BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3716_g1_i1 len=303 path=[1:0-302]

Length=303
                                                                      Score     E

gb|AIT42148.1|  defensin-like protein                                 77.4    4e-16   
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         77.4    4e-16   
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    77.0    5e-16   
gb|AFW90621.1|  protease inhibitor-related protein                    77.0    7e-16   
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            76.6    7e-16   
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      76.6    7e-16   
gb|AAL35366.1|AF442388_1  defensin protein precursor                  76.6    7e-16   Capsicum annuum
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    76.6    8e-16   
gb|ACJ26760.1|  protease inhibitor-related protein                    76.3    1e-15   Solanum tuberosum [potatoes]
gb|AIT42152.1|  defensin-like protein                                 76.3    1e-15   
gb|AIT42149.1|  defensin-like protein                                 76.3    1e-15   
gb|KHN06998.1|  Defensin-like protein                                 75.5    2e-15   
gb|AIT42147.1|  defensin-like protein                                 75.5    2e-15   
gb|AIT42153.1|  defensin-like protein                                 75.1    3e-15   
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  74.7    4e-15   Capsicum annuum
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    74.7    5e-15   
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            75.5    6e-15   
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 73.6    1e-14   
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            72.8    2e-14   
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         72.8    3e-14   
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       72.8    3e-14   
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      72.4    4e-14   
emb|CEJ09690.1|  Defensin protein                                     72.4    4e-14   
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  72.0    5e-14   Solanum tuberosum [potatoes]
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 71.6    7e-14   
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            71.6    7e-14   
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  71.6    7e-14   Petunia integrifolia [violet-flowered petunia]
ref|NP_001047493.1|  Os02g0629800                                     71.6    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            71.2    8e-14   
ref|XP_003628979.1|  Defensin                                         71.2    9e-14   
gb|ACN93800.1|  defensin precursor                                    71.2    9e-14   Vigna unguiculata
gb|KHN23780.1|  Defensin SD2                                          71.2    1e-13   
emb|CDP10468.1|  unnamed protein product                              70.9    1e-13   
dbj|BAA95697.1|  thionin like protein                                 70.9    1e-13   Nicotiana tabacum [American tobacco]
gb|EAY86781.1|  hypothetical protein OsI_08161                        75.1    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           70.1    3e-13   
gb|AFK44299.1|  unknown                                               69.7    4e-13   
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            69.3    5e-13   
ref|XP_011070572.1|  PREDICTED: defensin J1-2-like                    69.3    5e-13   
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            69.3    5e-13   
gb|ABO36637.1|  defensin protein                                      68.9    7e-13   Solanum lycopersicum
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 68.9    7e-13   
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    68.6    1e-12   
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       68.2    1e-12   
ref|NP_001234987.1|  protease inhibitor precursor                     68.2    1e-12   
ref|XP_003629332.1|  Defensin                                         68.2    2e-12   
ref|XP_003628977.1|  Defensin                                         67.8    2e-12   
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    67.8    2e-12   
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  67.4    3e-12   Helianthus annuus
gb|ABO36641.1|  defensin protein                                      67.4    3e-12   Solanum pimpinellifolium [currant tomato]
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 67.4    3e-12   
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       67.4    3e-12   
gb|ACB32234.1|  gamma-thionin/defensin                                67.0    4e-12   Solanum chacoense
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            67.0    4e-12   
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    66.6    5e-12   
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            66.2    6e-12   
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 66.2    8e-12   
ref|NP_001234872.1|  gamma-thionin precursor                          65.5    1e-11   
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    63.9    5e-11   Vitis vinifera
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    63.9    5e-11   
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               63.9    6e-11   
ref|XP_003628978.1|  Defensin                                         63.9    6e-11   
emb|CDY48618.1|  BnaC09g20670D                                        63.5    7e-11   
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               63.5    8e-11   
gb|EMT22728.1|  Defensin Tm-AMP-D1.2                                  63.2    1e-10   
gb|AIA66999.1|  defensin                                              63.2    1e-10   
gb|ABM89231.1|  defensin                                              62.8    1e-10   Setaria italica
gb|EMT22729.1|  Defensin Tk-AMP-D2                                    62.4    2e-10   
gb|AIT42150.1|  defensin-like protein                                 62.0    2e-10   
gb|AIA67000.1|  defensin                                              62.4    2e-10   
ref|XP_002513755.1|  Low-molecular-weight cysteine-rich protein L...  62.0    3e-10   Ricinus communis
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               61.6    3e-10   
emb|CDP16306.1|  unnamed protein product                              61.6    3e-10   
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           61.6    4e-10   
gb|EMT22726.1|  Defensin Tm-AMP-D1.2                                  61.6    4e-10   
emb|CEJ09689.1|  Defensin protein                                     61.2    5e-10   
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               60.8    7e-10   
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 60.8    7e-10   
gb|KHG09995.1|  Defensin-like protein 1                               60.8    7e-10   
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           60.8    8e-10   
gb|EMS54457.1|  Defensin Tk-AMP-D4                                    60.8    8e-10   
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               60.8    8e-10   
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  60.8    9e-10   
ref|XP_004297787.1|  PREDICTED: defensin-like protein 2-like          60.5    1e-09   
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           60.5    1e-09   
gb|ACG41256.1|  low-molecular-weight cysteine-rich protein LCR70 ...  60.5    1e-09   Zea mays [maize]
gb|EMS52097.1|  Defensin Tk-AMP-D1                                    60.5    1e-09   
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              60.1    1e-09   
gb|AFW58880.1|  low-molecular-weight cysteine-rich protein LCR70      60.1    1e-09   
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       60.1    2e-09   
ref|XP_004297786.1|  PREDICTED: defensin-like protein 2-like          59.7    2e-09   
ref|XP_007033367.1|  Scorpion toxin-like knottin superfamily protein  59.7    2e-09   
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               59.7    2e-09   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               59.7    2e-09   
ref|XP_004953175.1|  PREDICTED: defensin-like protein 2-like          59.7    2e-09   
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               59.7    2e-09   
gb|ADK87340.1|  defensin                                              59.3    2e-09   
emb|CAA65045.1|  defensin                                             59.3    3e-09   
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               59.3    3e-09   
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            59.3    3e-09   
gb|KFK33427.1|  hypothetical protein AALP_AA5G011600                  58.9    4e-09   
gb|AAL85480.1|  defensin protein 1                                    58.9    4e-09   Prunus persica
ref|XP_003630422.1|  Defensin                                         58.5    4e-09   
emb|CEJ09688.1|  Defensin protein                                     58.5    5e-09   
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           58.5    5e-09   
gb|ACG30752.1|  low-molecular-weight cysteine-rich protein LCR69 ...  58.5    6e-09   Zea mays [maize]
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               58.5    6e-09   
gb|AAA91049.1|  protease inhibitor II                                 58.5    6e-09   Brassica rapa
gb|ACG25019.1|  low-molecular-weight cysteine-rich protein LCR69 ...  58.5    6e-09   Zea mays [maize]
ref|NP_001147001.1|  LOC100280611 precursor                           58.5    6e-09   Zea mays [maize]
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               58.5    6e-09   
ref|NP_001149230.1|  LOC100282852 precursor                           58.2    8e-09   Zea mays [maize]
gb|AGT51227.1|  defensin                                              58.2    8e-09   
sp|Q43413.1|DEF1_CAPAN  RecName: Full=Defensin J1-1; Flags: Precu...  58.2    9e-09   Capsicum annuum
gb|ADQ43196.1|  unknown                                               57.8    9e-09   
gb|AFE88173.1|  g-thionin                                             57.8    1e-08   
gb|AGT51229.1|  defensin                                              57.8    1e-08   
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           57.8    1e-08   
ref|XP_003599384.1|  Defensin                                         57.4    1e-08   
ref|XP_007045354.1|  Defensin-like protein isoform 2                  57.4    1e-08   
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            57.4    1e-08   
ref|XP_009114204.1|  PREDICTED: defensin-like protein 2               57.4    2e-08   
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               57.0    2e-08   
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           57.0    2e-08   
dbj|BAJ89304.1|  predicted protein                                    57.0    2e-08   
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           57.0    2e-08   
gb|EMT16291.1|  Defensin SD2                                          57.0    2e-08   
gb|AIA66987.1|  defensin                                              57.0    2e-08   
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               56.6    2e-08   
dbj|BAC10287.1|  defensin                                             56.6    3e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           56.6    3e-08   
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               56.6    3e-08   
gb|EMT06279.1|  Defensin-like protein 2                               56.6    3e-08   
gb|ACV84383.1|  defensin precursor                                    56.6    3e-08   Triticum turgidum subsp. durum
gb|ACV84379.1|  defensin precursor                                    56.2    4e-08   Triticum aestivum [Canadian hard winter wheat]
gb|ACB20518.1|  defensin precursor                                    56.2    4e-08   Saccharum officinarum [noble cane]
ref|XP_008389118.1|  PREDICTED: defensin-like protein 1               56.2    4e-08   
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               55.8    5e-08   
gb|AGT51228.1|  defensin                                              55.8    5e-08   
gb|AFQ69079.1|  defensin precursor                                    55.8    5e-08   
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               55.8    5e-08   
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               55.8    6e-08   
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  56.6    6e-08   
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               55.8    6e-08   
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               55.8    6e-08   
dbj|BAJ86109.1|  predicted protein                                    55.8    6e-08   
gb|KEH35661.1|  Defensin                                              55.5    6e-08   
gb|EMT22721.1|  Defensin Tk-AMP-D2                                    55.8    6e-08   
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           55.5    7e-08   
ref|NP_178321.1|  defensin-like protein 1                             55.5    7e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AIA66993.1|  defensin                                              55.5    8e-08   
ref|XP_002452484.1|  hypothetical protein SORBIDRAFT_04g026670        55.5    8e-08   Sorghum bicolor [broomcorn]
ref|XP_006292097.1|  hypothetical protein CARUB_v10018292mg           55.5    1e-07   
ref|NP_178319.1|  defensin-like protein 2                             55.1    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        54.7    1e-07   Sorghum bicolor [broomcorn]
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       54.7    1e-07   
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   54.7    2e-07   
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    54.7    2e-07   
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      54.7    2e-07   Castanea sativa
ref|XP_007045353.1|  Defensin-like protein isoform 1                  54.3    2e-07   
gb|AIA67004.1|  defensin                                              54.3    2e-07   
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           55.1    2e-07   
dbj|BAB64929.1|  defensin-like protein                                54.3    2e-07   Pyrus pyrifolia [sha li]
gb|EMS52277.1|  Defensin Tk-AMP-D1.1                                  53.9    3e-07   
ref|NP_001146997.1|  flower-specific gamma-thionin                    53.5    3e-07   Zea mays [maize]
ref|XP_002446801.1|  hypothetical protein SORBIDRAFT_06g022870        53.5    3e-07   Sorghum bicolor [broomcorn]
ref|XP_009351647.1|  PREDICTED: defensin-like protein 1               53.9    4e-07   
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 53.5    4e-07   Jatropha curcas
ref|XP_007033370.1|  Scorpion toxin-like knottin superfamily protein  53.5    4e-07   
ref|NP_001146981.1|  flower-specific gamma-thionin precursor          53.5    4e-07   Zea mays [maize]
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  53.5    4e-07   Ricinus communis
gb|KGN49760.1|  hypothetical protein Csa_5G114570                     53.1    4e-07   
gb|EMT18782.1|  Defensin-like protein                                 56.2    5e-07   
emb|CAA62761.1|  putative gamma-thionin protein                       53.1    6e-07   Picea abies
gb|AIA67009.1|  defensin                                              52.8    6e-07   
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    52.8    8e-07   
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               52.8    8e-07   
ref|XP_004976260.1|  PREDICTED: defensin-like protein-like            52.8    9e-07   
gb|ABK23404.1|  unknown                                               52.8    9e-07   Picea sitchensis
gb|ACS96442.1|  defensin                                              52.4    9e-07   Jatropha curcas
gb|AIA66994.1|  defensin                                              52.4    1e-06   
emb|CAH58740.1|  defensin                                             52.0    1e-06   Plantago major [cart-track plant]
gb|AIA67011.1|  defensin                                              52.0    1e-06   
ref|XP_003575412.1|  PREDICTED: defensin Tm-AMP-D1.2-like             52.0    1e-06   
gb|ABX84377.1|  amylase inhibitor-like protein                        52.0    1e-06   Triticum aestivum [Canadian hard winter wheat]
gb|ABA81896.1|  putative defensin                                     51.6    1e-06   Aquilegia formosa
gb|ABX84378.1|  amylase inhibitor-like protein                        52.0    1e-06   Triticum aestivum [Canadian hard winter wheat]
gb|AIA66992.1|  defensin                                              52.0    1e-06   
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          51.6    2e-06   
gb|AAP80654.1|AF479035_1  proteinase inhibitor Rgpi9                  51.6    2e-06   Triticum aestivum [Canadian hard winter wheat]
gb|AAS65426.1|  Kunitz-type trypsin inhibitor                         51.6    2e-06   Ipomoea batatas [batate]
gb|EMT03364.1|  Defensin SD2                                          51.6    2e-06   
gb|AAS13434.1|  defensin                                              50.8    2e-06   Nicotiana attenuata
gb|EMT03877.1|  Defensin Tk-AMP-D3                                    51.2    2e-06   
ref|XP_010246429.1|  PREDICTED: defensin-like protein                 51.6    2e-06   
dbj|BAK06284.1|  predicted protein                                    51.6    3e-06   
ref|XP_006586320.1|  PREDICTED: defensin-like protein-like            51.2    3e-06   
gb|KHG15212.1|  Defensin-like protein 1                               50.8    3e-06   
gb|EMS68062.1|  Defensin Tm-AMP-D1.2                                  50.8    3e-06   
gb|ACV84382.1|  defensin precursor                                    51.2    3e-06   Triticum turgidum subsp. durum
gb|AFD01290.1|  defensin 3                                            51.2    3e-06   
gb|ABK25062.1|  unknown                                               51.2    3e-06   Picea sitchensis
gb|KHN16909.1|  Defensin J1-2                                         51.2    3e-06   
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    50.8    4e-06   
gb|AIA67014.1|  defensin                                              50.8    4e-06   
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    50.8    4e-06   
ref|XP_009590912.1|  PREDICTED: defensin-like protein 1               50.8    4e-06   
gb|EMS65297.1|  Defensin SD2                                          50.4    4e-06   
gb|EMT32128.1|  Defensin-like protein                                 51.2    4e-06   
pdb|2LR3|A  Chain A, Solution Structure Of The Anti-fungal Defens...  50.1    5e-06   
gb|EMT11359.1|  Defensin-like protein P322                            50.4    5e-06   
gb|AHA50470.1|  defensin-like protein 1                               50.4    5e-06   
gb|ABA86586.1|  putative defensin 1                                   50.1    6e-06   Aquilegia formosa
ref|XP_002875116.1|  hypothetical protein ARALYDRAFT_904442           50.1    6e-06   
ref|XP_009780051.1|  PREDICTED: defensin-like protein 1               50.1    6e-06   
gb|EPS66510.1|  kunitz trypsin inhibitor protein                      50.1    6e-06   
ref|XP_002451983.1|  hypothetical protein SORBIDRAFT_04g012170        50.1    6e-06   Sorghum bicolor [broomcorn]
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           50.1    7e-06   
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           50.1    7e-06   
ref|XP_002459604.1|  hypothetical protein SORBIDRAFT_02g007400        50.1    8e-06   Sorghum bicolor [broomcorn]
ref|XP_010675152.1|  PREDICTED: defensin-like protein 1 isoform X1    49.7    8e-06   
ref|XP_003573542.1|  PREDICTED: defensin-like protein 3               49.7    9e-06   
gb|AFK47422.1|  unknown                                               49.7    1e-05   
gb|AHA50472.1|  defensin-like protein 5                               49.3    1e-05   
ref|XP_008340513.1|  PREDICTED: defensin-like protein 1               49.7    1e-05   
ref|XP_009370221.1|  PREDICTED: defensin-like protein 2               49.7    1e-05   
ref|XP_009383785.1|  PREDICTED: defensin-like protein 1               49.3    1e-05   
ref|NP_178320.1|  defensin-like protein 4                             49.3    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EMT11360.1|  Defensin Tk-AMP-D4                                    49.3    1e-05   
gb|AIA66989.1|  defensin                                              49.3    1e-05   
gb|ACV84384.1|  defensin precursor                                    49.3    1e-05   Triticum turgidum subsp. durum
gb|ABS72000.1|  putative defensin protein 1                           48.9    1e-05   Olea europaea
gb|AHA50473.1|  defensin-like protein 6                               49.3    1e-05   
dbj|BAK07043.1|  predicted protein                                    49.7    1e-05   
ref|NP_178322.1|  defensin-like protein 10                            48.9    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|ACV84381.1|  defensin precursor                                    49.3    1e-05   Triticum turgidum subsp. durum
ref|XP_006394251.1|  hypothetical protein EUTSA_v10005235mg           48.9    1e-05   
ref|XP_004976259.1|  PREDICTED: defensin-like protein-like            48.9    2e-05   
ref|XP_004976261.1|  PREDICTED: defensin-like protein P322-like       48.9    2e-05   
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            48.9    2e-05   
ref|XP_007203247.1|  hypothetical protein PRUPE_ppa019504mg           48.9    2e-05   
ref|XP_006367122.1|  PREDICTED: defensin J1-2-like                    48.9    2e-05   
gb|AHA50471.1|  defensin-like protein 4                               48.9    2e-05   
gb|ABA86589.1|  putative defensin 1                                   48.5    2e-05   Aquilegia pyrenaica
emb|CAD41436.1|  OSJNBa0019D11.21                                     48.9    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002325734.2|  defensin-like family protein                     48.5    2e-05   Populus trichocarpa [western balsam poplar]
gb|EMT00351.1|  Defensin-like protein                                 48.5    2e-05   
ref|XP_009763849.1|  PREDICTED: defensin-like protein 1               48.5    2e-05   
ref|XP_006292846.1|  hypothetical protein CARUB_v10019106mg           48.5    2e-05   
emb|CAH65875.1|  OSIGBa0160I04.1                                      48.5    3e-05   Oryza sativa [red rice]
emb|CDM85870.1|  unnamed protein product                              48.1    3e-05   
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        48.1    3e-05   Sorghum bicolor [broomcorn]
ref|XP_007203287.1|  hypothetical protein PRUPE_ppa025677mg           48.1    3e-05   
ref|XP_003630421.1|  Defensin                                         48.1    3e-05   
gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 47.8    4e-05   
gb|EMT26158.1|  Defensin-like protein                                 47.8    4e-05   
ref|XP_009101271.1|  PREDICTED: defensin-like protein 10              47.8    5e-05   
ref|XP_011099655.1|  PREDICTED: defensin-like protein 1               47.4    5e-05   
ref|XP_002862935.1|  low-molecular-weight cysteine-rich 76            47.8    5e-05   
gb|AAM62652.1|  protease inhibitor II                                 47.4    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EMS64594.1|  Defensin Tm-AMP-D1.2                                  47.8    5e-05   
ref|XP_009389205.1|  PREDICTED: defensin Tk-AMP-D2-like               47.4    5e-05   
ref|XP_004954814.1|  PREDICTED: defensin SD2-like                     47.4    6e-05   
ref|XP_010025674.1|  PREDICTED: defensin-like protein 1               47.4    7e-05   
ref|NP_001048853.1|  Os03g0130300                                     47.4    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008240820.1|  PREDICTED: defensin Ec-AMP-D1-like               47.4    7e-05   
ref|NP_201171.1|  defensin-like protein 6                             47.0    8e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39856.1|  BnaC02g42620D                                        47.0    8e-05   
ref|XP_004503014.1|  PREDICTED: defensin-like protein 6-like isof...  47.0    9e-05   
emb|CAH65876.1|  OSIGBa0160I04.2                                      46.6    1e-04   Oryza sativa [red rice]
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    46.6    1e-04   
ref|XP_004509637.1|  PREDICTED: defensin J1-2-like                    46.2    1e-04   
gb|ABA86587.1|  putative defensin 1                                   46.6    1e-04   Aquilegia chrysantha
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     46.6    1e-04   
ref|XP_010088525.1|  Defensin-like protein 2                          46.6    1e-04   
ref|XP_009353671.1|  PREDICTED: defensin-like protein 2               46.6    1e-04   
ref|XP_010096414.1|  Defensin-like protein 6                          47.4    1e-04   
ref|XP_007204040.1|  hypothetical protein PRUPE_ppa021088mg           46.2    1e-04   
gb|EMT03363.1|  hypothetical protein F775_43918                       46.2    2e-04   
ref|XP_002865329.1|  hypothetical protein ARALYDRAFT_917107           46.2    2e-04   
gb|EMS49334.1|  Defensin-like protein                                 46.2    2e-04   
gb|ABK93231.1|  unknown                                               46.2    2e-04   
gb|AIA67010.1|  defensin                                              46.2    2e-04   
dbj|BAK07823.1|  predicted protein                                    46.2    2e-04   
sp|P84964.1|DEF12_TRIMO  RecName: Full=Defensin Tm-AMP-D1.2           45.8    2e-04   
sp|P84968.1|DEF2_TRIKH  RecName: Full=Defensin Tk-AMP-D2              45.4    2e-04   
ref|XP_010675153.1|  PREDICTED: defensin-like protein 1 isoform X2    45.8    2e-04   
gb|EMT03365.1|  Defensin-like protein 1                               45.8    2e-04   
ref|XP_009345992.1|  PREDICTED: defensin-like protein 2               46.2    2e-04   
ref|XP_009353672.1|  PREDICTED: defensin-like protein 2               46.2    2e-04   
ref|NP_001031460.1|  low-molecular-weight cysteine-rich 76            45.8    2e-04   
ref|XP_002459605.1|  hypothetical protein SORBIDRAFT_02g007410        45.8    2e-04   
ref|XP_009355482.1|  PREDICTED: defensin Tk-AMP-D1.1-like             45.8    2e-04   
gb|AIA66990.1|  defensin                                              45.8    3e-04   
sp|P84965.1|DEF11_TRIKH  RecName: Full=Defensin Tk-AMP-D1.1           45.1    3e-04   
sp|P84963.1|DEF1_TRIKH  RecName: Full=Defensin Tk-AMP-D1              45.1    3e-04   
gb|KEH35658.1|  low-molecular-weight cysteine-rich protein            45.1    3e-04   
gb|ACV84385.1|  defensin precursor                                    45.4    3e-04   
emb|CAN69975.1|  hypothetical protein VITISV_020776                   45.4    3e-04   
ref|XP_009345976.1|  PREDICTED: defensin-like protein 2               45.4    3e-04   
gb|KFK33428.1|  hypothetical protein AALP_AA5G011900                  45.4    3e-04   
ref|XP_008240819.1|  PREDICTED: defensin Ec-AMP-D1-like               45.4    3e-04   
ref|XP_007202809.1|  hypothetical protein PRUPE_ppa014119mg           45.4    3e-04   
gb|AAU04859.1|  defensin precursor                                    45.4    3e-04   
ref|XP_009338353.1|  PREDICTED: defensin-like protein 2               45.4    4e-04   
gb|EMS65298.1|  Defensin-like protein 1                               45.1    4e-04   
ref|XP_009631841.1|  PREDICTED: defensin-like protein 1               44.7    4e-04   
emb|CBI24167.3|  unnamed protein product                              44.7    4e-04   
ref|XP_010653029.1|  PREDICTED: defensin-like protein 1 isoform X2    45.1    4e-04   
ref|XP_002272913.2|  PREDICTED: defensin-like protein 1 isoform X1    45.1    4e-04   
gb|ADQ43197.1|  unknown                                               45.1    4e-04   
gb|AIA67012.1|  defensin                                              45.1    4e-04   
ref|XP_008780828.1|  PREDICTED: defensin-like protein 1               44.7    4e-04   
ref|XP_007226630.1|  hypothetical protein PRUPE_ppa022845mg           45.1    5e-04   
ref|XP_009779973.1|  PREDICTED: defensin-like protein                 44.7    5e-04   
ref|XP_007202934.1|  hypothetical protein PRUPE_ppa016748mg           44.7    5e-04   
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  44.3    5e-04   
ref|XP_002263380.3|  PREDICTED: defensin-like protein 1               44.7    5e-04   
ref|XP_009355481.1|  PREDICTED: defensin Tk-AMP-D1.1-like             44.7    6e-04   
gb|KGN62247.1|  hypothetical protein Csa_2G340400                     44.7    7e-04   
ref|XP_004301463.1|  PREDICTED: defensin-like protein-like            44.3    7e-04   
gb|AIA67013.1|  defensin                                              44.3    8e-04   
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               44.3    8e-04   
ref|XP_004503015.1|  PREDICTED: defensin-like protein 6-like isof...  43.9    8e-04   



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T+FL+ M+V A EMG MR+AEAR CES SH+FKG C  D NC SVC+TE
Sbjct  1    MAHSMRFFTTVFLLAMIVMATEMGPMRIAEARNCESLSHRFKGPCTRDSNCASVCETE  58



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+   K+  T+FLM+MLVFA EMG M VAEAR CES+SH+FKGLCFS  NC SVC TE
Sbjct  1    MAGYPKVVATVFLMLMLVFATEMGPM-VAEARTCESQSHRFKGLCFSKSNCASVCHTE  57



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+   KLF T+FLM+MLVFA EMGTM VAEAR CES+SH+FKG C    NC +VCQTE
Sbjct  1    MAGFKKLFATVFLMLMLVFATEMGTM-VAEARTCESQSHRFKGPCVRKSNCAAVCQTE  57



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 77.0 bits (188),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T FL+ MLV A EMG MR+AEAR CES SH+FKG C  D NC SVC+TE
Sbjct  1    MALSMRFFATFFLLAMLVMATEMGPMRIAEARNCESLSHRFKGPCTRDSNCASVCETE  58



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 76.6 bits (187),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T+FL+ MLV A EMG  R+ EAR CES SH+FKG C SD NC SVC+TE
Sbjct  1    MAQSIRFFATLFLLAMLVMATEMGPTRIVEARHCESLSHRFKGPCVSDKNCASVCETE  58



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 76.6 bits (187),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L  T+FL++M+VFA EMG + VAEAR CES+S +FKG+C S+ NC SVC TE
Sbjct  2    MRRSMRLLSTVFLLLMVVFATEMGPIMVAEARNCESQSQRFKGVCVSNRNCASVCNTE  59



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 76.6 bits (187),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F  + L+ MLV A EMG MR+ EAR CES+SH+FKG+C S+ NC SVCQTE
Sbjct  1    MAHSMRFFAIVLLLAMLVMATEMGPMRIVEARTCESQSHRFKGVCASETNCASVCQTE  58



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 76.6 bits (187),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+   KLF T+FLM+ML+FA EMGTM VAEAR CES+SH+FKG C    NC +VCQTE
Sbjct  1    MAGFKKLFATVFLMLMLIFATEMGTM-VAEARTCESQSHRFKGPCVRKSNCAAVCQTE  57



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T FL+ MLV A EMG MR+AEAR CES SH+FKG C  D NC SVC+TE
Sbjct  1    MALSMRFFATFFLLAMLVMATEMGPMRIAEARHCESLSHRFKGPCTRDSNCASVCETE  58



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T FL+ MLV A EMG MR+ EAR CES SH+FKG C SD NC SVC+TE
Sbjct  1    MALSMRFFSTFFLLAMLVMATEMGPMRIVEARHCESLSHRFKGPCASDRNCASVCETE  58



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T FL+ MLV A EMG MR+ EAR CES SH+FKG C SD NC SVC+TE
Sbjct  1    MALSMRFFSTFFLLAMLVMATEMGPMRIVEARHCESLSHRFKGPCASDRNCASVCETE  58



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+ L  TIF++++L+ A EMG   VAEAR CES+SH+FKG C SD NCGSVC+TE
Sbjct  1    MARSVPLVSTIFVLLLLLIATEMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTE  58



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F  +FL+ M+V A EMG MR+ EAR CES SH+FKG C SD NC SVC+TE
Sbjct  1    MAYSMRFFTIVFLLAMIVMATEMGPMRIVEARHCESLSHRFKGPCASDKNCASVCETE  58



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T FL+ MLV + EMG MR+ EAR CES SH+FKG C SD NC SVC+TE
Sbjct  1    MALSMRFFATFFLLAMLVMSTEMGPMRIVEARHCESLSHRFKGPCASDKNCASVCETE  58



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 74.7 bits (182),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+   K+  TIFLMMMLVFA  M    VAEAR CES+SH+FKGLCFS  NCGSVC TE
Sbjct  1    MAGFSKVIATIFLMMMLVFATGM----VAEARTCESQSHRFKGLCFSKSNCGSVCHTE  54



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 74.7 bits (182),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+   KLF T+FL++MLVFA EMGTM VA+AR CES+SH+FKG C    NC +VCQTE
Sbjct  1    MAGFKKLFATVFLVLMLVFATEMGTM-VADARTCESQSHRFKGPCVRKSNCAAVCQTE  57



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 75.5 bits (184),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+ L  TIF++++L+ A EMG   VAEAR CES+SH+FKG C SD NCGSVC+TE
Sbjct  1    MARSVPLVSTIFVLLLLLIATEMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTE  58



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  90   LKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            ++L  T+FL++M+VFA EMG + VAEAR CES+S +FKG+C S+ NC SVC TE
Sbjct  2    MRLLSTVFLLLMVVFATEMGPVMVAEARNCESQSERFKGVCVSNRNCASVCNTE  55



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T+ L+ MLV A EMG M +AEAR+CESKS +F+G C  + NC +VC+TE
Sbjct  1    MAKSMRFFATVLLLAMLVMATEMGPMTIAEARRCESKSQRFRGPCVREKNCAAVCETE  58



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 72.8 bits (177),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            K+   +FLM+MLVFA EMG M VAEAR CES+SH+FKGLC S  NC SVC TE
Sbjct  6    KVLAIVFLMLMLVFANEMGPM-VAEARTCESQSHRFKGLCISKSNCASVCHTE  57



>ref|XP_006647552.1| PREDICTED: defensin-like protein P322-like [Oryza brachyantha]
Length=80

 Score = 72.8 bits (177),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+PS ++  ++FL++ ++ A EMGT +VAEAR C S+SH+FKG+C S +NC +VC+TE
Sbjct  1    MAPSRRMVASVFLLLAILVATEMGTTQVAEARHCLSQSHRFKGMCVSSNNCANVCKTE  58



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFA-PEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L  T+FL++M+VFA  EMG + VAEAR CES+S +FKG+C S+ NC SVC TE
Sbjct  2    MRRSMRLLSTVFLLLMVVFATEEMGPIMVAEARNCESQSQRFKGVCVSNRNCASVCNTE  60



>emb|CEJ09690.1| Defensin protein [Zea mays]
Length=80

 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+PS ++   + ++M+L  A E+GT +VAEAR C S+SH+FKGLC S +NC +VCQTE
Sbjct  1    MAPSRRMAAPVLVLMLLPVATELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  58



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 72.0 bits (175),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  90   LKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            ++ F T FL+ MLV A +MG MR+AEAR CES SH+FKG C  D NC SVC+TE
Sbjct  1    MRFFATFFLLAMLVVATKMGPMRIAEARHCESLSHRFKGPCTRDSNCASVCETE  54



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 71.6 bits (174),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +LF T FL+ ML+ A EMG M  AEAR CES+SH+F G C  D NC S+CQTE
Sbjct  3    RLFATFFLVAMLLLATEMGQMSSAEARTCESQSHRFHGTCVRDSNCASICQTE  55



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 71.6 bits (174),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +LF T FL+ ML+ + EMGTM  AEAR CES+S++FKG C  D NC +VCQTE
Sbjct  6    RLFATFFLVAMLLLSSEMGTMSSAEARTCESQSNRFKGTCVRDSNCATVCQTE  58



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 71.6 bits (174),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T FL+ ML  + EMG M  AEAR CES+SH+F G C  + NC SVCQTE
Sbjct  1    MGRSIRLFATFFLIAMLFLSTEMGPMTSAEARTCESQSHRFHGTCVRESNCASVCQTE  58



>ref|NP_001047493.1| Os02g0629800 [Oryza sativa Japonica Group]
 dbj|BAD23741.1| putative defensin [Oryza sativa Japonica Group]
 dbj|BAF09407.1| Os02g0629800 [Oryza sativa Japonica Group]
 gb|EEE57415.1| hypothetical protein OsJ_07607 [Oryza sativa Japonica Group]
Length=80

 Score = 71.6 bits (174),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+PS ++  + FL++ ++ A EMGT +VAEAR C S+SH+FKG+C S +NC +VC+TE
Sbjct  1    MAPSRRMVASAFLLLAILVATEMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTE  58



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 71.2 bits (173),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T+ L+ +LV A EMG M +AEAR CES+SH+FKG C  D NC +VC TE
Sbjct  1    MANSMRFFATVLLIALLVMATEMGPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTE  58



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 71.2 bits (173),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ SL L  TIF+  +L+ A EMG + VAEAR CE+ S+ FKGLC SD NC SVCQTE
Sbjct  1    MARSLPLVSTIFVFFLLLVATEMGPIMVAEARTCETPSNNFKGLCVSDTNCASVCQTE  58



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 71.2 bits (173),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+ L  TIF+ ++L+ A EMG   VAEAR CES+SH+FKG C SD NC SVC+TE
Sbjct  1    MARSVPLVSTIFVFLLLLVATEMGPTMVAEARTCESQSHRFKGPCVSDTNCASVCRTE  58



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEM-GTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            MS S+ L  TIF++++L+ A EM G   VAEAR CES+SH+FKG C SD NCGSVC+TE
Sbjct  1    MSRSVPLVSTIFVLLLLLVATEMMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTE  59



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++LF T FL++ML  + EM  +RVAEAR CES SH+FKG C    NC +VCQTE
Sbjct  1    MTYSMRLFATAFLLLMLFMSTEMDPVRVAEARTCESLSHRFKGTCVRGSNCAAVCQTE  58



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T+ L+ +LV A EMG M +AEAR CES+SH+FKG C  D NC +VC TE
Sbjct  1    MANSMRFFATVLLIALLVTATEMGPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTE  58



>gb|EAY86781.1| hypothetical protein OsI_08161 [Oryza sativa Indica Group]
Length=487

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+PS ++  + FL++ ++ A EMGT +VAEAR C S+SH+FKG+C S +NC +VC+TE
Sbjct  1    MAPSRRMVASAFLLLAILVATEMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTE  58



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+    TIF+ ++L+ A EMG   VAEAR CES+SH+FKG C SD NC SVC+TE
Sbjct  1    MARSVSFVSTIFVFLLLLLATEMGPRMVAEARTCESQSHRFKGPCVSDTNCASVCRTE  58



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ SL L  TIF+ ++L+ A EMG   VAEAR CES+SH+FKG C SD NC SVC  E
Sbjct  1    MARSLPLVSTIFVFLLLLVATEMGPTMVAEARDCESQSHRFKGPCVSDTNCASVCHGE  58



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 69.3 bits (168),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T+ L+ +L  A EMG M +AEAR CES+S +F+GLC  + NC +VC+TE
Sbjct  1    MAKSMRFFATVLLLAILFMATEMGPMTIAEARHCESQSQRFRGLCVREKNCAAVCETE  58



>ref|XP_011070572.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 69.3 bits (168),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 4/58 (7%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+  L+LF  +FLM+MLVF+  M    VAEAR CESKSH+F+G+C    NC +VCQTE
Sbjct  1    MASFLRLFAAVFLMLMLVFSSGM----VAEARICESKSHRFRGICVRKANCAAVCQTE  54



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 69.3 bits (168),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRV-AEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T FL+ ML+ + EMG M   AEAR CES+SH FKG C  D NC SVCQTE
Sbjct  1    MGYSMRLFATFFLVAMLLLSTEMGPMSGGAEARTCESQSHSFKGPCVGDTNCASVCQTE  59



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++LF T+ L+ MLV A   G MR+ EAR CES+SH+FKG C S+ NC SVC+TE
Sbjct  1    MANSMRLFATMLLLAMLVMA--TGPMRIVEARTCESQSHRFKGPCVSEKNCASVCETE  56



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +LF T FL+ ML+ A EMG M  AEAR CES+SH+F G C    NC SVCQTE
Sbjct  3    RLFATFFLVAMLLLATEMGPMSSAEARTCESQSHRFHGTCVRGSNCASVCQTE  55



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+  L++F T F+M+MLVF+  M    VAEARKCES+SH+FKG+C    NC +VCQTE
Sbjct  1    MACFLRMFATAFVMLMLVFSTGM----VAEARKCESQSHRFKGICLRKANCAAVCQTE  54



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T+  + MLV   +MG MR+ EAR CES S +FKG C +D NC SVC+TE
Sbjct  1    MAHSMRFFATVLFLAMLVMDTKMGPMRIIEARICESPSQRFKGPCLTDRNCASVCETE  58



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEM-GTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            MS S+ L  TI ++++L+ A EM G   VAEAR CES+SH+FKG C SD NCGSVC+TE
Sbjct  1    MSRSVPLVSTICVLLLLLVATEMMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTE  59



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +3

Query  105  TIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            TIFL ++++ A EMG++ V EARKC S+SH FKGLC SD NC +VC TE
Sbjct  10   TIFLFLLVLVATEMGSIMVVEARKCLSQSHSFKGLCLSDQNCATVCLTE  58



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+ L  TIF+ ++L+ A   G   VAEAR CES+SHKFKG C SDHNC SVCQTE
Sbjct  1    MARSVPLVSTIFVFLLLLVA--TGPSMVAEARTCESQSHKFKGPCASDHNCASVCQTE  56



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 4/58 (7%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+   KL  TI LM+MLVF+  M    +AEAR CES+S +FKGLCFS  NCGSVC TE
Sbjct  1    MAGFSKLVATILLMLMLVFSTGM----IAEARTCESQSRRFKGLCFSKSNCGSVCHTE  54



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S+K+F  + L++M + A EMG   V EAR CES+SHKFKG C SD NC +VC +E
Sbjct  1    MKSSMKMFAALLLVVMCLLANEMGGPLVVEARTCESQSHKFKGTCLSDTNCANVCHSE  58



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++LF T+ L+ MLV A   G M++ EAR CES+SH+FKG C S+ NC SVC+TE
Sbjct  1    MANSMRLFATMLLLAMLVMA--TGPMKIVEARTCESQSHRFKGPCVSEKNCASVCETE  56



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLM-MMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++LF T FL+ M+L+ + EMG +  AEAR CES+S+ FKG C  D NC +VCQTE
Sbjct  1    MAHSIRLFATFFLVAMLLLLSTEMGPISSAEARTCESQSNSFKGTCVRDSNCATVCQTE  59



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+    TIF+M +L+ A EMG ++VAEAR C+S+S+ FKG C  DH+C  VCQTE
Sbjct  1    MARSIPFISTIFVMFLLLVATEMGPIKVAEARICDSQSNTFKGPCVIDHSCAIVCQTE  58



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++LF T+ L+ MLV A   G  R+ EAR CES+SH+FKG C S+ NC SVC+TE
Sbjct  1    MANSMRLFATMLLLAMLVMA--TGPTRIVEARTCESQSHRFKGPCVSEKNCASVCETE  56



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  SL+LF T FL+ ML+ A   G     EAR CESKSH FKG C SD NCGSVC TE
Sbjct  1    MGNSLRLFATFFLVTMLLLAT--GPTTRVEARTCESKSHHFKGKCLSDTNCGSVCHTE  56



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 66.6 bits (161),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 4/58 (7%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+ +  TIF+ ++L+ A EM    VAEAR CESKS KFKG C SD NC SVCQTE
Sbjct  1    MARSIPMVSTIFVFLLLLVATEM----VAEARTCESKSQKFKGACVSDRNCASVCQTE  54



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 66.2 bits (160),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+ L  TI ++ +L+ A EM  + VAEAR CES S+ FKGLC  DHNC  VCQTE
Sbjct  1    MARSVPLVSTIIVIFLLLVATEMRPIMVAEARTCESLSYSFKGLCVRDHNCAVVCQTE  58



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 66.2 bits (160),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  SL+LF T FL+ ML+ A   G     EAR CES+SH FKG C SD NCGSVC+TE
Sbjct  1    MGNSLRLFATFFLVAMLLLAT--GPTTSVEARTCESQSHHFKGNCLSDTNCGSVCRTE  56



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = +3

Query  90   LKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            ++LF T+ L+ MLV A   G MR+ EAR CES+SH+FKG C S+ NC SVC+TE
Sbjct  1    MRLFATMLLLAMLVMA--TGPMRIVEARTCESQSHRFKGPCVSEKNCASVCETE  52



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S +LF    L+++L  A EMG M VAEAR CES+SH+FKG C    NC +VCQTE
Sbjct  1    MKGSQRLFSAFLLVILLFMATEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTE  57



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +3

Query  90   LKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +K F     +++L+F   M  M VAEAR CES SH FKGLCFSD NCG++C+TE
Sbjct  1    MKFFSAPIFLLLLIFGSGMAPM-VAEARVCESPSHNFKGLCFSDTNCGNICKTE  53



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 63.9 bits (154),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++LF  +F+++ L+ A  MG  +VAEAR CES+SH+FKG+C    NC +VCQTE
Sbjct  1    MARSMRLFSILFVVLFLLTATGMGP-KVAEARTCESQSHRFKGICVRKSNCAAVCQTE  57



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 63.9 bits (154),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+ L  TIF+  +L+ A EMG   VA AR CE+ S+ FKG CFSD NC SVCQTE
Sbjct  1    MARSVSLVSTIFVFFLLIVATEMGPSMVA-ARTCETPSNSFKGACFSDTNCASVCQTE  57



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 63.5 bits (153),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  SL+L   + LM M+  A  MG + V EAR CESKSHKF+GLC S HNC +VC  E
Sbjct  1    MKLSLRLISAVLLMFMIFVASGMGPVTV-EARTCESKSHKFRGLCVSRHNCANVCHNE  57



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T FL ++LV    MG M VAE R C+S+SH+FKG C S  NC +VCQTE
Sbjct  1    MERSMRLFSTAFLFLLLVATGMMGPM-VAEGRTCDSQSHRFKGSCVSKSNCATVCQTE  57



>gb|EMT22728.1| Defensin Tm-AMP-D1.2 [Aegilops tauschii]
Length=82

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGTM+ AEAR C+S+SHKFKG CFSD NC SVC+TE
Sbjct  24   EMGTMKTAEARTCQSQSHKFKGACFSDTNCASVCRTE  60



>gb|AIA66999.1| defensin [Triticum aestivum]
Length=82

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  135  APEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            A EMGT++VAEAR CES+SH FKG CFSD NC SVC TE
Sbjct  22   ATEMGTVKVAEARTCESQSHNFKGACFSDTNCASVCHTE  60



>gb|ABM89231.1| defensin [Setaria italica]
 gb|AEG19551.1| defensin [Zea mays subsp. mays]
 emb|CDK12932.1| defensin [Zea mays subsp. mays]
 gb|AHG97966.1| defensin 1 [Zea mays]
 emb|CEJ09692.1| Defensin protein [Zea mays]
Length=80

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+PS ++   + ++M+L+ A E+GT +VAEAR C S+SH+FKGLC S +NC +VCQTE
Sbjct  1    MAPSRRMAAPVLVLMLLLVATELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  58



>gb|EMT22729.1| Defensin Tk-AMP-D2 [Aegilops tauschii]
Length=76

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  135  APEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            A EMGT + AEAR CES+SHKFKG CFSD NC +VC+TE
Sbjct  16   ATEMGTTKTAEARTCESQSHKFKGPCFSDSNCATVCRTE  54



>gb|AIT42150.1| defensin-like protein [Solanum tuberosum]
Length=63

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  123  MLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            MLV + EMG MR+ EAR CES SH+FKG C SD NC SVC+TE
Sbjct  1    MLVMSTEMGPMRIVEARHCESLSHRFKGPCASDKNCASVCETE  43



>gb|AIA67000.1| defensin [Triticum aestivum]
Length=84

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  135  APEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            A EMGT + AEAR CES+SHKFKG CFSD NC +VC+TE
Sbjct  24   ATEMGTTKTAEARTCESQSHKFKGPCFSDSNCATVCRTE  62



>ref|XP_002513755.1| Low-molecular-weight cysteine-rich protein LCR69 precursor, putative 
[Ricinus communis]
 gb|EEF48338.1| Low-molecular-weight cysteine-rich protein LCR69 precursor, putative 
[Ricinus communis]
Length=77

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M   ++LF T+FL+++L+ A EMG  +VAEAR CES+SHKFKG C S  NC ++C+TE
Sbjct  1    MKHPMRLFSTVFLLLLLLVATEMGA-KVAEARTCESQSHKFKGTCLSTTNCANICKTE  57



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + LM ML  A  MG + V EAR CESKSH+F+G C S HNCG+VC  E
Sbjct  1    MKLSMRLISAVLLMFMLFVATGMGPVTV-EARTCESKSHRFRGPCVSRHNCGNVCHNE  57



>emb|CDP16306.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M   ++L  T+ L++ L  A  MG + VAEAR CES+SH+FKG C    NC +VCQTE
Sbjct  1    MRSFMRLSATVLLLLALFMASVMGPIGVAEARICESQSHRFKGPCIRKDNCAAVCQTE  58



>ref|XP_007156390.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
 gb|ESW28384.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
Length=78

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+    TIF+ ++L+ A EMG   VAEAR CES+S   +G C SD NC S C+TE
Sbjct  1    MARSVSFVSTIFVFLLLLLATEMGPRMVAEARGCESRSRHLRGKCESDENCASACRTE  58



>gb|EMT22726.1| Defensin Tm-AMP-D1.2 [Aegilops tauschii]
Length=82

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGT +VAEAR CES+SH FKG CFSD NC SVC+TE
Sbjct  24   EMGTTKVAEARTCESQSHNFKGACFSDTNCASVCRTE  60



>emb|CEJ09689.1| Defensin protein [Zea mays]
 emb|CEJ09691.1| Defensin protein [Zea mays]
Length=80

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+PS ++   + ++++L+ A E+GT +VAEAR C S+SH+FKGLC S +NC + CQTE
Sbjct  1    MAPSRRMAAPVLVLLLLLVATELGTTKVAEARHCLSQSHRFKGLCMSSNNCANACQTE  58



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 60.8 bits (146),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + LM M+  A  MG + V EAR CESKSH+F+G C S HNCG+VC  E
Sbjct  1    MKLSMRLISAVLLMFMIFVATGMGPVTV-EARTCESKSHRFRGPCVSRHNCGNVCHNE  57



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 60.8 bits (146),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M   ++LF ++ L+++LV A EMG  +VAEAR CES+SH+FKG C SD NC SVCQTE
Sbjct  1    MERGMRLFSSLVLVLLLVTATEMGP-KVAEARTCESQSHRFKGACLSDTNCASVCQTE  57



>gb|KHG09995.1| Defensin-like protein 1 [Gossypium arboreum]
Length=75

 Score = 60.8 bits (146),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            KLF  +F++++LV     G   V E R CESKSH+FKG+C SDHNCG VC+ E
Sbjct  5    KLFGMMFMLLLLVALASHGG--VVEGRICESKSHRFKGVCLSDHNCGLVCRNE  55



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 60.8 bits (146),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T F+  +L+ A  M    VAEAR CES+S++FKG C S  NC SVCQTE
Sbjct  1    MERSMRLFSTAFVFFLLLAAAGMMGPMVAEARTCESQSNRFKGTCVSTSNCASVCQTE  58



>gb|EMS54457.1| Defensin Tk-AMP-D4 [Triticum urartu]
 gb|AIA67008.1| defensin [Triticum aestivum]
Length=74

 Score = 60.8 bits (146),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S+K+F  +FL+  LV     G ++VA AR C S+SHKF GLC SD NC SVC TE
Sbjct  1    MDRSMKVFAVVFLL--LVATGFQGAVQVALARDCTSQSHKFVGLCLSDRNCASVCLTE  56



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 60.8 bits (146),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  SL+L   + LM M+  A  MG + V EAR CESKSHKF+G C S HNC +VC  E
Sbjct  1    MKLSLRLISAVLLMFMIFVASGMGPVTV-EARTCESKSHKFRGPCVSRHNCANVCHNE  57



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 60.8 bits (146),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S ++   I L+ +L+   +MG M   EARKCES SHKFKGLCF   NC +VC+TE
Sbjct  1    MEDSRRMLPAIVLLFLLLITSDMG-MTSVEARKCESASHKFKGLCFRASNCANVCKTE  57



>ref|XP_004297787.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMG-TMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M   +++F  +F+ ++L+ A  MG    VAEAR CES SHKFKG C S+ NC SVC+TE
Sbjct  1    MESFMRMFSAVFVALLLLVATGMGPNTMVAEARTCESLSHKFKGTCLSETNCASVCKTE  59



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +3

Query  114  LMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            L+++++FA +MG M+ +EAR CES SH FKGLCF+D NC +VC TE
Sbjct  11   LVLLVIFASDMGVMK-SEARLCESPSHSFKGLCFNDRNCANVCLTE  55



>gb|ACG41256.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +3

Query  108  IFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +FL+M+L  A EMGT RVAEAR C S+SH+F G C S  NC +VC+TE
Sbjct  14   VFLLMLLA-ASEMGTTRVAEARHCTSQSHRFVGACMSKSNCENVCRTE  60



>gb|EMS52097.1| Defensin Tk-AMP-D1 [Triticum urartu]
Length=83

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGT + AEAR C+S+SHKFKG CFSD NC SVC+TE
Sbjct  25   EMGTTKTAEARTCQSQSHKFKGACFSDTNCDSVCRTE  61



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 5/59 (8%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEA-RKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+  L+LF T   M+MLVF+  M    VAEA R CE+KSH+FKG+C    NC +VCQTE
Sbjct  1    MASFLRLFATALFMVMLVFSTGM----VAEATRTCEAKSHRFKGICARKANCAAVCQTE  55



>gb|AFW58880.1| low-molecular-weight cysteine-rich protein LCR70 [Zea mays]
Length=82

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +3

Query  108  IFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +FL+M+L  A EMGT RVAEAR C S+SH+F G C S  NC +VC+TE
Sbjct  14   VFLLMLLA-ASEMGTTRVAEARHCTSQSHRFVGACMSKSNCENVCRTE  60



>ref|XP_004509602.1| PREDICTED: defensin-1-like [Cicer arietinum]
Length=80

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+  L    TIF+M +L+   EMG   VAEAR C SKS  +KGLC  D NC +VC+TE
Sbjct  1    MARLLSSVSTIFVMFLLLVVTEMGANMVAEARSCISKSFTYKGLCVHDRNCANVCRTE  58



>ref|XP_004297786.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMG-TMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M   +++F  +F+ ++L+ A  MG    VAEAR CE+ SHKFKG C  + NC SVCQTE
Sbjct  1    MESFMRMFSAVFVALLLLVATGMGPNAMVAEARTCETLSHKFKGTCLRESNCASVCQTE  59



>ref|XP_007033367.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04293.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=76

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            KLF  +FL++++V AP+   +  +EAR CESKSH FKG C SDHNCG VC+ E
Sbjct  6    KLF-GMFLLLLIVLAPQEMVVP-SEARTCESKSHAFKGPCLSDHNCGLVCRNE  56



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T F+ ++L+ A  M    +AE R CES+S KFKG C S  NC SVCQTE
Sbjct  1    MERSMRLFSTAFVFVLLLVATGMMGPLLAEGRTCESQSRKFKGTCLSKTNCASVCQTE  58



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S ++   I L++++V A EM TM V EAR CES+SHKFKG C    NC +VC+TE
Sbjct  1    MERSRRMLPAILLLVLIVVASEMATMMV-EARTCESQSHKFKGPCLRASNCANVCKTE  57



>ref|XP_004953175.1| PREDICTED: defensin-like protein 2-like [Setaria italica]
Length=80

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S ++   + + ++L+ A EMG   VAEAR C S+SH FKGLC S  NC +VC+ E
Sbjct  1    MALSRRMAAPVLVFLLLLIASEMGPATVAEARHCLSQSHHFKGLCLSSSNCANVCRVE  58



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T F+ ++L+ A  M    +AE R CES+S KFKG C S  NC SVCQTE
Sbjct  1    MERSMRLFSTAFVFVLLLVATGMMGPMLAEGRTCESQSRKFKGACLSRSNCASVCQTE  58



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T F+ ++L+ A  M    +AE R CES+S KFKG C S  NC SVCQTE
Sbjct  1    MERSVRLFSTAFVFVLLLVATGMMGPMLAEGRTCESQSRKFKGACLSRSNCASVCQTE  58



>emb|CAA65045.1| defensin [Capsicum annuum]
Length=75

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 4/53 (8%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            K+  TIFLMMMLVFA +M    +AEA+ CE+ S  FKGLC S  +CG+VC+ E
Sbjct  6    KVIATIFLMMMLVFATDM----MAEAKICEALSGNFKGLCLSSRDCGNVCRRE  54



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T F+ ++L+ A   GTM VAE R CES+S++FKG C S  NC +VCQTE
Sbjct  1    MERSMRLFPTAFVFLLLLVA--TGTM-VAEGRTCESQSNRFKGTCVSKSNCAAVCQTE  55



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T+ L+ +LV A EMG M +AEAR CES+SH+FKG C  D NC +VC TE
Sbjct  1    MANSMRFFATVLLLTLLVMATEMGPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTE  58



>gb|KFK33427.1| hypothetical protein AALP_AA5G011600 [Arabis alpina]
Length=77

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + +M M+  A  MG + V EAR CES+SH+FKG C SD NC +VC  E
Sbjct  1    MKLSMRLISAVLIMFMIFVATGMGPVTV-EARTCESQSHRFKGTCVSDTNCANVCHNE  57



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEM--GTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T F+  +L+ A  M  G M VAEAR CES+S++FKG C S  NC SVCQTE
Sbjct  1    MERSMRLFSTAFVFFLLLAAAGMMMGPM-VAEARTCESQSNRFKGTCVSTSNCASVCQTE  59



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  102  VTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            + I  M+ LV A ++  ++ AE R+CES+SHKFKG C SD NCGSVC+ E
Sbjct  6    LGILFMLFLVLAADV-AVKTAEGRRCESQSHKFKGPCVSDSNCGSVCRGE  54



>emb|CEJ09688.1| Defensin protein [Zea mays]
Length=80

 Score = 58.5 bits (140),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+PS ++   + ++++L+ A E+GT +VAEAR   S+SH+FKGLC S +NC +VCQTE
Sbjct  1    MAPSRRMAAPVLVLLLLLVATELGTTKVAEARHYLSQSHRFKGLCMSSNNCANVCQTE  58



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 58.5 bits (140),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + +M M+  A  MG + V EAR CESKSH+FKG C S HNC +VC  E
Sbjct  1    MKLSMRLISAVLIMFMVFVATGMGPVTV-EARTCESKSHRFKGPCVSTHNCANVCHNE  57



>gb|ACG30752.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
Length=80

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S ++   + ++M+L+ A E+GT +VAEAR C S+SH+FKGLC S +NC +VCQTE
Sbjct  1    MALSRRMAAPVLVLMLLLVATELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  58



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 5/58 (9%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+   KL  T FL++MLVFA E+      EAR CES+SH++KG C   +NC +VC+TE
Sbjct  1    MAGFKKLLATFFLVLMLVFAAEL-----TEARTCESQSHRYKGPCVRKNNCANVCKTE  53



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + L+ M+  A  MG + V EAR CESKSH+FKG C S  NCG+VC  E
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGPVTV-EARTCESKSHRFKGTCVSSTNCGNVCHNE  57



>gb|ACG25019.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
Length=80

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S ++   + ++++L+ A E+GT +VAEAR C S+SH+FKGLC S +NC +VCQTE
Sbjct  1    MALSRRMAAPVLVLLLLLVATELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  58



>ref|NP_001147001.1| LOC100280611 precursor [Zea mays]
 gb|ACG29535.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG30746.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG30775.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG34029.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG43919.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|AFW72423.1| low-molecular-weight cysteine-rich protein LCR69 [Zea mays]
Length=80

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S ++   + ++M+L+ A E+GT +VAEAR C S+SH+FKGLC S +NC +VCQTE
Sbjct  1    MALSRRMAAPVLVLMLLLVATELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  58



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + L+ M+  A  MG + V EAR CESKSH+FKG C S  NCG+VC  E
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGPVTV-EARTCESKSHRFKGTCVSSTNCGNVCHNE  57



>ref|NP_001149230.1| LOC100282852 precursor [Zea mays]
 gb|ACG34648.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 58.2 bits (139),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +3

Query  108  IFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +FL+M+L  A EMGT R AEAR C S+SH+F G C S  NC +VC+TE
Sbjct  14   VFLLMLLA-ASEMGTTRXAEARHCTSQSHRFVGACMSKSNCENVCRTE  60



>gb|AGT51227.1| defensin [Brassica napus]
Length=77

 Score = 58.2 bits (139),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  SL+L   + LM+M+  A  MG + V EAR  ESKSHKF+G C S HNC +VC  E
Sbjct  1    MKLSLRLISAVLLMIMIFVASGMGPVTV-EARTSESKSHKFRGPCVSRHNCANVCHNE  57



>sp|Q43413.1|DEF1_CAPAN RecName: Full=Defensin J1-1; Flags: Precursor [Capsicum annuum]
 gb|AAM09502.1|AF488780_1 gamma thionin [Capsicum annuum]
 emb|CAA64653.1| gamma-thionin [Capsicum annuum]
 gb|ACB30365.1| defensin [Capsicum annuum]
Length=75

 Score = 58.2 bits (139),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 4/53 (8%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            K+  TIFLMM+LVFA +M    +AEA+ CE+ S  FKGLC S  +CG+VC+ E
Sbjct  6    KVVATIFLMMLLVFATDM----MAEAKICEALSGNFKGLCLSSRDCGNVCRRE  54



>gb|ADQ43196.1| unknown [Eutrema parvulum]
Length=76

 Score = 57.8 bits (138),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L ++  L+M ++F   MG + V EAR CES+SH+FKG C SD NCG+VC  E
Sbjct  1    MKLSMRL-ISAALLMFMIFVAAMGPVTV-EARTCESQSHRFKGKCLSDGNCGNVCHNE  56



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M   ++LF TIF+++ML+ A  +     AE R CES+SHKFKG C S  NC +VC+TE
Sbjct  1    MGVLMRLFTTIFMVLMLLMATGL---EPAEGRTCESQSHKFKGTCASGTNCANVCKTE  55



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + L+ M+  A  MG + V EAR CES+SH+FKG C SD+NC +VC  E
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGPVSV-EARTCESQSHRFKGPCVSDNNCANVCHNE  57



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L  T+ L+ M+  A  MG + V EAR CESKSH+FKG C S+ NC +VC  E
Sbjct  1    MKLSMRLISTVILVFMIFVATGMGPVTV-EARTCESKSHRFKGACLSETNCKNVCHNE  57



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRV--AEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S+ L  TIF  + L+ + EM    V   EAR C+S+SH FKG+C+  HNC +VC+TE
Sbjct  1    MARSITLVCTIFFFLFLLVSTEMQPTHVEEPEARTCDSQSHSFKGVCWIKHNCANVCKTE  60



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S +LF   F++++L+ A EMG  + AEAR C+S+SH+FKG+C    NC +VCQTE
Sbjct  1    MERSTRLFSAAFVLLLLLLATEMGP-KAAEARTCQSQSHRFKGMCMRKSNCAAVCQTE  57



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++ F T+ L+ +LV A EMG M +AEAR CES+ H+FKG C  D NC +VC TE
Sbjct  1    MANSMRFFATVLLLTLLVMATEMGPMTIAEARTCESQRHRFKGPCSRDGNCATVCLTE  58



>ref|XP_009114204.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
Length=77

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  99   FVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
             +++ L M ++F          EAR CESKSHKF+GLC S HNC +VC T+
Sbjct  7    LISVVLFMFMIFVASGAGPVTVEARTCESKSHKFRGLCVSTHNCANVCHTQ  57



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +L    F++M++V + E G M V EAR CES SH+FKG C S  NC SVC TE
Sbjct  3    RLATVFFVLMLVVISTERGPM-VGEARTCESLSHRFKGACVSSTNCASVCHTE  54



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + L+ M+  A  MG + V EARKCESKSH+FKG C S+ NC +VC  E
Sbjct  1    MKLSMRLISALLLVFMIFVATGMGPVTV-EARKCESKSHRFKGKCLSETNCKNVCHNE  57



>dbj|BAJ89304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=83

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  135  APEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            A EMGTM+ AEAR C S+SHKFKG C S+ NC  VC+TE
Sbjct  23   ATEMGTMKAAEARTCLSQSHKFKGTCLSNSNCAGVCRTE  61



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + ++ M+  A  MG + V EAR CESKSH+FKG CFS+ NC +VC  E
Sbjct  1    MKLSIRLISAVLVLFMIFVATGMGPVTV-EARTCESKSHRFKGKCFSETNCKNVCHNE  57



>gb|EMT16291.1| Defensin SD2 [Aegilops tauschii]
 gb|AIA66995.1| defensin [Triticum aestivum]
Length=82

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  135  APEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            A EMGT +V EAR C S+SHKFKG C SD NC  VC+TE
Sbjct  22   ATEMGTTKVVEARTCLSQSHKFKGTCLSDSNCAGVCRTE  60



>gb|AIA66987.1| defensin [Triticum aestivum]
Length=82

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGT +VAEAR C S+SHKFKG C SD NC  VC+TE
Sbjct  24   EMGTTKVAEARTCLSQSHKFKGTCLSDSNCAGVCRTE  60



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + ++ M+  A  MG + V EAR CESKSH+FKG CFS+ NC +VC  E
Sbjct  1    MKLSIRLISAVLVLFMIFVATGMGPVTV-EARTCESKSHRFKGKCFSETNCRNVCHNE  57



>dbj|BAC10287.1| defensin [Triticum aestivum]
 gb|EMS52103.1| Defensin Tk-AMP-D2 [Triticum urartu]
 gb|AGX26528.1| defensin [Triticum aestivum]
 gb|AIA66998.1| defensin [Triticum aestivum]
Length=82

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGTM+ AEAR C S+SHKFKG C S+ NC +VC+TE
Sbjct  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + +M M+  A  MG + V EAR CESKSH+FKG C S+ NC +VC  E
Sbjct  1    MKLSMRLISAVLVMFMIFVATGMGPVTV-EARTCESKSHRFKGTCLSESNCKNVCHNE  57



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T F+ ++L+ A  M    +AE R CE+ S KFKG C    NC SVCQTE
Sbjct  1    MERSMRLFSTAFVFVLLLVATGMMGPMLAEGRTCEAHSRKFKGTCLGKSNCASVCQTE  58



>gb|EMT06279.1| Defensin-like protein 2 [Aegilops tauschii]
Length=82

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRV--AEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+P+ ++  +  L+++L+ A EMGT R   AEAR C S+SHKFKG C S  NC  VC+TE
Sbjct  1    MAPTRRMAASALLLLLLLVATEMGTTRTKTAEARDCLSQSHKFKGACLSSSNCAGVCRTE  60



>gb|ACV84383.1| defensin precursor [Triticum turgidum subsp. durum]
Length=85

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +3

Query  81   SPSLKLFVTIFLMMMLVFAPEMGTMRVAEARK----CESKSHKFKGLCFSDHNCGSVCQT  248
            S S ++  ++ L+++L+ A EMGTMRVAEAR     CES+SH+++G C+ D NC  VC T
Sbjct  3    STSRRMVASVLLVLLLLVATEMGTMRVAEARHGHRHCESQSHRYRGACWRDDNCEHVCNT  62

Query  249  E  251
            E
Sbjct  63   E  63



>gb|ACV84379.1| defensin precursor [Triticum aestivum]
 gb|EMT06280.1| Defensin-like protein 5 [Aegilops tauschii]
 gb|AIA66986.1| defensin [Triticum aestivum]
Length=81

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGT--MRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S ++  +  L+ +LV A EMGT  ++VAEAR C S+SH FKG C S  NC +VC+TE
Sbjct  1    MALSRRMTASALLLFLLV-ATEMGTTTVKVAEARNCLSQSHNFKGACLSSSNCAAVCRTE  59



>gb|ACB20518.1| defensin precursor [Saccharum officinarum]
Length=80

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S ++   + ++++L+ A E+GT  VAEAR C S+SH+FKGLC S  NC +VCQTE
Sbjct  1    MALSRRMAAPVLVLVLLLVATELGTTTVAEARYCLSQSHRFKGLCMSSSNCANVCQTE  58



>ref|XP_008389118.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=87

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 9/67 (13%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTM---------RVAEARKCESKSHKFKGLCFSDHNC  230
            M  S++L    F++++L+ A EMGTM         +V E R CE+ S KFKGLCFS +NC
Sbjct  1    MERSMRLVSASFVLVLLLVATEMGTMGVEARSKSSKVVEERTCEAASGKFKGLCFSSNNC  60

Query  231  GSVCQTE  251
               C+ E
Sbjct  61   KHTCKRE  67



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 55.8 bits (133),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S +L     ++M+L+ A EM  M V EAR CES+S +FKG C S  NC SVCQTE
Sbjct  1    MDFSKRLIPAALIVMLLLVATEMEPM-VVEARTCESQSQRFKGACVSKTNCASVCQTE  57



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 55.8 bits (133),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S++L   + L M+ V A  MG + V EAR CESKSH+FKG C S  NCG+VC  E
Sbjct  1    MNLSMRLISAVLLFMIFV-ATGMGPVTV-EARTCESKSHRFKGTCVSSTNCGNVCHNE  56



>gb|AFQ69079.1| defensin precursor, partial [Triticum aestivum]
Length=81

 Score = 55.8 bits (133),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGT++ AEAR C S+SHKFKG C SD NC  VC+TE
Sbjct  23   EMGTLKTAEARTCLSQSHKFKGTCISDSNCAGVCRTE  59



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 55.8 bits (133),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + L+ M+  A  MG + V EAR CES+SH+FKG C S++NC +VC  E
Sbjct  1    MKLSMRLISAVLLLFMIFVATGMGPVSV-EARTCESQSHRFKGPCVSENNCANVCHNE  57



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S ++   I L++ L+   EMGT +VAEAR CES+SHKF+G C  + NC +VCQTE
Sbjct  1    MEHSRRMLPAILLLLFLLMPSEMGT-KVAEARTCESQSHKFQGTCLRESNCANVCQTE  57



>ref|XP_007033927.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04853.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=141

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 9/76 (12%)
 Frame = +3

Query  24   KTQKQKYFLKNLERNRANMSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFK  203
            K +  + F++ +E  + ++         IF ++++V A +    + AE R CESKSHKFK
Sbjct  55   KAKVSRLFIEGIEMEKRSLG--------IFFLLLIVLASQW-VAQPAEGRVCESKSHKFK  105

Query  204  GLCFSDHNCGSVCQTE  251
            G C  DHNC  VC+ E
Sbjct  106  GPCLGDHNCALVCRNE  121



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T F+ ++L+ A  M    +AE R CE+ S KFKG C S  NC +VCQTE
Sbjct  1    MERSVRLFSTAFVFVLLLVATGMMGPMLAEGRTCEAHSRKFKGHCHSKSNCATVCQTE  58



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + ++ M+  A  MG + V EAR CES+SH+FKG CFS+ NC +VC  E
Sbjct  1    MKLSIRLISAVLVLFMIFVATGMGPVTV-EARTCESQSHRFKGKCFSETNCRNVCHNE  57



>dbj|BAJ86109.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=84

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMG  + AEAR CES+SHKFKG CFSD NC SVC+TE
Sbjct  28   EMG--KTAEARTCESQSHKFKGACFSDTNCASVCRTE  62



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +3

Query  108  IFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
             F +++++ A +M  M   E R CESKSH+FKG+C SDHNC SVC  E
Sbjct  8    FFFILLILLASQM--MVQTEGRHCESKSHRFKGMCMSDHNCASVCHVE  53



>gb|EMT22721.1| Defensin Tk-AMP-D2 [Aegilops tauschii]
Length=82

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGTM+ AEAR C S+SHKFKG C S+ NC  VC+TE
Sbjct  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAGVCRTE  60



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 55.5 bits (132),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++LF T+ L+++L+ A EMG +R AEAR CES+SH+FKG C S  NC +VCQTE
Sbjct  1    MERSVRLFSTVLLVLLLL-ASEMG-LRAAEARICESQSHRFKGPCVSKSNCAAVCQTE  56



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 55.5 bits (132),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++      L+ M+  A  MG + V EAR CESKSH+FKG C S HNC +VC  E
Sbjct  1    MKLSVRFISAALLLFMVFIATGMGPVTV-EARTCESKSHRFKGPCVSTHNCANVCHNE  57



>gb|AIA66993.1| defensin [Triticum aestivum]
Length=83

 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGTM+ AEAR C S+SHKFKG C S+ NC  VC+TE
Sbjct  25   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAGVCRTE  61



>ref|XP_002452484.1| hypothetical protein SORBIDRAFT_04g026670 [Sorghum bicolor]
 gb|EES05460.1| hypothetical protein SORBIDRAFT_04g026670 [Sorghum bicolor]
Length=82

 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  135  APEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            A E+GT  VAEAR C S+SH+FKGLC S  NC +VCQTE
Sbjct  22   ATELGTTPVAEARHCLSQSHRFKGLCMSSTNCANVCQTE  60



>ref|XP_006292097.1| hypothetical protein CARUB_v10018292mg, partial [Capsella rubella]
 gb|EOA24995.1| hypothetical protein CARUB_v10018292mg, partial [Capsella rubella]
Length=103

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  87   SLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            S++L   + L+ M+  A  MG + V EAR CESKSH+FKG C S +NC +VC  E
Sbjct  30   SMRLISAVLLVFMIFVATGMGPVTV-EARTCESKSHRFKGPCVSGNNCKNVCHNE  83



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   + +M M+  A  MG + V EAR CES+SH+FKG C S  NC +VC  E
Sbjct  1    MKLSMRLISAVLIMFMIFVATGMGPVTV-EARTCESQSHRFKGTCVSASNCANVCHNE  57



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S KLF  + L+M+L+ A E+G + VAEAR C+S+SH+F+G C    NC +VC+TE
Sbjct  1    MELSRKLFTAVVLVMLLLVATEIGAVAVAEARTCQSQSHRFRGPCVRRENCANVCRTE  58



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M   ++LF T+ L+++L+ A E G M VAEAR CES SH+FKG+C  + NC ++CQTE
Sbjct  1    MKCPMRLFSTLLLLLLLLLATETGPM-VAEARTCESLSHRFKGICVRNSNCAAICQTE  57



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M   ++LF T+ L+++L+ A E G M VAEAR CES SH+FKG+C  + NC ++CQTE
Sbjct  1    MKCPMRLFSTLLLLLLLLLATETGPM-VAEARTCESLSHRFKGICVRNSNCAAICQTE  57



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  159  VAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            VAEAR CES SH FKGLCFSD NCG++C+TE
Sbjct  26   VAEARVCESPSHNFKGLCFSDTNCGNICKTE  56



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPE-MGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            MS S+++F T+F++++L+ A + MG M VAEAR CES+SH+FKG C    NC SVCQTE
Sbjct  1    MSRSMRVFSTVFVVLLLLVATQYMGPM-VAEARTCESQSHRFKGPCVRKSNCASVCQTE  58



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S +LF   F++++L+ A E    + AEAR C+S+SH+FKG+C    NC +VCQTE
Sbjct  1    MERSTRLFSAAFVLLLLLLATEEMGPKAAEARTCQSQSHRFKGMCMRKSNCAAVCQTE  58



>gb|AIA67004.1| defensin [Triticum aestivum]
Length=84

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = +3

Query  81   SPSLKLFVTIFLMMMLVFAPEMGTMRVAEARK--CESKSHKFKGLCFSDHNCGSVCQTE  251
            S S  +  ++ L+++L+ A EMGT RVAEAR   CES+SH+++G C+ D NC  VC TE
Sbjct  3    STSRHMVASVLLVLLLLVATEMGTTRVAEARHRHCESQSHRYRGACWRDDNCKHVCNTE  61



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +3

Query  108  IFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
             F M++++ A +M  M   E R CESKSH+FKG+C SD NC SVC  E
Sbjct  80   FFFMLLILLASQM--MVQTEGRHCESKSHRFKGMCLSDRNCASVCHLE  125



>dbj|BAB64929.1| defensin-like protein [Pyrus pyrifolia]
Length=87

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 9/67 (13%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRV---------AEARKCESKSHKFKGLCFSDHNC  230
            M PS++L    F++++L+   EMG M V          E R CE+ S KFKG+CFS +NC
Sbjct  1    MEPSMRLISAAFVLILLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNC  60

Query  231  GSVCQTE  251
             + C  E
Sbjct  61   ANTCARE  67



>gb|EMS52277.1| Defensin Tk-AMP-D1.1 [Triticum urartu]
Length=77

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S K+FV + L+++     + G+++VA AR CES SHKF G CFSD NC +VCQTE
Sbjct  1    MGLSAKVFVVLLLLLVAT-EEQGGSVQVALARDCESDSHKFHGACFSDTNCANVCQTE  57



>ref|NP_001146997.1| flower-specific gamma-thionin [Zea mays]
 gb|ACG24979.1| flower-specific gamma-thionin precursor [Zea mays]
 tpg|DAA43154.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=65

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  120  MMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+L  A E+G + VAEAR C+S+SH+F+G C    NC +VC+TE
Sbjct  1    MLLRAAAEVGPVAVAEARTCQSQSHRFRGPCLRRSNCANVCRTE  44



>ref|XP_002446801.1| hypothetical protein SORBIDRAFT_06g022870 [Sorghum bicolor]
 gb|EES11129.1| hypothetical protein SORBIDRAFT_06g022870 [Sorghum bicolor]
Length=82

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGT RVAEAR C S+SHKF G C S  NC +VC+TE
Sbjct  24   EMGTTRVAEARHCLSQSHKFVGACLSKRNCANVCRTE  60



>ref|XP_009351647.1| PREDICTED: defensin-like protein 1 [Pyrus x bretschneideri]
Length=87

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 9/67 (13%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRV---------AEARKCESKSHKFKGLCFSDHNC  230
            M PS++L    F++++L+   EMG M V          E R CE+ S KFKG+CFS +NC
Sbjct  1    MEPSMRLVSAAFVLVLLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNC  60

Query  231  GSVCQTE  251
             + C  E
Sbjct  61   ANTCARE  67



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M   ++ F  +  +++L+ A E+G+ ++AEAR CES+SHKFKG C S+ NC +VC+TE
Sbjct  1    MKNPMRPFSAVLFLLLLLVATEIGS-KMAEARTCESQSHKFKGTCLSETNCANVCKTE  57



>ref|XP_007033370.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04296.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=76

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            KLF    L+++++ + EM  +  ++AR CESKSH FKG C SDHNCG VC  E
Sbjct  6    KLFGMFLLLLIVLASQEM--VVPSKARLCESKSHGFKGACLSDHNCGMVCSNE  56



>ref|NP_001146981.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG24882.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG40169.1| flower-specific gamma-thionin precursor [Zea mays]
 tpg|DAA43153.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=79

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S KLF  + L+M+L+ + E+G + VAEAR C+S+SH+F+G C    NC +VC+TE
Sbjct  1    MELSRKLFTAVLLVMLLLLSAEVGPVAVAEARTCQSQSHRFRGPCLRRSNCANVCRTE  58



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            K F  +FL++++V A +   +   EAR CES+SH FKG C  DHNC  VC+ E
Sbjct  3    KRFFGVFLLLLIVLASQEAIV-PTEARVCESQSHYFKGPCLRDHNCAMVCRNE  54



>gb|KGN49760.1| hypothetical protein Csa_5G114570 [Cucumis sativus]
Length=74

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +3

Query  90   LKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +  F     +++L+    MG M V EAR CES SH+FKGLCFS +NCG VC+TE
Sbjct  1    MNFFSAAIFLLLLLLGTGMGPM-VTEARTCESPSHRFKGLCFSKNNCGHVCKTE  53



>gb|EMT18782.1| Defensin-like protein [Aegilops tauschii]
Length=404

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  150  TMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            T +VAEAR C SKSHKFKG C S  NC S+C+TE
Sbjct  5    TRKVAEARDCLSKSHKFKGACLSSSNCASICRTE  38



>emb|CAA62761.1| putative gamma-thionin protein [Picea abies]
Length=83

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  105  TIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
             IFL+++LV +  M  + +AE R C++ S KFKG+C S +NC +VCQTE
Sbjct  12   AIFLLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTE  60



>gb|AIA67009.1| defensin [Triticum aestivum]
Length=77

 Score = 52.8 bits (125),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S K+FV + L+++     + G+++VA AR CES SHKF G CFSD NC  VCQTE
Sbjct  1    MGLSAKVFVVLLLLLVAT-EEQGGSVQVALARDCESDSHKFHGACFSDTNCAYVCQTE  57



>ref|XP_008466730.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=74

 Score = 52.8 bits (125),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +3

Query  90   LKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +K       +++L+    MG M V EAR CES SH+FKGLCFS +NCG VC+TE
Sbjct  1    MKFLSAAIFLLLLLLGTGMGPM-VTEARTCESPSHRFKGLCFSKNNCGHVCKTE  53



>ref|XP_010671291.1| PREDICTED: defensin Ec-AMP-D2-like [Beta vulgaris subsp. vulgaris]
Length=78

 Score = 52.8 bits (125),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 3/53 (6%)
 Frame = +3

Query  99   FVTIFLMMMLVFA--PEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
             ++  L++ML+F+   E+G  +VAEAR CE++SH+FKG+C    NC +VCQ E
Sbjct  7    LISALLLVMLLFSSTAEVGP-KVAEARTCETRSHRFKGICGRKANCAAVCQAE  58



>ref|XP_004976260.1| PREDICTED: defensin-like protein-like [Setaria italica]
Length=83

 Score = 52.8 bits (125),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  135  APEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            A EMGT RVAEAR C S+SHKF G C S  NC  VC TE
Sbjct  23   ASEMGTTRVAEARHCLSQSHKFVGACMSYRNCEGVCNTE  61



>gb|ABK23404.1| unknown [Picea sitchensis]
 gb|ABK23503.1| unknown [Picea sitchensis]
 gb|ABR17883.1| unknown [Picea sitchensis]
 gb|ACN40306.1| unknown [Picea sitchensis]
Length=83

 Score = 52.8 bits (125),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  111  FLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            FL+++LV +  M  + +AEAR C++ S KFKG+C S +NC +VCQTE
Sbjct  14   FLLVLLVISIGMIQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTE  60



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 52.4 bits (124),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M   ++ F  +  +++L+ A E+G+ ++AEAR CES++HKFKG C S+ NC +VC+TE
Sbjct  1    MKNPMRPFSAVLFLLLLLVATEIGS-KMAEARTCESQTHKFKGTCLSETNCANVCKTE  57



>gb|AIA66994.1| defensin [Triticum aestivum]
Length=82

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRV--AEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ + ++  +  L+++L+ A EMGT R   AEAR C S+SHKFKG C S  NC  VC+TE
Sbjct  1    MALTRRMAASALLLLLLLVATEMGTTRTKTAEARDCLSQSHKFKGACLSSSNCAGVCRTE  60



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 4/50 (8%)
 Frame = +3

Query  102  VTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            V   L ++LV    M    V EARKC S SH+FKG C SD NC SVC+TE
Sbjct  7    VLFALFLVLVITGPM----VGEARKCRSASHRFKGTCLSDTNCASVCKTE  52



>gb|AIA67011.1| defensin [Triticum aestivum]
Length=75

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S K+FV + L+++     + G+++VA AR C+S SHKF G CFSD NC +VCQTE
Sbjct  1    MGLSAKVFVVLLLLLVAT-EEQGGSVQVALARDCKSDSHKFHGACFSDTNCANVCQTE  57



>ref|XP_003575412.1| PREDICTED: defensin Tm-AMP-D1.2-like [Brachypodium distachyon]
Length=80

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S ++  +  L+M+L+ A EMGT +VAEAR C S+SHKFKG C    NC +VC+TE
Sbjct  1    MALSRRMAASALLLMVLLVATEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTE  58



>gb|ABX84377.1| amylase inhibitor-like protein [Triticum aestivum]
 gb|AIA66997.1| defensin [Triticum aestivum]
Length=82

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  EMGT--MRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGT   +VAEAR C SKSHKFKG C S  NC S+C+TE
Sbjct  22   EMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTE  60



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMG ++VAEAR CES+SHKFKG C    NC SVCQ+E
Sbjct  13   EMG-LKVAEARDCESQSHKFKGTCIRKSNCASVCQSE  48



>gb|ABX84378.1| amylase inhibitor-like protein [Triticum aestivum]
 gb|AIA66996.1| defensin [Triticum aestivum]
Length=82

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  EMGT--MRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGT   +VAEAR C SKSHKFKG C S  NC S+C+TE
Sbjct  22   EMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTE  60



>gb|AIA66992.1| defensin [Triticum aestivum]
Length=82

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMR--VAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+PS ++  +  L+++L+ A E+G  R  VAEAR C S+SHKFKG C S  NC  VC+TE
Sbjct  1    MAPSRRMAASALLLLVLLVATEIGATRTKVAEARDCLSQSHKFKGACLSSSNCAGVCRTE  60



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 2/48 (4%)
 Frame = +3

Query  108  IFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
             F M++++ + +M      E R CESKSH+FKG+C S HNC SVC  E
Sbjct  8    FFFMLLILLSSQMVVQ--TEGRHCESKSHRFKGMCLSKHNCASVCHLE  53



>gb|AAP80654.1|AF479035_1 proteinase inhibitor Rgpi9, partial [Triticum aestivum]
Length=90

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  147  GTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            G + VAEARKCES SH+F GLC   HNC +VC+TE
Sbjct  35   GPVAVAEARKCESLSHRFAGLCLRGHNCANVCRTE  69



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 31/46 (67%), Gaps = 2/46 (4%)
 Frame = +3

Query  120  MMLVFAPEMGTMR--VAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +ML  A E+GT R  VAEAR CES S KFKG C  D NC +VC TE
Sbjct  15   VMLFMATELGTNRIMVAEARMCESASSKFKGPCSRDSNCATVCHTE  60



>gb|EMT03364.1| Defensin SD2 [Aegilops tauschii]
 gb|AIA67006.1| defensin [Triticum aestivum]
Length=81

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  147  GTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            G + VAEARKCES SH+F GLC   HNC +VC+TE
Sbjct  26   GPVAVAEARKCESLSHRFAGLCLRGHNCANVCRTE  60



>gb|AAS13434.1| defensin [Nicotiana attenuata]
Length=52

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  159  VAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            VAEAR CES+S +F+GLCFS  NCGSVC TE
Sbjct  2    VAEARTCESQSRRFRGLCFSKSNCGSVCHTE  32



>gb|EMT03877.1| Defensin Tk-AMP-D3 [Aegilops tauschii]
Length=75

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  138  PEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
             + G+++VA AR C+S SHKF G CFSD NC +VCQTE
Sbjct  20   EQGGSVQVALARDCKSDSHKFHGACFSDTNCANVCQTE  57



>ref|XP_010246429.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
Length=82

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  156  RVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +V EAR CES+SH+FKG C SD NC S+CQTE
Sbjct  26   KVVEARTCESQSHRFKGACLSDTNCLSICQTE  57



>dbj|BAK06284.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=100

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 3/62 (5%)
 Frame = +3

Query  66   NRANMSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQ  245
             +  M  S KLF  + ++++LV A E+     A+AR+CE +S +F GLCF   NC  VC 
Sbjct  22   QQGRMESSHKLFSAVAILLLLVVATEVAP---AQARECEVESERFNGLCFVSANCAGVCG  78

Query  246  TE  251
             E
Sbjct  79   AE  80



>ref|XP_006586320.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=74

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  117  MMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            + +LV   ++   R AE R C SKSH FKGLCFSD NC  VC+TE
Sbjct  11   LELLVICVDVAVKR-AEGRDCSSKSHGFKGLCFSDTNCAHVCRTE  54



>gb|KHG15212.1| Defensin-like protein 1 [Gossypium arboreum]
Length=74

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +3

Query  90   LKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +K  +  F ++++V A + G ++  EAR C+S+SHKF G C S HNC  VC+ E
Sbjct  2    VKRSLGFFFLLLIVLASQWG-VQPTEARVCQSQSHKFHGACVSSHNCAMVCRNE  54



>gb|EMS68062.1| Defensin Tm-AMP-D1.2 [Triticum urartu]
Length=74

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  150  TMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            T +VAEAR C SKSHKFKG C S  NC S+C+TE
Sbjct  5    TRKVAEARDCLSKSHKFKGACLSSSNCASICRTE  38



>gb|ACV84382.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  EMGT--MRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMGT  M+ AEAR C S+SHKFKG C S  NC S+C+TE
Sbjct  22   EMGTPTMKAAEARDCLSQSHKFKGSCLSSSNCASICRTE  60



>gb|AFD01290.1| defensin 3 [Pinus sylvestris]
Length=83

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  108  IFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            IFL+++LV    M  ++VAE R C++ S KFKG C S  NC +VC+TE
Sbjct  13   IFLLVLLVITIGMMAVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTE  60



>gb|ABK25062.1| unknown [Picea sitchensis]
Length=83

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  111  FLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            FL+++LV +  M  + +AE R C++ S KFKG+C S +NC +VCQTE
Sbjct  14   FLLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTE  60



>gb|KHN16909.1| Defensin J1-2 [Glycine soja]
Length=84

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 7/61 (11%)
 Frame = +3

Query  87   SLKLFVTIFLMM------MLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQT  248
            ++ +   +FL++       +   P +   R AE R C SKSH FKGLCFSD NC  VC+T
Sbjct  5    TIGILFLVFLVLPSVKDRYIYIIPYVAVKR-AEGRDCSSKSHGFKGLCFSDTNCAHVCRT  63

Query  249  E  251
            E
Sbjct  64   E  64



>ref|XP_008793609.1| PREDICTED: defensin Ec-AMP-D1-like isoform X1 [Phoenix dactylifera]
Length=78

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +3

Query  129  VFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            + + EMGT +V EAR CES+SH+FKG C    NC +VCQTE
Sbjct  19   ISSEEMGT-KVVEARTCESQSHRFKGTCLRASNCANVCQTE  58



>gb|AIA67014.1| defensin [Triticum aestivum]
Length=75

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S KLF  + ++++LV A E+     A+AR+CE++S +F GLCF   NC  VC  E
Sbjct  1    MESSHKLFPAVAILLLLVVATEV---VPAQARECETESERFNGLCFVSANCAGVCNAE  55



>ref|XP_008793610.1| PREDICTED: defensin Ec-AMP-D1-like isoform X2 [Phoenix dactylifera]
Length=77

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S +L   I L++ L+ + EMGT +V EAR CES+SH+FKG C    NC +VCQTE
Sbjct  1    MEHSRRLLPAILLLLFLLISSEMGT-KVVEARTCESQSHRFKGTCLRASNCANVCQTE  57



>ref|XP_009590912.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=74

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            K F  IFL++ +VFA +M   R AE R C S+SH ++G C  DHNC  VC+ E
Sbjct  4    KTFGLIFLLL-IVFASQMAIQR-AEGRVCISQSHGYRGPCVHDHNCALVCRNE  54



>gb|EMS65297.1| Defensin SD2 [Triticum urartu]
 gb|AIA67005.1| defensin [Triticum aestivum]
Length=78

 Score = 50.4 bits (119),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  147  GTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            G + VAEAR+CES SH+F GLC   HNC +VC+TE
Sbjct  23   GPVAVAEARRCESLSHRFAGLCLRGHNCANVCRTE  57



>gb|EMT32128.1| Defensin-like protein [Aegilops tauschii]
Length=125

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 2/38 (5%)
 Frame = +3

Query  144  MGTMRVAEARK--CESKSHKFKGLCFSDHNCGSVCQTE  251
            MGT RVAEAR   CES+SH+++G C+ D NC  VC TE
Sbjct  1    MGTTRVAEARHRHCESQSHRYRGACWRDDNCKHVCNTE  38



>pdb|2LR3|A Chain A, Solution Structure Of The Anti-fungal Defensin Def4 
(mtr_8g070770) From Medicago Truncatula (barrel Clover)
Length=47

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +3

Query  171  RKCESKSHKFKGLCFSDHNCGSVCQTE  251
            R CES+SHKFKG C SDHNC SVCQTE
Sbjct  1    RTCESQSHKFKGPCASDHNCASVCQTE  27



>gb|EMT11359.1| Defensin-like protein P322 [Aegilops tauschii]
Length=76

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  144  MGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
             G ++VA AR+C S SHKFKGLC SD NC SVC TE
Sbjct  21   QGAVQVALARECTSPSHKFKGLCVSDTNCASVCLTE  56



>gb|AHA50470.1| defensin-like protein 1 [Citrullus lanatus]
Length=74

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +3

Query  90   LKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +K F    L+++L+ A  MG M V +AR CES S  FKGLCFS +NCG VC+TE
Sbjct  1    MKFFSAAILLLLLLLATGMGPM-VTDARTCESPSRHFKGLCFSKNNCGHVCKTE  53



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMG  +VAEAR CES+SHKFKG C    NC SVCQ+E
Sbjct  13   EMGP-KVAEARDCESQSHKFKGTCIRKSNCASVCQSE  48



>ref|XP_002875116.1| hypothetical protein ARALYDRAFT_904442 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51375.1| hypothetical protein ARALYDRAFT_904442 [Arabidopsis lyrata subsp. 
lyrata]
Length=73

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  SL+L   + L +ML+FA  MG +   EAR CES S+KF+G+C +  +C   C +E
Sbjct  1    MKLSLRLISALLLSVMLLFATGMGPV---EARTCESPSNKFQGVCLNSQSCAKACPSE  55



>ref|XP_009780051.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=74

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +3

Query  108  IFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +F ++++VFA +M   RV E R C S+SH + G C  DHNC  VC+ E
Sbjct  8    LFFLLLIVFASQMAISRV-EGRVCISQSHGYHGTCVHDHNCALVCRNE  54



>gb|EPS66510.1| kunitz trypsin inhibitor protein, partial [Genlisea aurea]
Length=66

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  159  VAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
             AEAR CES+SH FKG C SDHNCG VC+ E
Sbjct  16   AAEARTCESQSHGFKGRCLSDHNCGLVCRNE  46



>ref|XP_002451983.1| hypothetical protein SORBIDRAFT_04g012170 [Sorghum bicolor]
 gb|EES04959.1| hypothetical protein SORBIDRAFT_04g012170 [Sorghum bicolor]
Length=81

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVA-EARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+   ++    FL+++++ A E  T RV  E + C S+SH F G+CFS  NC +VC+TE
Sbjct  1    MALCRRMAAPFFLVLLIIVAAETATARVVVEEKHCLSQSHSFSGMCFSHTNCDNVCKTE  59



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  SL L   I +M+ML+ A  MG + V EAR CES S  F G C S  NC ++C  E
Sbjct  3    MKISLPLISAIAIMLMLLLATGMGPVTV-EARMCESSSQLFNGPCLSTTNCANICHNE  59



>ref|XP_007159919.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
 gb|ESW31913.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
Length=74

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +3

Query  108  IFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            IFL+  LV A ++   R AEAR C S+S  FKGLCFS+ NC +VC TE
Sbjct  9    IFLLF-LVLAADVAVKR-AEARLCWSESQAFKGLCFSNDNCATVCLTE  54



>ref|XP_002459604.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
 gb|EER96125.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
Length=78

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S KLF  + L+++  +    G + VA ARKC+SKS KFKG C  D NC +VC TE
Sbjct  1    MGLSTKLFAVLLLLLIGGYTEMQGPVTVALARKCQSKSFKFKGPCSRDENCATVCLTE  58



>ref|XP_010675152.1| PREDICTED: defensin-like protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=73

 Score = 49.7 bits (117),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 3/53 (6%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +LF    L ++L  +PE+   + AE R C+S+SH FKG C  DHNC  VC+ E
Sbjct  4    RLFGLCILFLVLFASPEV---KQAEGRVCQSRSHYFKGPCARDHNCAYVCRNE  53



>ref|XP_003573542.1| PREDICTED: defensin-like protein 3 [Brachypodium distachyon]
Length=77

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 32/54 (59%), Gaps = 1/54 (2%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAP-EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            K  V + LM++++ A  E G   VAEA+ C  +S  + G+C SD NC  VCQ E
Sbjct  4    KKNVALVLMLLIILAAQEEGGSNVAEAKICRKRSAGYHGMCMSDRNCAQVCQAE  57



>gb|AFK47422.1| unknown [Lotus japonicus]
Length=74

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 2/51 (4%)
 Frame = +3

Query  99   FVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            F   F++ +L+ + +M      E R CESKSH+F GLC S HNC SVC  E
Sbjct  6    FGLFFVLFILLASHQMVVQ--TEGRHCESKSHRFHGLCLSHHNCASVCHLE  54



>gb|AHA50472.1| defensin-like protein 5 [Citrullus lanatus]
Length=74

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  159  VAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            V EAR CES SH FKGLCFS  NCG++C+TE
Sbjct  23   VVEARVCESLSHSFKGLCFSSTNCGNICKTE  53



>ref|XP_008340513.1| PREDICTED: defensin-like protein 1 [Malus domestica]
 gb|AFH74425.1| defensin [Malus domestica]
Length=87

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 9/67 (13%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRV---------AEARKCESKSHKFKGLCFSDHNC  230
            M  S++L    F++++L+   EMG M V          E R CE+ S KFKG+CFS +NC
Sbjct  1    MEHSMRLVSAAFVLVLLLATTEMGPMGVEAKSKSSKEVEKRTCEAASGKFKGMCFSSNNC  60

Query  231  GSVCQTE  251
             + C  E
Sbjct  61   ANTCARE  67



>ref|XP_009370221.1| PREDICTED: defensin-like protein 2 [Pyrus x bretschneideri]
Length=86

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 14/71 (20%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARK-------------CESKSHKFKGLCFS  218
            M  S +LF TIF++++L+ A   G M VAE +              CES SHKF+G+CF 
Sbjct  1    MERSGRLFSTIFILVLLLVAIGTGPM-VAEGKTKEKSSKNEKSSKTCESPSHKFRGICFR  59

Query  219  DHNCGSVCQTE  251
              NC + C+ E
Sbjct  60   SSNCATTCKKE  70



>ref|XP_009383785.1| PREDICTED: defensin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=76

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +3

Query  114  LMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            L+M L+F+     M   EAR C   S  F+GLCFSD NC  VCQTE
Sbjct  10   LLMFLLFSASQLMMPGVEARVCRYASRSFRGLCFSDTNCAHVCQTE  55



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S++L   +  ++M+  A  MG + V EAR C S+S +FKG C SD NC +VC  E
Sbjct  1    MKFSMRLISAVLFLVMIFVATGMGPVTV-EARTCASQSQRFKGKCVSDTNCENVCHNE  57



>gb|EMT11360.1| Defensin Tk-AMP-D4 [Aegilops tauschii]
Length=74

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  144  MGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
             G ++VA AR C S+SH+F G+C SD NC SVCQTE
Sbjct  21   QGPVQVALARDCTSQSHEFVGMCLSDRNCASVCQTE  56



>gb|AIA66989.1| defensin [Triticum aestivum]
Length=82

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  EMG--TMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMG  T+++AEAR C S+SHKFKG C S  NC +VC+TE
Sbjct  22   EMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTE  60



>gb|ACV84384.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = +3

Query  141  EMG--TMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMG  T+++AEAR C S+SHKFKG C S  NC +VC+TE
Sbjct  22   EMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTE  60



>gb|ABS72000.1| putative defensin protein 1 [Olea europaea]
Length=56

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  147  GTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            G + VA+AR CES+SH+FKG C S  NC +VCQTE
Sbjct  2    GPLMVADARTCESQSHRFKGSCVSKSNCAAVCQTE  36



>gb|AHA50473.1| defensin-like protein 6 [Citrullus lanatus]
Length=74

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  159  VAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            V EAR CES SH FKGLCFS  NCG++C+TE
Sbjct  23   VVEARVCESLSHSFKGLCFSSTNCGNICKTE  53



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  147  GTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            G + VAEAR+CES SH F+G C   HNC +VC+TE
Sbjct  48   GPVAVAEARRCESPSHMFRGPCVRGHNCANVCRTE  82



>ref|NP_178322.1| defensin-like protein 10 [Arabidopsis thaliana]
 sp|Q9ZUL8.1|DEF10_ARATH RecName: Full=Defensin-like protein 10; AltName: Full=Low-molecular-weight 
cysteine-rich protein 72; Short=Protein LCR72; 
AltName: Full=Plant defensin 2.6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97220.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAM64623.1| protease inhibitor II [Arabidopsis thaliana]
 gb|ABI49429.1| At2g02140 [Arabidopsis thaliana]
 gb|AEC05550.1| defensin-like protein 10 [Arabidopsis thaliana]
Length=73

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  SL+L   + + +ML+FA  MG +   EAR CES S+KF+G+C +  +C   C +E
Sbjct  1    MKLSLRLISALLMSVMLLFATGMGPV---EARTCESPSNKFQGVCLNSQSCAKACPSE  55



>gb|ACV84381.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMG--TMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S ++  +  L+++L+ A EMG  T +VAEAR C S+SH FKG C S  NC +VC+TE
Sbjct  1    MALSRRMAPSALLLLVLLVATEMGATTTKVAEARDCVSQSHNFKGACLSSSNCPAVCRTE  60



>ref|XP_006394251.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
 gb|ESQ31537.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
Length=73

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 3/53 (6%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            K F  IFL ++L  + ++  +   E R C+SKSH FK +C+SDHNC  +C+ E
Sbjct  4    KTFAAIFLFLVLFSSQKIIGI---EGRMCQSKSHHFKHMCWSDHNCAIICRNE  53



>ref|XP_004976259.1| PREDICTED: defensin-like protein-like [Setaria italica]
Length=84

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +3

Query  135  APEMGTMR-VAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            A EMGT R VAEAR+C S+SHKF G C    NC  VCQTE
Sbjct  22   ASEMGTTRPVAEARRCVSQSHKFVGSCMRKSNCQHVCQTE  61



>ref|XP_004976261.1| PREDICTED: defensin-like protein P322-like [Setaria italica]
Length=83

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  135  APEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            A E+G  RVAEAR C S+SHKF+G C    NC +VC+TE
Sbjct  23   ASEIGPTRVAEARHCVSQSHKFEGTCTRKSNCENVCKTE  61



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +3

Query  93   KLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            K    +F+  +L+ A     ++ AEAR CES+SH+FKG C SD  C   C+ E
Sbjct  4    KTLGVLFMFFLLLTAVTDVAVKTAEARTCESRSHRFKGTCLSDTTCAHACRNE  56



>ref|XP_007203247.1| hypothetical protein PRUPE_ppa019504mg [Prunus persica]
 gb|EMJ04446.1| hypothetical protein PRUPE_ppa019504mg [Prunus persica]
Length=85

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 37/65 (57%), Gaps = 7/65 (11%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTM----RVA---EARKCESKSHKFKGLCFSDHNCGS  236
            M  S ++F T+F++++L+ A E G M    +VA   E+R CES S KFKG C     C  
Sbjct  1    MEGSRRMFSTVFILILLLVAIETGPMVAEGKVATKEESRTCESLSTKFKGFCLRSSRCAE  60

Query  237  VCQTE  251
             CQ E
Sbjct  61   ACQKE  65



>ref|XP_006367122.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=71

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 7/58 (12%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+   K+  TI LM+ML+F+         EA+ CES S +FKGLCF+   C  VC TE
Sbjct  1    MAALSKVVATILLMLMLIFS-------TVEAKTCESPSRRFKGLCFNTWKCRFVCSTE  51



>gb|AHA50471.1| defensin-like protein 4 [Citrullus lanatus]
Length=75

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  159  VAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            V EAR CES SH FKGLCFS  NCG++C+TE
Sbjct  24   VVEARVCESLSHSFKGLCFSSTNCGNICKTE  54



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 1/37 (3%)
 Frame = +3

Query  141  EMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            EMG  + AEAR CES+SHKFKG C    NC SVCQ+E
Sbjct  13   EMGP-KAAEARDCESQSHKFKGTCIRKSNCASVCQSE  48



>emb|CAD41436.1| OSJNBa0019D11.21 [Oryza sativa Japonica Group]
 emb|CAH67531.1| OSIGBa0131L05.12 [Oryza sativa Indica Group]
 gb|EAY94881.1| hypothetical protein OsI_16682 [Oryza sativa Indica Group]
 gb|EAZ31369.1| hypothetical protein OsJ_15496 [Oryza sativa Japonica Group]
Length=81

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  135  APEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            A EMGT RVAEAR C S+SH+F G C    NC  VC TE
Sbjct  21   ASEMGTTRVAEARHCVSQSHRFVGACMRKSNCEHVCMTE  59



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  90   LKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            +K    +F ++++V A     +   EAR C+S+SH FKG C  DHNC  VC+ E
Sbjct  3    IKRSFGLFFLLLIVLASPEEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNE  56



>gb|EMT00351.1| Defensin-like protein [Aegilops tauschii]
Length=82

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMG--TMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M+ S ++  +  L+++L+ A EMG  T +VAEAR C S+S KFKG C S  NC  VC+TE
Sbjct  1    MALSRRMAASTLLLLVLLVATEMGATTTKVAEARDCLSQSFKFKGACLSSSNCAGVCRTE  60



>ref|XP_009763849.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=76

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = +3

Query  99   FVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            F+ +FL   ++F  +M  MR  EAR C S SH + G C+ DHNC  VC+ E
Sbjct  9    FLFVFL---IIFVSQMEMMRQVEARVCMSPSHGYHGPCWHDHNCALVCRNE  56



>ref|XP_006292846.1| hypothetical protein CARUB_v10019106mg [Capsella rubella]
 gb|EOA25744.1| hypothetical protein CARUB_v10019106mg [Capsella rubella]
Length=73

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  SL+L   + L +ML+FA  MG +   EAR CES S KF G+C +   C   C +E
Sbjct  1    MKLSLRLVSALLLSIMLLFATGMGPV---EARTCESPSSKFSGVCLNSQTCAKACPSE  55



>emb|CAH65875.1| OSIGBa0160I04.1 [Oryza sativa Indica Group]
Length=78

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +3

Query  78   MSPSLKLFVTIFLMMMLVFAPEMGTMRVAEARKCESKSHKFKGLCFSDHNCGSVCQTE  251
            M  S K F  I ++++LV   EM     A+AR+CE++S KF G+C    NC  +C+TE
Sbjct  1    MESSRKFFPAIAVLLLLVINTEMAP---AQARECETESSKFSGMCMIQANCDHICKTE  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517403453504