTL +D  KS
Sbjct  3585  PEYQLTLIKVLTWHKEPVTALCLGNDLKQLCSGDSGGHVVSWTLLDDVSKS  3635



>ref|XP_001774708.1| predicted protein [Physcomitrella patens]
 gb|EDQ60523.1| predicted protein [Physcomitrella patens]
Length=3541

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 45/84 (54%), Gaps = 6/84 (7%)
 Frame = -1

Query  662   VWKMVHCSSEDESPHS-----NPTCGLSLGNRLPECKLNLHKVLKGHKHPVTALHHTSDM  498
             +W+M   S    +  S     NPT  + +    PE +L L KVL  HK PVTAL   +D+
Sbjct  3441  LWRMQFDSQSSTNRMSLLRTKNPT-KMCITGGTPEFQLVLIKVLSWHKEPVTALCLGNDL  3499

Query  497   KYLFSGDYGGSLHLWTLQEDSMKS  426
             K L SGD GG +  WTL +D  K+
Sbjct  3500  KQLCSGDSGGHVVSWTLLDDISKN  3523



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 959982664718