BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c37143_g1_i1 len=873 path=[851:0-872]

Length=873
                                                                      Score     E

ref|XP_006364703.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    420   2e-142   
ref|XP_009778729.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    425   8e-142   
ref|XP_009613929.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    421   4e-140   
ref|XP_011073828.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    410   5e-136   
ref|XP_011073827.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    410   6e-136   
ref|XP_004247997.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    409   2e-135   
gb|EYU32731.1|  hypothetical protein MIMGU_mgv1a002945mg                391   1e-128   
emb|CDP19615.1|  unnamed protein product                                387   6e-127   
dbj|BAF03493.1|  Ku70 homolog                                           386   1e-126   Populus nigra [black poplar]
gb|KDO44369.1|  hypothetical protein CISIN_1g0069751mg                  379   3e-126   
ref|XP_002317447.2|  Ku70-like family protein                           385   3e-126   Populus trichocarpa [western balsam poplar]
ref|XP_011044051.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    382   5e-125   
ref|XP_010103927.1|  hypothetical protein L484_012012                   372   7e-125   
gb|KDP46042.1|  hypothetical protein JCGZ_13488                         382   9e-125   
ref|XP_006442384.1|  hypothetical protein CICLE_v10019318mg             378   1e-123   
ref|XP_006477846.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    378   2e-123   
ref|XP_008222687.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    376   1e-122   
ref|XP_007221986.1|  hypothetical protein PRUPE_ppa002852mg             375   4e-122   
ref|XP_002521532.1|  ku P70 DNA helicase, putative                      374   9e-122   Ricinus communis
ref|XP_004296683.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    372   3e-121   
ref|XP_008342867.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    362   3e-120   
ref|XP_008453932.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    366   1e-118   
ref|XP_007021876.1|  KU70 isoform 2                                     359   2e-117   
ref|XP_007021877.1|  KU70 isoform 3                                     359   3e-117   
ref|XP_004152086.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    362   3e-117   
ref|XP_004161593.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    361   6e-117   
ref|XP_007021875.1|  KU70 isoform 1                                     360   3e-116   
ref|XP_006416754.1|  hypothetical protein EUTSA_v10007085mg             358   9e-116   
ref|XP_009149134.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    358   1e-115   
ref|XP_010923465.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    357   3e-115   
emb|CDY40008.1|  BnaC05g13070D                                          356   4e-115   
ref|XP_010273411.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    355   2e-114   
ref|XP_010273409.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    355   3e-114   
gb|KCW69915.1|  hypothetical protein EUGRSUZ_F032412                    350   3e-114   
ref|NP_564012.1|  ATP-dependent DNA helicase 2 subunit KU70             354   4e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008786104.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    350   1e-113   
ref|XP_006307010.1|  hypothetical protein CARUB_v10008595mg             352   1e-113   
ref|XP_010062792.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    352   4e-113   
ref|XP_010650420.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    347   4e-113   
emb|CDY35134.1|  BnaA06g11440D                                          350   6e-113   
ref|XP_008786103.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    350   1e-112   
gb|KFK43907.1|  hypothetical protein AALP_AA1G189500                    350   2e-112   
ref|XP_010273410.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    350   3e-112   
ref|XP_010476832.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    348   5e-112   
ref|XP_002267875.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    348   7e-112   Vitis vinifera
dbj|BAC83190.1|  putative DNA-dependent protein kinase 70 kda DNA...    337   5e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010459255.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    346   5e-111   
ref|XP_010498037.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    345   1e-110   
ref|XP_009397017.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    345   2e-110   
ref|XP_004956589.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    344   2e-110   
ref|XP_010680644.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    344   2e-110   
ref|XP_002892931.1|  hypothetical protein ARALYDRAFT_471898             343   4e-110   
ref|XP_006606601.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    344   5e-110   
gb|EEC81629.1|  hypothetical protein OsI_25158                          337   9e-110   Oryza sativa Indica Group [Indian rice]
ref|XP_010537714.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    342   2e-109   
tpg|DAA42527.1|  TPA: hypothetical protein ZEAMMB73_363757              328   7e-109   
gb|AEO86623.1|  Ku70                                                    339   3e-108   
ref|XP_009778730.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    337   9e-108   
ref|NP_001059061.1|  Os07g0184900                                       337   1e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003557466.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    336   4e-107   
ref|XP_002459446.1|  hypothetical protein SORBIDRAFT_02g004740          335   1e-106   Sorghum bicolor [broomcorn]
ref|XP_009613930.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    333   1e-106   
ref|XP_008668260.1|  PREDICTED: uncharacterized protein LOC100381...    334   2e-106   
gb|ADO00728.1|  Ku70                                                    333   4e-106   
ref|XP_002461302.1|  hypothetical protein SORBIDRAFT_02g000480          328   7e-104   Sorghum bicolor [broomcorn]
gb|AAT48365.1|  Ku70-like protein                                       326   4e-103   Vigna radiata [mung bean]
gb|EMT11495.1|  ATP-dependent DNA helicase 2 subunit 1                  334   1e-102   
gb|EPS73529.1|  hypothetical protein M569_01226                         324   1e-102   
ref|XP_006657510.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    320   4e-101   
ref|XP_003592861.1|  ATP-dependent DNA helicase 2 subunit               310   2e-99    
ref|XP_004497482.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    316   3e-99    
ref|XP_007142604.1|  hypothetical protein PHAVU_007G001600g             315   3e-99    
gb|AAF99835.1|AC051629_2  Hypothetical protein                          315   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007142605.1|  hypothetical protein PHAVU_007G001600g             315   4e-99    
ref|XP_010650419.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    313   1e-98    
gb|KCW69914.1|  hypothetical protein EUGRSUZ_F032412                    312   3e-98    
gb|KGN53122.1|  hypothetical protein Csa_4G017100                       311   3e-98    
gb|ABR16802.1|  unknown                                                 312   8e-98    Picea sitchensis
gb|EMS60366.1|  ATP-dependent DNA helicase 2 subunit KU70               312   2e-97    
gb|KHN27146.1|  ATP-dependent DNA helicase 2 subunit KU70               297   4e-97    
gb|AES63112.2|  ATP-dependent DNA helicase 2 subunit Ku70               310   6e-97    
gb|EAZ38936.1|  hypothetical protein OsJ_23357                          307   3e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004959001.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    306   4e-95    
ref|XP_006850259.1|  hypothetical protein AMTR_s00020p00070810          294   4e-91    
tpg|DAA42529.1|  TPA: hypothetical protein ZEAMMB73_363757              253   2e-73    
gb|ACG47682.1|  hypothetical protein                                    194   1e-57    Zea mays [maize]
ref|XP_002962490.1|  hypothetical protein SELMODRAFT_165509             191   1e-52    
ref|XP_002962795.1|  hypothetical protein SELMODRAFT_78255              190   5e-52    
ref|XP_001781270.1|  predicted protein                                  152   2e-38    
ref|XP_004380026.1|  PREDICTED: X-ray repair cross-complementing ...    116   1e-25    
ref|XP_001180453.1|  PREDICTED: X-ray repair cross-complementing ...    113   4e-25    Strongylocentrotus purpuratus [purple urchin]
ref|XP_006027713.1|  PREDICTED: X-ray repair cross-complementing ...    114   4e-25    
ref|XP_006027710.1|  PREDICTED: X-ray repair cross-complementing ...    114   9e-25    
ref|XP_006027711.1|  PREDICTED: X-ray repair cross-complementing ...    114   1e-24    
ref|XP_003290709.1|  hypothetical protein DICPUDRAFT_7342               112   1e-24    
ref|XP_006259035.1|  PREDICTED: X-ray repair cross-complementing ...    111   8e-24    
gb|EKC34975.1|  ATP-dependent DNA helicase 2 subunit 1                  111   8e-24    
ref|XP_007099959.1|  PREDICTED: X-ray repair cross-complementing ...    110   1e-23    
ref|XP_006980263.1|  PREDICTED: X-ray repair cross-complementing ...    110   1e-23    
ref|XP_007099958.1|  PREDICTED: X-ray repair cross-complementing ...    110   1e-23    
gb|AAA39396.1|  p70 Ku lupus autoantigen                                110   1e-23    Mus musculus [mouse]
gb|EDL04536.1|  X-ray repair complementing defective repair in Ch...    110   1e-23    
ref|XP_004279584.1|  PREDICTED: X-ray repair cross-complementing ...    110   1e-23    
sp|P23475.5|XRCC6_MOUSE  RecName: Full=X-ray repair cross-complem...    110   1e-23    Mus musculus [mouse]
ref|NP_034377.2|  X-ray repair cross-complementing protein 6            110   1e-23    Mus musculus [mouse]
gb|AAC52675.1|  DNA repair enzyme                                       110   2e-23    Mus musculus [mouse]
ref|XP_006980262.1|  PREDICTED: X-ray repair cross-complementing ...    110   2e-23    
ref|NP_001177114.1|  X-ray repair cross-complementing protein 6         110   2e-23    
ref|XP_003989387.1|  PREDICTED: X-ray repair cross-complementing ...    110   2e-23    
ref|XP_007454026.1|  PREDICTED: X-ray repair cross-complementing ...    109   2e-23    
ref|XP_008763893.1|  PREDICTED: X-ray repair cross-complementing ...    108   3e-23    
ref|NP_620780.2|  X-ray repair cross-complementing protein 6            109   4e-23    Rattus norvegicus [brown rat]
dbj|BAB83858.1|  G22p1                                                  109   4e-23    Rattus norvegicus [brown rat]
ref|XP_005984778.1|  PREDICTED: X-ray repair cross-complementing ...    108   5e-23    
ref|XP_007425757.1|  PREDICTED: X-ray repair cross-complementing ...    107   5e-23    
ref|XP_007198780.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    108   5e-23    
ref|XP_006890247.1|  PREDICTED: X-ray repair cross-complementing ...    108   5e-23    
dbj|BAE27135.1|  unnamed protein product                                108   6e-23    Mus musculus [mouse]
ref|XP_004007067.1|  PREDICTED: X-ray repair cross-complementing ...    108   6e-23    
ref|XP_007425756.1|  PREDICTED: X-ray repair cross-complementing ...    107   7e-23    
ref|XP_008506155.1|  PREDICTED: X-ray repair cross-complementing ...    107   9e-23    
ref|XP_007907750.1|  PREDICTED: X-ray repair cross-complementing ...    108   9e-23    
ref|XP_009051802.1|  hypothetical protein LOTGIDRAFT_182021             108   1e-22    
gb|AAI03219.1|  XRCC6 protein                                           105   1e-22    Bos taurus [bovine]
ref|XP_004437969.1|  PREDICTED: X-ray repair cross-complementing ...    107   2e-22    
ref|XP_009900754.1|  PREDICTED: X-ray repair cross-complementing ...    107   2e-22    
ref|XP_005067084.1|  PREDICTED: X-ray repair cross-complementing ...    107   2e-22    
ref|XP_005606746.1|  PREDICTED: X-ray repair cross-complementing ...    106   2e-22    
ref|XP_006068968.1|  PREDICTED: X-ray repair cross-complementing ...    107   2e-22    
gb|KFV68842.1|  X-ray repair cross-complementing protein 5              107   2e-22    
ref|XP_006150789.1|  PREDICTED: X-ray repair cross-complementing ...    107   2e-22    
ref|XP_006068969.1|  PREDICTED: X-ray repair cross-complementing ...    107   2e-22    
ref|XP_006150788.1|  PREDICTED: X-ray repair cross-complementing ...    107   2e-22    
ref|XP_001500404.2|  PREDICTED: X-ray repair cross-complementing ...    107   2e-22    Equus caballus [domestic horse]
ref|XP_003264863.1|  PREDICTED: X-ray repair cross-complementing ...    106   2e-22    
ref|XP_010341877.1|  PREDICTED: X-ray repair cross-complementing ...    106   2e-22    
ref|XP_009573861.1|  PREDICTED: X-ray repair cross-complementing ...    106   3e-22    
ref|XP_004484200.1|  PREDICTED: X-ray repair cross-complementing ...    106   3e-22    
ref|XP_005515012.1|  PREDICTED: X-ray repair cross-complementing ...    106   3e-22    
gb|EMC89970.1|  ATP-dependent DNA helicase 2 subunit 1                  106   3e-22    
ref|XP_004484198.1|  PREDICTED: X-ray repair cross-complementing ...    106   3e-22    
ref|XP_006207195.1|  PREDICTED: X-ray repair cross-complementing ...    106   3e-22    
gb|KFV91337.1|  X-ray repair cross-complementing protein 5              106   3e-22    
ref|XP_003419862.1|  PREDICTED: X-ray repair cross-complementing ...    106   3e-22    
emb|CAG47015.1|  G22P1                                                  106   3e-22    Homo sapiens [man]
ref|XP_007618650.1|  PREDICTED: X-ray repair cross-complementing ...    106   4e-22    
ref|XP_004360399.1|  ATP-dependent DNA helicase                         107   4e-22    
ref|XP_003514777.1|  PREDICTED: X-ray repair cross-complementing ...    106   4e-22    
ref|NP_001460.1|  X-ray repair cross-complementing protein 6 isof...    106   4e-22    Homo sapiens [man]
dbj|BAK63517.1|  ATP-dependent DNA helicase 2 subunit 1                 106   4e-22    
ref|XP_002721433.1|  PREDICTED: X-ray repair cross-complementing ...    106   4e-22    Oryctolagus cuniculus [domestic rabbit]
ref|XP_010016424.1|  PREDICTED: X-ray repair cross-complementing ...    106   4e-22    
gb|KFQ52863.1|  X-ray repair cross-complementing protein 5              106   5e-22    
ref|NP_001126888.1|  X-ray repair cross-complementing protein 6         106   5e-22    Pongo abelii [orang utan]
ref|XP_008989116.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    106   5e-22    
gb|AAB46854.1|  Ku70=DNA-dependent protein kinase 70 kda DNA-bind...    105   5e-22    
ref|XP_010189290.1|  PREDICTED: X-ray repair cross-complementing ...    105   5e-22    
ref|XP_004063587.1|  PREDICTED: X-ray repair cross-complementing ...    105   6e-22    
ref|XP_007079517.1|  PREDICTED: X-ray repair cross-complementing ...    105   6e-22    
ref|NP_001271637.1|  uncharacterized protein LOC101866663               105   6e-22    
dbj|BAG37986.1|  unnamed protein product                                105   6e-22    Homo sapiens [man]
ref|XP_005567198.1|  PREDICTED: X-ray repair cross-complementing ...    105   6e-22    
gb|EHH20277.1|  hypothetical protein EGK_03094                          105   6e-22    
ref|XP_005681172.1|  PREDICTED: X-ray repair cross-complementing ...    105   6e-22    
gb|KFQ27941.1|  X-ray repair cross-complementing protein 5              105   6e-22    
ref|XP_005681173.1|  PREDICTED: X-ray repair cross-complementing ...    105   6e-22    
ref|XP_005681174.1|  PREDICTED: X-ray repair cross-complementing ...    105   6e-22    
ref|XP_010145297.1|  PREDICTED: X-ray repair cross-complementing ...    104   8e-22    
gb|KFV91400.1|  X-ray repair cross-complementing protein 5              104   8e-22    
ref|XP_007939902.1|  PREDICTED: X-ray repair cross-complementing ...    105   9e-22    
ref|XP_010828252.1|  PREDICTED: X-ray repair cross-complementing ...    105   9e-22    
ref|XP_009215653.1|  PREDICTED: X-ray repair cross-complementing ...    105   9e-22    
ref|XP_009813306.1|  PREDICTED: X-ray repair cross-complementing ...    105   1e-21    
ref|XP_005909502.1|  PREDICTED: X-ray repair cross-complementing ...    105   1e-21    
ref|XP_010828213.1|  PREDICTED: X-ray repair cross-complementing ...    105   1e-21    
gb|ELR46327.1|  X-ray repair cross-complementing protein 6              105   1e-21    
ref|XP_010828209.1|  PREDICTED: X-ray repair cross-complementing ...    105   1e-21    
gb|KFV55965.1|  X-ray repair cross-complementing protein 5              104   1e-21    
gb|KFR11028.1|  X-ray repair cross-complementing protein 5              104   1e-21    
ref|XP_009320250.1|  PREDICTED: X-ray repair cross-complementing ...    104   1e-21    
ref|XP_003783203.1|  PREDICTED: X-ray repair cross-complementing ...    104   1e-21    
gb|KFW61113.1|  X-ray repair cross-complementing protein 5              104   1e-21    
ref|XP_006124038.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-21    
ref|XP_010804048.1|  PREDICTED: X-ray repair cross-complementing ...    104   2e-21    
ref|XP_008843016.1|  PREDICTED: X-ray repair cross-complementing ...    104   2e-21    
ref|NP_001179175.1|  X-ray repair cross-complementing protein 6         104   2e-21    
ref|XP_005207439.1|  PREDICTED: X-ray repair cross-complementing ...    104   2e-21    
ref|XP_004589793.1|  PREDICTED: X-ray repair cross-complementing ...    104   2e-21    
ref|XP_005322256.1|  PREDICTED: X-ray repair cross-complementing ...    104   2e-21    
ref|XP_005488740.1|  PREDICTED: X-ray repair cross-complementing ...    104   2e-21    
ref|XP_005039734.1|  PREDICTED: X-ray repair cross-complementing ...    103   2e-21    
ref|XP_002597564.1|  hypothetical protein BRAFLDRAFT_281658             103   2e-21    Branchiostoma floridae
ref|XP_009864836.1|  PREDICTED: X-ray repair cross-complementing ...    103   3e-21    
gb|KFP86069.1|  X-ray repair cross-complementing protein 5              103   3e-21    
ref|XP_002197201.1|  PREDICTED: X-ray repair cross-complementing ...    103   3e-21    Taeniopygia guttata
gb|ETE68597.1|  X-ray repair cross-complementing protein 6              101   3e-21    
ref|XP_531714.1|  PREDICTED: X-ray repair cross-complementing pro...    103   3e-21    Canis lupus familiaris [dogs]
ref|XP_010078314.1|  PREDICTED: X-ray repair cross-complementing ...    103   4e-21    
ref|NP_990258.1|  X-ray repair cross-complementing protein 5 prec...    103   4e-21    Gallus gallus [bantam]
ref|XP_006740422.1|  PREDICTED: X-ray repair cross-complementing ...    102   4e-21    
ref|XP_005096713.1|  PREDICTED: X-ray repair cross-complementing ...    103   5e-21    
gb|KFV00120.1|  X-ray repair cross-complementing protein 5              103   5e-21    
ref|XP_004417914.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    103   5e-21    
ref|XP_010582172.1|  PREDICTED: X-ray repair cross-complementing ...    103   5e-21    
ref|XP_004771288.1|  PREDICTED: X-ray repair cross-complementing ...    102   6e-21    
ref|XP_004771289.1|  PREDICTED: X-ray repair cross-complementing ...    102   6e-21    
gb|KFQ86621.1|  X-ray repair cross-complementing protein 5              102   6e-21    
ref|XP_010194547.1|  PREDICTED: X-ray repair cross-complementing ...    102   7e-21    
ref|XP_004771287.1|  PREDICTED: X-ray repair cross-complementing ...    102   7e-21    
ref|XP_005421932.1|  PREDICTED: X-ray repair cross-complementing ...    102   7e-21    
gb|KFQ11659.1|  X-ray repair cross-complementing protein 5              102   7e-21    
ref|XP_008572445.1|  PREDICTED: X-ray repair cross-complementing ...    102   7e-21    
ref|XP_009949739.1|  PREDICTED: X-ray repair cross-complementing ...    102   7e-21    
ref|XP_009487326.1|  PREDICTED: X-ray repair cross-complementing ...  99.8    8e-21    
gb|KFR08939.1|  X-ray repair cross-complementing protein 5              102   8e-21    
ref|XP_008701164.1|  PREDICTED: X-ray repair cross-complementing ...    102   8e-21    
gb|KFP27662.1|  X-ray repair cross-complementing protein 5              102   8e-21    
gb|KFQ64475.1|  X-ray repair cross-complementing protein 5            99.8    9e-21    
ref|XP_009473520.1|  PREDICTED: X-ray repair cross-complementing ...    102   9e-21    
ref|XP_005379417.1|  PREDICTED: X-ray repair cross-complementing ...    102   9e-21    
ref|XP_008634857.1|  PREDICTED: X-ray repair cross-complementing ...    102   9e-21    
ref|XP_010409219.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-20    
ref|XP_001378778.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-20    Monodelphis domestica
ref|XP_003202349.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-20    
ref|XP_010981805.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-20    
ref|XP_004675683.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-20    
ref|XP_006174761.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-20    
ref|XP_004610780.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-20    
ref|XP_008982115.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    102   1e-20    
ref|XP_006917436.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-20    
ref|XP_010958530.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-20    
gb|KFO61326.1|  X-ray repair cross-complementing protein 5              102   1e-20    
ref|XP_009438053.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    102   1e-20    
ref|XP_010222806.1|  PREDICTED: X-ray repair cross-complementing ...    102   1e-20    
ref|XP_009706116.1|  PREDICTED: X-ray repair cross-complementing ...    101   1e-20    
ref|XP_008051748.1|  PREDICTED: X-ray repair cross-complementing ...    101   1e-20    
gb|KGL84030.1|  X-ray repair cross-complementing protein 5              101   1e-20    
ref|XP_005302658.1|  PREDICTED: X-ray repair cross-complementing ...    101   1e-20    
ref|XP_006027712.1|  PREDICTED: X-ray repair cross-complementing ...    101   2e-20    
gb|EFB16518.1|  hypothetical protein PANDA_019481                       101   2e-20    Ailuropoda melanoleuca
ref|XP_002929325.1|  PREDICTED: x-ray repair cross-complementing ...    101   2e-20    
ref|XP_010281700.1|  PREDICTED: X-ray repair cross-complementing ...    101   2e-20    
ref|XP_010281702.1|  PREDICTED: X-ray repair cross-complementing ...    101   2e-20    
ref|XP_010281701.1|  PREDICTED: X-ray repair cross-complementing ...    101   2e-20    
gb|EFA79065.1|  ATP-dependent DNA helicase                              101   2e-20    Polysphondylium pallidum PN500
gb|KFH70399.1|  hypothetical protein MVEG_03249                         101   2e-20    
ref|XP_007053384.1|  PREDICTED: X-ray repair cross-complementing ...    101   2e-20    
gb|EMP41869.1|  X-ray repair cross-complementing protein 5              100   2e-20    
ref|XP_008929762.1|  PREDICTED: X-ray repair cross-complementing ...    100   3e-20    
ref|XP_004897785.1|  PREDICTED: X-ray repair cross-complementing ...    100   3e-20    
ref|XP_003470435.1|  PREDICTED: X-ray repair cross-complementing ...    100   3e-20    
ref|XP_008142789.1|  PREDICTED: X-ray repair cross-complementing ...    100   3e-20    
ref|XP_006098580.1|  PREDICTED: X-ray repair cross-complementing ...    100   3e-20    
ref|XP_005527726.1|  PREDICTED: X-ray repair cross-complementing ...    100   3e-20    
ref|XP_005354530.1|  PREDICTED: X-ray repair cross-complementing ...    100   3e-20    
ref|XP_005871421.1|  PREDICTED: X-ray repair cross-complementing ...    100   3e-20    
ref|XP_005237457.1|  PREDICTED: X-ray repair cross-complementing ...    100   4e-20    
ref|XP_005441334.1|  PREDICTED: X-ray repair cross-complementing ...    100   4e-20    
ref|XP_006776025.1|  PREDICTED: X-ray repair cross-complementing ...    100   4e-20    
ref|XP_009893581.1|  PREDICTED: X-ray repair cross-complementing ...  99.8    5e-20    
ref|XP_010137482.1|  PREDICTED: X-ray repair cross-complementing ...  99.8    6e-20    
gb|KGL88163.1|  X-ray repair cross-complementing protein 5            99.8    7e-20    
gb|KFO91633.1|  X-ray repair cross-complementing protein 5            99.8    7e-20    
ref|XP_009554911.1|  PREDICTED: X-ray repair cross-complementing ...  99.4    8e-20    
gb|KFZ62665.1|  X-ray repair cross-complementing protein 5            99.4    8e-20    
ref|XP_003221047.1|  PREDICTED: X-ray repair cross-complementing ...  99.0    1e-19    
ref|XP_009962451.1|  PREDICTED: X-ray repair cross-complementing ...  99.0    1e-19    
ref|XP_008108959.1|  PREDICTED: X-ray repair cross-complementing ...  99.0    1e-19    
gb|KFP10284.1|  X-ray repair cross-complementing protein 5            99.0    1e-19    
ref|XP_009646069.1|  PREDICTED: X-ray repair cross-complementing ...  99.0    1e-19    
gb|KFO73042.1|  X-ray repair cross-complementing protein 5            99.0    1e-19    
ref|XP_004650672.1|  PREDICTED: X-ray repair cross-complementing ...  99.0    1e-19    
gb|KFV42180.1|  X-ray repair cross-complementing protein 5            98.6    1e-19    
ref|XP_004700745.1|  PREDICTED: X-ray repair cross-complementing ...  98.6    2e-19    
ref|XP_010307235.1|  PREDICTED: X-ray repair cross-complementing ...  98.6    2e-19    
gb|KFO03651.1|  X-ray repair cross-complementing protein 5            98.2    2e-19    
ref|XP_009500118.1|  PREDICTED: X-ray repair cross-complementing ...  98.2    2e-19    
ref|XP_637925.1|  ATP-dependent DNA helicase                          99.0    2e-19    Dictyostelium discoideum AX4
gb|KFW89471.1|  X-ray repair cross-complementing protein 5            98.2    2e-19    
gb|KFU88661.1|  X-ray repair cross-complementing protein 5            98.2    2e-19    
ref|XP_008943375.1|  PREDICTED: X-ray repair cross-complementing ...  98.2    2e-19    
ref|XP_009663645.1|  PREDICTED: X-ray repair cross-complementing ...  98.2    2e-19    
gb|KFV75750.1|  X-ray repair cross-complementing protein 5            98.2    2e-19    
gb|KFQ34229.1|  X-ray repair cross-complementing protein 5            97.8    2e-19    
ref|XP_003388771.1|  PREDICTED: x-ray repair cross-complementing ...  97.8    2e-19    
ref|XP_010118849.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...  94.4    3e-19    
ref|XP_008495455.1|  PREDICTED: X-ray repair cross-complementing ...  97.4    4e-19    
ref|NP_956198.1|  X-ray repair cross-complementing protein 6          95.9    4e-19    
gb|KFO96069.1|  X-ray repair cross-complementing protein 5            97.4    4e-19    
ref|XP_010632759.1|  PREDICTED: X-ray repair cross-complementing ...  97.1    4e-19    
ref|XP_004642634.1|  PREDICTED: X-ray repair cross-complementing ...  97.1    4e-19    
ref|XP_010632758.1|  PREDICTED: X-ray repair cross-complementing ...  97.1    5e-19    
gb|EJY72241.1|  Ku P70 DNA helicase                                   97.4    5e-19    
ref|XP_004998089.1|  hypothetical protein PTSG_00622                  97.1    5e-19    
ref|XP_009304867.1|  PREDICTED: X-ray repair cross-complementing ...  97.1    5e-19    
ref|XP_007652975.1|  PREDICTED: X-ray repair cross-complementing ...  95.9    1e-18    
gb|ABI54461.1|  Ku70 autoantigen                                      95.9    1e-18    
gb|AAI54333.1|  Xrcc6 protein                                         95.9    1e-18    
ref|NP_001133439.1|  ATP-dependent DNA helicase 2 subunit 1           95.1    2e-18    
ref|XP_010828224.1|  PREDICTED: X-ray repair cross-complementing ...  94.7    3e-18    
ref|XP_009933283.1|  PREDICTED: X-ray repair cross-complementing ...  94.4    3e-18    
ref|XP_005150367.1|  PREDICTED: X-ray repair cross-complementing ...  94.4    4e-18    
ref|XP_006807338.1|  PREDICTED: X-ray repair cross-complementing ...  94.4    4e-18    
ref|XP_002117640.1|  hypothetical protein TRIADDRAFT_61626            94.4    5e-18    
ref|XP_005207441.1|  PREDICTED: X-ray repair cross-complementing ...  94.0    5e-18    
ref|XP_001641354.1|  predicted protein                                94.0    5e-18    
emb|CDW84185.1|  ku p70 dna helicase                                  94.4    5e-18    
ref|XP_004380027.1|  PREDICTED: X-ray repair cross-complementing ...  94.0    5e-18    
emb|CDQ86748.1|  unnamed protein product                              94.0    5e-18    
ref|XP_007259146.1|  PREDICTED: X-ray repair cross-complementing ...  94.0    5e-18    
ref|XP_004557656.1|  PREDICTED: X-ray repair cross-complementing ...  93.6    7e-18    
ref|NP_001005700.1|  X-ray repair complementing defective repair ...  93.6    8e-18    
ref|XP_003772300.1|  PREDICTED: X-ray repair cross-complementing ...  93.6    8e-18    
ref|XP_008701165.1|  PREDICTED: X-ray repair cross-complementing ...  93.2    1e-17    
ref|XP_002160929.2|  PREDICTED: X-ray repair cross-complementing ...  92.8    1e-17    
ref|NP_001082274.1|  X-ray repair complementing defective repair ...  92.8    1e-17    
dbj|BAA76953.1|  human Ku70 autoantigen homologue                     92.4    2e-17    
ref|XP_006636934.1|  PREDICTED: X-ray repair cross-complementing ...  91.3    2e-17    
ref|XP_003438750.1|  PREDICTED: X-ray repair cross-complementing ...  92.0    2e-17    
ref|XP_006520507.1|  PREDICTED: X-ray repair cross-complementing ...  92.0    3e-17    
gb|KFM74382.1|  X-ray repair cross-complementing protein 5            91.7    3e-17    
ref|XP_005379421.1|  PREDICTED: X-ray repair cross-complementing ...  91.7    3e-17    
ref|XP_006934181.1|  PREDICTED: X-ray repair cross-complementing ...  91.3    3e-17    
ref|XP_009288399.1|  PREDICTED: X-ray repair cross-complementing ...  91.3    4e-17    
ref|XP_005721839.1|  PREDICTED: X-ray repair cross-complementing ...  90.9    6e-17    
emb|CDQ80648.1|  unnamed protein product                              90.1    8e-17    
ref|XP_005809730.1|  PREDICTED: X-ray repair cross-complementing ...  90.1    1e-16    
ref|XP_009084798.1|  PREDICTED: X-ray repair cross-complementing ...  90.1    1e-16    
gb|KFM02204.1|  X-ray repair cross-complementing protein 5            89.7    1e-16    
ref|XP_008313041.1|  PREDICTED: X-ray repair cross-complementing ...  89.7    1e-16    
gb|ELU12174.1|  hypothetical protein CAPTEDRAFT_158558                89.4    2e-16    
ref|XP_007099960.1|  PREDICTED: X-ray repair cross-complementing ...  89.0    2e-16    
gb|EHB08570.1|  ATP-dependent DNA helicase 2 subunit 1                87.4    2e-16    
ref|XP_008436124.1|  PREDICTED: X-ray repair cross-complementing ...  89.0    2e-16    
ref|XP_008436123.1|  PREDICTED: X-ray repair cross-complementing ...  89.0    2e-16    
ref|XP_009994664.1|  PREDICTED: X-ray repair cross-complementing ...  88.6    3e-16    
gb|EPZ36969.1|  Ku70/Ku80 beta-barrel domain-containing protein       87.8    3e-16    
gb|AFW70425.1|  putative protein phosphatase 2C family protein        89.0    3e-16    
ref|XP_008304591.1|  PREDICTED: X-ray repair cross-complementing ...  88.6    4e-16    
ref|XP_004279585.1|  PREDICTED: X-ray repair cross-complementing ...  88.2    4e-16    
ref|XP_001470738.1|  ku P70 DNA helicase                              88.2    4e-16    
ref|XP_007454028.1|  PREDICTED: X-ray repair cross-complementing ...  87.8    5e-16    
ref|XP_008436121.1|  PREDICTED: X-ray repair cross-complementing ...  88.6    6e-16    
ref|XP_008436122.1|  PREDICTED: X-ray repair cross-complementing ...  88.2    6e-16    
ref|XP_010893805.1|  PREDICTED: X-ray repair cross-complementing ...  87.8    6e-16    
ref|XP_009913229.1|  PREDICTED: X-ray repair cross-complementing ...  87.4    6e-16    
ref|XP_007079520.1|  PREDICTED: X-ray repair cross-complementing ...  87.4    6e-16    
gb|KFP93686.1|  X-ray repair cross-complementing protein 5            87.4    7e-16    
ref|XP_007559986.1|  PREDICTED: X-ray repair cross-complementing ...  87.4    8e-16    
ref|XP_008965672.1|  PREDICTED: X-ray repair cross-complementing ...  87.0    1e-15    
ref|XP_001515249.3|  PREDICTED: X-ray repair cross-complementing ...  83.2    1e-15    
ref|XP_009022335.1|  hypothetical protein HELRODRAFT_192857           86.7    1e-15    
dbj|BAG56943.1|  unnamed protein product                              86.7    1e-15    
emb|CBN81200.1|  ATP-dependent DNA helicase 2 subunit 1               86.7    1e-15    
ref|XP_009975710.1|  PREDICTED: X-ray repair cross-complementing ...  86.7    1e-15    
ref|NP_001275907.1|  X-ray repair cross-complementing protein 6 i...  86.3    2e-15    
gb|KFU99358.1|  X-ray repair cross-complementing protein 5            86.3    2e-15    
ref|XP_005028528.1|  PREDICTED: X-ray repair cross-complementing ...  85.9    2e-15    
ref|XP_001105684.1|  PREDICTED: x-ray repair cross-complementing ...  85.9    2e-15    
ref|XP_006866983.1|  PREDICTED: X-ray repair cross-complementing ...  85.9    2e-15    
ref|XP_004063588.1|  PREDICTED: X-ray repair cross-complementing ...  85.9    2e-15    
ref|XP_010597605.1|  PREDICTED: X-ray repair cross-complementing ...  85.9    2e-15    
ref|XP_010169082.1|  PREDICTED: X-ray repair cross-complementing ...  85.5    3e-15    
gb|KFZ45504.1|  X-ray repair cross-complementing protein 5            85.5    3e-15    
gb|ELK07970.1|  ATP-dependent DNA helicase 2 subunit 1                85.1    3e-15    
ref|XP_010729053.1|  PREDICTED: X-ray repair cross-complementing ...  85.1    4e-15    
gb|EHH64886.1|  hypothetical protein EGM_18216                        84.0    4e-15    
gb|EPB83836.1|  hypothetical protein HMPREF1544_09410                 84.3    6e-15    
ref|XP_010828229.1|  PREDICTED: X-ray repair cross-complementing ...  84.3    7e-15    
ref|XP_005938093.1|  PREDICTED: X-ray repair cross-complementing ...  84.0    9e-15    
ref|XP_003783204.1|  PREDICTED: X-ray repair cross-complementing ...  84.0    1e-14    
gb|EKV12387.1|  Ku seventy                                            84.0    1e-14    
gb|KGO77952.1|  DNA helicase, ATP-dependent, Ku type                  83.2    2e-14    
ref|XP_002565468.1|  Pc22g15510                                       83.2    2e-14    
ref|XP_003961577.1|  PREDICTED: X-ray repair cross-complementing ...  82.8    2e-14    
ref|XP_007961776.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...  82.8    2e-14    
ref|XP_009171238.1|  hypothetical protein T265_07445                  83.2    2e-14    
gb|KGO36073.1|  DNA helicase, ATP-dependent, Ku type                  82.8    3e-14    
gb|EHH19233.1|  hypothetical protein EGK_19907                        81.3    3e-14    
ref|XP_004034800.1|  ku p70 DNA helicase, putative                    82.0    4e-14    
gb|EXX50577.1|  Yku70p                                                81.6    5e-14    
gb|ERZ97177.1|  hypothetical protein GLOINDRAFT_296472                81.6    6e-14    
emb|CEJ02097.1|  hypothetical protein RMCBS344292_16114               81.6    6e-14    
ref|XP_005647185.1|  ATP-dependent DNA helicase ii                    80.1    2e-13    
dbj|GAA29239.2|  acylaminoacyl-peptidase                              80.5    2e-13    
gb|EIE80179.1|  hypothetical protein RO3G_04884                       79.7    2e-13    
gb|KFX90867.1|  hypothetical protein O988_07988                       79.0    4e-13    
gb|KFY47715.1|  hypothetical protein V495_01838                       79.0    4e-13    
emb|CAG04519.1|  unnamed protein product                              79.0    4e-13    
ref|XP_008436125.1|  PREDICTED: X-ray repair cross-complementing ...  79.0    4e-13    
gb|KFX94811.1|  hypothetical protein V490_04152                       78.6    5e-13    
gb|KFY65608.1|  hypothetical protein V497_01354                       78.6    6e-13    
ref|XP_001216976.1|  hypothetical protein ATEG_08355                  78.6    6e-13    
ref|XP_001803226.1|  hypothetical protein SNOG_13012                  78.2    7e-13    
sp|Q0U5F2.1|KU70_PHANO  RecName: Full=ATP-dependent DNA helicase ...  78.2    8e-13    
gb|EFX89553.1|  hypothetical protein DAPPUDRAFT_40467                 77.0    2e-12    
gb|ADQ73897.1|  DNA-dependent protein kinase                          77.4    2e-12    
gb|KDR17626.1|  ATP-dependent DNA helicase 2 subunit 1                77.0    2e-12    
ref|XP_001259909.1|  DSB repair complex subunit Ku70, putative        76.6    2e-12    
gb|AIA61437.1|  Ku70                                                  76.6    3e-12    
ref|XP_007726562.1|  ATP-dependent DNA helicase 2 subunit 1           76.6    3e-12    
dbj|GAA90526.1|  DSB repair complex subunit Ku70                      76.3    3e-12    
gb|KFY90800.1|  hypothetical protein V498_05826                       76.3    3e-12    
emb|CEJ00114.1|  hypothetical protein RMCBS344292_14180               75.9    4e-12    
emb|CEG68343.1|  hypothetical protein RMATCC62417_04626               75.9    4e-12    
ref|XP_004346782.1|  ATP-dependent DNA helicase II 70 kDa subunit     75.9    5e-12    
gb|KFZ15984.1|  hypothetical protein V502_05300                       75.9    5e-12    
gb|EFW47153.2|  ATP-dependent DNA helicase II 70 kDa subunit          75.9    5e-12    
gb|KFY87080.1|  hypothetical protein V500_07193                       75.9    5e-12    
emb|CDM35978.1|  ATP-dependent DNA helicase II subunit 1              75.5    6e-12    
gb|KEY78844.1|  DSB repair complex subunit Ku70                       75.5    6e-12    
ref|XP_001396808.2|  ATP-dependent DNA helicase II subunit 1          75.1    7e-12    
gb|ENH83415.1|  ku70 protein                                          75.1    7e-12    
gb|KFY62534.1|  hypothetical protein V496_04539                       75.1    9e-12    
emb|CEG76588.1|  hypothetical protein RMATCC62417_11468               74.3    1e-11    
ref|XP_001941106.1|  Ku domain containing protein Pku70               74.7    1e-11    
gb|ABN13872.1|  Ku seventy                                            74.7    1e-11    
ref|XP_003840776.1|  similar to TPA: ATP-dependent DNA helicase I...  74.7    1e-11    
ref|XP_009157528.1|  ATP-dependent DNA helicase 2 subunit 1           74.7    1e-11    
emb|CDH57952.1|  dsb repair complex subunit                           74.3    2e-11    
gb|EWC46835.1|  hypothetical protein DRE_03847                        73.9    2e-11    
gb|ADC34633.1|  DSB repair complex subunit Ku70                       73.9    2e-11    
gb|ACI15997.1|  KU70 protein                                          73.9    2e-11    
gb|ELR03492.1|  hypothetical protein GMDG_01243                       73.6    2e-11    
sp|Q2MHH3.1|KU70_ASPSO  RecName: Full=ATP-dependent DNA helicase ...  73.6    3e-11    
gb|EHA24615.1|  hypothetical protein ASPNIDRAFT_48713                 73.6    3e-11    
ref|XP_003300810.1|  hypothetical protein PTT_12162                   73.2    3e-11    
gb|AGF90043.1|  ATP-dependent DNA helicase II 70 kDa subunit          73.2    4e-11    
gb|EQL29559.1|  ATP-dependent DNA helicase II subunit 1               72.8    5e-11    
ref|XP_753862.1|  DSB repair complex subunit Ku70                     72.8    5e-11    
gb|EDP51518.1|  DSB repair complex subunit Ku70, putative             72.8    5e-11    
gb|EEQ86026.1|  protein Ku70                                          72.8    5e-11    
ref|XP_001699098.1|  DNA binding protein                              72.4    6e-11    
ref|XP_003190337.1|  ATP-dependent DNA helicase II subunit 1          72.0    9e-11    
gb|KEQ66872.1|  Ku70/Ku80 beta-barrel domain-containing protein       72.0    9e-11    
gb|KFZ07417.1|  hypothetical protein V501_06475                       71.6    1e-10    
ref|XP_002378891.1|  DSB repair complex subunit Ku70, putative        71.6    1e-10    
ref|XP_002621072.1|  DSB repair complex subunit Ku70                  71.6    1e-10    
ref|XP_004351630.1|  ATPdependent DNA helicase ii, 70 kDa subunit...  71.2    1e-10    
gb|EUN28329.1|  hypothetical protein COCVIDRAFT_25642                 71.2    1e-10    
dbj|BAI58987.1|  Ku70 protein                                         71.2    1e-10    
emb|CCG80791.1|  putative DSB repair complex subunit Ku70             71.2    2e-10    
gb|KEQ89492.1|  ATP-dependent DNA helicase-like protein II subunit 1  71.2    2e-10    
gb|KFY73542.1|  hypothetical protein V499_06363                       71.2    2e-10    
ref|XP_007700608.1|  hypothetical protein COCSADRAFT_190760           71.2    2e-10    
dbj|GAD97375.1|  DSB repair complex subunit Ku70, putative            70.9    2e-10    
gb|ENH99789.1|  hypothetical protein COCC4DRAFT_207184                70.5    3e-10    
ref|XP_001274275.1|  DSB repair complex subunit Ku70, putative        70.5    3e-10    
ref|XP_001440829.1|  hypothetical protein                             70.5    3e-10    
gb|EMD85824.1|  hypothetical protein COCHEDRAFT_1198766               70.5    3e-10    
ref|XP_010758090.1|  ATP-dependent DNA helicase II subunit 1          70.5    3e-10    
sp|Q1DU75.2|KU70_COCIM  RecName: Full=ATP-dependent DNA helicase ...  70.1    3e-10    
ref|XP_001242242.1|  hypothetical protein CIMG_06138                  70.1    3e-10    
gb|EEH17728.1|  ATP-dependent DNA helicase II subunit 1               70.1    4e-10    
ref|XP_007295736.1|  putative ATP-dependent DNA helicase II subun...  70.1    4e-10    
ref|XP_009823832.1|  hypothetical protein H257_02043                  69.7    4e-10    
ref|XP_006811758.1|  PREDICTED: X-ray repair cross-complementing ...  69.3    5e-10    
ref|XP_001433343.1|  hypothetical protein                             69.3    6e-10    
gb|KDD74890.1|  hypothetical protein H632_c1007p1                     68.9    6e-10    
gb|EEH39500.2|  ATP-dependent DNA helicase 2 subunit 1                69.3    7e-10    
ref|XP_006682855.1|  hypothetical protein BATDEDRAFT_36232            69.3    7e-10    
ref|XP_010016425.1|  PREDICTED: X-ray repair cross-complementing ...  68.9    8e-10    
ref|XP_002789304.1|  ATP-dependent DNA helicase 2 subunit 1           68.9    9e-10    
gb|ADV35594.1|  X-ray repair complementing defective repair 6         68.6    1e-09    
gb|KFX45694.1|  ATP-dependent DNA helicase II subunit 1               68.6    1e-09    
gb|EGC44870.1|  Ku70 protein                                          68.6    1e-09    
ref|XP_007709946.1|  hypothetical protein COCCADRAFT_90040            68.6    1e-09    
ref|XP_007685520.1|  hypothetical protein COCMIDRAFT_88717            68.6    1e-09    
ref|XP_007274178.1|  ku70 protein                                     68.6    1e-09    
gb|EYE93061.1|  putative DSB repair complex subunit Ku70              68.2    2e-09    
gb|KEZ41281.1|  ATP-dependent DNA helicase II subunit 1               68.2    2e-09    
ref|XP_002145509.1|  DSB repair complex subunit Ku70, putative        68.2    2e-09    
gb|EQB55167.1|  ATP-dependent DNA helicase II                         68.2    2e-09    
ref|XP_007596203.1|  ATP-dependent DNA helicase II                    68.2    2e-09    
ref|XP_008078143.1|  SPOC                                             68.2    2e-09    
ref|XP_007454027.1|  PREDICTED: X-ray repair cross-complementing ...  67.8    2e-09    
gb|EGE07188.1|  Ku70 protein                                          67.8    2e-09    
gb|EZF33565.1|  ATP-dependent DNA helicase II subunit 1               67.8    2e-09    
gb|EGD99025.1|  Ku70/Ku80 beta-barrel domain-containing protein       67.8    2e-09    
ref|XP_003233849.1|  Ku70/Ku80 beta-barrel domain-containing protein  67.8    2e-09    
ref|XP_003653227.1|  hypothetical protein THITE_2115421               67.8    2e-09    
emb|CEG01580.1|  von Willebrand factor, type A                        67.8    2e-09    
gb|EZF24225.1|  ATP-dependent DNA helicase II subunit 1               66.6    2e-09    
ref|NP_001275906.1|  X-ray repair cross-complementing protein 6 i...  67.8    2e-09    
ref|XP_003015785.1|  hypothetical protein ARB_06096                   67.4    3e-09    
ref|XP_004063589.1|  PREDICTED: X-ray repair cross-complementing ...  67.4    3e-09    
ref|XP_001596497.1|  hypothetical protein SS1G_02717                  67.4    3e-09    
gb|EER36607.1|  Ku70                                                  67.4    3e-09    
ref|XP_009900755.1|  PREDICTED: X-ray repair cross-complementing ...  67.4    3e-09    
ref|XP_007342158.1|  Ku DNA-binding complex, Ku70 subunit             67.0    4e-09    
ref|XP_009473521.1|  PREDICTED: X-ray repair cross-complementing ...  67.0    4e-09    
emb|CDS32276.1|  x ray repair cross complementing protein 6           67.0    5e-09    
ref|XP_002849435.1|  conserved hypothetical protein                   66.6    5e-09    
gb|ELW66080.1|  X-ray repair cross-complementing protein 6            66.6    5e-09    
ref|XP_007736471.1|  ATP-dependent DNA helicase 2 subunit 1           66.6    5e-09    
gb|EEH10394.1|  conserved hypothetical protein                        66.6    5e-09    
gb|EXK35267.1|  ATP-dependent DNA helicase II subunit 1               66.6    5e-09    
ref|XP_004327212.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...  66.6    6e-09    
ref|XP_003025556.1|  hypothetical protein TRV_00318                   66.2    7e-09    
gb|KEF60559.1|  ATP-dependent DNA helicase 2 subunit 1                66.2    7e-09    



>ref|XP_006364703.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like, partial 
[Solanum tuberosum]
Length=425

 Score =   420 bits (1079),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 200/238 (84%), Positives = 222/238 (93%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EF++ERDA KELLVYLVDASPKMFSTT P +DEK A+HF+VA+N IAQSLRTQIINRSY
Sbjct  20   NEFFKERDAIKELLVYLVDASPKMFSTTCPTDDEKTATHFQVAINSIAQSLRTQIINRSY  79

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEV+ICF+NTREKKNLQDL+ VYV+NVPER+DLDRPTARLIKEFD IE+RF KEIGSKYG
Sbjct  80   DEVSICFFNTREKKNLQDLSGVYVFNVPEREDLDRPTARLIKEFDQIEERFEKEIGSKYG  139

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I PGSR+NSLY+ALWVAQALLRKGSAKTADKRILL TNEDDPFG +KGVIK DMMRTT Q
Sbjct  140  IVPGSRENSLYNALWVAQALLRKGSAKTADKRILLLTNEDDPFGNLKGVIKVDMMRTTMQ  199

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGI+IELLPLSRPD+EFNVS+FYA++LGLE D+L QFKALIGERFEDL DQ
Sbjct  200  RAKDAQDLGITIELLPLSRPDDEFNVSLFYADLLGLEGDDLAQFKALIGERFEDLNDQ  257



>ref|XP_009778729.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X1 [Nicotiana sylvestris]
Length=624

 Score =   425 bits (1093),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 201/238 (84%), Positives = 224/238 (94%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFY+ERDATKELLVYLVDASPKMFSTT P +DEK A+HF++++NCIAQSLRTQIINRSY
Sbjct  20   SEFYKERDATKELLVYLVDASPKMFSTTCPTDDEKTATHFQLSINCIAQSLRTQIINRSY  79

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDL+ VYV+NVPER+DLDRPTARLIKEFD IE+RF KEIGSKYG
Sbjct  80   DEVAICFFNTREKKNLQDLSGVYVFNVPEREDLDRPTARLIKEFDRIEERFDKEIGSKYG  139

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I PGSR+NSLY+ALWVAQALLRKGSAK ADKR+LLFTNEDDPFG +KGVIK DMMRTT Q
Sbjct  140  IVPGSRENSLYNALWVAQALLRKGSAKIADKRMLLFTNEDDPFGNLKGVIKVDMMRTTLQ  199

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGI+IELLPLSRPD+EFNVS+FY ++LGLE D+L QFKAL+GERFEDLKDQ
Sbjct  200  RAKDAQDLGIAIELLPLSRPDDEFNVSLFYTDLLGLEGDDLAQFKALVGERFEDLKDQ  257



>ref|XP_009613929.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X1 [Nicotiana tomentosiformis]
Length=624

 Score =   421 bits (1082),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 199/238 (84%), Positives = 224/238 (94%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFY+ERDATKELLVYLVDASPKMFSTT P +D+K A+HF++++NCIAQSLRTQIINRSY
Sbjct  20   SEFYKERDATKELLVYLVDASPKMFSTTCPTDDDKTATHFQLSINCIAQSLRTQIINRSY  79

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDL+ VYV+NVPER+DLDRPTARLIKEFD IE+ F KEIGSKYG
Sbjct  80   DEVAICFFNTREKKNLQDLSGVYVFNVPEREDLDRPTARLIKEFDRIEEIFDKEIGSKYG  139

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I PGSR+NSLY+ALWVAQALLRKGSAKTADKR+LLFTNEDDPFG +KGVIK DMMRTT Q
Sbjct  140  IVPGSRENSLYNALWVAQALLRKGSAKTADKRMLLFTNEDDPFGNLKGVIKVDMMRTTLQ  199

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGI+IELLPLSRPD++FNVS+FY ++LGLE D+L QFKAL+GERFEDLKDQ
Sbjct  200  RAKDAQDLGIAIELLPLSRPDDDFNVSLFYTDLLGLEGDDLAQFKALVGERFEDLKDQ  257



>ref|XP_011073828.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X2 [Sesamum indicum]
Length=627

 Score =   410 bits (1055),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 218/237 (92%), Gaps = 0/237 (0%)
 Frame = -1

Query  711  EFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYD  532
            EF+QERDATKE+LVYLVDASPKMFSTT P+ED+K+ SHF++AV  IAQSL+TQIINRSYD
Sbjct  18   EFHQERDATKEMLVYLVDASPKMFSTTFPSEDQKDVSHFQIAVRSIAQSLKTQIINRSYD  77

Query  531  EVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGI  352
            EVAICF+NTREKKNLQDLN VYV+NVPER+DLDRPTARLIKEFD IE+ F K+IGSKYGI
Sbjct  78   EVAICFFNTREKKNLQDLNGVYVFNVPEREDLDRPTARLIKEFDRIEESFDKQIGSKYGI  137

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
             PG+RDNSLY+A W AQA+LRKGSAKTADKRILLFTNEDDPFG +KGV K DMMRTT QR
Sbjct  138  LPGTRDNSLYNAFWAAQAILRKGSAKTADKRILLFTNEDDPFGNMKGVTKMDMMRTTLQR  197

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AKDAQDLGI IELLPLSRPDE+FN+S FYAE+LGLE ++L +FKALIGERFED+KDQ
Sbjct  198  AKDAQDLGILIELLPLSRPDEDFNMSTFYAELLGLEGNDLAEFKALIGERFEDMKDQ  254



>ref|XP_011073827.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X1 [Sesamum indicum]
Length=631

 Score =   410 bits (1055),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 218/237 (92%), Gaps = 0/237 (0%)
 Frame = -1

Query  711  EFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYD  532
            EF+QERDATKE+LVYLVDASPKMFSTT P+ED+K+ SHF++AV  IAQSL+TQIINRSYD
Sbjct  18   EFHQERDATKEMLVYLVDASPKMFSTTFPSEDQKDVSHFQIAVRSIAQSLKTQIINRSYD  77

Query  531  EVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGI  352
            EVAICF+NTREKKNLQDLN VYV+NVPER+DLDRPTARLIKEFD IE+ F K+IGSKYGI
Sbjct  78   EVAICFFNTREKKNLQDLNGVYVFNVPEREDLDRPTARLIKEFDRIEESFDKQIGSKYGI  137

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
             PG+RDNSLY+A W AQA+LRKGSAKTADKRILLFTNEDDPFG +KGV K DMMRTT QR
Sbjct  138  LPGTRDNSLYNAFWAAQAILRKGSAKTADKRILLFTNEDDPFGNMKGVTKMDMMRTTLQR  197

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AKDAQDLGI IELLPLSRPDE+FN+S FYAE+LGLE ++L +FKALIGERFED+KDQ
Sbjct  198  AKDAQDLGILIELLPLSRPDEDFNMSTFYAELLGLEGNDLAEFKALIGERFEDMKDQ  254



>ref|XP_004247997.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Solanum 
lycopersicum]
Length=624

 Score =   409 bits (1051),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 197/238 (83%), Positives = 219/238 (92%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EF++ERD TKE LVYLVDASPKMFS+T P +DEK A+HF+VAV+ IAQSLRTQIINRSY
Sbjct  20   NEFFKERDNTKEFLVYLVDASPKMFSSTCPTDDEKIATHFQVAVSSIAQSLRTQIINRSY  79

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEV+ICF+NTR KKNLQDL+ VYV+NV ER+DLDRPTARLIKEFD IE+RF KEIGSKYG
Sbjct  80   DEVSICFFNTRGKKNLQDLSGVYVFNVREREDLDRPTARLIKEFDQIEERFEKEIGSKYG  139

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I PGSRDNSLY+ALWVAQALLRKGSAKTADKRILL TNEDDPFG +KGVIK DMMRTT Q
Sbjct  140  IVPGSRDNSLYNALWVAQALLRKGSAKTADKRILLLTNEDDPFGNLKGVIKVDMMRTTMQ  199

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGI+IELLPLSRPD+EFNVS+FYA++LGLE D+L QFKALIGERFEDL DQ
Sbjct  200  RAKDAQDLGITIELLPLSRPDDEFNVSLFYADLLGLEGDDLAQFKALIGERFEDLNDQ  257



>gb|EYU32731.1| hypothetical protein MIMGU_mgv1a002945mg [Erythranthe guttata]
Length=623

 Score =   391 bits (1005),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/238 (79%), Positives = 211/238 (89%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EFYQE+DATKELLVYLVDASPKMFSTT  +E+EK+ +HF+VAV  IAQSL+TQIINRSY
Sbjct  17   NEFYQEKDATKELLVYLVDASPKMFSTTCTSEEEKDVTHFQVAVRSIAQSLKTQIINRSY  76

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NT EKKNLQD N VYV+NVPER+DLDRPTARL+KEFD IE+ FSK IGSKYG
Sbjct  77   DEVAICFFNTSEKKNLQDSNGVYVFNVPEREDLDRPTARLVKEFDCIEETFSKRIGSKYG  136

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I   SRDNSLY+ALW AQALLRKGSAKTADKRILLFTNEDDPFG IKGV K DMMRTT Q
Sbjct  137  ILSASRDNSLYNALWAAQALLRKGSAKTADKRILLFTNEDDPFGNIKGVTKMDMMRTTLQ  196

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKD QDLGISIELLPLSRP E+FN+S FYA++LGLE +EL +FKAL+ ER  D+KDQ
Sbjct  197  RAKDTQDLGISIELLPLSRPGEDFNISTFYADLLGLEGNELAEFKALVEERLGDMKDQ  254



>emb|CDP19615.1| unnamed protein product [Coffea canephora]
Length=627

 Score =   387 bits (994),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 185/238 (78%), Positives = 213/238 (89%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEF+Q RD+TKEL+VYLVDASPKMFST+ P+ED K+ S F  A++CI +SL+TQIINRSY
Sbjct  18   SEFHQGRDSTKELVVYLVDASPKMFSTSCPSEDAKDGSLFHAAMSCILESLKTQIINRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDLN VYV+NV ER+DLDRPTARLIKEF+ IE++F  +IGSKYG
Sbjct  78   DEVAICFFNTREKKNLQDLNGVYVFNVAEREDLDRPTARLIKEFECIEEKFDNDIGSKYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSRDNSLYSALWVAQALLRKGSAKTADKR+LL TNEDDPFG IKG+ K DM+RTT Q
Sbjct  138  ILSGSRDNSLYSALWVAQALLRKGSAKTADKRMLLLTNEDDPFGSIKGITKMDMLRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLSR ++EFNVS+FYAE+LGLE DEL QF+AL GER +D+K+Q
Sbjct  198  RAKDAQDLGISIELLPLSRRNDEFNVSLFYAELLGLEGDELTQFQALAGERLKDMKEQ  255



>dbj|BAF03493.1| Ku70 homolog [Populus nigra]
Length=627

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 215/238 (90%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFYQ+R+++KE +VYLVDASPKMFS+T P+ED KE +HF++A++CIAQSL+TQIINRSY
Sbjct  18   SEFYQQRESSKEFVVYLVDASPKMFSSTCPSEDGKEETHFQIAISCIAQSLKTQIINRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDLN  +V+NV ER+ LDRPTARLIK+FD IE+ F+K+IGS+YG
Sbjct  78   DEVAICFFNTREKKNLQDLNGAFVFNVAEREYLDRPTARLIKDFDCIEESFTKDIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALW+AQALLRKGSAKTADKRILLFTNEDDPFG IKGV KADM RTT Q
Sbjct  138  IVSGSRENSLYNALWIAQALLRKGSAKTADKRILLFTNEDDPFGSIKGVAKADMTRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS+PDEEFNVS+FY++++GLE DEL QF    G++ +D+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSQPDEEFNVSLFYSDLIGLEGDELAQFMPSAGQKLQDMKDQ  255



>gb|KDO44369.1| hypothetical protein CISIN_1g0069751mg, partial [Citrus sinensis]
Length=423

 Score =   379 bits (972),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 205/238 (86%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EFYQE +ATKE +VYLVDASPKMFSTT PAED+ + +HF +AV+CIAQSL+TQIINR Y
Sbjct  18   NEFYQEHEATKEYVVYLVDASPKMFSTTCPAEDQTDETHFHIAVSCIAQSLKTQIINRLY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTR+KKNLQDLN V+V+NV ER+ LDRPTAR IKEFDHIE+ F KEIGS+YG
Sbjct  78   DEVAICFFNTRKKKNLQDLNAVFVFNVAEREQLDRPTARFIKEFDHIEESFEKEIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQ LLRKGS+KTADKRILLFTNEDDPFG IKG  K DM RTT Q
Sbjct  138  IVSGSRENSLYNALWVAQGLLRKGSSKTADKRILLFTNEDDPFGSIKGAAKNDMTRTTMQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS PDEEF VS FYA+M+GLE D+L  F    G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSPPDEEFKVSHFYADMIGLEGDDLALFMPSAGQKLEDMKDQ  255



>ref|XP_002317447.2| Ku70-like family protein [Populus trichocarpa]
 gb|EEE98059.2| Ku70-like family protein [Populus trichocarpa]
Length=628

 Score =   385 bits (989),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 214/238 (90%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFYQ+R+++KE +VYLVDASPKMFS+T P+ED KE +HF +A++CIAQSL+TQIINRSY
Sbjct  18   SEFYQQRESSKEFVVYLVDASPKMFSSTCPSEDGKEETHFHIAISCIAQSLKTQIINRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDLN  +V+NV ER+ LDRPTARLIK+FD IE+ F+K+IGS+YG
Sbjct  78   DEVAICFFNTREKKNLQDLNGAFVFNVAEREYLDRPTARLIKDFDCIEESFTKDIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALW+AQALLRKGSAKTADKRILLFTNEDDPFG IKGV KADM RTT Q
Sbjct  138  IVSGSRENSLYNALWIAQALLRKGSAKTADKRILLFTNEDDPFGSIKGVAKADMTRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS+PDEEFNVS+FY++++GLE DEL QF    G++ +D+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSQPDEEFNVSLFYSDLIGLEGDELAQFMPSAGQKLQDMKDQ  255



>ref|XP_011044051.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Populus 
euphratica]
Length=627

 Score =   382 bits (982),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 213/238 (89%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFYQ+R+++KE +VYLVDASPKMFS+T P+ED KE +HF +A++CIAQSL+TQIINRSY
Sbjct  18   SEFYQQRESSKEFVVYLVDASPKMFSSTCPSEDGKEETHFHIAISCIAQSLKTQIINRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDLN  +V+NV ER+ LDRPTARLIK+FD IE+ F+K+IGS+YG
Sbjct  78   DEVAICFFNTREKKNLQDLNGAFVFNVAEREYLDRPTARLIKDFDCIEESFTKDIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALW+AQALLRKGSAKTADKRILLFTN+DDPFG IKGV KADM RTT Q
Sbjct  138  IVSGSRENSLYNALWIAQALLRKGSAKTADKRILLFTNKDDPFGSIKGVAKADMTRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPL +PDEEFNVS+FY++++GLE DEL QF    G++ +D+KDQ
Sbjct  198  RAKDAQDLGISIELLPLCQPDEEFNVSLFYSDLIGLEGDELAQFMPSAGQKLQDMKDQ  255



>ref|XP_010103927.1| hypothetical protein L484_012012 [Morus notabilis]
 gb|EXB97444.1| hypothetical protein L484_012012 [Morus notabilis]
Length=339

 Score =   372 bits (955),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 210/238 (88%), Gaps = 1/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EFY E++ATKEL VYLVDASPKMFS+TSP ED K+ +HF+VA++CI+QSL+TQIINRSY
Sbjct  19   NEFY-EKEATKELAVYLVDASPKMFSSTSPNEDGKDETHFDVALSCISQSLKTQIINRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDLN VY++NV +RD LDRPTARLIKEFD IE+ F+KEIGSKYG
Sbjct  78   DEVAICFFNTREKKNLQDLNGVYLFNVADRDYLDRPTARLIKEFDLIEESFTKEIGSKYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQALLRKGS KTA KR+LLFTNEDDPFG  KG  K DM+RTT Q
Sbjct  138  IVSGSRENSLYNALWVAQALLRKGSVKTACKRMLLFTNEDDPFGSFKGASKIDMIRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDA+DLGISIELLPL RP+EEFNVS+FYA+++GLE DEL QF    GE+ ED+KDQ
Sbjct  198  RAKDARDLGISIELLPLGRPEEEFNVSLFYADLIGLEGDELAQFIPSAGEKLEDMKDQ  255



>gb|KDP46042.1| hypothetical protein JCGZ_13488 [Jatropha curcas]
Length=627

 Score =   382 bits (980),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 211/238 (89%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFYQ+R+ +KE +VYLVDASPKMFSTT P ED+KE +HF +AV+CI+QSL+TQIINRSY
Sbjct  18   SEFYQQRETSKEFVVYLVDASPKMFSTTCPGEDQKEETHFHIAVSCISQSLKTQIINRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAI F+NTR+K+NLQDL+ V+V+NV ER+ LDRPTARLIK+FD IE+ F KEIGS+YG
Sbjct  78   DEVAIVFFNTRQKRNLQDLSGVFVFNVAEREYLDRPTARLIKDFDCIEESFLKEIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQA+LRKGSAKTADKRILLFTNEDDPFG +KG  K DM RTT Q
Sbjct  138  IVSGSRENSLYNALWVAQAILRKGSAKTADKRILLFTNEDDPFGSMKGAAKTDMTRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLSRPDEEFNVS+FYAE++GL  D++DQF  L G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSRPDEEFNVSLFYAELIGLGGDDVDQFMPLAGQKLEDMKDQ  255



>ref|XP_006442384.1| hypothetical protein CICLE_v10019318mg [Citrus clementina]
 gb|ESR55624.1| hypothetical protein CICLE_v10019318mg [Citrus clementina]
Length=623

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 205/238 (86%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EFYQE +ATKE +VYLVDASPKMFSTT PAED+ + +HF +AV+CIAQSL+TQIINR Y
Sbjct  18   NEFYQEHEATKEYVVYLVDASPKMFSTTCPAEDQTDETHFHIAVSCIAQSLKTQIINRLY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTR+KKNLQDLN V+V+NV ER+ LDRPTAR IKEFDHIE+ F KEIGS+YG
Sbjct  78   DEVAICFFNTRKKKNLQDLNAVFVFNVAEREQLDRPTARFIKEFDHIEESFEKEIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQ LLRKGS+KTADKRILLFTNEDDPFG IKG  K DM RTT Q
Sbjct  138  IVSGSRENSLYNALWVAQGLLRKGSSKTADKRILLFTNEDDPFGSIKGAAKNDMTRTTMQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS PDEEF VS FYA+M+GLE D+L  F    G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSPPDEEFKVSHFYADMIGLEGDDLALFMPSAGQKLEDMKDQ  255



>ref|XP_006477846.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like [Citrus 
sinensis]
Length=623

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 205/238 (86%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EFYQE +ATKE +VYLVDASPKMFSTT PAED+ + +HF +AV+CIAQSL+TQIINR Y
Sbjct  18   NEFYQEHEATKEYVVYLVDASPKMFSTTCPAEDQTDETHFHIAVSCIAQSLKTQIINRLY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTR+KKNLQDLN V+V+NV ER+ LDRPTAR IKEFDHIE+ F KEIGS+YG
Sbjct  78   DEVAICFFNTRKKKNLQDLNGVFVFNVAEREQLDRPTARFIKEFDHIEESFEKEIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQ LLRKGS+KTADKRILLFTNEDDPFG IKG  K DM RTT Q
Sbjct  138  IVSGSRENSLYNALWVAQGLLRKGSSKTADKRILLFTNEDDPFGSIKGAAKNDMTRTTMQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS PDEEF VS FYA+M+GLE D+L  F    G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSPPDEEFKVSHFYADMIGLEGDDLALFMPSAGQKLEDMKDQ  255



>ref|XP_008222687.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Prunus 
mume]
Length=628

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 209/238 (88%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +E +QER++TKEL+VYLVDASPKMF+TT PA D K+ +HF VAV+CIAQSL+TQIIN SY
Sbjct  18   NELFQERESTKELVVYLVDASPKMFTTTCPAGDRKDDTHFHVAVSCIAQSLKTQIINNSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREK+NLQDLN VYV+NV +R+ LDRPTARLIKE D+IE+ F  +IGS+YG
Sbjct  78   DEVAICFFNTREKRNLQDLNGVYVFNVADREYLDRPTARLIKEIDNIEESFMSKIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQALLRKGSAKTADKR+LLFTNEDDPFG IKGVIK DMMRTT Q
Sbjct  138  IVSGSRENSLYNALWVAQALLRKGSAKTADKRVLLFTNEDDPFGSIKGVIKTDMMRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            R +DAQDLGISIELLPLSRPD +FNVS FY+++LGL+ D+L +F    GE+ ED+KDQ
Sbjct  198  RTRDAQDLGISIELLPLSRPDSDFNVSTFYSDLLGLKGDDLARFMPAAGEKLEDMKDQ  255



>ref|XP_007221986.1| hypothetical protein PRUPE_ppa002852mg [Prunus persica]
 gb|EMJ23185.1| hypothetical protein PRUPE_ppa002852mg [Prunus persica]
Length=628

 Score =   375 bits (962),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 208/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +E +QER++TKEL+VYLVDASPKMF+TT PA D K+ +HF VAV+CIAQSL+TQIIN SY
Sbjct  18   NELFQERESTKELVVYLVDASPKMFTTTCPAGDRKDDTHFHVAVSCIAQSLKTQIINNSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREK+NLQDLN VYV+NV +R+ LDRPTARLIKE D+IE+ F  +IGS+YG
Sbjct  78   DEVAICFFNTREKRNLQDLNGVYVFNVADREYLDRPTARLIKEIDNIEESFMSKIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ LWVAQALLRKGSAKTADKR+LLFTNEDDPFG IKGVIK DMMRTT Q
Sbjct  138  IVSGSRENSLYNVLWVAQALLRKGSAKTADKRVLLFTNEDDPFGSIKGVIKTDMMRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            R +DAQDLGISIELLPLSRPD +FNVS FY+++LGL+ D+L +F    GE+ ED+KDQ
Sbjct  198  RTRDAQDLGISIELLPLSRPDSDFNVSTFYSDLLGLKGDDLARFMPAAGEKLEDMKDQ  255



>ref|XP_002521532.1| ku P70 DNA helicase, putative [Ricinus communis]
 gb|EEF40803.1| ku P70 DNA helicase, putative [Ricinus communis]
Length=626

 Score =   374 bits (960),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 176/236 (75%), Positives = 208/236 (88%), Gaps = 0/236 (0%)
 Frame = -1

Query  708  FYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDE  529
            FYQ+R+++KE +VYLVDASPKMF+TT PAED+K+ +HF +AV+ IAQSL+TQIINRSYDE
Sbjct  20   FYQQRESSKEFVVYLVDASPKMFTTTFPAEDQKDETHFHIAVSSIAQSLKTQIINRSYDE  79

Query  528  VAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIE  349
            VAICF+NTREK+NLQDLN V+VYNV ER+ LDRPTARLIK+FD IE+ F KEIGS+YGI 
Sbjct  80   VAICFFNTREKRNLQDLNGVFVYNVAEREYLDRPTARLIKDFDCIEESFMKEIGSQYGIV  139

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
             GSR+NSLY+ALWVAQALLRKGSAKTADKRILL TNEDDPFG ++G  K DM RTT QRA
Sbjct  140  SGSRENSLYNALWVAQALLRKGSAKTADKRILLLTNEDDPFGSMQGAAKTDMTRTTLQRA  199

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            KDAQDLGISIELLPLS+PDEEF++S+FYA ++GLE DEL QF    G++ ED+KDQ
Sbjct  200  KDAQDLGISIELLPLSQPDEEFHISLFYAGLIGLEGDELAQFVPSAGQKLEDMKDQ  255



>ref|XP_004296683.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase 2 
subunit KU70-like [Fragaria vesca subsp. vesca]
Length=627

 Score =   372 bits (956),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 205/238 (86%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EFYQER +TKEL+VYLVDASPKMFSTTSPAED ++ + F VA++CI++SLR QIIN SY
Sbjct  18   NEFYQERASTKELVVYLVDASPKMFSTTSPAEDGEDVTDFHVAMSCISESLRKQIINSSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVA+CF+NTREK+NLQDLN VYV+NV ERD+LDRPTARLIKE  ++E+ F   IGS+YG
Sbjct  78   DEVAVCFFNTREKRNLQDLNGVYVFNVDERDNLDRPTARLIKEVSNVEESFMSNIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQALL KGSA+TADKR+LLFTNEDDPFG IKG+IK DMMRTT Q
Sbjct  138  INSGSRENSLYNALWVAQALLHKGSARTADKRVLLFTNEDDPFGSIKGIIKTDMMRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPL   D EFNVS FY++++GL  DEL QF   +GE+ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLCHSDNEFNVSTFYSDLIGLTGDELAQFMPKVGEKLEDMKDQ  255



>ref|XP_008342867.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like [Malus 
domestica]
Length=391

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 207/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +E +Q R++TK+L+VYLVDASPKMFSTT P+ D+K+ +HF VAV+CIAQSL+TQIIN +Y
Sbjct  20   NELFQGRESTKDLVVYLVDASPKMFSTTCPSGDDKDETHFHVAVSCIAQSLKTQIINHAY  79

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREK NLQDLN VYV+NV E++ LDRPTARLIKE D +E+ F  +IGS+YG
Sbjct  80   DEVAICFFNTREKWNLQDLNGVYVFNVAEQEYLDRPTARLIKEIDSVEESFMSKIGSQYG  139

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQALLRKGS+KTA+KR+LLFTNED+PFG I GVIK DMMRTT Q
Sbjct  140  IVSGSRENSLYNALWVAQALLRKGSSKTAEKRVLLFTNEDNPFGNITGVIKTDMMRTTLQ  199

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RA+DAQDLGISIELLPLSRPD +FNVS FY+++LGL+ D+L +F    G++ ED+KDQ
Sbjct  200  RARDAQDLGISIELLPLSRPDSDFNVSTFYSDLLGLKSDDLARFMPAAGKKLEDMKDQ  257



>ref|XP_008453932.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Cucumis 
melo]
Length=626

 Score =   366 bits (939),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 206/236 (87%), Gaps = 0/236 (0%)
 Frame = -1

Query  708  FYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDE  529
            F+QER++TKEL VYLVDASPKMFSTT P+ED+K  +HF+VA++CI+QSL+TQIINRSYDE
Sbjct  20   FFQERESTKELAVYLVDASPKMFSTTCPSEDKKRETHFQVALSCISQSLKTQIINRSYDE  79

Query  528  VAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIE  349
            VAICF+NTREKKNLQDLN V+V NVPER+DLDRPTARL+K  D IE+ F KEIGS+YGI 
Sbjct  80   VAICFFNTREKKNLQDLNGVFVLNVPEREDLDRPTARLLKTIDGIEEVFMKEIGSQYGIV  139

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
             GSR+N+LY+ALW AQALLRKGSAKT DKRILLFTNEDDPFG IKG  K D++RTT QRA
Sbjct  140  SGSRENALYNALWAAQALLRKGSAKTLDKRILLFTNEDDPFGSIKGATKFDLIRTTLQRA  199

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            KDAQDLGISIEL PLS P+E+FN+S+FYA+++GLE  +L Q+    G+R +D+KDQ
Sbjct  200  KDAQDLGISIELFPLSCPNEQFNISLFYADLIGLEGGDLVQYLPSAGDRLQDMKDQ  255



>ref|XP_007021876.1| KU70 isoform 2 [Theobroma cacao]
 gb|EOY13401.1| KU70 isoform 2 [Theobroma cacao]
Length=508

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 207/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EF+Q+  ++KE +VYLVDASPKMF+TT P +D+K+ +HF +AV+CIA+SL+TQII+RSY
Sbjct  18   NEFFQQSASSKEYVVYLVDASPKMFNTTCPGKDQKDETHFHLAVSCIAESLKTQIISRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDLN V+V+NV ER+ LDRPTARLIKEFD +++ F +EIGS+YG
Sbjct  78   DEVAICFFNTREKKNLQDLNGVFVFNVAEREHLDRPTARLIKEFDCLQESFMREIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I PGSR+NSLY+ALWVAQALLRKGS KTADKRILL TNEDDPFG + G  KADM RT+ Q
Sbjct  138  IVPGSRENSLYNALWVAQALLRKGSIKTADKRILLLTNEDDPFGGLLGAAKADMTRTSLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS PDEEFNV +FYA++LGL+ ++L QF    G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSCPDEEFNVKVFYADLLGLDGEDLVQFMPSAGQKLEDMKDQ  255



>ref|XP_007021877.1| KU70 isoform 3 [Theobroma cacao]
 gb|EOY13402.1| KU70 isoform 3 [Theobroma cacao]
Length=529

 Score =   359 bits (921),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 207/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EF+Q+  ++KE +VYLVDASPKMF+TT P +D+K+ +HF +AV+CIA+SL+TQII+RSY
Sbjct  18   NEFFQQSASSKEYVVYLVDASPKMFNTTCPGKDQKDETHFHLAVSCIAESLKTQIISRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDLN V+V+NV ER+ LDRPTARLIKEFD +++ F +EIGS+YG
Sbjct  78   DEVAICFFNTREKKNLQDLNGVFVFNVAEREHLDRPTARLIKEFDCLQESFMREIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I PGSR+NSLY+ALWVAQALLRKGS KTADKRILL TNEDDPFG + G  KADM RT+ Q
Sbjct  138  IVPGSRENSLYNALWVAQALLRKGSIKTADKRILLLTNEDDPFGGLLGAAKADMTRTSLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS PDEEFNV +FYA++LGL+ ++L QF    G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSCPDEEFNVKVFYADLLGLDGEDLVQFMPSAGQKLEDMKDQ  255



>ref|XP_004152086.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like [Cucumis 
sativus]
Length=625

 Score =   362 bits (929),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 206/236 (87%), Gaps = 0/236 (0%)
 Frame = -1

Query  708  FYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDE  529
            F+QER++TKEL VYLVDASPKMF+TT  +ED+KE +HF+VA++CI+QSL+TQIINRSYDE
Sbjct  20   FFQERESTKELAVYLVDASPKMFTTTCLSEDKKEETHFQVALSCISQSLKTQIINRSYDE  79

Query  528  VAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIE  349
            VAICF+NTREKKNLQDLN V+V NVPER+DLDRPTARL+K  D IE+ F KEIGS+YGI 
Sbjct  80   VAICFFNTREKKNLQDLNGVFVLNVPEREDLDRPTARLLKTIDGIEEVFMKEIGSQYGIV  139

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
             GSR+N+LY+ALW AQALLRKGSAKT DKRILLFTNEDDPFG IKG  K D++RTT QRA
Sbjct  140  SGSRENALYNALWAAQALLRKGSAKTLDKRILLFTNEDDPFGSIKGATKFDLIRTTLQRA  199

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            KDAQDLGISIEL PLS P+E+FN+S+FYA+++GLE  +L Q+    G+R +D+KDQ
Sbjct  200  KDAQDLGISIELFPLSCPNEQFNLSLFYADLVGLEGGDLVQYLPSAGDRLQDMKDQ  255



>ref|XP_004161593.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase 2 
subunit KU70-like [Cucumis sativus]
Length=625

 Score =   361 bits (927),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 205/236 (87%), Gaps = 0/236 (0%)
 Frame = -1

Query  708  FYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDE  529
            F+QER++TKEL VYLVDASPKMF+TT  +ED KE +HF+VA++CI+QSL+TQIINRSYDE
Sbjct  20   FFQERESTKELAVYLVDASPKMFTTTCLSEDXKEETHFQVALSCISQSLKTQIINRSYDE  79

Query  528  VAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIE  349
            VAICF+NTREKKNLQDLN V+V NVPER+DLDRPTARL+K  D IE+ F KEIGS+YGI 
Sbjct  80   VAICFFNTREKKNLQDLNGVFVLNVPEREDLDRPTARLLKTIDGIEEVFMKEIGSQYGIV  139

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
             GSR+N+LY+ALW AQALLRKGSAKT DKRILLFTNEDDPFG IKG  K D++RTT QRA
Sbjct  140  SGSRENALYNALWAAQALLRKGSAKTLDKRILLFTNEDDPFGSIKGATKFDLIRTTLQRA  199

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            KDAQDLGISIEL PLS P+E+FN+S+FYA+++GLE  +L Q+    G+R +D+KDQ
Sbjct  200  KDAQDLGISIELFPLSCPNEQFNLSLFYADLVGLEGGDLVQYLPSAGDRLQDMKDQ  255



>ref|XP_007021875.1| KU70 isoform 1 [Theobroma cacao]
 gb|EOY13400.1| KU70 isoform 1 [Theobroma cacao]
Length=628

 Score =   360 bits (923),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 207/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EF+Q+  ++KE +VYLVDASPKMF+TT P +D+K+ +HF +AV+CIA+SL+TQII+RSY
Sbjct  18   NEFFQQSASSKEYVVYLVDASPKMFNTTCPGKDQKDETHFHLAVSCIAESLKTQIISRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDLN V+V+NV ER+ LDRPTARLIKEFD +++ F +EIGS+YG
Sbjct  78   DEVAICFFNTREKKNLQDLNGVFVFNVAEREHLDRPTARLIKEFDCLQESFMREIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I PGSR+NSLY+ALWVAQALLRKGS KTADKRILL TNEDDPFG + G  KADM RT+ Q
Sbjct  138  IVPGSRENSLYNALWVAQALLRKGSIKTADKRILLLTNEDDPFGGLLGAAKADMTRTSLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS PDEEFNV +FYA++LGL+ ++L QF    G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSCPDEEFNVKVFYADLLGLDGEDLVQFMPSAGQKLEDMKDQ  255



>ref|XP_006416754.1| hypothetical protein EUTSA_v10007085mg [Eutrema salsugineum]
 gb|ESQ35107.1| hypothetical protein EUTSA_v10007085mg [Eutrema salsugineum]
Length=620

 Score =   358 bits (919),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 205/238 (86%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            S+F+QE++A+KE +VYL+DASPKMFS+T P+ED+K+ SHF +AV+CIAQSL+  IINRS 
Sbjct  18   SDFFQEKEASKEFVVYLIDASPKMFSSTCPSEDDKQESHFHIAVSCIAQSLKAHIINRSN  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DE+AICF+NTREKKNLQDLN VYV+NVPER+ +DRPTARLIK+FD IE+ F K+IGS+ G
Sbjct  78   DEIAICFFNTREKKNLQDLNGVYVFNVPEREGIDRPTARLIKDFDVIEESFIKDIGSQNG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I   SR+NSLYSALWVAQALLRKGS KTADKRI LFTNEDDPFG ++  +K DM RTT Q
Sbjct  138  IVSDSRENSLYSALWVAQALLRKGSTKTADKRIFLFTNEDDPFGSMRISVKEDMTRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS PD++FN+++FY +++GL  DEL +F   +G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSHPDKQFNITLFYKDLIGLNSDELTEFMPSVGQKLEDMKDQ  255



>ref|XP_009149134.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Brassica 
rapa]
Length=618

 Score =   358 bits (918),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 207/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            S+F+QE++A+KE +VYL+DASPKMFS+T P+EDEK+ SHF +AV+CIAQSL++ IINRS 
Sbjct  18   SQFFQEKEASKEFVVYLIDASPKMFSSTCPSEDEKQESHFHIAVSCIAQSLKSHIINRSN  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DE+AICF+NTREKKNLQDLN VYV+NVP+R+ +DRPTARLIK+FD IE+ F K+IGS+ G
Sbjct  78   DEIAICFFNTREKKNLQDLNGVYVFNVPQRECIDRPTARLIKDFDLIEESFIKDIGSQNG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I   SR+NSLYSALWVAQALLRKGS+KTADKRI LFTNEDDPFG ++  +K DM RTT Q
Sbjct  138  IVSDSRENSLYSALWVAQALLRKGSSKTADKRIFLFTNEDDPFGSMRISVKEDMTRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS PD++F++S+FY +++GL  DEL +F   +G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSHPDKQFDISLFYKDLIGLNGDELTEFMPSVGQKLEDMKDQ  255



>ref|XP_010923465.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Elaeis 
guineensis]
Length=629

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 195/238 (82%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFYQE+D TKE +VYLVDASPKMF      EDEK  +HF VA+NCI+QSL+ QII  SY
Sbjct  17   SEFYQEKDFTKEFVVYLVDASPKMFGAAGSDEDEKTDTHFHVAINCISQSLKAQIIGSSY  76

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVA+CF+NT+EKKNLQDLN VYV+NV +R+ LDRPTARLIKEF ++ED F   IGS+YG
Sbjct  77   DEVAVCFFNTKEKKNLQDLNGVYVFNVTDRECLDRPTARLIKEFFYVEDTFMSNIGSRYG  136

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS++NSLY+ALWVAQALLRKGS+K+  KRILLFTNEDDPFG I G  K DM+R T Q
Sbjct  137  IVSGSQENSLYNALWVAQALLRKGSSKSVSKRILLFTNEDDPFGSITGATKTDMIRMTLQ  196

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLSRPDE FNVSIFYAE+LGLE DE+  F    GE+ ED+ DQ
Sbjct  197  RAKDAQDLGISIELLPLSRPDEGFNVSIFYAELLGLEGDEISHFLPSAGEKLEDMTDQ  254



>emb|CDY40008.1| BnaC05g13070D [Brassica napus]
Length=612

 Score =   356 bits (914),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 206/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            S+F+QER+A+KE +VYL+DASPKMFS T P+EDEK+ SHF ++V+CIAQSL++ IINRS 
Sbjct  18   SQFFQEREASKEFVVYLIDASPKMFSYTCPSEDEKQESHFHISVSCIAQSLKSHIINRSN  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DE+AICF+NTREKKNLQDLN VYV+NVP+R+ +DRPTARLIK+FD IE+ F ++IGS+ G
Sbjct  78   DEIAICFFNTREKKNLQDLNGVYVFNVPQRECIDRPTARLIKDFDLIEESFIEDIGSQNG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I   SR+NSLYSALWVAQALLRKGS+KTADKRI LFTNEDDPFG ++  +K DM RTT Q
Sbjct  138  IVSDSRENSLYSALWVAQALLRKGSSKTADKRIFLFTNEDDPFGSMRISVKEDMTRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS PD++F++S+FY E++GL  DEL +F   +G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSHPDKQFDISLFYKELIGLNGDELTEFMPSVGQKLEDMKDQ  255



>ref|XP_010273411.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X3 [Nelumbo nucifera]
Length=625

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 200/236 (85%), Gaps = 0/236 (0%)
 Frame = -1

Query  708  FYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDE  529
            F+QER ATKEL+VYL+DASPKMFS     E+++E S+F   V+CI+QSL+T IINRSYDE
Sbjct  20   FFQERVATKELVVYLIDASPKMFSPAGKLENQEEESYFHTVVSCISQSLKTLIINRSYDE  79

Query  528  VAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIE  349
            VAICF+NTREKKN+QDLN V+V+NV ER+ LD+PTARLIKEF HIE++F  EIGS+Y I 
Sbjct  80   VAICFFNTREKKNMQDLNGVFVFNVAERECLDKPTARLIKEFSHIEEQFMGEIGSQYQII  139

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
            PG+R+NSLY+A+WVAQ LLRKGSAKT DKRILLFTNEDDPFG + G  K DM RTT QRA
Sbjct  140  PGNRENSLYNAIWVAQGLLRKGSAKTVDKRILLFTNEDDPFGSVSGAAKIDMTRTTLQRA  199

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            KDAQDLGISIELLPL+R DEEFNV++FYA++LGL+ D L QF  + GE+ +D+KDQ
Sbjct  200  KDAQDLGISIELLPLNRSDEEFNVALFYADLLGLDGDNLTQFMPVAGEKLDDMKDQ  255



>ref|XP_010273409.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X1 [Nelumbo nucifera]
Length=651

 Score =   355 bits (911),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 200/236 (85%), Gaps = 0/236 (0%)
 Frame = -1

Query  708  FYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDE  529
            F+QER ATKEL+VYL+DASPKMFS     E+++E S+F   V+CI+QSL+T IINRSYDE
Sbjct  20   FFQERVATKELVVYLIDASPKMFSPAGKLENQEEESYFHTVVSCISQSLKTLIINRSYDE  79

Query  528  VAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIE  349
            VAICF+NTREKKN+QDLN V+V+NV ER+ LD+PTARLIKEF HIE++F  EIGS+Y I 
Sbjct  80   VAICFFNTREKKNMQDLNGVFVFNVAERECLDKPTARLIKEFSHIEEQFMGEIGSQYQII  139

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
            PG+R+NSLY+A+WVAQ LLRKGSAKT DKRILLFTNEDDPFG + G  K DM RTT QRA
Sbjct  140  PGNRENSLYNAIWVAQGLLRKGSAKTVDKRILLFTNEDDPFGSVSGAAKIDMTRTTLQRA  199

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            KDAQDLGISIELLPL+R DEEFNV++FYA++LGL+ D L QF  + GE+ +D+KDQ
Sbjct  200  KDAQDLGISIELLPLNRSDEEFNVALFYADLLGLDGDNLTQFMPVAGEKLDDMKDQ  255



>gb|KCW69915.1| hypothetical protein EUGRSUZ_F032412, partial [Eucalyptus grandis]
Length=483

 Score =   350 bits (898),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/233 (71%), Positives = 201/233 (86%), Gaps = 0/233 (0%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAI  520
            ER ++KEL+VYLVDASPKMFST  P+ED+K+ SHF++A +CI +SL+TQIINRSYDEVA+
Sbjct  1    ERASSKELVVYLVDASPKMFSTKCPSEDQKDESHFQIATSCILESLKTQIINRSYDEVAV  60

Query  519  CFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGS  340
            CF+NTREKKNLQDLN V+V+NV +R+ LDRPTA+ IKEF  +E+ F K+IGS+YGI  GS
Sbjct  61   CFFNTREKKNLQDLNNVFVFNVADREFLDRPTAKFIKEFSRLEEFFMKDIGSQYGIVSGS  120

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
            R+NSLY+ALWVAQALLRKGSAKTADKRIL+FT+EDDPFG IKG  KADM RTT QRAKDA
Sbjct  121  RENSLYNALWVAQALLRKGSAKTADKRILIFTDEDDPFGNIKGGAKADMTRTTLQRAKDA  180

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            QDLGISIELLPLS+ D EFN+S+FYA+++GL+ + L QF    GER ED+K Q
Sbjct  181  QDLGISIELLPLSQLDREFNISLFYADLIGLQGENLAQFMPAAGERMEDMKYQ  233



>ref|NP_564012.1| ATP-dependent DNA helicase 2 subunit KU70 [Arabidopsis thaliana]
 sp|Q9FQ08.1|KU70_ARATH RecName: Full=ATP-dependent DNA helicase 2 subunit KU70; AltName: 
Full=ATP-dependent DNA helicase 2 subunit 1; AltName: Full=ATP-dependent 
DNA helicase II 70 kDa subunit [Arabidopsis 
thaliana]
 gb|AAG44852.1|AF283759_1 Ku70-like protein [Arabidopsis thaliana]
 dbj|BAD95294.1| Ku70-like protein [Arabidopsis thaliana]
 gb|AEE29527.1| ATP-dependent DNA helicase 2 subunit KU70 [Arabidopsis thaliana]
Length=621

 Score =   354 bits (908),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 205/239 (86%), Gaps = 1/239 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDE-KEASHFEVAVNCIAQSLRTQIINRS  538
            ++F+QE++A+KE +VYL+DASPKMF +T P+E+E K+ SHF +AV+CIAQSL+  IINRS
Sbjct  18   NDFFQEKEASKEFVVYLIDASPKMFCSTCPSEEEDKQESHFHIAVSCIAQSLKAHIINRS  77

Query  537  YDEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY  358
             DE+AICF+NTREKKNLQDLN VYV+NVPERD +DRPTARLIKEFD IE+ F KEIGS+ 
Sbjct  78   NDEIAICFFNTREKKNLQDLNGVYVFNVPERDSIDRPTARLIKEFDLIEESFDKEIGSQT  137

Query  357  GIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTF  178
            GI   SR+NSLYSALWVAQALLRKGS KTADKR+ LFTNEDDPFG ++  +K DM RTT 
Sbjct  138  GIVSDSRENSLYSALWVAQALLRKGSLKTADKRMFLFTNEDDPFGSMRISVKEDMTRTTL  197

Query  177  QRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            QRAKDAQDLGISIELLPLS+PD++FN+++FY +++GL  DEL +F   +G++ ED+KDQ
Sbjct  198  QRAKDAQDLGISIELLPLSQPDKQFNITLFYKDLIGLNSDELTEFMPSVGQKLEDMKDQ  256



>ref|XP_008786104.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X2 [Phoenix dactylifera]
Length=528

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 193/238 (81%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFY+E+D+TKE +VYLVDASPKMF      EDEK  +HF  A++CI+QSL  QII RSY
Sbjct  17   SEFYREKDSTKEFVVYLVDASPKMFGAARSDEDEKPETHFHAAISCISQSLMAQIIGRSY  76

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVA+CF+NT+EKKNLQDLN VYV+NV +R+ LDRPTARLIKE  ++ED F   IGS+YG
Sbjct  77   DEVAVCFFNTKEKKNLQDLNGVYVFNVMDRECLDRPTARLIKELSYVEDTFMSNIGSRYG  136

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQALLRKGSAK+  KRILLFTNEDDPFG I G  K DM+R T Q
Sbjct  137  IVSGSRENSLYNALWVAQALLRKGSAKSVSKRILLFTNEDDPFGSITGATKTDMIRMTLQ  196

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKD QDLGISIELLPLS PDEEFNVSIFYAE+LGLE D++ QF    G+  ED+ DQ
Sbjct  197  RAKDTQDLGISIELLPLSWPDEEFNVSIFYAELLGLEGDDISQFLPSAGDILEDMTDQ  254



>ref|XP_006307010.1| hypothetical protein CARUB_v10008595mg [Capsella rubella]
 gb|EOA39908.1| hypothetical protein CARUB_v10008595mg [Capsella rubella]
Length=620

 Score =   352 bits (904),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/239 (69%), Positives = 207/239 (87%), Gaps = 1/239 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDE-KEASHFEVAVNCIAQSLRTQIINRS  538
            ++F+QE++A+KE +VYL+DASPKMFS+T P+E+E K+ SHF +AV+CIAQSL+  IINRS
Sbjct  18   NDFFQEKEASKEFVVYLIDASPKMFSSTCPSEEEDKQESHFHIAVSCIAQSLKAHIINRS  77

Query  537  YDEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY  358
             DE+AICF+NTREKKNLQDLN VYV+NVPER+ +DRPTARLIKEFD IE+ F KEIGS+ 
Sbjct  78   NDEIAICFFNTREKKNLQDLNGVYVFNVPERECIDRPTARLIKEFDLIEESFDKEIGSQT  137

Query  357  GIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTF  178
            GI   SR+NSLYSALW+AQALLRKGS+KTADKR+ LFTNEDDPFG ++  +K DM RTT 
Sbjct  138  GIVSDSRENSLYSALWIAQALLRKGSSKTADKRMFLFTNEDDPFGNMRISVKEDMTRTTL  197

Query  177  QRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            QRAKDAQDLGISIELLPLS+PD++FN+++FY +++GL  DEL +F   +G++ ED+KDQ
Sbjct  198  QRAKDAQDLGISIELLPLSQPDKQFNINLFYKDLIGLNSDELTEFMPSVGQKLEDMKDQ  256



>ref|XP_010062792.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Eucalyptus 
grandis]
Length=627

 Score =   352 bits (902),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 204/238 (86%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +E  +ER ++KEL+VYLVDASPKMFST  P+ED+K+ SHF++A +CI +SL+TQIINRSY
Sbjct  18   NEALRERASSKELVVYLVDASPKMFSTKCPSEDQKDESHFQIATSCILESLKTQIINRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVA+CF+NTREKKNLQDLN V+V+NV +R+ LDRPTA+ IKEF  +E+ F K+IGS+YG
Sbjct  78   DEVAVCFFNTREKKNLQDLNNVFVFNVADREFLDRPTAKFIKEFSRLEEFFMKDIGSQYG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQALLRKGSAKTADKRIL+FT+EDDPFG IKG  KADM RTT Q
Sbjct  138  IVSGSRENSLYNALWVAQALLRKGSAKTADKRILIFTDEDDPFGNIKGGAKADMTRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS+ D EFN+S+FYA+++GL+ + L QF    GER ED+K Q
Sbjct  198  RAKDAQDLGISIELLPLSQLDREFNISLFYADLIGLQGENLAQFMPAAGERMEDMKYQ  255



>ref|XP_010650420.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X3 [Vitis vinifera]
Length=502

 Score =   347 bits (891),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/233 (73%), Positives = 195/233 (84%), Gaps = 0/233 (0%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAI  520
            E+ +TKE +VYLVDASPKMFSTT   ED+K+ + F  AV+CI+QSL+TQIIN S DEVAI
Sbjct  21   EKASTKEFVVYLVDASPKMFSTTFQGEDQKDETPFHAAVSCISQSLKTQIINNSNDEVAI  80

Query  519  CFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGS  340
            CF+NTREKKNLQDLN V+V+NV ER+ LDRPTARLIKEFD IE+ F KEIGS+YGI  GS
Sbjct  81   CFFNTREKKNLQDLNGVFVFNVAEREYLDRPTARLIKEFDRIEELFMKEIGSQYGIMSGS  140

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
            R+NSLY+ALW AQALLRKGSAKTADKRILLFTNEDDPFG I G  K DM RTT QRAKD 
Sbjct  141  RENSLYNALWAAQALLRKGSAKTADKRILLFTNEDDPFGSITGATKMDMTRTTLQRAKDT  200

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            QDLGISIELLPLS PDEEFNVS FYA+++GLE D+L  F   +G++  D+K+Q
Sbjct  201  QDLGISIELLPLSCPDEEFNVSAFYADLIGLEGDDLALFMPSVGDKLTDMKNQ  253



>emb|CDY35134.1| BnaA06g11440D [Brassica napus]
Length=607

 Score =   350 bits (899),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 205/238 (86%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            S+F+QE++A+KE +VYL+D+SPKMFS+T P+EDEK+ SHF +AV+CIAQSL++ IINRS 
Sbjct  18   SQFFQEKEASKEFVVYLIDSSPKMFSSTCPSEDEKQESHFHIAVSCIAQSLKSHIINRSN  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DE+AICF+NTREKKNLQDLN VYV+NVP+R+ +DRPTARLIK+FD IE+ F K+IGS+ G
Sbjct  78   DEIAICFFNTREKKNLQDLNGVYVFNVPQRECIDRPTARLIKDFDLIEESFIKDIGSQNG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I   SR+NSLYSALWVAQALLRKGS+KTADKRI LFTNEDDPFG ++  +K DM RTT Q
Sbjct  138  IVSDSRENSLYSALWVAQALLRKGSSKTADKRIFLFTNEDDPFGSMRISVKEDMTRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPL   D++F++S+FY +++GL  DEL +F   +G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLIHHDKQFDISLFYKDLIGLNGDELTEFMPSVGQKLEDMKDQ  255



>ref|XP_008786103.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X1 [Phoenix dactylifera]
Length=629

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 193/238 (81%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFY+E+D+TKE +VYLVDASPKMF      EDEK  +HF  A++CI+QSL  QII RSY
Sbjct  17   SEFYREKDSTKEFVVYLVDASPKMFGAARSDEDEKPETHFHAAISCISQSLMAQIIGRSY  76

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVA+CF+NT+EKKNLQDLN VYV+NV +R+ LDRPTARLIKE  ++ED F   IGS+YG
Sbjct  77   DEVAVCFFNTKEKKNLQDLNGVYVFNVMDRECLDRPTARLIKELSYVEDTFMSNIGSRYG  136

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GSR+NSLY+ALWVAQALLRKGSAK+  KRILLFTNEDDPFG I G  K DM+R T Q
Sbjct  137  IVSGSRENSLYNALWVAQALLRKGSAKSVSKRILLFTNEDDPFGSITGATKTDMIRMTLQ  196

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKD QDLGISIELLPLS PDEEFNVSIFYAE+LGLE D++ QF    G+  ED+ DQ
Sbjct  197  RAKDTQDLGISIELLPLSWPDEEFNVSIFYAELLGLEGDDISQFLPSAGDILEDMTDQ  254



>gb|KFK43907.1| hypothetical protein AALP_AA1G189500 [Arabis alpina]
Length=619

 Score =   350 bits (897),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 203/238 (85%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEF+QE++A+KE +VYL+DASPKM +TT  +ED+K+ SHF +AV+CIAQSL++ IINRS 
Sbjct  18   SEFFQEKEASKEFVVYLIDASPKMLNTTCLSEDDKQESHFHIAVSCIAQSLKSHIINRSN  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DE+AICF+NTREKKNLQDLN VYV+NVPER+ +DRPTARLIK+F  I++ F K IGS+ G
Sbjct  78   DEIAICFFNTREKKNLQDLNAVYVFNVPEREPIDRPTARLIKDFHLIQESFVKHIGSQNG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I   SR+NSLYSALWVAQALLRKGS+KTADKRI LFTNEDDPFG ++  +K DM RTT Q
Sbjct  138  IVSDSRENSLYSALWVAQALLRKGSSKTADKRIFLFTNEDDPFGSMRISVKEDMTRTTLQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGISIELLPLS PD++F++++FY +++GL  DEL +F   +G++ ED+KDQ
Sbjct  198  RAKDAQDLGISIELLPLSHPDKQFDITLFYKDLIGLNSDELTEFMPSVGQKLEDMKDQ  255



>ref|XP_010273410.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X2 [Nelumbo nucifera]
Length=631

 Score =   350 bits (897),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 200/242 (83%), Gaps = 6/242 (2%)
 Frame = -1

Query  708  FYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDE  529
            F+QER ATKEL+VYL+DASPKMFS     E+++E S+F   V+CI+QSL+T IINRSYDE
Sbjct  20   FFQERVATKELVVYLIDASPKMFSPAGKLENQEEESYFHTVVSCISQSLKTLIINRSYDE  79

Query  528  VAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIE  349
            VAICF+NTREKKN+QDLN V+V+NV ER+ LD+PTARLIKEF HIE++F  EIGS+Y I 
Sbjct  80   VAICFFNTREKKNMQDLNGVFVFNVAERECLDKPTARLIKEFSHIEEQFMGEIGSQYQII  139

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
            PG+R+NSLY+A+WVAQ LLRKGSAKT DKRILLFTNEDDPFG + G  K DM RTT QRA
Sbjct  140  PGNRENSLYNAIWVAQGLLRKGSAKTVDKRILLFTNEDDPFGSVSGAAKIDMTRTTLQRA  199

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGE------RFEDLK  7
            KDAQDLGISIELLPL+R DEEFNV++FYA++LGL+ D L QF  + GE      R +D+K
Sbjct  200  KDAQDLGISIELLPLNRSDEEFNVALFYADLLGLDGDNLTQFMPVAGEKIWSLRRLDDMK  259

Query  6    DQ  1
            DQ
Sbjct  260  DQ  261



>ref|XP_010476832.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Camelina 
sativa]
Length=621

 Score =   348 bits (894),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/239 (68%), Positives = 207/239 (87%), Gaps = 1/239 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDE-KEASHFEVAVNCIAQSLRTQIINRS  538
            ++F+QE++A+KE +VYL+DASPKMFS+T  +E+E K+ SHF +AV+CIAQSL++ IINRS
Sbjct  18   NDFFQEKEASKEFVVYLIDASPKMFSSTCHSEEEDKQESHFHIAVSCIAQSLKSHIINRS  77

Query  537  YDEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY  358
             DE+AICF+NTREKKNLQDLN VYV+NVPER+ +DRPTARLIKEFD IE+ F K+IGS+ 
Sbjct  78   NDEIAICFFNTREKKNLQDLNGVYVFNVPERECIDRPTARLIKEFDLIEESFDKDIGSQT  137

Query  357  GIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTF  178
            GI   SR+NSLYSALWVAQALLRKGS+KTADKR+ LFTNEDDPFG ++  +K DM RTT 
Sbjct  138  GIVSDSRENSLYSALWVAQALLRKGSSKTADKRMFLFTNEDDPFGNMRISVKEDMTRTTL  197

Query  177  QRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            QRAKDAQDLGISIELLPLS+PD++FN+++FY +++GL  DEL +F   +G++ ED+KDQ
Sbjct  198  QRAKDAQDLGISIELLPLSQPDKQFNITLFYKDLIGLNSDELTEFMPSVGQKLEDMKDQ  256



>ref|XP_002267875.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X1 [Vitis vinifera]
 emb|CBI39448.3| unnamed protein product [Vitis vinifera]
Length=623

 Score =   348 bits (893),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 169/233 (73%), Positives = 195/233 (84%), Gaps = 0/233 (0%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAI  520
            E+ +TKE +VYLVDASPKMFSTT   ED+K+ + F  AV+CI+QSL+TQIIN S DEVAI
Sbjct  21   EKASTKEFVVYLVDASPKMFSTTFQGEDQKDETPFHAAVSCISQSLKTQIINNSNDEVAI  80

Query  519  CFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGS  340
            CF+NTREKKNLQDLN V+V+NV ER+ LDRPTARLIKEFD IE+ F KEIGS+YGI  GS
Sbjct  81   CFFNTREKKNLQDLNGVFVFNVAEREYLDRPTARLIKEFDRIEELFMKEIGSQYGIMSGS  140

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
            R+NSLY+ALW AQALLRKGSAKTADKRILLFTNEDDPFG I G  K DM RTT QRAKD 
Sbjct  141  RENSLYNALWAAQALLRKGSAKTADKRILLFTNEDDPFGSITGATKMDMTRTTLQRAKDT  200

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            QDLGISIELLPLS PDEEFNVS FYA+++GLE D+L  F   +G++  D+K+Q
Sbjct  201  QDLGISIELLPLSCPDEEFNVSAFYADLIGLEGDDLALFMPSVGDKLTDMKNQ  253



>dbj|BAC83190.1| putative DNA-dependent protein kinase 70 kda DNA-binding subunit 
Ku70 [Oryza sativa Japonica Group]
Length=331

 Score =   337 bits (863),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/234 (68%), Positives = 192/234 (82%), Gaps = 1/234 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+A KE++VYL+DASPKMF+  + A DEKE +HF   VNCI  +L+TQII RSYDEVA
Sbjct  21   QEREANKEMVVYLIDASPKMFTPATKA-DEKEETHFHTIVNCITHALKTQIIGRSYDEVA  79

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQ+L  VYVYNV ER+ LDRP ARLIKEF  IED F   IGS+YGI  G
Sbjct  80   ICFFNTKEKKNLQELAGVYVYNVTEREPLDRPDARLIKEFSCIEDSFMSNIGSRYGITSG  139

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            SR+N+LY+ALWVAQALLRKGS KT  KRI++FTNEDDPFG + G +K DM+RTT QRA+D
Sbjct  140  SRENTLYNALWVAQALLRKGSVKTVSKRIVIFTNEDDPFGGLTGAVKTDMIRTTIQRARD  199

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AQDLG+SIELLPLSRPDEEFN+S+FYA+++GLE DE+  +    GE+ ED+ +Q
Sbjct  200  AQDLGLSIELLPLSRPDEEFNMSLFYADLIGLEGDEIVDYLPSSGEKLEDMTNQ  253



>ref|XP_010459255.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like [Camelina 
sativa]
Length=621

 Score =   346 bits (888),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/239 (68%), Positives = 207/239 (87%), Gaps = 1/239 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDE-KEASHFEVAVNCIAQSLRTQIINRS  538
            ++F+QE++A+KE +VYL+DASPKMFS+TS +E+E K+ SHF +AV+CIAQSL++ IINRS
Sbjct  18   NDFFQEKEASKEFVVYLIDASPKMFSSTSHSEEEDKQESHFHIAVSCIAQSLKSHIINRS  77

Query  537  YDEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY  358
             DE+AICF+NTREKKNLQDLN VY +NVPER+ +DRPTARLIKEFD IE+ F K+IGS+ 
Sbjct  78   NDEIAICFFNTREKKNLQDLNGVYAFNVPERECIDRPTARLIKEFDLIEESFDKDIGSQT  137

Query  357  GIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTF  178
            GI   SR+NSLYSALWVAQALLRKGS+KTADKR+ LFTNEDDPFG ++  +K DM RTT 
Sbjct  138  GIVSDSRENSLYSALWVAQALLRKGSSKTADKRMFLFTNEDDPFGNMRISVKEDMTRTTL  197

Query  177  QRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            QRAKDA+DLGISIELLPLS+PD++FN+++FY +++GL  DEL +F   +G++ ED+KDQ
Sbjct  198  QRAKDARDLGISIELLPLSQPDKQFNITLFYKDLIGLNSDELIEFMPSVGQKLEDMKDQ  256



>ref|XP_010498037.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like [Camelina 
sativa]
Length=621

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/239 (68%), Positives = 205/239 (86%), Gaps = 1/239 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDE-KEASHFEVAVNCIAQSLRTQIINRS  538
            ++F+QE++A+KE +VYL+DASPKMFS+T  +E+E K+ SHF +AV+CIAQSL++ IINRS
Sbjct  18   NDFFQEKEASKEFVVYLIDASPKMFSSTCHSEEEDKQESHFHIAVSCIAQSLKSHIINRS  77

Query  537  YDEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY  358
             DE+A CF+NTREKKNLQDLN VYV+NVPER+ +DRPTARLIKEFD IE+ F K+IGS+ 
Sbjct  78   NDEIAFCFFNTREKKNLQDLNGVYVFNVPERECIDRPTARLIKEFDLIEESFDKDIGSQT  137

Query  357  GIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTF  178
            GI   SR+NSLYSALWVAQALLRKGS+KTADKR+ LFTNEDDPFG ++  +K DM RTT 
Sbjct  138  GIVSDSRENSLYSALWVAQALLRKGSSKTADKRMFLFTNEDDPFGNMRISVKEDMTRTTL  197

Query  177  QRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            QRAKDAQDLGISIELLPLS+PD++FN+ +FY +++GL  DEL +F   +G++ ED+KDQ
Sbjct  198  QRAKDAQDLGISIELLPLSQPDKQFNIILFYKDLIGLNSDELTEFMPSVGQKLEDMKDQ  256



>ref|XP_009397017.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Musa acuminata 
subsp. malaccensis]
Length=629

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 199/238 (84%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SE Y+E++ TKEL VYL+DASPKMF+  +  E+  + ++F VA++CI +SL+TQII RSY
Sbjct  17   SELYEEKEPTKELAVYLIDASPKMFAPIADHENGNKETYFHVAIDCITRSLKTQIIGRSY  76

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVA+CF+NT+EKKNLQD+N VYV+NV ER+ +DRPTA+LIKEF  IED+F   IGS+YG
Sbjct  77   DEVALCFFNTKEKKNLQDVNSVYVFNVMERELIDRPTAKLIKEFSSIEDKFMSTIGSRYG  136

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            + PGSR+NSLY+A WVAQALLRKGS KT+ KRIL+FTN+DDPFG + G +KADM+RTT Q
Sbjct  137  VLPGSRENSLYNAFWVAQALLRKGSVKTSSKRILIFTNDDDPFGSMTGAMKADMIRTTTQ  196

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGIS ELLPLSRPDEEFNVS+FYA+M+GLE  ++ QF     E+ ED+KDQ
Sbjct  197  RAKDAQDLGISFELLPLSRPDEEFNVSMFYADMIGLEGTDISQFLPSASEKLEDMKDQ  254



>ref|XP_004956589.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like [Setaria 
italica]
Length=628

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 192/234 (82%), Gaps = 0/234 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+A KE++VYLVDASPKMF+  +   DEK+ +HF   VNCI QSL+TQII RSYDEVA
Sbjct  21   QEREANKEMVVYLVDASPKMFTPATTQADEKQETHFHTIVNCITQSLKTQIIGRSYDEVA  80

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQDL  VYVYNV +RD LDRPTA+LIK+F  IED F   IGS+YGI  G
Sbjct  81   ICFFNTKEKKNLQDLAGVYVYNVGDRDPLDRPTAKLIKDFSCIEDSFMSNIGSRYGITAG  140

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            SR+N+LY+ALWVAQALLRKGS KT  KR+L+FTNEDDPF  I G +K DM+RTT QRAKD
Sbjct  141  SRENTLYNALWVAQALLRKGSVKTVSKRMLIFTNEDDPFSAITGAVKTDMIRTTIQRAKD  200

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AQDLG+SIELLPLSRPDEEFNVS+FYA+++GL+  E+ ++    GE+ ED+ DQ
Sbjct  201  AQDLGLSIELLPLSRPDEEFNVSLFYADLIGLDGAEITEYLPSAGEKLEDMTDQ  254



>ref|XP_010680644.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Beta vulgaris 
subsp. vulgaris]
Length=624

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/234 (69%), Positives = 195/234 (83%), Gaps = 0/234 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+++KE  VY+VDASPKMF+TT P ED+   SHF++A++CI++SL+ +IIN SYDE+A
Sbjct  22   QERESSKEYAVYIVDASPKMFNTTCPGEDQTVQSHFQMAISCISESLKNRIINSSYDEIA  81

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NTREKKNLQDLN V+V++V   D LDRPTARLIKEFD IE+ F K+IGS+YGI  G
Sbjct  82   ICFFNTREKKNLQDLNGVFVFSVAVEDGLDRPTARLIKEFDQIEESFMKKIGSQYGIVSG  141

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            SR+NSLY+ALWVAQALLRKGSAK  DKR+L+FTNEDDPFG +KGV K DM RTT QRAKD
Sbjct  142  SRENSLYNALWVAQALLRKGSAKMVDKRMLMFTNEDDPFGTLKGVTKLDMTRTTLQRAKD  201

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AQDLGISIELLPLS PD EFN+S+F+A+MLGLE D L  F      R +D+KDQ
Sbjct  202  AQDLGISIELLPLSSPDREFNMSLFFADMLGLEGDALADFVPSSIARLQDMKDQ  255



>ref|XP_002892931.1| hypothetical protein ARALYDRAFT_471898 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69190.1| hypothetical protein ARALYDRAFT_471898 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   343 bits (881),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/241 (69%), Positives = 205/241 (85%), Gaps = 3/241 (1%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDE-KEASHFEVAVNCIAQSLRTQIINRS  538
            SEF+QE++A+KE LVYL+DASPKMFS+T P+E+E K+ SHF +AV+CIA SL++ IINRS
Sbjct  18   SEFFQEKEASKEFLVYLIDASPKMFSSTCPSEEEDKQESHFHIAVSCIALSLKSHIINRS  77

Query  537  YDEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY  358
             DE+AICF+NTREKKNLQDLN VYV+NVPERD +DRPTARLIKEFD IE+ F K+IGS+ 
Sbjct  78   NDEIAICFFNTREKKNLQDLNGVYVFNVPERDCIDRPTARLIKEFDLIEESFDKDIGSQT  137

Query  357  GIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTF  178
            GI   SR+NSLYSALWVAQALLRKGS+KTADKR+ LFTNEDDPFG ++  +K DM RTT 
Sbjct  138  GIVSDSRENSLYSALWVAQALLRKGSSKTADKRMFLFTNEDDPFGNMRISVKEDMTRTTL  197

Query  177  QRAK-DAQDLGISIELLPLSRPDEEFNVSIFY-AEMLGLEDDELDQFKALIGERFEDLKD  4
            QRAK D QDLGISIELLPLS+PD++FN+++FY   ++GL  DEL +F   +G++ ED+KD
Sbjct  198  QRAKDDLQDLGISIELLPLSQPDKQFNITLFYKVNLIGLNSDELTEFMPSVGQKLEDMKD  257

Query  3    Q  1
            Q
Sbjct  258  Q  258



>ref|XP_006606601.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like [Glycine 
max]
Length=634

 Score =   344 bits (882),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 198/235 (84%), Gaps = 2/235 (1%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAE--DEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            E +++KE +VYLVDASPKMFSTT PAE  D+   +HF +A++CI+Q+L +QIINRSYD+V
Sbjct  28   ENESSKEYVVYLVDASPKMFSTTCPAEEDDQNGETHFHIAISCISQTLESQIINRSYDQV  87

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP  346
            AICF+NTREK NLQDLN V+V+NVPER+ LDRPTARLIKEF  +E+ FSK IGS++GI  
Sbjct  88   AICFFNTREKNNLQDLNSVFVFNVPEREFLDRPTARLIKEFYQLEESFSKIIGSQHGIVS  147

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
            G+R+NSLY+A+W AQALLRKGSAKT DKRILLFTN+DDPFG IKG +K+DM R T QRAK
Sbjct  148  GTRENSLYNAIWAAQALLRKGSAKTVDKRILLFTNDDDPFGSIKGAVKSDMTRMTLQRAK  207

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            DAQDLGISIELLPLS PDE FNVS FYA+++GLE D+L  F    G++ ED+KDQ
Sbjct  208  DAQDLGISIELLPLSHPDEVFNVSQFYADLIGLEGDDLVDFMPSAGKKLEDMKDQ  262



>gb|EEC81629.1| hypothetical protein OsI_25158 [Oryza sativa Indica Group]
Length=433

 Score =   337 bits (863),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/234 (68%), Positives = 192/234 (82%), Gaps = 1/234 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+A KE++VYL+DASPKMF+  + A DEKE +HF   VNCI  +L+TQII RSYDEVA
Sbjct  21   QEREANKEMVVYLIDASPKMFTPATKA-DEKEETHFHTIVNCITHALKTQIIGRSYDEVA  79

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQ+L  VYVYNV ER+ LDRP ARLIKEF  IED F   IGS+YGI  G
Sbjct  80   ICFFNTKEKKNLQELAGVYVYNVTEREPLDRPDARLIKEFSCIEDSFMSNIGSRYGITSG  139

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            SR+N+LY+ALWVAQALLRKGS KT  KRI++FTNEDDPFG + G +K DM+RTT QRA+D
Sbjct  140  SRENTLYNALWVAQALLRKGSVKTVSKRIVIFTNEDDPFGGLTGAVKTDMIRTTIQRARD  199

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AQDLG+SIELLPLSRPDEEFN+S+FYA+++GLE DE+  +    GE+ ED+ +Q
Sbjct  200  AQDLGLSIELLPLSRPDEEFNMSLFYADLIGLEGDEIVDYLPSSGEKLEDMTNQ  253



>ref|XP_010537714.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Tarenaya 
hassleriana]
Length=619

 Score =   342 bits (877),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 200/238 (84%), Gaps = 0/238 (0%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            +EF+QE++A+KE +VYL+DASPKMFS+T P+ED+K  SHF +AV+CIAQSL+  I+NRSY
Sbjct  18   NEFFQEKEASKEFIVYLIDASPKMFSSTCPSEDDKGESHFHIAVSCIAQSLKALIVNRSY  77

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NTREKKNLQDLN VYV+NV ER+ +DRPTARLIKEFD IE+ F K IGS+ G
Sbjct  78   DEVAICFFNTREKKNLQDLNGVYVFNVAEREFIDRPTARLIKEFDLIEESFMKNIGSQCG  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I    R+N+LY+ALWVAQ LLRKGS KTADKRI LFTNEDDPFG ++  +KADM RTT Q
Sbjct  138  IVAEPRENALYNALWVAQGLLRKGSVKTADKRIFLFTNEDDPFGSMRPFVKADMTRTTSQ  197

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGI+IELLPLS  D+ F+++IFY +++GLE +EL  F   +G++ ED+KDQ
Sbjct  198  RAKDAQDLGITIELLPLSCSDKPFDITIFYKDLIGLEGNELVDFMPSVGQKLEDMKDQ  255



>tpg|DAA42527.1| TPA: hypothetical protein ZEAMMB73_363757 [Zea mays]
 tpg|DAA42528.1| TPA: hypothetical protein ZEAMMB73_363757 [Zea mays]
Length=250

 Score =   328 bits (840),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+A KE++VYLVDASPKMF+  +  ++EK+ +HF   VNCI +SL+TQII RSYDEVA
Sbjct  21   QEREANKEMVVYLVDASPKMFTPATTQDNEKQETHFHTIVNCITESLKTQIIGRSYDEVA  80

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQD   VYVYNV +R+ LDRPTA+LIK+F  IED F   IGS+YGI  G
Sbjct  81   ICFFNTKEKKNLQDSAGVYVYNVGDREQLDRPTAKLIKDFSLIEDSFMSTIGSRYGITAG  140

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            SR+N+LY+ALWVAQALLRKGS KT  KRIL+FTNEDDPFG I G +K DM+RTT QRAKD
Sbjct  141  SRENTLYNALWVAQALLRKGSVKTVSKRILIFTNEDDPFGTITGAVKTDMIRTTLQRAKD  200

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGER  22
            AQDLG+SIELLPLS PD++FN+S+FYA+++GL+ DE+ ++    G++
Sbjct  201  AQDLGLSIELLPLSPPDDQFNMSLFYADLIGLDGDEMTEYLPSAGDK  247



>gb|AEO86623.1| Ku70 [Hordeum vulgare subsp. vulgare]
Length=623

 Score =   339 bits (869),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 193/235 (82%), Gaps = 1/235 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAE-DEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
             ER+A KE++VYL+DASPKMF+  + A+ DEK+ +HF   VNCI QSL+TQII RS DEV
Sbjct  21   HEREANKEMVVYLIDASPKMFTPANAAKADEKQETHFHTIVNCITQSLKTQIIGRSRDEV  80

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP  346
            AICF+NT+EKKNLQ+L  VYVYNV ER+ LDRP ARLIKEF  +ED F   IGS+YGI  
Sbjct  81   AICFFNTKEKKNLQELAGVYVYNVTEREQLDRPDARLIKEFSCVEDSFMNNIGSRYGITS  140

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
            GSR+N+LY+ALWVAQALLRKGS KT  KRIL+FTNEDDPFG I G  KADM+RTT QRAK
Sbjct  141  GSRENTLYNALWVAQALLRKGSVKTVSKRILIFTNEDDPFGGITGAAKADMIRTTIQRAK  200

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            DA+DLG+SIELLPLSRPDE+FN+S+FYAE++GLE DE+ Q+    GE+ ED+ DQ
Sbjct  201  DAKDLGLSIELLPLSRPDEDFNMSLFYAELIGLEGDEVLQYVPSAGEKLEDMTDQ  255



>ref|XP_009778730.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X2 [Nicotiana sylvestris]
Length=585

 Score =   337 bits (863),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 187/238 (79%), Gaps = 39/238 (16%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFY+ERDATKELLVYLVDASPKMFSTT P                              
Sbjct  20   SEFYKERDATKELLVYLVDASPKMFSTTCP------------------------------  49

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
                     TREKKNLQDL+ VYV+NVPER+DLDRPTARLIKEFD IE+RF KEIGSKYG
Sbjct  50   ---------TREKKNLQDLSGVYVFNVPEREDLDRPTARLIKEFDRIEERFDKEIGSKYG  100

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I PGSR+NSLY+ALWVAQALLRKGSAK ADKR+LLFTNEDDPFG +KGVIK DMMRTT Q
Sbjct  101  IVPGSRENSLYNALWVAQALLRKGSAKIADKRMLLFTNEDDPFGNLKGVIKVDMMRTTLQ  160

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGI+IELLPLSRPD+EFNVS+FY ++LGLE D+L QFKAL+GERFEDLKDQ
Sbjct  161  RAKDAQDLGIAIELLPLSRPDDEFNVSLFYTDLLGLEGDDLAQFKALVGERFEDLKDQ  218



>ref|NP_001059061.1| Os07g0184900 [Oryza sativa Japonica Group]
 sp|Q7F1M0.1|KU70_ORYSJ RecName: Full=ATP-dependent DNA helicase 2 subunit KU70; Short=OsKU70; 
AltName: Full=ATP-dependent DNA helicase 2 subunit 
1; AltName: Full=ATP-dependent DNA helicase II 70 kDa subunit 
[Oryza sativa Japonica Group]
 dbj|BAC83189.1| putative ATP-dependent DNA helicase II 70 kDa subunit [Oryza 
sativa Japonica Group]
 dbj|BAF20975.1| Os07g0184900 [Oryza sativa Japonica Group]
 dbj|BAG95371.1| unnamed protein product [Oryza sativa Japonica Group]
Length=624

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/234 (68%), Positives = 192/234 (82%), Gaps = 1/234 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+A KE++VYL+DASPKMF+  + A DEKE +HF   VNCI  +L+TQII RSYDEVA
Sbjct  21   QEREANKEMVVYLIDASPKMFTPATKA-DEKEETHFHTIVNCITHALKTQIIGRSYDEVA  79

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQ+L  VYVYNV ER+ LDRP ARLIKEF  IED F   IGS+YGI  G
Sbjct  80   ICFFNTKEKKNLQELAGVYVYNVTEREPLDRPDARLIKEFSCIEDSFMSNIGSRYGITSG  139

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            SR+N+LY+ALWVAQALLRKGS KT  KRI++FTNEDDPFG + G +K DM+RTT QRA+D
Sbjct  140  SRENTLYNALWVAQALLRKGSVKTVSKRIVIFTNEDDPFGGLTGAVKTDMIRTTIQRARD  199

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AQDLG+SIELLPLSRPDEEFN+S+FYA+++GLE DE+  +    GE+ ED+ +Q
Sbjct  200  AQDLGLSIELLPLSRPDEEFNMSLFYADLIGLEGDEIVDYLPSSGEKLEDMTNQ  253



>ref|XP_003557466.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 [Brachypodium 
distachyon]
Length=626

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 193/235 (82%), Gaps = 1/235 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAE-DEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
             ER+A KE++VYL+DASPKMF+  + A+ DEK+ +HF   VNCI QSL+TQII RS+DEV
Sbjct  21   HEREANKEMVVYLIDASPKMFTPATTAQSDEKQETHFHTIVNCITQSLKTQIIGRSHDEV  80

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP  346
            +ICF+NT+EKKNLQDL  VYVYNV ER+ LDRP ARLIKEF  IED F   IGS+YGI  
Sbjct  81   SICFFNTKEKKNLQDLAGVYVYNVTEREPLDRPDARLIKEFSCIEDSFMNNIGSRYGITS  140

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
            GSR+N+LY+ALWVAQALLRKGS KT  KRIL+FTNEDDPFG I G  K DM+RTT QRAK
Sbjct  141  GSRENTLYNALWVAQALLRKGSVKTVVKRILIFTNEDDPFGGITGAAKTDMIRTTIQRAK  200

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            DAQDLG+SIELLPLSRPDE+FN+S+FYA+++GLE D++ Q+    G++ ED+ +Q
Sbjct  201  DAQDLGLSIELLPLSRPDEDFNMSLFYADLIGLEGDDIVQYVPSAGDKLEDMTNQ  255



>ref|XP_002459446.1| hypothetical protein SORBIDRAFT_02g004740 [Sorghum bicolor]
 gb|EER95967.1| hypothetical protein SORBIDRAFT_02g004740 [Sorghum bicolor]
Length=628

 Score =   335 bits (859),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 194/234 (83%), Gaps = 0/234 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+A KE++VYLVDASPKMF+  +  ++EK+ +HF   V+CI +SL+TQII RSYDEVA
Sbjct  21   QEREANKEMVVYLVDASPKMFTPATTQDNEKQETHFRTIVSCITESLKTQIIGRSYDEVA  80

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQD   VYVYNV +R++LDRPTA+LIK+F  IED F   IGS+YGI  G
Sbjct  81   ICFFNTKEKKNLQDSAGVYVYNVGDREELDRPTAKLIKDFSSIEDSFMSTIGSRYGITSG  140

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            SR+N+LY+ALWVAQALLRKGS KT  KRIL+FTNEDDPFG I G +K DM+RTT QRAKD
Sbjct  141  SRENTLYNALWVAQALLRKGSVKTVSKRILIFTNEDDPFGTITGAVKTDMIRTTVQRAKD  200

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AQDLG+SIELLPLSRPDE+F++S+FYA+++GL+ DE+ ++    G R ED+ +Q
Sbjct  201  AQDLGLSIELLPLSRPDEQFDMSLFYADLIGLDGDEITEYLPSAGVRLEDMSNQ  254



>ref|XP_009613930.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X2 [Nicotiana tomentosiformis]
Length=585

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 187/238 (79%), Gaps = 39/238 (16%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            SEFY+ERDATKELLVYLVDASPKMFSTT P                              
Sbjct  20   SEFYKERDATKELLVYLVDASPKMFSTTCP------------------------------  49

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
                     TREKKNLQDL+ VYV+NVPER+DLDRPTARLIKEFD IE+ F KEIGSKYG
Sbjct  50   ---------TREKKNLQDLSGVYVFNVPEREDLDRPTARLIKEFDRIEEIFDKEIGSKYG  100

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I PGSR+NSLY+ALWVAQALLRKGSAKTADKR+LLFTNEDDPFG +KGVIK DMMRTT Q
Sbjct  101  IVPGSRENSLYNALWVAQALLRKGSAKTADKRMLLFTNEDDPFGNLKGVIKVDMMRTTLQ  160

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKDAQDLGI+IELLPLSRPD++FNVS+FY ++LGLE D+L QFKAL+GERFEDLKDQ
Sbjct  161  RAKDAQDLGIAIELLPLSRPDDDFNVSLFYTDLLGLEGDDLAQFKALVGERFEDLKDQ  218



>ref|XP_008668260.1| PREDICTED: uncharacterized protein LOC100381505 isoform X1 [Zea 
mays]
Length=628

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 193/234 (82%), Gaps = 0/234 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+A KE++VYLVDASPKMF+  +  ++EK+ +HF   VNCI +SL+TQII RSYDEVA
Sbjct  21   QEREANKEMVVYLVDASPKMFTPATTQDNEKQETHFHTIVNCITESLKTQIIGRSYDEVA  80

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQD   VYVYNV +R+ LDRPTA+LIK+F  IED F   IGS+YGI  G
Sbjct  81   ICFFNTKEKKNLQDSAGVYVYNVGDREQLDRPTAKLIKDFSLIEDSFMSTIGSRYGITAG  140

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            SR+N+LY+ALWVAQALLRKGS KT  KRIL+FTNEDDPFG I G +K DM+RTT QRAKD
Sbjct  141  SRENTLYNALWVAQALLRKGSVKTVSKRILIFTNEDDPFGTITGAVKTDMIRTTLQRAKD  200

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AQDLG+SIELLPLS PD++FN+S+FYA+++GL+ DE+ ++    G++ ED+ +Q
Sbjct  201  AQDLGLSIELLPLSPPDDQFNMSLFYADLIGLDGDEMTEYLPSAGDKLEDMTNQ  254



>gb|ADO00728.1| Ku70 [Triticum aestivum]
Length=626

 Score =   333 bits (855),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 190/235 (81%), Gaps = 1/235 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAE-DEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
             ER+A KE++VYL+DASPKMF+  + A+ DE + +HF   VNCI QSL+TQII RS DEV
Sbjct  21   HEREANKEMVVYLIDASPKMFTPANAAKPDEMQETHFHTIVNCITQSLKTQIIGRSRDEV  80

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP  346
            AICF+NT+EKKNLQ+L  VYVYN  ER+ LDRP ARLIKEF  +ED F   IGS+YGI  
Sbjct  81   AICFFNTKEKKNLQELAGVYVYNATEREQLDRPDARLIKEFSCVEDSFMNTIGSRYGITS  140

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
            GSR+N+LY+ALWVAQALLRKGS KT  KRIL+FTNEDDPFG I G  K DM+RTT QRAK
Sbjct  141  GSRENTLYNALWVAQALLRKGSVKTVSKRILIFTNEDDPFGGITGAAKTDMIRTTIQRAK  200

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            DAQDLG+SIELLPLSRPDE+FN+S+FYA+++GLE DE+ Q+    GE+ ED+ DQ
Sbjct  201  DAQDLGLSIELLPLSRPDEDFNMSLFYADLIGLEGDEVLQYVPSAGEKLEDMTDQ  255



>ref|XP_002461302.1| hypothetical protein SORBIDRAFT_02g000480 [Sorghum bicolor]
 gb|EER97823.1| hypothetical protein SORBIDRAFT_02g000480 [Sorghum bicolor]
Length=628

 Score =   328 bits (840),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 194/234 (83%), Gaps = 0/234 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+A K+++VYLVDASPKMF+  +  ++EK+ ++F   VNCI +SL+TQII RSYDEVA
Sbjct  21   QEREANKDMVVYLVDASPKMFTPATTQDNEKQETYFHTIVNCITESLKTQIIGRSYDEVA  80

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQD   VYVYNV +R+ LDRPTA+LIK+F  IED F   IGS++GI  G
Sbjct  81   ICFFNTKEKKNLQDSAGVYVYNVGDREQLDRPTAKLIKDFSCIEDSFMSTIGSRFGITAG  140

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            SR+N+LY+ALWVAQALLRKGS KT  KRIL+FTNEDDPFG + G +K DM+RTT QRAKD
Sbjct  141  SRENTLYNALWVAQALLRKGSVKTVSKRILIFTNEDDPFGTVTGAVKTDMIRTTIQRAKD  200

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AQDLG+SIELLPLS+PDE+F++S+FYA+++GL+ DE+ ++    G++ ED+ +Q
Sbjct  201  AQDLGLSIELLPLSQPDEQFDMSLFYADLIGLDGDEITEYLPSAGDKLEDMANQ  254



>gb|AAT48365.1| Ku70-like protein [Vigna radiata]
Length=629

 Score =   326 bits (835),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 192/234 (82%), Gaps = 1/234 (0%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPA-EDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            E + +KE +VYLVDASPKMF+T  P  E +K  SHF +A++CI+Q+L+TQII RSYD+VA
Sbjct  24   EGELSKEYVVYLVDASPKMFNTLFPTQEHQKLESHFHIAISCISQTLKTQIITRSYDQVA  83

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NTREKKNLQDL  V+V+NVPER+ LDRPTARLIKEFD +E+ FSK IGS++GI   
Sbjct  84   ICFFNTREKKNLQDLKSVFVFNVPEREFLDRPTARLIKEFDQLEELFSKNIGSQHGIVSD  143

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            +R+NSLY+A+W AQALLRKGSAKT DKRILLFTN+DDPFG IKG  K+DM+R T QRAKD
Sbjct  144  TRENSLYNAIWAAQALLRKGSAKTVDKRILLFTNDDDPFGSIKGAAKSDMIRMTLQRAKD  203

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            AQDLGISIE+LPLS PD  F +S FYA+++GLE D+L  F    G++ ED+K Q
Sbjct  204  AQDLGISIEILPLSCPDGVFKISQFYADLIGLEGDDLVDFMPEAGKKLEDMKSQ  257



>gb|EMT11495.1| ATP-dependent DNA helicase 2 subunit 1 [Aegilops tauschii]
Length=1072

 Score =   334 bits (857),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 191/235 (81%), Gaps = 1/235 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAE-DEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
             ER+A KE++VYL+DASP+MF+  + A+ DEK+ +HF   VNCI QSL+ QII RS DEV
Sbjct  411  HEREANKEMVVYLIDASPRMFTPANAAKPDEKQETHFHTIVNCITQSLKMQIIGRSRDEV  470

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP  346
            AICF+NT+EKKNLQ+L  VYVYNV ER+ LDRP ARLIKEF  +ED F   IGS+YGI  
Sbjct  471  AICFFNTKEKKNLQELAGVYVYNVTEREQLDRPDARLIKEFSCVEDSFMNNIGSRYGITS  530

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
            GSR+N+LY+ALWVAQALLRKGS KT  KRIL+FTNEDDPFG I G  K DM+RTT QRAK
Sbjct  531  GSRENTLYNALWVAQALLRKGSVKTVSKRILIFTNEDDPFGGITGAAKTDMIRTTIQRAK  590

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            DAQDLG+SIELLPLSRPDE+FN+S+FYA+++GLE DE+ Q+    GE+ ED+ DQ
Sbjct  591  DAQDLGLSIELLPLSRPDEDFNMSLFYADLIGLEGDEVVQYVPSAGEKLEDMTDQ  645



>gb|EPS73529.1| hypothetical protein M569_01226 [Genlisea aurea]
Length=619

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 195/235 (83%), Gaps = 2/235 (1%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            + ERDAT E++VY+VDASPKMFST   + DEK+ SHFE+ V  IAQSL+TQII+RSYDEV
Sbjct  21   HTERDATMEMVVYVVDASPKMFSTLCQSGDEKDVSHFEIVVRGIAQSLKTQIISRSYDEV  80

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP  346
            AICF+NTREKKNLQDLN VYVYNV +R DLDR TA LI+EFD I+    K++GSKYGI  
Sbjct  81   AICFFNTREKKNLQDLNGVYVYNVHDRKDLDRITALLIQEFDCIQG--YKQVGSKYGILS  138

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
             +RDNSLY+ALWVAQALLRKG+AK  DKRILLFTNEDDPFG ++GV K DMMRTT QRA+
Sbjct  139  ETRDNSLYNALWVAQALLRKGNAKRVDKRILLFTNEDDPFGNVRGVTKMDMMRTTLQRAQ  198

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            D +DLGISIELLPLS+P ++FN+S FYAE+L L + EL  F AL  ERFED+KDQ
Sbjct  199  DTEDLGISIELLPLSKPGDQFNLSTFYAELLELGESELADFNALAAERFEDMKDQ  253



>ref|XP_006657510.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like [Oryza 
brachyantha]
Length=597

 Score =   320 bits (819),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -1

Query  678  LLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTRE  499
            ++VYL+DASPKMF+  + A+ + + +HF   VNCI  +L+TQII RSYDEVAICF+NT+E
Sbjct  1    MVVYLIDASPKMFTPATTAQADDKETHFCTIVNCITHALKTQIIGRSYDEVAICFFNTKE  60

Query  498  KKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDNSLYS  319
            KKNLQ+L  VYVYNV +R+ LDRP ARLIKEF  IED F   IGS+YGI  GSR+N+LY+
Sbjct  61   KKNLQELAGVYVYNVTDREPLDRPDARLIKEFSCIEDSFMSNIGSRYGITAGSRENTLYN  120

Query  318  ALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISI  139
            ALWVAQALLRKGS KT  KRI++FTNEDDPFG + G +K DM+RTT QRA+DAQDLG+SI
Sbjct  121  ALWVAQALLRKGSVKTVSKRIVIFTNEDDPFGGLTGSVKTDMIRTTIQRARDAQDLGLSI  180

Query  138  ELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            ELLPLSRPDEEFN+S+FYA+++GLE DE+ ++    GE+ ED+ +Q
Sbjct  181  ELLPLSRPDEEFNMSLFYADLIGLEGDEIVEYLPSSGEKLEDMTNQ  226



>ref|XP_003592861.1| ATP-dependent DNA helicase 2 subunit [Medicago truncatula]
Length=432

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/240 (63%), Positives = 192/240 (80%), Gaps = 2/240 (1%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            + F    D+ KE +VYLVDASP MF TTS +E E++ SHF++A++CI+ SL+  IIN+S 
Sbjct  23   NSFQNNNDSNKEFVVYLVDASPNMFITTSSSESEEQESHFQIALSCISDSLKAMIINKSL  82

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPER--DDLDRPTARLIKEFDHIEDRFSKEIGSK  361
            D++AICF+NT+EKKNLQDLN VYV++V E   D LDRPTA+LIK+FD++   FSK IGS+
Sbjct  83   DQIAICFFNTKEKKNLQDLNGVYVFHVAEEGTDYLDRPTAKLIKQFDNLHHSFSKNIGSQ  142

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
            +G+  GSR+N LY+A+WVAQALLRKGSAKT DKRILLFTN+DDPFG +KG  K+DM RTT
Sbjct  143  HGVMSGSRENPLYNAIWVAQALLRKGSAKTIDKRILLFTNQDDPFGSLKGPFKSDMTRTT  202

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
             QRAKD QDLGI+IELLPLS PD+ F+VS FY +++GLE D+L  F A  G + ED+KDQ
Sbjct  203  LQRAKDTQDLGITIELLPLSFPDQTFDVSKFYVDLIGLEGDDLVNFVASAGNKLEDMKDQ  262



>ref|XP_004497482.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like [Cicer 
arietinum]
Length=652

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 191/230 (83%), Gaps = 2/230 (1%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            +  D+TKE +VYLVDASPKMF+TT  +E++   +HF++A++ I+ SL++QIIN+SYD+VA
Sbjct  25   ENNDSTKEYVVYLVDASPKMFTTTCQSENQDVETHFQIALSSISHSLKSQIINKSYDQVA  84

Query  522  ICFYNTREKKNLQDLNCVYVYNVP-ERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP  346
            ICF+NTREK NLQDLN VYV+NV  ER+ LD P A  IK+FD ++D FSK IGS +G+  
Sbjct  85   ICFFNTREKNNLQDLNAVYVFNVAAEREYLDMPNASFIKQFDLLQDTFSKNIGSHHGVMS  144

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
            GSR+N LY+A+WVAQALLRKGSAKT DKRILLFTNEDDPFGC+KG IK+DM RTT QRAK
Sbjct  145  GSRENPLYNAIWVAQALLRKGSAKTVDKRILLFTNEDDPFGCVKGAIKSDMTRTTLQRAK  204

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFE  16
            DAQDLGI+IELLPLS PDE F++S FYA+++GLE D+L QF + I + FE
Sbjct  205  DAQDLGITIELLPLSCPDEMFDLSKFYADLIGLEGDDL-QFISRIYKIFE  253



>ref|XP_007142604.1| hypothetical protein PHAVU_007G001600g [Phaseolus vulgaris]
 gb|ESW14598.1| hypothetical protein PHAVU_007G001600g [Phaseolus vulgaris]
Length=619

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 190/233 (82%), Gaps = 3/233 (1%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAI  520
            E ++TKE +VYLVDASPKMF+    +  E   ++F +A++CI+Q+L+TQII+RSYD+VAI
Sbjct  24   EDESTKEYVVYLVDASPKMFNAVCTSNLE---TYFHIAISCISQTLKTQIISRSYDQVAI  80

Query  519  CFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGS  340
            CF+NTREK+NLQ LN V+V+ VPER+ LDRPTARLIKEFD +E+ FSK IGS++GI   +
Sbjct  81   CFFNTREKQNLQGLNSVFVFTVPEREFLDRPTARLIKEFDQLEESFSKHIGSQHGIVSDT  140

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
            R+NSLY+A+W AQALLRKGSAKT DKRILLFTN+DDPFG I G  K+DM+R T QRAKDA
Sbjct  141  RENSLYNAIWAAQALLRKGSAKTIDKRILLFTNDDDPFGSIIGAAKSDMIRMTLQRAKDA  200

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            QDLGISIELLPLS  DE FNVS FYA+++GL+ D+L  F    G + ED+KDQ
Sbjct  201  QDLGISIELLPLSCSDEVFNVSQFYADLIGLQGDDLVDFIPAAGNKLEDMKDQ  253



>gb|AAF99835.1|AC051629_2 Hypothetical protein [Arabidopsis thaliana]
Length=607

 Score =   315 bits (806),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 177/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  621  EDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREKKNLQDLNCVYVYNVPERD  442
            E++K+ SHF +AV+CIAQSL+  IINRS DE+AICF+NTREKKNLQDLN VYV+NVPERD
Sbjct  24   EEDKQESHFHIAVSCIAQSLKAHIINRSNDEIAICFFNTREKKNLQDLNGVYVFNVPERD  83

Query  441  DLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDNSLYSALWVAQALLRKGSAKTADK  262
             +DRPTARLIKEFD IE+ F KEIGS+ GI   SR+NSLYSALWVAQALLRKGS KTADK
Sbjct  84   SIDRPTARLIKEFDLIEESFDKEIGSQTGIVSDSRENSLYSALWVAQALLRKGSLKTADK  143

Query  261  RILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISIELLPLSRPDEEFNVSIFYA  82
            R+ LFTNEDDPFG ++  +K DM RTT QRAKDAQDLGISIELLPLS+PD++FN+++FY 
Sbjct  144  RMFLFTNEDDPFGSMRISVKEDMTRTTLQRAKDAQDLGISIELLPLSQPDKQFNITLFYK  203

Query  81   EMLGLEDDELDQFKALIGERFEDLKDQ  1
            +++GL  DEL +F   +G++ ED+KDQ
Sbjct  204  DLIGLNSDELTEFMPSVGQKLEDMKDQ  230



>ref|XP_007142605.1| hypothetical protein PHAVU_007G001600g [Phaseolus vulgaris]
 gb|ESW14599.1| hypothetical protein PHAVU_007G001600g [Phaseolus vulgaris]
Length=625

 Score =   315 bits (807),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 190/233 (82%), Gaps = 3/233 (1%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAI  520
            E ++TKE +VYLVDASPKMF+    +  E   ++F +A++CI+Q+L+TQII+RSYD+VAI
Sbjct  24   EDESTKEYVVYLVDASPKMFNAVCTSNLE---TYFHIAISCISQTLKTQIISRSYDQVAI  80

Query  519  CFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGS  340
            CF+NTREK+NLQ LN V+V+ VPER+ LDRPTARLIKEFD +E+ FSK IGS++GI   +
Sbjct  81   CFFNTREKQNLQGLNSVFVFTVPEREFLDRPTARLIKEFDQLEESFSKHIGSQHGIVSDT  140

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
            R+NSLY+A+W AQALLRKGSAKT DKRILLFTN+DDPFG I G  K+DM+R T QRAKDA
Sbjct  141  RENSLYNAIWAAQALLRKGSAKTIDKRILLFTNDDDPFGSIIGAAKSDMIRMTLQRAKDA  200

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            QDLGISIELLPLS  DE FNVS FYA+++GL+ D+L  F    G + ED+KDQ
Sbjct  201  QDLGISIELLPLSCSDEVFNVSQFYADLIGLQGDDLVDFIPAAGNKLEDMKDQ  253



>ref|XP_010650419.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70 isoform 
X2 [Vitis vinifera]
Length=602

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 174/207 (84%), Gaps = 0/207 (0%)
 Frame = -1

Query  621  EDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREKKNLQDLNCVYVYNVPERD  442
            ED+K+ + F  AV+CI+QSL+TQIIN S DEVAICF+NTREKKNLQDLN V+V+NV ER+
Sbjct  26   EDQKDETPFHAAVSCISQSLKTQIINNSNDEVAICFFNTREKKNLQDLNGVFVFNVAERE  85

Query  441  DLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDNSLYSALWVAQALLRKGSAKTADK  262
             LDRPTARLIKEFD IE+ F KEIGS+YGI  GSR+NSLY+ALW AQALLRKGSAKTADK
Sbjct  86   YLDRPTARLIKEFDRIEELFMKEIGSQYGIMSGSRENSLYNALWAAQALLRKGSAKTADK  145

Query  261  RILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISIELLPLSRPDEEFNVSIFYA  82
            RILLFTNEDDPFG I G  K DM RTT QRAKD QDLGISIELLPLS PDEEFNVS FYA
Sbjct  146  RILLFTNEDDPFGSITGATKMDMTRTTLQRAKDTQDLGISIELLPLSCPDEEFNVSAFYA  205

Query  81   EMLGLEDDELDQFKALIGERFEDLKDQ  1
            +++GLE D+L  F   +G++  D+K+Q
Sbjct  206  DLIGLEGDDLALFMPSVGDKLTDMKNQ  232



>gb|KCW69914.1| hypothetical protein EUGRSUZ_F032412, partial [Eucalyptus grandis]
Length=579

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  621  EDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREKKNLQDLNCVYVYNVPERD  442
            ED+K+ SHF++A +CI +SL+TQIINRSYDEVA+CF+NTREKKNLQDLN V+V+NV +R+
Sbjct  1    EDQKDESHFQIATSCILESLKTQIINRSYDEVAVCFFNTREKKNLQDLNNVFVFNVADRE  60

Query  441  DLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDNSLYSALWVAQALLRKGSAKTADK  262
             LDRPTA+ IKEF  +E+ F K+IGS+YGI  GSR+NSLY+ALWVAQALLRKGSAKTADK
Sbjct  61   FLDRPTAKFIKEFSRLEEFFMKDIGSQYGIVSGSRENSLYNALWVAQALLRKGSAKTADK  120

Query  261  RILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISIELLPLSRPDEEFNVSIFYA  82
            RIL+FT+EDDPFG IKG  KADM RTT QRAKDAQDLGISIELLPLS+ D EFN+S+FYA
Sbjct  121  RILIFTDEDDPFGNIKGGAKADMTRTTLQRAKDAQDLGISIELLPLSQLDREFNISLFYA  180

Query  81   EMLGLEDDELDQFKALIGERFEDLKDQ  1
            +++GL+ + L QF    GER ED+K Q
Sbjct  181  DLIGLQGENLAQFMPAAGERMEDMKYQ  207



>gb|KGN53122.1| hypothetical protein Csa_4G017100 [Cucumis sativus]
Length=549

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 175/201 (87%), Gaps = 0/201 (0%)
 Frame = -1

Query  621  EDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREKKNLQDLNCVYVYNVPERD  442
            ED+KE +HF+VA++CI+QSL+TQIINRSYDEVAICF+NTREKKNLQDLN V+V NVPER+
Sbjct  23   EDKKEETHFQVALSCISQSLKTQIINRSYDEVAICFFNTREKKNLQDLNGVFVLNVPERE  82

Query  441  DLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDNSLYSALWVAQALLRKGSAKTADK  262
            DLDRPTARL+K  D IE+ F KEIGS+YGI  GSR+N+LY+ALW AQALLRKGSAKT DK
Sbjct  83   DLDRPTARLLKTIDGIEEVFMKEIGSQYGIVSGSRENALYNALWAAQALLRKGSAKTLDK  142

Query  261  RILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISIELLPLSRPDEEFNVSIFYA  82
            RILLFTNEDDPFG IKG  K D++RTT QRAKDAQDLGISIEL PLS P+E+FN+S+FYA
Sbjct  143  RILLFTNEDDPFGSIKGATKFDLIRTTLQRAKDAQDLGISIELFPLSCPNEQFNLSLFYA  202

Query  81   EMLGLEDDELDQFKALIGERF  19
            +++GLE  +L Q+    G+RF
Sbjct  203  DLVGLEGGDLVQYLPSAGDRF  223



>gb|ABR16802.1| unknown [Picea sitchensis]
Length=630

 Score =   312 bits (799),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 181/236 (77%), Gaps = 0/236 (0%)
 Frame = -1

Query  708  FYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDE  529
            + Q+R+A K+ ++Y++DA P MF      ++ K  +HF   V CI +SL+ +IINR YDE
Sbjct  20   YTQDREANKDFVIYMIDAGPDMFFEIKQEDEGKTETHFSTVVKCIVESLKIRIINRDYDE  79

Query  528  VAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIE  349
            VAICFYNTREKKN+Q+   VYV+NVPER++LD PTARLIK+   IED+F +EIGS+  I 
Sbjct  80   VAICFYNTREKKNMQESEGVYVFNVPEREELDHPTARLIKDLSCIEDKFKREIGSQSAII  139

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
            PGSR+N LY+ALWVAQ LLRKGS  + DKRI LFTN DDPFG + G  KADM RTT QRA
Sbjct  140  PGSRENPLYNALWVAQGLLRKGSTHSTDKRIQLFTNNDDPFGNVDGGAKADMRRTTIQRA  199

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            KDAQDLGISIEL PL+RP EEFNVSIFYA++  LE +E+ QF  +  E+FEDLKDQ
Sbjct  200  KDAQDLGISIELFPLNRPGEEFNVSIFYADIFELEKEEVSQFMPMAVEKFEDLKDQ  255



>gb|EMS60366.1| ATP-dependent DNA helicase 2 subunit KU70 [Triticum urartu]
Length=655

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 174/209 (83%), Gaps = 1/209 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAE-DEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
             ER+A KE++VYL+DASPKMF+  + A+ DEK+ +HF   VNCI QSL+TQII RS DEV
Sbjct  21   HEREANKEMVVYLIDASPKMFTPANAAKPDEKQETHFHTIVNCITQSLKTQIIGRSRDEV  80

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP  346
            AICF+NT+EKKNLQ+L  VYVYNV ER+ LDRP ARLIKEF  +ED F   IGS+YGI  
Sbjct  81   AICFFNTKEKKNLQELAGVYVYNVTEREQLDRPDARLIKEFSCVEDSFMNNIGSRYGITS  140

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
            GSR+N+LY+ALWVAQALLRKGS KT  KRIL+FTNEDDPFG I G  K DM+RTT QRAK
Sbjct  141  GSRENTLYNALWVAQALLRKGSVKTVSKRILIFTNEDDPFGGITGAAKTDMIRTTIQRAK  200

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAE  79
            DAQDLG+SIELLPLSRPDE+FN+S+FYA+
Sbjct  201  DAQDLGLSIELLPLSRPDEDFNMSLFYAD  229



>gb|KHN27146.1| ATP-dependent DNA helicase 2 subunit KU70 [Glycine soja]
Length=229

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = -1

Query  621  EDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREKKNLQDLNCVYVYNVPERD  442
            +D+   +HF +A++CI+Q+L +QIINRSYD+VAICF+NTREK NLQDLN V+V+NVPER+
Sbjct  14   DDQNGETHFHIAISCISQTLESQIINRSYDQVAICFFNTREKNNLQDLNSVFVFNVPERE  73

Query  441  DLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDNSLYSALWVAQALLRKGSAKTADK  262
             LDRPTARLIKEF  +E+ FSK IGS++GI  G+R+NSLY+A+W AQALLRKGSAKT DK
Sbjct  74   FLDRPTARLIKEFYQLEESFSKIIGSQHGIVSGTRENSLYNAIWAAQALLRKGSAKTVDK  133

Query  261  RILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISIELLPLSRPDEEFNVSIFYA  82
            RILLFTN+DDPFG IKG +K+DM R T QRAKDAQDLGISIELLPLS PDE FNVS FYA
Sbjct  134  RILLFTNDDDPFGSIKGAVKSDMTRMTLQRAKDAQDLGISIELLPLSHPDEVFNVSQFYA  193

Query  81   EMLGLEDDELDQFKALIGERF  19
            +++GLE D+L  F    G+++
Sbjct  194  DLIGLEGDDLVDFMPSAGKKY  214



>gb|AES63112.2| ATP-dependent DNA helicase 2 subunit Ku70 [Medicago truncatula]
Length=634

 Score =   310 bits (794),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/240 (63%), Positives = 192/240 (80%), Gaps = 2/240 (1%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
            + F    D+ KE +VYLVDASP MF TTS +E E++ SHF++A++CI+ SL+  IIN+S 
Sbjct  23   NSFQNNNDSNKEFVVYLVDASPNMFITTSSSESEEQESHFQIALSCISDSLKAMIINKSL  82

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPER--DDLDRPTARLIKEFDHIEDRFSKEIGSK  361
            D++AICF+NT+EKKNLQDLN VYV++V E   D LDRPTA+LIK+FD++   FSK IGS+
Sbjct  83   DQIAICFFNTKEKKNLQDLNGVYVFHVAEEGTDYLDRPTAKLIKQFDNLHHSFSKNIGSQ  142

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
            +G+  GSR+N LY+A+WVAQALLRKGSAKT DKRILLFTN+DDPFG +KG  K+DM RTT
Sbjct  143  HGVMSGSRENPLYNAIWVAQALLRKGSAKTIDKRILLFTNQDDPFGSLKGPFKSDMTRTT  202

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
             QRAKD QDLGI+IELLPLS PD+ F+VS FY +++GLE D+L  F A  G + ED+KDQ
Sbjct  203  LQRAKDTQDLGITIELLPLSFPDQTFDVSKFYVDLIGLEGDDLVNFVASAGNKLEDMKDQ  262



>gb|EAZ38936.1| hypothetical protein OsJ_23357 [Oryza sativa Japonica Group]
Length=594

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 168/200 (84%), Gaps = 1/200 (1%)
 Frame = -1

Query  681  ELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTR  502
            E++VYL+DASPKMF+  + A DEKE +HF   VNCI  +L+TQII RSYDEVAICF+NT+
Sbjct  268  EMVVYLIDASPKMFTPATKA-DEKEETHFHTIVNCITHALKTQIIGRSYDEVAICFFNTK  326

Query  501  EKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDNSLY  322
            EKKNLQ+L  VYVYNV ER+ LDRP ARLIKEF  IED F   IGS+YGI  GSR+N+LY
Sbjct  327  EKKNLQELAGVYVYNVTEREPLDRPDARLIKEFSCIEDSFMSNIGSRYGITSGSRENTLY  386

Query  321  SALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGIS  142
            +ALWVAQALLRKGS KT  KRI++FTNEDDPFG + G +K DM+RTT QRA+DAQDLG+S
Sbjct  387  NALWVAQALLRKGSVKTVSKRIVIFTNEDDPFGGLTGAVKTDMIRTTIQRARDAQDLGLS  446

Query  141  IELLPLSRPDEEFNVSIFYA  82
            IELLPLSRPDEEFN+S+FYA
Sbjct  447  IELLPLSRPDEEFNMSLFYA  466



>ref|XP_004959001.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU70-like [Setaria 
italica]
Length=664

 Score =   306 bits (784),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 184/245 (75%), Gaps = 11/245 (4%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            Q R   KE++VYLV AS KMF+  +  EDEK+ +HF   V CI QSL+TQII  SYDEVA
Sbjct  21   QVRSCNKEMVVYLVYASLKMFTPATTQEDEKQETHFHTIVYCITQSLKTQIIGGSYDEVA  80

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQDL  VYVYNV +RD LDRPTA+LIK+F  IED F   IGS+YGI  G
Sbjct  81   ICFFNTKEKKNLQDLAGVYVYNVGDRDPLDRPTAKLIKDFSCIEDSFMSNIGSRYGITAG  140

Query  342  SRDNSLYSALWVAQALLRKG----SAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            SR+N+LY+ALWVAQ LLRKG    + KT  KRI +FTNEDDPFG + G +K DM+RTT Q
Sbjct  141  SRENTLYNALWVAQTLLRKGYQLTNMKTVSKRIPIFTNEDDPFGDMTGAVKTDMIRTTIQ  200

Query  174  RAK-------DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFE  16
            RAK       DAQDLG SIELLPLSRPDEEFN+S+FYA+++GL+  E+ ++    GE+ E
Sbjct  201  RAKVLLAFLWDAQDLGRSIELLPLSRPDEEFNMSLFYADLIGLDGGEITEYLPSAGEKLE  260

Query  15   DLKDQ  1
            D+ DQ
Sbjct  261  DMTDQ  265



>ref|XP_006850259.1| hypothetical protein AMTR_s00020p00070810 [Amborella trichopoda]
 gb|ERN11840.1| hypothetical protein AMTR_s00020p00070810 [Amborella trichopoda]
Length=625

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 185/238 (78%), Gaps = 4/238 (2%)
 Frame = -1

Query  714  SEFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSY  535
             EF+QER+++KE +VYL+DA P+M +  +     K  SHF  A  CI +SL+T IINR Y
Sbjct  18   GEFFQERESSKEFVVYLIDARPEMLAQDA----GKSESHFHAANRCITESLKTLIINRDY  73

Query  534  DEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG  355
            DEVAICF+NT+EKKN+QDL+ VYV+NVPER++LDRPTARLIKEF HIE++F  +IGS+ G
Sbjct  74   DEVAICFFNTKEKKNMQDLDSVYVFNVPEREELDRPTARLIKEFSHIEEKFLTKIGSRNG  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I P +R+NSLY+A+WV+Q LLR+GS+K  DKRILLFTNEDDPF  + G  K+DM+RTT Q
Sbjct  134  IIPMTRENSLYNAIWVSQGLLRRGSSKNVDKRILLFTNEDDPFRHVDGATKSDMIRTTLQ  193

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKDQ  1
            RAKD QDL ISIEL P+ RP  EFN   FYAE+LGLE +EL +F  L  E+ ED+ DQ
Sbjct  194  RAKDVQDLSISIELFPMCRPGTEFNTYKFYAELLGLEGEELSEFLPLAAEKIEDMVDQ  251



>tpg|DAA42529.1| TPA: hypothetical protein ZEAMMB73_363757 [Zea mays]
Length=907

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 157/220 (71%), Gaps = 35/220 (16%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+A KE++VYLVDASPKMF+  +  ++EK+ +HF   VNCI +SL+TQII RSYDEVA
Sbjct  21   QEREANKEMVVYLVDASPKMFTPATTQDNEKQETHFHTIVNCITESLKTQIIGRSYDEVA  80

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQD   VYVYNV +R+ LDRPTA+LIK+F  IED F   IGS+YGI  G
Sbjct  81   ICFFNTKEKKNLQDSAGVYVYNVGDREQLDRPTAKLIKDFSLIEDSFMSTIGSRYGITAG  140

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            SR+N+LY+ALWVAQALLRKGS KT                                   D
Sbjct  141  SRENTLYNALWVAQALLRKGSVKT-----------------------------------D  165

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQF  43
            AQDLG+SIELLPLS PD++FN+S+FYA+++GL+ DE+ ++
Sbjct  166  AQDLGLSIELLPLSPPDDQFNMSLFYADLIGLDGDEMTEY  205



>gb|ACG47682.1| hypothetical protein [Zea mays]
Length=178

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            QER+A KE++VYLVDASPKMF+  +  ++EK+ +HF   VNCI +SL+TQII RSYDEVA
Sbjct  21   QEREANKEMVVYLVDASPKMFTPATTQDNEKQETHFHTIVNCITESLKTQIIGRSYDEVA  80

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            ICF+NT+EKKNLQD   VYVYNV +R+ LDRPTA+LIK+F  IED F   IGS+YGI  G
Sbjct  81   ICFFNTKEKKNLQDSAGVYVYNVGDREQLDRPTAKLIKDFSLIEDSFMSTIGSRYGITAG  140

Query  342  SRDNSLYSALWVAQALL  292
            SR+N+LY+ALWVA+ +L
Sbjct  141  SRENTLYNALWVARFML  157



>ref|XP_002962490.1| hypothetical protein SELMODRAFT_165509 [Selaginella moellendorffii]
 gb|EFJ35953.1| hypothetical protein SELMODRAFT_165509 [Selaginella moellendorffii]
Length=564

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -1

Query  576  IAQSLRTQIINRSYDEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDH  397
            I + L+T+II+R  DEV ICF NTREK N      VY +      +L + +A  IK+   
Sbjct  4    ITEDLKTRIISRDTDEVGICFINTREKNNSLSSEGVYTFK-----ELSKLSASFIKDTSS  58

Query  396  IEDRFSKEIGSKYGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCI  217
            + + F   IGS  G   G+R+N LYS LWVAQ +L K + K   KRILLFTN DDPF   
Sbjct  59   LCENFDSVIGSNDGSNYGARENPLYSGLWVAQGMLGKSATKNLGKRILLFTNNDDPFENA  118

Query  216  KGVIKADMMRTTFQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKA  37
              V KADM RTT QRAKD+QDLGISIEL P+SRP EEFN++IFY +M+ +EDDEL  F  
Sbjct  119  DPVTKADMRRTTIQRAKDSQDLGISIELYPMSRPGEEFNLNIFYKDMITMEDDELSNFMV  178

Query  36   LIGERFEDLK  7
               +RFE+LK
Sbjct  179  GAEKRFEELK  188



>ref|XP_002962795.1| hypothetical protein SELMODRAFT_78255 [Selaginella moellendorffii]
 gb|EFJ36258.1| hypothetical protein SELMODRAFT_78255 [Selaginella moellendorffii]
Length=565

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 124/190 (65%), Gaps = 5/190 (3%)
 Frame = -1

Query  576  IAQSLRTQIINRSYDEVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDH  397
            I + L+T+II+R  DEV ICF NTREK N      VY +      +L + +A  IK+   
Sbjct  4    ITEDLKTRIISRDSDEVGICFINTREKNNSLSSEGVYTFK-----ELSKLSASFIKDTSS  58

Query  396  IEDRFSKEIGSKYGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCI  217
            + + F   IGS  G   G+R+N LY+ LWVAQ +L K + K   KRILLFTN DDPF   
Sbjct  59   LCENFDSVIGSNDGSNYGARENPLYNGLWVAQGMLGKSATKNLGKRILLFTNNDDPFENA  118

Query  216  KGVIKADMMRTTFQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKA  37
              V KADM RTT QRAKD+QDLGISIEL P+SRP EEFN++IFY +M+ +EDDEL  F  
Sbjct  119  DPVTKADMRRTTIQRAKDSQDLGISIELYPMSRPGEEFNLNIFYKDMITMEDDELSNFMV  178

Query  36   LIGERFEDLK  7
               +RFE+LK
Sbjct  179  GAEKRFEELK  188



>ref|XP_001781270.1| predicted protein [Physcomitrella patens]
 gb|EDQ53886.1| predicted protein [Physcomitrella patens]
Length=606

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 139/230 (60%), Gaps = 14/230 (6%)
 Frame = -1

Query  690  ATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFY  511
            A KE LVYL+D+   M         EK  S  + A+  + ++L+ +II R  D+V ICF+
Sbjct  27   ANKEYLVYLIDSGCDMMLPF-----EKGESCLKWAMKAVEENLKKRIIARD-DKVGICFF  80

Query  510  NTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDN  331
            NT +KKN+Q+ + VYV++  E DDL   +A LI+ F  +   F K+IGS+      +R++
Sbjct  81   NTLKKKNIQEADGVYVWS--ELDDL---SAELIRNFRSLHGSFQKDIGSQVTAAANAREH  135

Query  330  SLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIK-GVIKADMMRTTFQRAKDAQD  154
             L+ ALWV QA+LR G  K  +K +++ TN DDPFG I    ++ D+ RTT QRA DAQD
Sbjct  136  PLHDALWVVQAMLRSG-VKNVEKSVVIITNNDDPFGDINDAFVRKDLERTTIQRALDAQD  194

Query  153  LGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDLKD  4
            LGI+IEL+ L+ PD+ F+ + FY  +   E +E     +    RF+DL D
Sbjct  195  LGINIELVALNTPDKLFDKT-FYNMITQFEGNEDASQDSEPSSRFDDLVD  243



>ref|XP_004380026.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
1 [Trichechus manatus latirostris]
Length=612

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/220 (37%), Positives = 120/220 (55%), Gaps = 24/220 (11%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + +   DE E + FE+++ CI      +II+   D +
Sbjct  31   YSGRDS----LIFLVDASRAMFESQNEG-DENELTPFEMSIECILSVYTNKIISSDRDLL  85

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       +LD P A+ + E D    RF  ++G K+    
Sbjct  86   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----RFKGQLGKKHFQDL  136

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL  ALWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  137  IGCGS-DYSLSEALWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  190

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  191  KAADLRDTGIFLDLMHLKKPG-GFDISLFYRDIISVAEDE  229



>ref|XP_001180453.1| PREDICTED: X-ray repair cross-complementing protein 5-like, partial 
[Strongylocentrotus purpuratus]
Length=414

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 117/233 (50%), Gaps = 28/233 (12%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            ++A K+ L++L+D S +MF      E + + SHFE+++ C    L  +II+   D V + 
Sbjct  32   KNAGKDSLIFLIDCSEQMF------EKDDDRSHFEMSIECAKTVLSNKIISSDKDLVGVV  85

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSR  337
            F+ T + KN      +Y        DLD+P+A  I E +      + +  +K+G E G  
Sbjct  86   FFGTEKDKNSGSFKHIYALQ-----DLDQPSASRILELESFLTEGNNDFANKFGFESGY-  139

Query  336  DNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQ  157
              SL  ALW    +  +   K   KR+LLFTN+D P    K V      R   Q+AKD  
Sbjct  140  --SLSDALWTCSNMFSQSPQKVGHKRVLLFTNDDHPHD--KNVA---FQRQAKQKAKDLD  192

Query  156  DLGISIELLPLSRPDEEFNVSIFYAEML-GLEDDELDQFKALI---GERFEDL  10
            D+GI I L+ ++ PD  F  S FY +++ G ED+E      LI    E+FE L
Sbjct  193  DIGIEILLMHMALPDSPFRFSEFYQDIVHGSEDEE-----GLIPDASEKFEQL  240



>ref|XP_006027713.1| PREDICTED: X-ray repair cross-complementing protein 5-like isoform 
X4 [Alligator sinensis]
Length=521

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 119/233 (51%), Gaps = 19/233 (8%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    ED+ + + FE+ + CI      +II+   D +
Sbjct  29   YSGRDS----LIFLVDASKAMFQSYEEGEDDDDWTPFEMTIQCIRNVYTNKIISSDRDLL  84

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEI-GSKYGIE  349
            +I FY T + KNL D   VYV       +LD P A+ + E D  +    K +    +G  
Sbjct  85   SIVFYGTEKNKNLADFKHVYVLQ-----ELDNPGAQRVLELDQYKGNRGKALFRESFG--  137

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
              S + SL  A W    L      K + KRI+LFTNED+P        KA + RT   RA
Sbjct  138  -HSNEYSLGEAFWACSNLFSDVQLKMSHKRIMLFTNEDNPHA--NDSTKAKLART---RA  191

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
             D +D GI ++L+ L +P   F++S+FY +++ + +DE    + +   + EDL
Sbjct  192  ADLRDTGIILDLMHLKKPG-RFDISMFYRDIINVAEDEDLGVQPVESGKLEDL  243



>ref|XP_006027710.1| PREDICTED: X-ray repair cross-complementing protein 5-like isoform 
X1 [Alligator sinensis]
Length=612

 Score =   114 bits (284),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 119/233 (51%), Gaps = 19/233 (8%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    ED+ + + FE+ + CI      +II+   D +
Sbjct  29   YSGRDS----LIFLVDASKAMFQSYEEGEDDDDWTPFEMTIQCIRNVYTNKIISSDRDLL  84

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEI-GSKYGIE  349
            +I FY T + KNL D   VYV       +LD P A+ + E D  +    K +    +G  
Sbjct  85   SIVFYGTEKNKNLADFKHVYVLQ-----ELDNPGAQRVLELDQYKGNRGKALFRESFG--  137

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
              S + SL  A W    L      K + KRI+LFTNED+P        KA + RT   RA
Sbjct  138  -HSNEYSLGEAFWACSNLFSDVQLKMSHKRIMLFTNEDNPHA--NDSTKAKLART---RA  191

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
             D +D GI ++L+ L +P   F++S+FY +++ + +DE    + +   + EDL
Sbjct  192  ADLRDTGIILDLMHLKKPG-RFDISMFYRDIINVAEDEDLGVQPVESGKLEDL  243



>ref|XP_006027711.1| PREDICTED: X-ray repair cross-complementing protein 5-like isoform 
X2 [Alligator sinensis]
Length=611

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 119/233 (51%), Gaps = 19/233 (8%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    ED+ + + FE+ + CI      +II+   D +
Sbjct  29   YSGRDS----LIFLVDASKAMFQSYEEGEDDDDWTPFEMTIQCIRNVYTNKIISSDRDLL  84

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEI-GSKYGIE  349
            +I FY T + KNL D   VYV       +LD P A+ + E D  +    K +    +G  
Sbjct  85   SIVFYGTEKNKNLADFKHVYVLQ-----ELDNPGAQRVLELDQYKGNRGKALFRESFG--  137

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
              S + SL  A W    L      K + KRI+LFTNED+P        KA + RT   RA
Sbjct  138  -HSNEYSLGEAFWACSNLFSDVQLKMSHKRIMLFTNEDNPHA--NDSTKAKLART---RA  191

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
             D +D GI ++L+ L +P   F++S+FY +++ + +DE    + +   + EDL
Sbjct  192  ADLRDTGIILDLMHLKKPG-RFDISMFYRDIINVAEDEDLGVQPVESGKLEDL  243



>ref|XP_003290709.1| hypothetical protein DICPUDRAFT_7342 [Dictyostelium purpureum]
 gb|EGC32746.1| hypothetical protein DICPUDRAFT_7342 [Dictyostelium purpureum]
Length=528

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 114/218 (52%), Gaps = 29/218 (13%)
 Frame = -1

Query  684  KELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNT  505
            ++ +V+L+DAS  MF      E       F  A+ C+ Q++  +II    D + +CFYNT
Sbjct  4    RDCIVFLIDASKSMFDQNDSGE-----VPFYNAIKCLIQTITDKIITSESDLIGVCFYNT  58

Query  504  REKKNLQDLNCVYVYNVPERDDLDRPTARLIKEF-DHIEDRFSKEIGSKYGIEPGSRDNS  328
             +KKN+ D   +YV +     +LD P  ++I +  D +E+ FSK  G   G      D  
Sbjct  59   DKKKNINDFENIYVLS-----ELDIPDPKIILQLEDILENDFSKSFGHFNG------DFP  107

Query  327  LYSALWVAQAL---LRKGSAKTAD----KRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
            L  ALW    +   +++ SA++      KRI LFTN+D+P    +G         T QRA
Sbjct  108  LCDALWTCSTMFSNMKQTSAQSQQQNNFKRIFLFTNQDNPNQYNEG-----NRNLTIQRA  162

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            KD  +L I IEL  +++P E+F+ ++FY  +L   DD+
Sbjct  163  KDLSELNIQIELFSMNKPGEQFDFTLFYQNILVFGDDD  200



>ref|XP_006259035.1| PREDICTED: X-ray repair cross-complementing protein 5-like [Alligator 
mississippiensis]
Length=613

 Score =   111 bits (277),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 119/233 (51%), Gaps = 19/233 (8%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    ED+ + + FE+ + CI      +II+   D +
Sbjct  30   YSGRDS----LIFLVDASKAMFQSYEEGEDDDDWTSFEMTIQCIRNVYTNKIISSDRDLL  85

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSK-YGIE  349
            +I FY T + KN  D   VYV       +LD P A+ + E D  +    K +  + +G  
Sbjct  86   SIVFYGTEKNKNSADFKHVYVLQ-----ELDNPGAQRVLELDQYKGNRGKALFHELFG--  138

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
              S + SL  A W    L      K + KRI+LFTNED+P        KA + RT   RA
Sbjct  139  -HSNEYSLGEAFWACSNLFSDVQLKMSHKRIMLFTNEDNPHA--NDSTKAKLART---RA  192

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
             D +D GI ++L+ L +P   F++S+FY +++ + +DE    + +   + EDL
Sbjct  193  ADLRDTGIILDLMHLKKPG-GFDISMFYRDIINVAEDEDLGVQPVESGKLEDL  244



>gb|EKC34975.1| ATP-dependent DNA helicase 2 subunit 1 [Crassostrea gigas]
Length=607

 Score =   111 bits (277),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 113/225 (50%), Gaps = 21/225 (9%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++L+D S  MF      ++E+E SHF++ + C   +L+ +II+   D V I FY T + 
Sbjct  31   LIFLIDCSKSMFDKDD-EDNEEEESHFQLCLRCAQTTLQNKIISSDKDLVGIVFYGTEKS  89

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDNSLYS-  319
            +N  D   VYVY       L++P A  I E +++ D   K     +G       N+ YS 
Sbjct  90   QNPSDFKHVYVYQ-----GLEQPGAERILELENLIDDGMKSFEKDFG------HNTAYSL  138

Query  318  --ALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGI  145
              ALW  Q +    S K   KRI+LFTN D+P           + R    +A D ++ GI
Sbjct  139  NDALWTCQNMFANSSQKVGFKRIMLFTNNDNPHAGA-----PQLQRQAKTKAGDLKETGI  193

Query  144  SIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
             +EL+ L +P+E F V  FY ++L   DD+  +  A   ER E+L
Sbjct  194  ELELMHLQKPNESFEVDKFYKDLLYSADDDFTEL-ANPAERLEEL  237



>ref|XP_007099959.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Physeter catodon]
Length=609

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 118/220 (54%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++L+DAS  MF T    +DE E + F++++ CI     ++II+   D +
Sbjct  31   YSGRDS----LIFLIDASEAMFET----QDEDELTPFDMSIQCIRSVYTSKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       +LD P A+ + E DH    F  + G K+    
Sbjct  83   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELDH----FKGQEGKKHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  134  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++LL L +    F++S+FY +++ + +DE
Sbjct  188  KAGDLRDTGIFLDLLHLKK-RGGFDISLFYRDIISIAEDE  226



>ref|XP_006980263.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Peromyscus maniculatus bairdii]
 ref|XP_006980264.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Peromyscus maniculatus bairdii]
Length=608

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 113/220 (51%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF   S AEDE   + F++++ CI      +II+   D +
Sbjct  30   YSGRDS----LIFLVDASRAMFE--SQAEDE--ITPFDMSIQCIQSVYTNKIISSDRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
             + FY T + KN  +   +YV       DLD P A+ + E D    RF  + G K+    
Sbjct  82   GVVFYGTEKDKNSVNFKNIYVLQ-----DLDSPGAKRVLELD----RFKGQQGKKHFQDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGLGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +  D +D GI +EL+ L RP   F++S+FY  +L   +DE
Sbjct  187  KVSDLRDTGIFLELMHLKRPG-GFDISLFYKNILSTAEDE  225



>ref|XP_007099958.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Physeter catodon]
Length=654

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 118/220 (54%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++L+DAS  MF T    +DE E + F++++ CI     ++II+   D +
Sbjct  76   YSGRDS----LIFLIDASEAMFET----QDEDELTPFDMSIQCIRSVYTSKIISSDRDLL  127

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       +LD P A+ + E DH    F  + G K+    
Sbjct  128  AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELDH----FKGQEGKKHFQDL  178

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  179  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  232

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++LL L +    F++S+FY +++ + +DE
Sbjct  233  KAGDLRDTGIFLDLLHLKK-RGGFDISLFYRDIISIAEDE  271



>gb|AAA39396.1| p70 Ku lupus autoantigen, partial [Mus musculus]
Length=595

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 117/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF     ++ E E + F++++ CI     ++II+   D +
Sbjct  17   YSGRDS----LIFLVDASRAMFE----SQGEDELTPFDMSIQCIQSVYTSKIISSDRDLL  68

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T + KN  +   +YV       DLD P A+ + E D    +F  + G K+    
Sbjct  69   AVVFYGTEKDKNSVNFKNIYVLQ-----DLDNPGAKRVLELD----QFKGQQGKKHFRDT  119

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            +  GS D SL   LWV   L      K + KRI+LFTNEDDP G  +   KA   RT   
Sbjct  120  VGHGS-DYSLSEVLWVCANLFSDVQLKMSHKRIMLFTNEDDPHG--RDSAKASRART---  173

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F+VS+FY +++   +DE
Sbjct  174  KASDLRDTGIFLDLMHLKKPG-GFDVSVFYRDIITTAEDE  212



>gb|EDL04536.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6, isoform CRA_a [Mus musculus]
Length=617

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 117/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF     ++ E E + F++++ CI     ++II+   D +
Sbjct  39   YSGRDS----LIFLVDASRAMFE----SQGEDELTPFDMSIQCIQSVYTSKIISSDRDLL  90

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T + KN  +   +YV       DLD P A+ + E D    +F  + G K+    
Sbjct  91   AVVFYGTEKDKNSVNFKNIYVLQ-----DLDNPGAKRVLELD----QFKGQQGKKHFRDT  141

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            +  GS D SL   LWV   L      K + KRI+LFTNEDDP G  +   KA   RT   
Sbjct  142  VGHGS-DYSLSEVLWVCANLFSDVQLKMSHKRIMLFTNEDDPHG--RDSAKASRART---  195

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F+VS+FY +++   +DE
Sbjct  196  KASDLRDTGIFLDLMHLKKPG-GFDVSVFYRDIITTAEDE  234



>ref|XP_004279584.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
1 [Orcinus orca]
Length=609

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 118/220 (54%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++L+DAS  MF T    +DE E + F++++ CI     ++II+   D +
Sbjct  31   YSGRDS----LIFLIDASEAMFET----QDEDELTPFDMSIQCIRSVYTSKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       +LD P A+ + E     DRF  + G K+    
Sbjct  83   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVLEL----DRFKGQEGKKHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  134  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++LL L R    F++S+FY +++ + +DE
Sbjct  188  KAGDLRDTGIFLDLLHL-RKRGGFDISLFYRDIISIAEDE  226



>sp|P23475.5|XRCC6_MOUSE RecName: Full=X-ray repair cross-complementing protein 6; AltName: 
Full=5'-deoxyribose-5-phosphate lyase Ku70; Short=5'-dRP/AP 
lyase Ku70; AltName: Full=ATP-dependent DNA helicase 2 
subunit 1; AltName: Full=ATP-dependent DNA helicase II 70 kDa 
subunit; AltName: Full=CTC box-binding factor 75 kDa subunit; 
Short=CTC75; Short=CTCBF; AltName: Full=DNA repair protein 
XRCC6; AltName: Full=Ku autoantigen protein p70 homolog; 
Short=Ku70 [Mus musculus]
 dbj|BAA28874.1| Ku70 [Mus musculus]
 gb|AAH31422.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6 [Mus musculus]
 gb|EDL04537.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6, isoform CRA_b [Mus musculus]
Length=608

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 117/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF     ++ E E + F++++ CI     ++II+   D +
Sbjct  30   YSGRDS----LIFLVDASRAMFE----SQGEDELTPFDMSIQCIQSVYTSKIISSDRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T + KN  +   +YV       DLD P A+ + E D    +F  + G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----DLDNPGAKRVLELD----QFKGQQGKKHFRDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            +  GS D SL   LWV   L      K + KRI+LFTNEDDP G  +   KA   RT   
Sbjct  133  VGHGS-DYSLSEVLWVCANLFSDVQLKMSHKRIMLFTNEDDPHG--RDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F+VS+FY +++   +DE
Sbjct  187  KASDLRDTGIFLDLMHLKKPG-GFDVSVFYRDIITTAEDE  225



>ref|NP_034377.2| X-ray repair cross-complementing protein 6 [Mus musculus]
 ref|XP_006520503.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Mus musculus]
 ref|XP_006520504.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Mus musculus]
 ref|XP_006520505.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Mus musculus]
 ref|XP_006520506.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X4 [Mus musculus]
 gb|AAL90774.1| Ku70 [Mus musculus]
 gb|AAL90775.1| Ku70 [Mus musculus]
 dbj|BAE25441.1| unnamed protein product [Mus musculus]
Length=608

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 117/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF     ++ E E + F++++ CI     ++II+   D +
Sbjct  30   YSGRDS----LIFLVDASRAMFE----SQGEDELTPFDMSIQCIQSVYTSKIISSDRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T + KN  +   +YV       DLD P A+ + E D    +F  + G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----DLDNPGAKRVLELD----QFKGQQGKKHFRDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            +  GS D SL   LWV   L      K + KRI+LFTNEDDP G  +   KA   RT   
Sbjct  133  VGHGS-DYSLSEVLWVCANLFSDVQLKMSHKRIMLFTNEDDPHG--RDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F+VS+FY +++   +DE
Sbjct  187  KASDLRDTGIFLDLMHLKKPG-GFDVSVFYRDIITTAEDE  225



>gb|AAC52675.1| DNA repair enzyme [Mus musculus]
Length=608

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 117/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF     ++ E E + F++++ CI     ++II+   D +
Sbjct  30   YSGRDS----LIFLVDASRAMFE----SQGEDELTPFDMSIQCIQSVYTSKIISSDRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T + KN  +   +YV       DLD P A+ + E D    +F  + G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----DLDNPGAKRVLELD----QFKGQQGKKHFRDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            +  GS D SL   LWV   L      K + KRI+LFTNEDDP G  +   KA   RT   
Sbjct  133  VGHGS-DYSLSEVLWVCANLFSDVQLKMSHKRIMLFTNEDDPHG--RDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F+VS+FY +++   +DE
Sbjct  187  KASDLRDTGIFLDLMHLKKPG-GFDVSVFYRDIITTAEDE  225



>ref|XP_006980262.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Peromyscus maniculatus bairdii]
Length=644

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 113/220 (51%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF   S AEDE   + F++++ CI      +II+   D +
Sbjct  66   YSGRDS----LIFLVDASRAMFE--SQAEDE--ITPFDMSIQCIQSVYTNKIISSDRDLL  117

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
             + FY T + KN  +   +YV       DLD P A+ + E D    RF  + G K+    
Sbjct  118  GVVFYGTEKDKNSVNFKNIYVLQ-----DLDSPGAKRVLELD----RFKGQQGKKHFQDT  168

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  169  IGLGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  222

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +  D +D GI +EL+ L RP   F++S+FY  +L   +DE
Sbjct  223  KVSDLRDTGIFLELMHLKRPG-GFDISLFYKNILSTAEDE  261



>ref|NP_001177114.1| X-ray repair cross-complementing protein 6 [Sus scrofa]
Length=607

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 119/217 (55%), Gaps = 23/217 (11%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +    +DE E + F++++ CI      +II+   D +A+ 
Sbjct  29   RCSGRDSLIFLVDASRAMFES----QDEDELTPFDMSIQCIQSVYTNKIISSDRDLLAVV  84

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---IEP  346
            F  T++ KN  +   +YV       +LD P A+ ++E D    RF  + G+KY    +  
Sbjct  85   FCGTKKDKNSVNFKNIYVLQ-----ELDSPGAKRVQELD----RFKGQEGTKYFQDLLGH  135

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
            GS D SL   LWV   L      K + KRI+LFTN+DDP G      KA   RT   +A 
Sbjct  136  GS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNDDDPHG--NDSAKASRART---KAG  189

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  190  DLRDTGIFLDLMHLKKPG-GFDISLFYRDIISVAEDE  225



>ref|XP_003989387.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Felis catus]
 ref|XP_006934178.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Felis catus]
 ref|XP_006934179.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Felis catus]
 ref|XP_006934180.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X4 [Felis catus]
Length=608

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF + S    E E + F++++ CI      +II+ + D +
Sbjct  30   YSGRDS----LIFLVDGSKAMFESQS----EVELTPFDMSIQCIQSVYTNKIISSNQDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  E G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGEQGKKHFQDL  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      +A   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHG--NDSARASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F++S+FY +++ + DDE
Sbjct  187  KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIADDE  225



>ref|XP_007454026.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Lipotes vexillifer]
Length=609

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 118/220 (54%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++L+DAS  MF T    +DE E + F++++ CI     ++II+   D +
Sbjct  31   YSGRDS----LIFLIDASEAMFET----QDEDELTPFDMSIQCIRSVYTSKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       +LD P A+ + E DH    F  + G K+    
Sbjct  83   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELDH----FKGQEGKKHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      +A   RT   
Sbjct  134  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSARASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++LL L +    F++S+FY +++ + +DE
Sbjct  188  KAGDLRDTGIFLDLLHLKK-RGGFDISLFYRDIISIAEDE  226



>ref|XP_008763893.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Rattus norvegicus]
Length=554

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI     ++II+   D +
Sbjct  30   YSGRDS----LIFLVDASRAMFES----QGEDELTPFDMSIQCIQSVYTSKIISSDRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T + KN  +   +YV       DLD P A+ + E D    RF  + G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKSIYVLQ-----DLDNPGAKRVLELD----RFKGQQGKKHFRDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F+VS+FY +++ + +DE
Sbjct  187  KASDLRDTGIFLDLMHLKKRG-GFDVSLFYRDIISIAEDE  225



>ref|NP_620780.2| X-ray repair cross-complementing protein 6 [Rattus norvegicus]
 gb|AAH78718.1| Xrcc6 protein [Rattus norvegicus]
 gb|EDM15680.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6, isoform CRA_a [Rattus norvegicus]
Length=608

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI     ++II+   D +
Sbjct  30   YSGRDS----LIFLVDASRAMFES----QGEDELTPFDMSIQCIQSVYTSKIISSDRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T + KN  +   +YV       DLD P A+ + E D    RF  + G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKSIYVLQ-----DLDNPGAKRVLELD----RFKGQQGKKHFRDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F+VS+FY +++ + +DE
Sbjct  187  KASDLRDTGIFLDLMHLKKRG-GFDVSLFYRDIISIAEDE  225



>dbj|BAB83858.1| G22p1 [Rattus norvegicus]
Length=609

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI     ++II+   D +
Sbjct  30   YSGRDS----LIFLVDASRAMFES----QGEDELTPFDMSIQCIQSVYTSKIISSDRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T + KN  +   +YV       DLD P A+ + E D    RF  + G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKSIYVLQ-----DLDNPGAKRVLELD----RFKGQQGKKHFRDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F+VS+FY +++ + +DE
Sbjct  187  KASDLRDTGIFLDLMHLKKRG-GFDVSLFYRDIISIAEDE  225



>ref|XP_005984778.1| PREDICTED: X-ray repair cross-complementing protein 6 [Pantholops 
hodgsonii]
Length=612

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 124/234 (53%), Gaps = 34/234 (15%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  35   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  86

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P A+ ++E     D+F  + G KY    
Sbjct  87   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVQEL----DKFKGQEGKKYFQDQ  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  138  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  191

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
            +A D +D GI ++L+ L +    F++S+FY +++  ED++       IG  FE+
Sbjct  192  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDIIVAEDED-------IGIHFEE  237



>ref|XP_007425757.1| PREDICTED: X-ray repair cross-complementing protein 5-like isoform 
X2 [Python bivittatus]
 ref|XP_007425758.1| PREDICTED: X-ray repair cross-complementing protein 5-like isoform 
X3 [Python bivittatus]
Length=434

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 108/213 (51%), Gaps = 19/213 (9%)
 Frame = -1

Query  690  ATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFY  511
              ++ L++LVD S  MF +     D+   + F++ + CI    + +II+   D V + FY
Sbjct  32   GGRDTLLFLVDGSTAMFDSF----DDSNLTPFDMTIQCIQNVYKNKIISHERDLVGVVFY  87

Query  510  NTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDN  331
             T + KN  D   +Y+       DLD P A+ + E    E    + +  K     G  DN
Sbjct  88   GTEQHKNSVDFKHIYILQ-----DLDNPGAKRVLELASYEGEQGRALFQK---SLGHSDN  139

Query  330  -SLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQD  154
             SL  ALWV   L      K + KRI+LFTNEDDP G  +   KA   RT   +A D ++
Sbjct  140  YSLGEALWVCSNLFSDVRLKMSHKRIMLFTNEDDPHG--QDSTKAKFART---KAADLRE  194

Query  153  LGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
             GI ++L+ L +P   F++S+FY +++   DDE
Sbjct  195  TGIYLDLMNLKKPG-GFDISLFYRDIINTADDE  226



>ref|XP_007198780.1| PREDICTED: LOW QUALITY PROTEIN: X-ray repair complementing defective 
repair in Chinese hamster cells 6 [Balaenoptera acutorostrata 
scammoni]
Length=612

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 113/210 (54%), Gaps = 23/210 (11%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++L+DAS  MF T    +DE E + F++++ CI     ++II+   D +A+ FY T++ 
Sbjct  40   LIFLIDASEAMFET----QDEDELTPFDMSIQCIRSVYTSKIISSDRDLLAVVFYGTKKD  95

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---IEPGSRDNSL  325
            KN  +   +YV       +LD P A+ + E DH    F  + G K+    +  GS D SL
Sbjct  96   KNSVNFKNIYVLQ-----ELDNPGAKRLLELDH----FKGQEGKKHFQDLVGHGS-DYSL  145

Query  324  YSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGI  145
               LWV   L      K + KR++LFTNEDDP G      KA   RT   +A D  D GI
Sbjct  146  SEVLWVCANLFSDVQFKMSHKRVMLFTNEDDPHG--NDSAKASRART---KAGDLHDTGI  200

Query  144  SIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
             ++LL L +    F++S+FY +++ + +DE
Sbjct  201  FLDLLHLKKRG-GFDISLFYRDIISIAEDE  229



>ref|XP_006890247.1| PREDICTED: X-ray repair cross-complementing protein 6 [Elephantulus 
edwardii]
Length=609

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 118/220 (54%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+   D +
Sbjct  31   YSGRDS----LIFLVDASRAMFKS----QDEDELTPFDMSIQCILSVYTDKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  + G K+    
Sbjct  83   AVVFYGTEKGKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGQQGKKHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL  ALWV   L      K + KR++LFTNEDDP G      KA   RT   
Sbjct  134  IGHGS-DYSLSEALWVCANLFSDVQFKMSHKRVMLFTNEDDPHGSDSA--KASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F++++FY +++ + +DE
Sbjct  188  KAADLRDTGIFLDLMHLKKPG-GFDIALFYRDIISVAEDE  226



>dbj|BAE27135.1| unnamed protein product [Mus musculus]
 dbj|BAE27137.1| unnamed protein product [Mus musculus]
 dbj|BAE27139.1| unnamed protein product [Mus musculus]
Length=608

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 116/219 (53%), Gaps = 27/219 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF     ++ E E + F++++ CI     ++II+   D +
Sbjct  30   YSGRDS----LIFLVDASRAMFE----SQGEDELTPFDMSIQCIQSVYTSKIISSDRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T + KN  +   +YV       DLD P A+ + E D    +F  + G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----DLDNPGAKRVLELD----QFKGQQGKKHFRDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            +  GS D SL   LWV   L      K + KRI+LFTNEDDP G  +   KA   RT   
Sbjct  133  VGHGS-DYSLSEVLWVCANLFSDVQLKMSHKRIMLFTNEDDPHG--RDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDD  58
            +A D +D GI ++L+ L +P   F+VS+FY +++   +D
Sbjct  187  KASDLRDTGIFLDLMHLKKPG-GFDVSVFYRDIITTAED  224



>ref|XP_004007067.1| PREDICTED: X-ray repair cross-complementing protein 6 [Ovis aries]
Length=612

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 120/221 (54%), Gaps = 27/221 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  35   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  86

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P A+ ++E     D+F  + G KY    
Sbjct  87   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVQEL----DKFKGQEGKKYFQDQ  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  138  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  191

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDEL  52
            +A D +D GI ++L+ L +    F++S+FY +++  ED+++
Sbjct  192  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDIIVAEDEDV  231



>ref|XP_007425756.1| PREDICTED: X-ray repair cross-complementing protein 5-like isoform 
X1 [Python bivittatus]
Length=470

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 108/213 (51%), Gaps = 19/213 (9%)
 Frame = -1

Query  690  ATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFY  511
              ++ L++LVD S  MF +     D+   + F++ + CI    + +II+   D V + FY
Sbjct  68   GGRDTLLFLVDGSTAMFDSF----DDSNLTPFDMTIQCIQNVYKNKIISHERDLVGVVFY  123

Query  510  NTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDN  331
             T + KN  D   +Y+       DLD P A+ + E    E    + +  K     G  DN
Sbjct  124  GTEQHKNSVDFKHIYIL-----QDLDNPGAKRVLELASYEGEQGRALFQK---SLGHSDN  175

Query  330  -SLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQD  154
             SL  ALWV   L      K + KRI+LFTNEDDP G  +   KA   RT   +A D ++
Sbjct  176  YSLGEALWVCSNLFSDVRLKMSHKRIMLFTNEDDPHG--QDSTKAKFART---KAADLRE  230

Query  153  LGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
             GI ++L+ L +P   F++S+FY +++   DDE
Sbjct  231  TGIYLDLMNLKKPG-GFDISLFYRDIINTADDE  262



>ref|XP_008506155.1| PREDICTED: X-ray repair cross-complementing protein 6 [Equus 
przewalskii]
 ref|XP_008506156.1| PREDICTED: X-ray repair cross-complementing protein 6 [Equus 
przewalskii]
 ref|XP_008506157.1| PREDICTED: X-ray repair cross-complementing protein 6 [Equus 
przewalskii]
Length=473

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  31   YSGRDS----LIFLVDASKAMFES----QDEDELTPFDMSIQCIQSVYTNKIISSNQDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E     DR   + G K+    
Sbjct  83   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLEL----DRLKGQQGKKHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            +  GS D SL   LWV   L      K + KRI+LFTNEDDP        KA   RT   
Sbjct  134  LGHGS-DYSLSEVLWVCANLFSNVQFKMSHKRIMLFTNEDDPHSSDSA--KASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  188  KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISVAEDE  226



>ref|XP_007907750.1| PREDICTED: X-ray repair cross-complementing protein 6 [Callorhinchus 
milii]
Length=667

 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 74/214 (35%), Positives = 110/214 (51%), Gaps = 22/214 (10%)
 Frame = -1

Query  690  ATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFY  511
            A ++ L++LVDAS  MF     A D  + S FE+ + CI     ++II+   D +A+ F+
Sbjct  87   AGRDSLIFLVDASEAMF-----AADGNDISPFEMTIQCIRSVYTSKIISSDRDLLAVVFF  141

Query  510  NTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIE--PGSR  337
             T   KN  D   +YV +     DLD P A+ + E D    ++ +E G ++  E    S 
Sbjct  142  GTGTHKNSGDFKHIYVLH-----DLDTPGAKRVLELD----KYKEETGRRHFREELGQSS  192

Query  336  DNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQ  157
            D SL  ALWV   L      K + KR++LFTN DDP         +   RT   +A D Q
Sbjct  193  DVSLGEALWVCSNLFSDVKLKLSHKRVMLFTNNDDPHAN-----DSAKARTARTKASDLQ  247

Query  156  DLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            + GI ++LL L +P   F++SIFY +++   D E
Sbjct  248  ETGIILDLLHLRKPG-GFDISIFYRDIINTADGE  280



>ref|XP_009051802.1| hypothetical protein LOTGIDRAFT_182021 [Lottia gigantea]
 gb|ESO97963.1| hypothetical protein LOTGIDRAFT_182021 [Lottia gigantea]
Length=605

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 111/218 (51%), Gaps = 18/218 (8%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R   ++ L+++VD + +MF     AEDE+E   F V + CI  +++ +II+   D V + 
Sbjct  26   RFGNRDGLIFVVDCNKEMFD----AEDEEECP-FRVCMRCIKTTMQNKIISSERDMVGVI  80

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSR  337
            FY T +  N  D   +Y+Y      +L++P A  I E +++ +   K+ G+KYG    + 
Sbjct  81   FYGTEKTDNPSDFKNIYIYM-----NLEQPGAERILEIENMIENGYKKFGTKYG---HNE  132

Query  336  DNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQ  157
              S+   LW    +    S K   KR+LLFTN DDP           + R    +A D  
Sbjct  133  HYSISEVLWTCANMFSNSSQKINYKRVLLFTNNDDPHSS-----SLQLQRQARTKANDLN  187

Query  156  DLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQF  43
            + GI +EL+ + +  + F+VS F+ +++   DDEL + 
Sbjct  188  ETGIDLELMHMQKQGQTFDVSKFWKDLIYTADDELTEL  225



>gb|AAI03219.1| XRCC6 protein [Bos taurus]
Length=331

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 122/234 (52%), Gaps = 34/234 (15%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF     ++DE E + F++++ CI      +II+ + D +
Sbjct  30   YSGRDS----LIFLVDASRAMFE----SQDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  82   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFEDQ  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
            +A D +D GI ++L+ L +    F+ S+FY +++  E+++       IG  FE+
Sbjct  187  KAGDLRDTGIFLDLMHLKKRG-GFDTSLFYRDVIIAENED-------IGIHFEE  232



>ref|XP_004437969.1| PREDICTED: X-ray repair cross-complementing protein 6 [Ceratotherium 
simum simum]
Length=606

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 114/222 (51%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ C+      +II+   D +
Sbjct  31   YSGRDS----LIFLVDASKAMFES----QDEDELTPFDMSIQCVRNVYTNKIISSDQDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSK  361
            A+ FY T++ KN  +   +YV       +LD P A+ + E D  +      +F   IG  
Sbjct  83   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELDQFKGQQGKKKFQDLIGYG  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
            Y       D SL   LWV   L      K + KRI+LFTNEDDP        KA   RT 
Sbjct  138  Y-------DYSLSEVLWVCANLFSNVQFKMSHKRIMLFTNEDDPHS--NDSAKASRART-  187

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  188  --KAGDLRDTGIFLDLMHLRKPG-GFDISLFYRDIISIAEDE  226



>ref|XP_009900754.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Picoides pubescens]
Length=612

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 110/215 (51%), Gaps = 20/215 (9%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     DE+  + FE+ + CI     ++II+   D +++ 
Sbjct  34   RFSGRDSLIFLVDASKAMFES-----DEEGMTPFEMTIQCIRNVYTSKIISSDKDLLSVV  88

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-EDRFSKEIGSKYGIEPGS  340
            FY T   KN  D   VYV       DLD P A+ + E D    D         +G    +
Sbjct  89   FYGTENSKNSADFKHVYVLQ-----DLDNPGAKRVLELDQYGGDEGQALFHDTFG---HN  140

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
             D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D 
Sbjct  141  ADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGDL  195

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +D GI ++L+ L +P   F++S+FY +++ L +DE
Sbjct  196  RDTGIILDLMHLKKPG-GFDISLFYRDIINLAEDE  229



>ref|XP_005067084.1| PREDICTED: X-ray repair cross-complementing protein 6 [Mesocricetus 
auratus]
Length=607

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 117/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++L+DAS  MF +    + E E + F++++ CI     ++II+ + D +
Sbjct  30   YSGRDS----LIFLLDASRAMFDS----QGEDEVTPFDMSIQCIQSVYTSKIISSNRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
             + FY T++ KN  +   +YV       DLD P A+ + E D    +F  + G K+    
Sbjct  82   GVVFYGTKKDKNSVNFKNIYVLQ-----DLDNPGAKRVLELD----QFKGQQGKKHFQDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L R    F++S+FY +++ + +DE
Sbjct  187  KASDLRDTGIFLDLMHLKR-RGGFDISLFYRDIISVAEDE  225



>ref|XP_005606746.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X4 [Equus caballus]
Length=527

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 114/219 (52%), Gaps = 25/219 (11%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  31   YSGRDS----LIFLVDASKAMFES----QDEDELTPFDMSIQCIQSVYTNKIISSNQDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY--GI  352
            A+ FY T + KN  +   +YV       +LD P A+ + E     DR   + G K+   +
Sbjct  83   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLEL----DRLKGQQGKKHFQDL  133

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
                 D SL   LWV   L      K + KRI+LFTNEDDP        KA   RT   +
Sbjct  134  LGHGSDYSLSEVLWVCANLFSNVQFKMSHKRIMLFTNEDDPHSSDSA--KASRART---K  188

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  AGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISVAEDE  226



>ref|XP_006068968.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Bubalus bubalis]
Length=612

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 123/234 (53%), Gaps = 34/234 (15%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  35   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  86

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  87   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFQDQ  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      +A   RT   
Sbjct  138  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAQASRART---  191

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
            +A D +D GI ++L+ L R    F++S+FY +++  ED++       IG  FE+
Sbjct  192  KAGDLRDTGIFLDLMHL-RKRGGFDISLFYRDVIIAEDED-------IGIHFEE  237



>gb|KFV68842.1| X-ray repair cross-complementing protein 5, partial [Picoides 
pubescens]
Length=601

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 110/215 (51%), Gaps = 20/215 (9%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     DE+  + FE+ + CI     ++II+   D +++ 
Sbjct  36   RFSGRDSLIFLVDASKAMFES-----DEEGMTPFEMTIQCIRNVYTSKIISSDKDLLSVV  90

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-EDRFSKEIGSKYGIEPGS  340
            FY T   KN  D   VYV       DLD P A+ + E D    D         +G    +
Sbjct  91   FYGTENSKNSADFKHVYVLQ-----DLDNPGAKRVLELDQYGGDEGQALFHDTFG---HN  142

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
             D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D 
Sbjct  143  ADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGDL  197

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +D GI ++L+ L +P   F++S+FY +++ L +DE
Sbjct  198  RDTGIILDLMHLKKPG-GFDISLFYRDIINLAEDE  231



>ref|XP_006150789.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Tupaia chinensis]
 ref|XP_006150790.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Tupaia chinensis]
 gb|ELW64430.1| X-ray repair cross-complementing protein 6 [Tupaia chinensis]
Length=609

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 115/227 (51%), Gaps = 27/227 (12%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF      +DE+E S F++++ CI      ++I+   D +A+ FY T + 
Sbjct  37   LIFLVDASSAMFEY----QDEEELSPFDMSIQCIQSVYTNKLISSDRDLLAVVFYGTEKD  92

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSKYGIEPGSRDN  331
            KN  +   +YV       +LD P A+ + E D       + RF  ++G       GS D 
Sbjct  93   KNSVNFKNIYVLQ-----ELDSPGAKRVLELDQFKGQQGKKRFQDQMGH------GS-DY  140

Query  330  SLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDL  151
            S    LWV   L      K + KRI+LFTNEDDP        KA   RT   +A D +D 
Sbjct  141  SFSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHR--NDSAKASRART---KASDLRDT  195

Query  150  GISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
            GI +EL+ L +P   F++S+FY +++ + +DE       +  + EDL
Sbjct  196  GIFLELMHLKKPG-GFDISLFYRDIISVAEDEDLGVHLEVSSKLEDL  241



>ref|XP_006068969.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Bubalus bubalis]
Length=607

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 123/234 (53%), Gaps = 34/234 (15%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  30   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  82   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFQDQ  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      +A   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAQASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
            +A D +D GI ++L+ L R    F++S+FY +++  ED++       IG  FE+
Sbjct  187  KAGDLRDTGIFLDLMHL-RKRGGFDISLFYRDVIIAEDED-------IGIHFEE  232



>ref|XP_006150788.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Tupaia chinensis]
Length=627

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 115/227 (51%), Gaps = 27/227 (12%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF      +DE+E S F++++ CI      ++I+   D +A+ FY T + 
Sbjct  55   LIFLVDASSAMFEY----QDEEELSPFDMSIQCIQSVYTNKLISSDRDLLAVVFYGTEKD  110

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGIEPGSRDN  331
            KN  +   +YV       +LD P A+ + E D  +      RF  ++G       GS D 
Sbjct  111  KNSVNFKNIYVLQ-----ELDSPGAKRVLELDQFKGQQGKKRFQDQMGH------GS-DY  158

Query  330  SLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDL  151
            S    LWV   L      K + KRI+LFTNEDDP        KA   RT   +A D +D 
Sbjct  159  SFSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHR--NDSAKASRART---KASDLRDT  213

Query  150  GISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
            GI +EL+ L +P   F++S+FY +++ + +DE       +  + EDL
Sbjct  214  GIFLELMHLKKPG-GFDISLFYRDIISVAEDEDLGVHLEVSSKLEDL  259



>ref|XP_001500404.2| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Equus caballus]
 ref|XP_005606744.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Equus caballus]
 ref|XP_005606745.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Equus caballus]
Length=606

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  31   YSGRDS----LIFLVDASKAMFES----QDEDELTPFDMSIQCIQSVYTNKIISSNQDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E     DR   + G K+    
Sbjct  83   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLEL----DRLKGQQGKKHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            +  GS D SL   LWV   L      K + KRI+LFTNEDDP        KA   RT   
Sbjct  134  LGHGS-DYSLSEVLWVCANLFSNVQFKMSHKRIMLFTNEDDPHSSDSA--KASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  188  KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISVAEDE  226



>ref|XP_003264863.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Nomascus leucogenys]
Length=533

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----ENELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQDLMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>ref|XP_010341877.1| PREDICTED: X-ray repair cross-complementing protein 6 [Saimiri 
boliviensis boliviensis]
Length=563

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 116/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF + +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQELMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>ref|XP_009573861.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Fulmarus glacialis]
Length=583

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 112/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D   A+ F++ V CI     ++II+   D++++ 
Sbjct  5    RFSGRDSLIFLVDASKAMFES-----DGDGATPFDMTVQCIRNVYTSKIISSDRDQLSVV  59

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGI  352
            FY T + KN  D   +YV       +LD P A+ + E D         RF +  G     
Sbjct  60   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGQVRFLETFGH----  110

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  111  ---NADYSLGEALWACSNLFSDVQVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  162

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  163  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINIAEDE  200



>ref|XP_004484200.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
3 [Dasypus novemcinctus]
Length=609

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+   D +
Sbjct  32   YSGRDS----LIFLVDASKTMFES----QDEDELTPFDMSIQCILSVYTNKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   VYV       +LD P A+ + E D       E+ F   IG  
Sbjct  84   AVVFYGTEKDKNSVNFKNVYVLQ-----ELDNPGAKRVLELDQFKGQQGEEHFRDLIGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL  ALWV   L      K + KRI+LFTNEDDP G      KA   RT 
Sbjct  138  -----GS-DYSLSEALWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L R    F++S+FY +++ + +D+
Sbjct  189  --KASDLRDTGIFLDLMHL-RKRGGFDISVFYRDIISVAEDK  227



>ref|XP_005515012.1| PREDICTED: X-ray repair cross-complementing protein 5-like, partial 
[Columba livia]
Length=606

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 109/208 (52%), Gaps = 20/208 (10%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF +     +E E + F++ + CI     ++II+   D +++ FY T + 
Sbjct  35   LIFLVDASKAMFES-----EEDEVTPFDMTIQCIRNVYTSKIISSDKDLLSVVFYGTEKN  89

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPGSRDNSLYS  319
            KNL D   +YV       +LD P A+ + E D    D+        +G    + D SL  
Sbjct  90   KNLADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDKGQALFRETFG---HNADYSLGE  141

Query  318  ALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISI  139
            ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D +D GI +
Sbjct  142  ALWACSNLFSDVRIRLSHKRIMLFTNEDDPHASDSA--KAKLART---RAGDLRDTGIIL  196

Query  138  ELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +L+ L +P   F++S+FY +++ + +DE
Sbjct  197  DLMHLKKPG-GFDISLFYRDIINVAEDE  223



>gb|EMC89970.1| ATP-dependent DNA helicase 2 subunit 1, partial [Columba livia]
Length=602

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 109/208 (52%), Gaps = 20/208 (10%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF +     +E E + F++ + CI     ++II+   D +++ FY T + 
Sbjct  31   LIFLVDASKAMFES-----EEDEVTPFDMTIQCIRNVYTSKIISSDKDLLSVVFYGTEKN  85

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPGSRDNSLYS  319
            KNL D   +YV       +LD P A+ + E D    D+        +G    + D SL  
Sbjct  86   KNLADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDKGQALFRETFG---HNADYSLGE  137

Query  318  ALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISI  139
            ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D +D GI +
Sbjct  138  ALWACSNLFSDVRIRLSHKRIMLFTNEDDPHASDSA--KAKLART---RAGDLRDTGIIL  192

Query  138  ELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +L+ L +P   F++S+FY +++ + +DE
Sbjct  193  DLMHLKKPG-GFDISLFYRDIINVAEDE  219



>ref|XP_004484198.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
1 [Dasypus novemcinctus]
 ref|XP_004484199.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
2 [Dasypus novemcinctus]
Length=616

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF     ++DE E + F++++ CI      +II+   D +
Sbjct  32   YSGRDS----LIFLVDASKTMFE----SQDEDELTPFDMSIQCILSVYTNKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   VYV       +LD P A+ + E D       E+ F   IG  
Sbjct  84   AVVFYGTEKDKNSVNFKNVYVLQ-----ELDNPGAKRVLELDQFKGQQGEEHFRDLIGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL  ALWV   L      K + KRI+LFTNEDDP G      KA   RT 
Sbjct  138  -----GS-DYSLSEALWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L R    F++S+FY +++ + +D+
Sbjct  189  --KASDLRDTGIFLDLMHL-RKRGGFDISVFYRDIISVAEDK  227



>ref|XP_006207195.1| PREDICTED: X-ray repair cross-complementing protein 6 [Vicugna 
pacos]
Length=608

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI      +II+   D +
Sbjct  31   YSGRDS----LIFLVDASRAMFDS----QGENELTPFDMSIQCIQSVYTNKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       +LD P A+ + E D    +F    G K+    
Sbjct  83   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDSPGAKRVLELD----QFKGPKGKKHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  134  IGHGS-DYSLSEVLWVCANLFSNVQFKMSYKRIMLFTNEDDPHGGDSA--KASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  188  KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  226



>gb|KFV91337.1| X-ray repair cross-complementing protein 5, partial [Fulmarus 
glacialis]
Length=583

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 112/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D   A+ F++ V CI     ++II+   D++++ 
Sbjct  6    RFSGRDSLIFLVDASKAMFES-----DGDGATPFDMTVQCIRNVYTSKIISSDRDQLSVV  60

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGI  352
            FY T + KN  D   +YV       +LD P A+ + E D         RF +  G     
Sbjct  61   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGQVRFLETFGH----  111

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  112  ---NADYSLGEALWACSNLFSDVQVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  163

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  164  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINIAEDE  201



>ref|XP_003419862.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Loxodonta africana]
Length=612

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 115/220 (52%), Gaps = 24/220 (11%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF       DE E + F++++ CI      +II+   D +
Sbjct  31   YSGRDS----LIFLVDASKAMFEIQGEG-DEDELTPFDMSIQCILSVYTNKIISSDRDLL  85

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  + G K+    
Sbjct  86   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGQQGRKHFQDL  136

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL  ALWV   L      K + KR++LFTNEDDP G      KA   RT   
Sbjct  137  IGHGS-DYSLNEALWVCANLFSDVQFKLSHKRVMLFTNEDDPHG--NDSAKASRART---  190

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++ L +DE
Sbjct  191  KAADLRDTGIFLDLMHLKK-HGGFDISLFYRDIISLAEDE  229



>emb|CAG47015.1| G22P1 [Homo sapiens]
Length=609

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQDMMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSTKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>ref|XP_007618650.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Cricetulus griseus]
 gb|ERE85341.1| X-ray repair cross-complementing protein 6 [Cricetulus griseus]
Length=608

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI     ++II+ + D +
Sbjct  30   YSGRDS----LIFLVDASRAMFDS----QGEDEVTPFDMSIQCIQSVYTSKIISSNRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
             + FY T + KN  +   +YV       +LD P A+ + E D    +F  + G K+    
Sbjct  82   GVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGQQGKKHFQDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L R    F++S+FY +++ + +DE
Sbjct  187  KANDLRDTGIFLDLMHLKR-RGGFDISLFYRDIISIAEDE  225



>ref|XP_004360399.1| ATP-dependent DNA helicase [Dictyostelium fasciculatum]
 gb|EGG22548.1| ATP-dependent DNA helicase [Dictyostelium fasciculatum]
Length=825

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 122/236 (52%), Gaps = 26/236 (11%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            Q   + ++ +++L+D S  MF   +P+  E     F+ A+ C+ Q++  +II    D + 
Sbjct  78   QTEYSLRDCIIFLIDCSKSMF-LPNPSTGEIP---FKNAIKCLIQTITDKIITSESDLIG  133

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPG  343
            +C + T + KNL D   +YV +     DLD P  +LI +   IED  + ++GS  G    
Sbjct  134  LCLFGTDKNKNLNDFENIYVMS-----DLDTPDPKLILQ---IEDILAGDLGSFGG--SA  183

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRT-TFQRAK  166
             ++ +    LW    +    + K A KRI LFTNED+P          D +RT +FQRAK
Sbjct  184  KKEFAFGDVLWTCSTMFSNCNVKIAHKRIFLFTNEDNP------NQGNDNLRTISFQRAK  237

Query  165  DAQDLGISIELLPLSRP--DEEFNVSIFYAEMLGLEDDE-LDQFKALIGERFEDLK  7
            D  DLGI IEL  +++   D+ F+   FY  ++  +D E +D+  A    +FE L+
Sbjct  238  DLSDLGIEIELFAMNKNEDDDTFDFGKFYQNIIFYQDGEYIDKIDA--SSKFEALR  291



>ref|XP_003514777.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Cricetulus griseus]
 gb|EGW14811.1| ATP-dependent DNA helicase 2 subunit 1 [Cricetulus griseus]
Length=608

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI     ++II+ + D +
Sbjct  30   YSGRDS----LIFLVDASRAMFDS----QGEDEVTPFDMSIQCIQSVYTSKIISSNRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
             + FY T + KN  +   +YV       +LD P A+ + E D    +F  + G K+    
Sbjct  82   GVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGQQGKKHFQDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L R    F++S+FY +++ + +DE
Sbjct  187  KANDLRDTGIFLDLMHLKR-RGGFDISLFYRDIISIAEDE  225



>ref|NP_001460.1| X-ray repair cross-complementing protein 6 isoform 1 [Homo sapiens]
 ref|NP_001267434.1| X-ray repair cross-complementing protein 6 [Pan troglodytes]
 ref|NP_001275905.1| X-ray repair cross-complementing protein 6 isoform 1 [Homo sapiens]
 sp|P12956.2|XRCC6_HUMAN RecName: Full=X-ray repair cross-complementing protein 6; AltName: 
Full=5'-deoxyribose-5-phosphate lyase Ku70; Short=5'-dRP 
lyase Ku70; AltName: Full=70 kDa subunit of Ku antigen; AltName: 
Full=ATP-dependent DNA helicase 2 subunit 1; AltName: 
Full=ATP-dependent DNA helicase II 70 kDa subunit; AltName: 
Full=CTC box-binding factor 75 kDa subunit; Short=CTC75; Short=CTCBF; 
AltName: Full=DNA repair protein XRCC6; AltName: 
Full=Lupus Ku autoantigen protein p70; Short=Ku70; AltName: 
Full=Thyroid-lupus autoantigen; Short=TLAA; AltName: Full=X-ray 
repair complementing defective repair in Chinese hamster 
cells 6 [Homo sapiens]
 pdb|1JEQ|A Chain A, Crystal Structure Of The Ku Heterodimer
 pdb|1JEY|A Chain A, Crystal Structure Of The Ku Heterodimer Bound To Dna
 gb|AAA51733.1| p70 autoantigen [Homo sapiens]
 gb|AAB22381.1| Ku autoantigen p70 subunit [Homo sapiens]
 gb|AAA36155.1| Ku protein subunit [Homo sapiens]
 gb|AAA61177.1| thyroid autoantigen [Homo sapiens]
 gb|AAH08343.1| XRCC6 protein [Homo sapiens]
 gb|AAH10034.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6 [Homo sapiens]
 gb|AAH12154.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6 [Homo sapiens]
 gb|AAH18259.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6 [Homo sapiens]
 gb|AAH72449.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6 [Homo sapiens]
 gb|AAW34364.1| thyroid autoantigen 70kDa (Ku antigen) [Homo sapiens]
 gb|EAW60446.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6 (Ku autoantigen, 70kDa), isoform CRA_a [Homo sapiens]
 gb|EAW60447.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6 (Ku autoantigen, 70kDa), isoform CRA_a [Homo sapiens]
 gb|ABZ92421.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6 (Ku autoantigen, 70kDa) [synthetic construct]
 dbj|BAG10952.1| ATP-dependent DNA helicase 2 subunit 1 [synthetic construct]
 gb|ACE86491.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6 (Ku autoantigen, 70kDa) protein [synthetic construct]
 gb|ACE87172.1| X-ray repair complementing defective repair in Chinese hamster 
cells 6 (Ku autoantigen, 70kDa) protein [synthetic construct]
 dbj|BAK62225.1| ATP-dependent DNA helicase 2 subunit 1 [Pan troglodytes]
 gb|AIC48800.1| XRCC6, partial [synthetic construct]
 gb|AIC54415.1| XRCC6, partial [synthetic construct]
Length=609

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQDMMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>dbj|BAK63517.1| ATP-dependent DNA helicase 2 subunit 1 [Pan troglodytes]
Length=609

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQDMMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>ref|XP_002721433.1| PREDICTED: X-ray repair cross-complementing protein 6 [Oryctolagus 
cuniculus]
Length=608

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 117/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  31   YSGRDS----LIFLVDASRAMFESQS----EDELTPFDMSIQCIQSVYTSKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       DLD P A+ + E D    RF  + G ++    
Sbjct  83   AVVFYGTKKDKNSVNFKNIYVLQ-----DLDNPGAKRMLELD----RFKGQEGKEHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  134  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++ + +DE
Sbjct  188  KASDLRDTGIYLDLMHLKK-RGGFDISLFYRDIISIAEDE  226



>ref|XP_010016424.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Nestor notabilis]
Length=612

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 105/208 (50%), Gaps = 20/208 (10%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF       D   A+ F++ + CI      +II+   D + + FY T E 
Sbjct  41   LIFLVDASKGMFEP-----DGDGATPFDMTIQCIWSVYTNKIISSDRDLLGVVFYGTEEN  95

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPGSRDNSLYS  319
            KN  D   VYV       +LD P A+ + E D    D+        +G    S D SL  
Sbjct  96   KNSADFKHVYVLQ-----ELDNPGAKRVLELDKYRGDKGQVLFRDTFG---HSTDYSLGE  147

Query  318  ALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISI  139
            ALW    L      + + KRI+LFTNEDDP       +KA M RT   RA D +D GI +
Sbjct  148  ALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSVKAKMART---RAGDLRDTGIIL  202

Query  138  ELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +L+ L +P   F++S+FY +++ + +DE
Sbjct  203  DLMHLKKPG-GFDISLFYRDIVNIAEDE  229



>gb|KFQ52863.1| X-ray repair cross-complementing protein 5, partial [Nestor notabilis]
Length=609

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 105/208 (50%), Gaps = 20/208 (10%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF       D   A+ F++ + CI      +II+   D + + FY T E 
Sbjct  41   LIFLVDASKGMFEP-----DGDGATPFDMTIQCIWSVYTNKIISSDRDLLGVVFYGTEEN  95

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPGSRDNSLYS  319
            KN  D   VYV       +LD P A+ + E D    D+        +G    S D SL  
Sbjct  96   KNSADFKHVYVLQ-----ELDNPGAKRVLELDKYRGDKGQVLFRDTFG---HSTDYSLGE  147

Query  318  ALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISI  139
            ALW    L      + + KRI+LFTNEDDP       +KA M RT   RA D +D GI +
Sbjct  148  ALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSVKAKMART---RAGDLRDTGIIL  202

Query  138  ELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +L+ L +P   F++S+FY +++ + +DE
Sbjct  203  DLMHLKKPG-GFDISLFYRDIVNIAEDE  229



>ref|NP_001126888.1| X-ray repair cross-complementing protein 6 [Pongo abelii]
 emb|CAH93208.1| hypothetical protein [Pongo abelii]
Length=609

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 112/212 (53%), Gaps = 27/212 (13%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +A+ FY T + 
Sbjct  38   LIFLVDASKAMFESQS----ENELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKD  93

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSKYGIEPGSRDN  331
            KN  +   +YV       +LD P A+ I E D       + RF + +G       GS D 
Sbjct  94   KNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQELMGH------GS-DY  141

Query  330  SLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDL  151
            SL   LWV   L      K + KRI+LFTNED+P G      KA   RT   +A D +D 
Sbjct  142  SLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART---KAGDLRDT  196

Query  150  GISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  197  GIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>ref|XP_008989116.1| PREDICTED: LOW QUALITY PROTEIN: X-ray repair cross-complementing 
protein 6 [Callithrix jacchus]
Length=609

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 116/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASRAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF + +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQELMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>gb|AAB46854.1| Ku70=DNA-dependent protein kinase 70 kda DNA-binding subunit/DNA-PK 
Ku70 subunit [Chinese hamsters, V79 cells, Peptide, 608 
aa]
Length=608

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI     ++II+ + D +
Sbjct  30   YSGRDS----LIFLVDASRAMFDS----QGEDEITPFDMSIQCIQSVYTSKIISSNRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
             + FY T + KN  +   +YV       +LD P A+ + E D    +F  + G K+    
Sbjct  82   GVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGQQGKKHFQDT  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L R    F++S+FY +++ + +DE
Sbjct  187  KANDLRDTGIFLDLMHLKR-RGGFDISLFYRDIMSIAEDE  225



>ref|XP_010189290.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Mesitornis unicolor]
Length=593

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 110/219 (50%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF       +E E + F++ + CI     ++II+   D +++ 
Sbjct  15   RFSGRDSLIFLVDASQAMFEA-----EEDEMTPFDMTIQCIRNVYTSKIISSDKDLLSVV  69

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDR-----FSKEIGSKYGI  352
            FY T   KN  D   +YV       +LD P A+ I E D  +       F K  G     
Sbjct  70   FYGTENNKNSADFKHIYVLQ-----ELDNPGAKRILELDKYKGAKGQVLFHKTFGH----  120

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  121  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  172

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   FN+S+FY +++ + +DE
Sbjct  173  AGDLRDTGIILDLMHLKKPG-GFNISLFYRDIINVAEDE  210



>ref|XP_004063587.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
1 [Gorilla gorilla gorilla]
Length=609

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQDLMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>ref|XP_007079517.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Panthera tigris altaica]
 ref|XP_007079518.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Panthera tigris altaica]
 ref|XP_007079519.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Panthera tigris altaica]
Length=608

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 115/220 (52%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF + S    E E + F++++ CI      +II+ + D +
Sbjct  30   YSGRDS----LIFLVDGSKAMFESQS----EVELTPFDMSIQCIQSVYTNKIISSNQDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  E G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGEQGKKHFQDL  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      +A   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHG--NDSARASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++ + DDE
Sbjct  187  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDIISIADDE  225



>ref|NP_001271637.1| uncharacterized protein LOC101866663 [Macaca fascicularis]
 dbj|BAE00743.1| unnamed protein product [Macaca fascicularis]
Length=609

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQDLMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-VFDISLFYRDIISIAEDE  227



>dbj|BAG37986.1| unnamed protein product [Homo sapiens]
Length=609

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQDMMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIVLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>ref|XP_005567198.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Macaca fascicularis]
 ref|XP_007974110.1| PREDICTED: X-ray repair cross-complementing protein 6 [Chlorocebus 
sabaeus]
 ref|XP_010373664.1| PREDICTED: X-ray repair cross-complementing protein 6 [Rhinopithecus 
roxellana]
 ref|XP_010373732.1| PREDICTED: X-ray repair cross-complementing protein 6 [Rhinopithecus 
roxellana]
 dbj|BAE01402.1| unnamed protein product [Macaca fascicularis]
 gb|EHH65883.1| hypothetical protein EGM_02739 [Macaca fascicularis]
Length=609

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQDLMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>gb|EHH20277.1| hypothetical protein EGK_03094 [Macaca mulatta]
Length=609

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQDLMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>ref|XP_005681172.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Capra hircus]
Length=639

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 80/236 (34%), Positives = 123/236 (52%), Gaps = 38/236 (16%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  62   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  113

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDR-----FSKEIGSK  361
            A+ FY T++ KN  +   +YV       +LD P A+ ++E D  + +     F  +IG  
Sbjct  114  AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVQELDKFKGQEGKKCFQDQIGH-  167

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT 
Sbjct  168  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART-  218

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
              +A D +D GI ++L+ L +    F++S+FY +++  ED++       IG  FE+
Sbjct  219  --KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDIIVAEDED-------IGIHFEE  264



>gb|KFQ27941.1| X-ray repair cross-complementing protein 5, partial [Mesitornis 
unicolor]
Length=584

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 110/219 (50%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF       +E E + F++ + CI     ++II+   D +++ 
Sbjct  8    RFSGRDSLIFLVDASQAMFEA-----EEDEMTPFDMTIQCIRNVYTSKIISSDKDLLSVV  62

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDR-----FSKEIGSKYGI  352
            FY T   KN  D   +YV       +LD P A+ I E D  +       F K  G     
Sbjct  63   FYGTENNKNSADFKHIYVLQ-----ELDNPGAKRILELDKYKGAKGQVLFHKTFGH----  113

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  114  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  165

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   FN+S+FY +++ + +DE
Sbjct  166  AGDLRDTGIILDLMHLKKPG-GFNISLFYRDIINVAEDE  203



>ref|XP_005681173.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Capra hircus]
Length=612

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 80/236 (34%), Positives = 123/236 (52%), Gaps = 38/236 (16%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  35   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  86

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDR-----FSKEIGSK  361
            A+ FY T++ KN  +   +YV       +LD P A+ ++E D  + +     F  +IG  
Sbjct  87   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVQELDKFKGQEGKKCFQDQIGH-  140

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT 
Sbjct  141  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART-  191

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
              +A D +D GI ++L+ L +    F++S+FY +++  ED++       IG  FE+
Sbjct  192  --KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDIIVAEDED-------IGIHFEE  237



>ref|XP_005681174.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Capra hircus]
 ref|XP_005681175.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X4 [Capra hircus]
Length=607

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 80/236 (34%), Positives = 123/236 (52%), Gaps = 38/236 (16%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  30   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDR-----FSKEIGSK  361
            A+ FY T++ KN  +   +YV       +LD P A+ ++E D  + +     F  +IG  
Sbjct  82   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVQELDKFKGQEGKKCFQDQIGH-  135

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT 
Sbjct  136  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART-  186

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
              +A D +D GI ++L+ L +    F++S+FY +++  ED++       IG  FE+
Sbjct  187  --KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDIIVAEDED-------IGIHFEE  232



>ref|XP_010145297.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Eurypyga helias]
Length=474

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 111/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF      EDE+  + F++ + CI     ++II+   D +++ 
Sbjct  33   RFSGRDSLIFLVDASKAMFD-----EDEEGVTPFDMTIQCIRNVYTSKIISSDRDLLSVV  87

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGI  352
            FY T + KN  D   +YV       +LD P A+ + E D          F K  G     
Sbjct  88   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDKGQVLFRKTFGH----  138

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  139  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSTKAKLART---R  190

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++++FY +++ + +DE
Sbjct  191  AGDLRDTGIILDLMHLKKPG-GFDIALFYRDIVNVAEDE  228



>gb|KFV91400.1| X-ray repair cross-complementing protein 5, partial [Eurypyga 
helias]
Length=477

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 111/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF      EDE+  + F++ + CI     ++II+   D +++ 
Sbjct  35   RFSGRDSLIFLVDASKAMFD-----EDEEGVTPFDMTIQCIRNVYTSKIISSDRDLLSVV  89

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGI  352
            FY T + KN  D   +YV       +LD P A+ + E D          F K  G     
Sbjct  90   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDKGQVLFRKTFGH----  140

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  141  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSTKAKLART---R  192

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++++FY +++ + +DE
Sbjct  193  AGDLRDTGIILDLMHLKKPG-GFDIALFYRDIVNVAEDE  230



>ref|XP_007939902.1| PREDICTED: X-ray repair cross-complementing protein 6 [Orycteropus 
afer afer]
Length=609

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 117/215 (54%), Gaps = 23/215 (11%)
 Frame = -1

Query  690  ATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFY  511
            + ++ L++LVDAS  MF +    +D+ E S F++++ CI     ++II+   D +A+ FY
Sbjct  32   SGRDCLIFLVDASRAMFES----QDQDELSPFDMSIQCILSVYTSKIISSDRDLLAVVFY  87

Query  510  NTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---IEPGS  340
             T + KN  +   +YV       +LD P AR + + D    +F  + G K+    I  GS
Sbjct  88   GTEKDKNSVNFKNIYVLQ-----ELDNPGARRVLQLD----QFKGQEGKKHFQDLIGHGS  138

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
             D S+  ALWV   L      K + KRI+LFTNEDDP G      KA   RT   +A D 
Sbjct  139  -DYSVSEALWVCANLFSDVQLKMSHKRIMLFTNEDDPHG--NDSAKASRART---KAADL  192

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +D G+S++L+ L +    F++S+FY +++ + + E
Sbjct  193  RDTGVSLDLMHLKKRG-GFDISLFYRDIISVAEGE  226



>ref|XP_010828252.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X5 [Bison bison bison]
Length=556

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 119/221 (54%), Gaps = 27/221 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF     ++DE E + F++++ CI      +II+ + D +
Sbjct  35   YSGRDS----LIFLVDASRAMFE----SQDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  86

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  87   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFQDQ  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  138  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  191

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDEL  52
            +A D +D GI ++L+ L +    F++S+FY +++  E++++
Sbjct  192  KAGDLRDTGIFLDLMHLKKRG-GFDISLFYRDVIIAENEDV  231



>ref|XP_009215653.1| PREDICTED: X-ray repair cross-complementing protein 6 [Papio 
anubis]
 ref|XP_009215654.1| PREDICTED: X-ray repair cross-complementing protein 6 [Papio 
anubis]
Length=609

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 117/224 (52%), Gaps = 32/224 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQDLMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGL-EDDEL  52
              +A D +D GI ++L+ L +P   F++S+FY +++ + EDD+L
Sbjct  189  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDDDL  229



>ref|XP_009813306.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Gavia stellata]
Length=596

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 111/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D  E + F + + CI     ++II+   D +++ 
Sbjct  18   RFSGRDSLIFLVDASEAMFES-----DGDEVTPFHMTIQCIRNVYTSKIISSDRDLLSVV  72

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T + KN  D   +YV       +LD P A+ + E D     E R  F +  G     
Sbjct  73   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGRVLFRETFGH----  123

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  124  ---NADYSLGEALWACSNLFSDVQVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  175

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   FN+S+FY +++ + +DE
Sbjct  176  AGDLRDTGIILDLMHLKKPG-GFNISLFYRDIINIAEDE  213



>ref|XP_005909502.1| PREDICTED: X-ray repair cross-complementing protein 6 [Bos mutus]
Length=612

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 119/221 (54%), Gaps = 27/221 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  35   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  86

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  87   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFQDQ  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  138  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  191

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDEL  52
            +A D +D GI ++L+ L +    F++S+FY +++  E++++
Sbjct  192  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDVIIAENEDV  231



>ref|XP_010828213.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Bison bison bison]
 ref|XP_010828219.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Bison bison bison]
Length=607

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 119/221 (54%), Gaps = 27/221 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  30   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  82   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFQDQ  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDEL  52
            +A D +D GI ++L+ L +    F++S+FY +++  E++++
Sbjct  187  KAGDLRDTGIFLDLMHLKKRG-GFDISLFYRDVIIAENEDV  226



>gb|ELR46327.1| X-ray repair cross-complementing protein 6 [Bos mutus]
Length=605

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 119/221 (54%), Gaps = 27/221 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  30   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  82   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFQDQ  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDEL  52
            +A D +D GI ++L+ L +    F++S+FY +++  E++++
Sbjct  187  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDVIIAENEDV  226



>ref|XP_010828209.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Bison bison bison]
Length=612

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 119/221 (54%), Gaps = 27/221 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  35   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  86

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  87   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFQDQ  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  138  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  191

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDEL  52
            +A D +D GI ++L+ L +    F++S+FY +++  E++++
Sbjct  192  KAGDLRDTGIFLDLMHLKKRG-GFDISLFYRDVIIAENEDV  231



>gb|KFV55965.1| X-ray repair cross-complementing protein 5, partial [Gavia stellata]
Length=573

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 111/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D  E + F + + CI     ++II+   D +++ 
Sbjct  8    RFSGRDSLIFLVDASEAMFES-----DGDEVTPFHMTIQCIRNVYTSKIISSDRDLLSVV  62

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T + KN  D   +YV       +LD P A+ + E D     E R  F +  G     
Sbjct  63   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGRVLFRETFGH----  113

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  114  ---NADYSLGEALWACSNLFSDVQVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  165

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   FN+S+FY +++ + +DE
Sbjct  166  AGDLRDTGIILDLMHLKKPG-GFNISLFYRDIINIAEDE  203



>gb|KFR11028.1| X-ray repair cross-complementing protein 5, partial [Opisthocomus 
hoazin]
Length=568

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 111/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +         A+ F++ V CI     ++II+   D +++ 
Sbjct  8    RFSGRDSLIFLVDASEAMFESAGDG-----AAPFDMTVQCIRNVYTSKIISSDRDLLSVV  62

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T + KN  D   +YV       DLD P AR + E D     E R  F +  G     
Sbjct  63   FYGTEKNKNSADFKHIYVLQ-----DLDNPGARRVLELDQYRGDEGRVLFRETFGH----  113

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  114  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  165

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  166  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINIAEDE  203



>ref|XP_009320250.1| PREDICTED: X-ray repair cross-complementing protein 6 [Pygoscelis 
adeliae]
Length=610

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 112/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ V CI     ++II+   D++++ 
Sbjct  32   RFSGRDSLIFLVDASEAMFES-----DGDGVTPFDMTVQCIRNVYTSKIISSDRDQLSVV  86

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T + KN  D   VYV       +LD P A+ + E D     E R  F K  G     
Sbjct  87   FYGTEKNKNSADFKHVYVLQ-----ELDSPGAKRVLELDQYRGDEGRVLFRKTFGH----  137

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  138  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  189

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  190  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINIAEDE  227



>ref|XP_003783203.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
1 [Otolemur garnettii]
Length=609

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 120/220 (55%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI     ++II+   D +
Sbjct  31   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIQSVYISKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T+++KN  +   +YV       +LD P A+ I E     D+F  + G K+    
Sbjct  83   AVVFYGTKKEKNSVNFKNIYVLQ-----ELDNPGAKRILEL----DQFKGQQGKKHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTN+D+P G      KA   RT   
Sbjct  134  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNDDNPHG--DDSAKASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D ++ GI ++L+ L +P   +++S+FY +++ + +DE
Sbjct  188  KAGDLRETGIFLDLMHLKKPG-GYDISLFYRDIISIAEDE  226



>gb|KFW61113.1| X-ray repair cross-complementing protein 5, partial [Pygoscelis 
adeliae]
Length=602

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 112/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ V CI     ++II+   D++++ 
Sbjct  33   RFSGRDSLIFLVDASEAMFES-----DGDGVTPFDMTVQCIRNVYTSKIISSDRDQLSVV  87

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T + KN  D   VYV       +LD P A+ + E D     E R  F K  G     
Sbjct  88   FYGTEKNKNSADFKHVYVLQ-----ELDSPGAKRVLELDQYRGDEGRVLFRKTFGH----  138

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  139  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  190

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  191  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINIAEDE  228



>ref|XP_006124038.1| PREDICTED: X-ray repair cross-complementing protein 5-like isoform 
X1 [Pelodiscus sinensis]
 ref|XP_006124039.1| PREDICTED: X-ray repair cross-complementing protein 5-like isoform 
X2 [Pelodiscus sinensis]
 ref|XP_006124040.1| PREDICTED: X-ray repair cross-complementing protein 5-like isoform 
X3 [Pelodiscus sinensis]
Length=372

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 118/233 (51%), Gaps = 22/233 (9%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF      +D+ E + F++ + CI     ++II+   D +
Sbjct  31   YSGRDS----LIFLVDASKAMFEY---YDDDDECTPFDMTIQCIRNVYTSKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIE  349
            ++ FY T + KN  D   VYV       +LD P A+ + E D  + D+        +G  
Sbjct  84   SVVFYGTEKHKNSVDFKHVYVLQ-----ELDNPGAKRVLELDKYKGDQGKALFRESFG--  136

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
              + D SL  ALW    L      K + KRI+LFTNED+P G      KA + RT   +A
Sbjct  137  -HNADYSLGEALWACCNLFSDVRLKMSHKRIMLFTNEDNPHG--HDNTKAKLART---KA  190

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
             D +D GI ++LL L +P   F++S+FY +++   +DE    +     + EDL
Sbjct  191  ADLRDTGIFLDLLHLKKPG-GFDISLFYRDIINTAEDEDLGVQTEASGKLEDL  242



>ref|XP_010804048.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Bos taurus]
 ref|XP_010804049.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Bos taurus]
Length=564

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 122/234 (52%), Gaps = 34/234 (15%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF     ++DE E + F++++ CI      +II+ + D +
Sbjct  35   YSGRDS----LIFLVDASRAMFE----SQDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  86

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  87   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFEDQ  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  138  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  191

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
            +A D +D GI ++L+ L +    F+ S+FY +++  E+++       IG  FE+
Sbjct  192  KAGDLRDTGIFLDLMHLKK-RGGFDTSLFYRDVIIAENED-------IGIHFEE  237



>ref|XP_008843016.1| PREDICTED: X-ray repair cross-complementing protein 6 [Nannospalax 
galili]
Length=608

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 116/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI     ++II+   D +
Sbjct  30   YSGRDS----LIFLVDASRAMFES----QGEDEITPFDMSIQCIQSVYTSKIISSDRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ +N  +   +YV       DLD P A+ + E D    +F  E G  +    
Sbjct  82   AVVFYGTKKDRNSVNFKNIYVLQ-----DLDNPGAKRMLELD----QFKGEQGKNHFQDV  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F+VS+FY +++ + +DE
Sbjct  187  KASDLRDTGIFLDLMHLKK-RGGFDVSLFYRDVISMGEDE  225



>ref|NP_001179175.1| X-ray repair cross-complementing protein 6 [Bos taurus]
 tpg|DAA29032.1| TPA: X-ray repair complementing defective repair in Chinese hamster 
cells 6 [Bos taurus]
Length=612

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 122/234 (52%), Gaps = 34/234 (15%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  35   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  86

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  87   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFEDQ  137

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  138  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  191

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
            +A D +D GI ++L+ L +    F+ S+FY +++  E+++       IG  FE+
Sbjct  192  KAGDLRDTGIFLDLMHLKK-RGGFDTSLFYRDVIIAENED-------IGIHFEE  237



>ref|XP_005207439.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Bos taurus]
 ref|XP_005207440.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Bos taurus]
Length=607

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 122/234 (52%), Gaps = 34/234 (15%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    +DE E + F++++ CI      +II+ + D +
Sbjct  30   YSGRDS----LIFLVDASRAMFES----QDEDELTPFDMSIQCIRSVYTNKIISSNRDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T++ KN  +   +YV       +LD P  + ++E     D+F  + G KY    
Sbjct  82   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGVKRVQEL----DKFKGQEGKKYFEDQ  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDDPHG--DDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
            +A D +D GI ++L+ L +    F+ S+FY +++  E+++       IG  FE+
Sbjct  187  KAGDLRDTGIFLDLMHLKK-RGGFDTSLFYRDVIIAENED-------IGIHFEE  232



>ref|XP_004589793.1| PREDICTED: X-ray repair cross-complementing protein 6 [Ochotona 
princeps]
Length=608

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF + S    E E + F++++ CI     ++II+ ++D +
Sbjct  31   YSGRDS----LIFLVDVSRAMFESQS----EDELTPFDMSIQCIRSVYTSKIISSAHDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       DLD P A+ + E D +     +  F   IG  
Sbjct  83   AVVFYGTEKDKNSVNFKNIYVLQ-----DLDTPGAKRMLELDRLKWPEGKQHFQDLIGH-  136

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT 
Sbjct  137  -----GS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDNPHGSDSA--KASRART-  187

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A+D +D GI ++L+ L +    F++S+FY +++   +DE
Sbjct  188  --KARDLRDTGIYVDLMHLKK-RGGFDISLFYRDIISAAEDE  226



>ref|XP_005322256.1| PREDICTED: X-ray repair cross-complementing protein 6 [Ictidomys 
tridecemlineatus]
Length=609

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 117/220 (53%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ C+     ++II+   D +
Sbjct  31   YSGRDS----LIFLVDASRAMFES----QGEDELTPFDMSIQCVQSVYASKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       +LD P A+ + E D    +F  + G K+    
Sbjct  83   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRMLELD----QFKGQQGKKHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  134  IGHGS-DYSLSEVLWVCANLFSNVQFKMSHKRIMLFTNEDDPHG--NDSAKASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++ + +DE
Sbjct  188  KAGDLRDTGIFLDLMHLKK-HGGFDISLFYRDIISIAEDE  226



>ref|XP_005488740.1| PREDICTED: X-ray repair cross-complementing protein 5-like [Zonotrichia 
albicollis]
Length=611

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 112/217 (52%), Gaps = 20/217 (9%)
 Frame = -1

Query  702  QERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVA  523
            ++R + ++ L++LVDAS  MF +   AE     + F++ + CI     ++II+   D ++
Sbjct  31   EQRFSGRDSLIFLVDASKAMFESHGEAE-----TPFDMTIQCIRNVYTSKIISSDRDLLS  85

Query  522  ICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEI-GSKYGIEP  346
            + FY T   KN  D   +YV       +LD P A+ + E D       + +    +G   
Sbjct  86   VVFYGTENNKNSVDFKHIYVLQ-----ELDNPGAKRVLELDQYRGEEGRALFRESFG---  137

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
             S D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   RA 
Sbjct  138  HSADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAG  192

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  193  DLRDTGIILDLMHLKKPG-GFDISLFYRDIINVAEDE  228



>ref|XP_005039734.1| PREDICTED: X-ray repair cross-complementing protein 5-like [Ficedula 
albicollis]
Length=612

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/216 (33%), Positives = 109/216 (50%), Gaps = 20/216 (9%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAI  520
            +R A ++ L++LVDAS  MF +   AE     + F + + CI     ++II+   D + +
Sbjct  32   QRFAGRDSLIFLVDASKAMFESDGDAE-----TPFGMTIQCIRNVYTSKIISSDRDLLGV  86

Query  519  CFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPG  343
             FY T + KN  D   +YV       +LD P A+ + E D    D         +G    
Sbjct  87   VFYGTEDNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGRAHFQENFG---H  138

Query  342  SRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKD  163
            + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D
Sbjct  139  NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGD  193

Query  162  AQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
             +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  194  LRDTGIILDLMHLRKPG-GFDISLFYRDIINVAEDE  228



>ref|XP_002597564.1| hypothetical protein BRAFLDRAFT_281658 [Branchiostoma floridae]
 gb|EEN53576.1| hypothetical protein BRAFLDRAFT_281658 [Branchiostoma floridae]
Length=613

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 114/219 (52%), Gaps = 30/219 (14%)
 Frame = -1

Query  690  ATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFY  511
            + ++ L++L+D S  MF      E+ +E S F   V C+  ++R +II+   D V + F+
Sbjct  40   SLRDSLIFLIDCSASMFQ-----EEGEEDSAFHKCVKCVHSAMRNKIISNDRDLVGVVFF  94

Query  510  NTREKKNLQDLNCVYVYNVPERDDLDRPTARL------IKEFDHIEDRFSKEIGSKYGIE  349
             T + KN  D   VY++      DLD P A++      I E D +E RF +E G      
Sbjct  95   ATNKHKNPSDFKHVYIFQ-----DLDVPGAQMILELEEIFEEDGVE-RFEEEFGH-----  143

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
              S D S+   LW    +    + K   KR+LLFTN DDP     G I  ++ R    +A
Sbjct  144  --STDFSMSEVLWNCSNMFSTCTQKLGHKRLLLFTNNDDPHA---GNI--NLQRQAKTKA  196

Query  168  KDAQDLGISIELLPLSRP-DEEFNVSIFYAEMLGLEDDE  55
            KD + LGI+ ELL +++P  E F+++ FY +++ + +DE
Sbjct  197  KDLEGLGINTELLHMNKPGGEPFDITKFYQDIIVIPEDE  235



>ref|XP_009864836.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Apaloderma vittatum]
Length=583

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 114/234 (49%), Gaps = 28/234 (12%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +        E + F++ + CI     ++II+   D ++I 
Sbjct  5    RFSGRDSLIFLVDASKAMFESNG-----DEMTPFDMTLQCIRTVYTSKIISSDRDLLSIV  59

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T   KN  D   +YV       +LD P A+ + E D     E R  F    G     
Sbjct  60   FYGTENNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGRVLFRNTFGH----  110

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP G      KA + RT   R
Sbjct  111  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHG--NDSAKAKLART---R  162

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
            A D +D GI ++L+ L +P   F++S+FY +++   DDE    +    E+ E L
Sbjct  163  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINTADDEDLGIQPEASEKLEHL  215



>gb|KFP86069.1| X-ray repair cross-complementing protein 5, partial [Apaloderma 
vittatum]
Length=584

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 114/234 (49%), Gaps = 28/234 (12%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +        E + F++ + CI     ++II+   D ++I 
Sbjct  8    RFSGRDSLIFLVDASKAMFESNG-----DEMTPFDMTLQCIRTVYTSKIISSDRDLLSIV  62

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T   KN  D   +YV       +LD P A+ + E D     E R  F    G     
Sbjct  63   FYGTENNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGRVLFRNTFGH----  113

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP G      KA + RT   R
Sbjct  114  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHG--NDSAKAKLART---R  165

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
            A D +D GI ++L+ L +P   F++S+FY +++   DDE    +    E+ E L
Sbjct  166  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINTADDEDLGIQPEASEKLEHL  218



>ref|XP_002197201.1| PREDICTED: X-ray repair cross-complementing protein 5-like [Taeniopygia 
guttata]
Length=611

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 112/220 (51%), Gaps = 28/220 (13%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAI  520
            +R + ++ L++LVDAS  MF +   AE     + F++ + CI     ++II+   D +++
Sbjct  32   QRVSGRDSLIFLVDASKAMFESDGEAE-----TPFDMTIQCIRTVYTSKIISSDRDLLSV  86

Query  519  CFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYG  355
             FY T   KN  D   +YV       +LD P A+ + E D     E R  F +  G    
Sbjct  87   VFYGTENNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGRALFRENFGH---  138

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
                S D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   
Sbjct  139  ----SADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---  189

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            RA D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  190  RAGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINVAEDE  228



>gb|ETE68597.1| X-ray repair cross-complementing protein 6, partial [Ophiophagus 
hannah]
Length=373

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 106/213 (50%), Gaps = 19/213 (9%)
 Frame = -1

Query  690  ATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFY  511
              ++ L++LVD S  MF +     D    + F++ + CI    R +II++  D V + FY
Sbjct  46   GGRDTLLFLVDGSRTMFESF----DGSNLTPFDMTIQCIQNVYRNKIISQERDLVGVVFY  101

Query  510  NTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDN  331
             T +  N  +   +YV       +L+ P A+ + E    E    K +  K     G  DN
Sbjct  102  GTEQHNNEMNYKHIYVL-----QNLNNPGAKQVLELASYEGEQGKVLFQK---SFGHSDN  153

Query  330  -SLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQD  154
             SL  ALWV   L      K + KRI+LFTNEDDP G  +   K  + RT   +A D + 
Sbjct  154  YSLGEALWVCTNLFSVAHFKMSHKRIMLFTNEDDPHG--QDSTKTKLART---KAADLRG  208

Query  153  LGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
             GI ++L+ L +P   F++S+FY +++   DDE
Sbjct  209  TGIYLDLMNLKKPG-GFDISLFYRDIINTADDE  240



>ref|XP_531714.1| PREDICTED: X-ray repair cross-complementing protein 6 isoformX1 
[Canis lupus familiaris]
 ref|XP_005625882.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Canis lupus familiaris]
Length=608

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 115/220 (52%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF +    + E E + F++++ CI      +II+ + D +
Sbjct  30   YSGRDS----LIFLVDGSRAMFES----QGEVELTPFDMSIQCIQSVYTNKIISSNQDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  E G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGERGKKHFQDL  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++ + +DE
Sbjct  187  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDIISIAEDE  225



>ref|XP_010078314.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Pterocles gutturalis]
Length=584

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 109/215 (51%), Gaps = 20/215 (9%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ + CI     ++II+   D +++ 
Sbjct  6    RFSGRDSLIFLVDASKAMFES-----DGDGLTPFDMTIQCIRNVYTSKIISSDRDLLSVV  60

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPGS  340
            FY T + KNL D   VYV        LD P A+ + E D    D         YG    +
Sbjct  61   FYGTDKNKNLADFKHVYVLQ-----KLDNPGAKHVLELDRYRGDEGQALFRETYG---HN  112

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
             D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D 
Sbjct  113  ADYSLGEALWACSNLFSDVQVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGDL  167

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  168  RDTGIILDLMHLKKPG-GFDISLFYRDIINIAEDE  201



>ref|NP_990258.1| X-ray repair cross-complementing protein 5 precursor [Gallus 
gallus]
 sp|O93257.1|XRCC6_CHICK RecName: Full=X-ray repair cross-complementing protein 5; AltName: 
Full=5'-deoxyribose-5-phosphate lyase Ku70; Short=5'-dRP/AP 
lyase Ku70; AltName: Full=ATP-dependent DNA helicase 2 
subunit 1; AltName: Full=ATP-dependent DNA helicase II 70 kDa 
subunit; AltName: Full=DNA repair protein XRCC6; AltName: 
Full=Ku autoantigen protein p70 homolog; Short=Ku70 [Gallus 
gallus]
 dbj|BAA32018.1| Ku70 [Gallus gallus]
Length=632

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 113/219 (52%), Gaps = 26/219 (12%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF    P E+E+ A+ F++ + CI     ++II+   D +++ 
Sbjct  52   RFSGRDSLIFLVDASKAMFE---PYENEEAATPFDMTMQCIRNVYTSKIISSDKDLLSVV  108

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY     KN  D   +YV       +LD P A+ I E D     E R  F +  G     
Sbjct  109  FYGMENNKNSADFKHIYVLQ-----ELDNPGAKRILELDQYRGDEGRVLFRETFGH----  159

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNED+P        KA + RT   R
Sbjct  160  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDNPHA--NDSAKAKLART---R  211

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  212  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINVAEDE  249



>ref|XP_006740422.1| PREDICTED: X-ray repair cross-complementing protein 6 [Leptonychotes 
weddellii]
Length=563

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 113/220 (51%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF +    + E E + F++++ CI      +II+   D +
Sbjct  30   YSGRDS----LIFLVDGSRAMFES----QGEVELTPFDMSIQCIQSVYTNKIISSDQDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  E G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGEQGKKHFQDL  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L R    F++S+FY +++   +DE
Sbjct  187  KAGDLRDTGIFLDLMHL-RKRGGFDISLFYRDIISTAEDE  225



>ref|XP_005096713.1| PREDICTED: X-ray repair cross-complementing protein 5-like [Aplysia 
californica]
Length=603

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 67/232 (29%), Positives = 115/232 (50%), Gaps = 19/232 (8%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            +Q R   ++ L++L+D S  MF     A+DE+    F++ +     +++ +II+   D +
Sbjct  24   FQARFNQRDGLIFLIDTSKSMFDA---ADDEE--CLFQLCMKAAKTTVQNKIISSERDLI  78

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP  346
               F+ T E +N      VYVY       LD+P A+ I + + +E+   +     YG   
Sbjct  79   GTVFFGTEESENQSGFKHVYVYQ-----SLDQPGAQRILDLEDMEENCVRTFSKDYG---  130

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
             +   SL  ALW  Q +    +     KRI+LFTN DDP G         + R    +A 
Sbjct  131  HNEAYSLRDALWTCQNMFASSAQNLGSKRIMLFTNNDDPHGA-----NPQLRRLAVTKAS  185

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
            D  + GI +EL+ L  P + F+++ FY ++L  +DD++++  A   E+ E+L
Sbjct  186  DLNETGIDLELMHLQNPGQSFDINKFYKDILYNDDDDINEM-ADPAEKMEEL  236



>gb|KFV00120.1| X-ray repair cross-complementing protein 5, partial [Pterocles 
gutturalis]
Length=590

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 109/215 (51%), Gaps = 20/215 (9%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ + CI     ++II+   D +++ 
Sbjct  8    RFSGRDSLIFLVDASKAMFES-----DGDGLTPFDMTIQCIRNVYTSKIISSDRDLLSVV  62

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPGS  340
            FY T + KNL D   VYV        LD P A+ + E D    D         YG    +
Sbjct  63   FYGTDKNKNLADFKHVYVLQ-----KLDNPGAKHVLELDRYRGDEGQALFRETYG---HN  114

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
             D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D 
Sbjct  115  ADYSLGEALWACSNLFSDVQVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGDL  169

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  170  RDTGIILDLMHLKKPG-GFDISLFYRDIINIAEDE  203



>ref|XP_004417914.1| PREDICTED: LOW QUALITY PROTEIN: X-ray repair complementing defective 
repair in Chinese hamster cells 6 [Odobenus rosmarus 
divergens]
Length=607

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 113/220 (51%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF +    + E E + F++++ CI      +II+   D +
Sbjct  30   YSGRDS----LIFLVDGSKAMFES----QGEVELTPFDMSIQCIQSVYTNKIISSDQDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  E G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGEQGKKHFQDL  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LW+   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWICANLFSDVQVKMSHKRIMLFTNEDDPHG--NDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L R    F++S+FY +++   +DE
Sbjct  187  KAGDLRDTGIFLDLMHL-RKRGGFDISLFYXDIISTAEDE  225



>ref|XP_010582172.1| PREDICTED: X-ray repair cross-complementing protein 6 [Haliaeetus 
leucocephalus]
Length=612

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 110/219 (50%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ V CI     ++II+   D + + 
Sbjct  34   RFSGRDSLIFLVDASKAMFES-----DGDGVTPFDMTVQCIRNVYTSKIISSDRDLLGVV  88

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T + KNL D   VYV       +LD P A+ + E D     E R  F +  G     
Sbjct  89   FYGTEKNKNLADFKHVYVLQ-----ELDNPGAKRVLELDQYRGDEGRVLFRETFGH----  139

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  140  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  191

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++   +DE
Sbjct  192  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINTAEDE  229



>ref|XP_004771288.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Mustela putorius furo]
 ref|XP_004813836.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Mustela putorius furo]
Length=580

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 113/220 (51%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF +    E E E + F++++ CI      +II+   D +
Sbjct  30   YSGRDS----LIFLVDGSRAMFES----EGEDEMTPFDMSIQCILSVYTNKIISSDQDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  E G ++    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGEQGKEHFQDL  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHGLDSA--KASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++   +DE
Sbjct  187  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYQDIISTAEDE  225



>ref|XP_004771289.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Mustela putorius furo]
 ref|XP_004813837.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Mustela putorius furo]
Length=576

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 113/220 (51%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF +    E E E + F++++ CI      +II+   D +
Sbjct  30   YSGRDS----LIFLVDGSRAMFES----EGEDEMTPFDMSIQCILSVYTNKIISSDQDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  E G ++    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGEQGKEHFQDL  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHGLDSA--KASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++   +DE
Sbjct  187  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYQDIISTAEDE  225



>gb|KFQ86621.1| X-ray repair cross-complementing protein 5, partial [Phoenicopterus 
ruber ruber]
Length=581

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 112/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D  E + F++ + CI     ++II+   D +++ 
Sbjct  8    RFSGRDSLIFLVDASKAMFES-----DGDEVTPFDMTIQCIRNVYTSKIISSDKDLLSVV  62

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T + KN  D   +YV       +LD P A+ + E D     E R  F   +G     
Sbjct  63   FYGTEKNKNSADFKYIYVLQ-----ELDNPGAKRVLELDQYRGGEGRVLFRDTLGH----  113

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  114  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  165

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  166  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINVAEDE  203



>ref|XP_010194547.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Colius striatus]
Length=581

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 110/227 (48%), Gaps = 28/227 (12%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF +          + F++ + CI     ++II+   D +++ FY T + 
Sbjct  10   LIFLVDASKAMFESNGEG-----VTPFDMTMQCIRNVFTSKIISSDRDLLSVVFYGTEKN  64

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGIEPGSRDN  331
            KNL D   +YV       DL+ P A+ + E D          F +  G        + D 
Sbjct  65   KNLADFKHIYVLQ-----DLENPGAKRVLELDQYRGDDGRVLFRETFGH-------NADY  112

Query  330  SLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDL  151
            SL  ALW    L      K + KRI+LFTNEDDP        KA + RT   RA D +D 
Sbjct  113  SLGEALWACSNLFSDVRVKLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGDLRDT  167

Query  150  GISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
            GI ++L+ L +P   F++S+FY +++ + +DE    +    E+ E L
Sbjct  168  GIILDLMHLKKPG-GFDISLFYRDIINIAEDEDLGIQPEASEKLEHL  213



>ref|XP_004771287.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Mustela putorius furo]
 ref|XP_004813835.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Mustela putorius furo]
Length=607

 Score =   102 bits (255),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 110/217 (51%), Gaps = 21/217 (10%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF +    E E E + F++++ CI      +II+   D +
Sbjct  30   YSGRDS----LIFLVDGSRAMFES----EGEDEMTPFDMSIQCILSVYTNKIISSDQDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP  346
            A+ FY T + KN  +   +YV       +LD P A+ + E D  +    KE      I  
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELDQFKGEQGKEHFQDL-IGH  135

Query  345  GSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAK  166
            GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   +A 
Sbjct  136  GS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHGLDSA--KASRART---KAG  189

Query  165  DAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            D +D GI ++L+ L +    F++S+FY +++   +DE
Sbjct  190  DLRDTGIFLDLMHLKK-RGGFDISLFYQDIISTAEDE  225



>ref|XP_005421932.1| PREDICTED: X-ray repair cross-complementing protein 5-like [Geospiza 
fortis]
Length=611

 Score =   102 bits (255),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 111/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +   AE     + F++ + CI     ++II+   D +++ 
Sbjct  33   RFSGRDSLIFLVDASKAMFESDGEAE-----TPFDMTIQCIRNVYTSKIISSDRDLLSVV  87

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T   KN  D   +YV       +LD P A+ + E D     E R  F +  G     
Sbjct  88   FYGTENNKNSVDFKHIYVLQ-----ELDNPGAKRVLELDQYRGEEGRALFRESFGH----  138

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               S D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  139  ---SADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  190

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  191  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINVAEDE  228



>gb|KFQ11659.1| X-ray repair cross-complementing protein 5, partial [Leptosomus 
discolor]
Length=578

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 109/219 (50%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ V CI     ++II+   D +++ 
Sbjct  8    RFSGRDSLIFLVDASKAMFES-----DGDGVTPFDMTVQCIRNVYTSKIISSDRDLLSVV  62

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGI  352
            FY T + KN  D   VYV       +LD P A+ + E D          F K  G     
Sbjct  63   FYGTEKNKNSADFKHVYVLQ-----ELDNPGAKRVLELDQYRGDEGQVLFRKTFGH----  113

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  114  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  165

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  166  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINIAEDE  203



>ref|XP_008572445.1| PREDICTED: X-ray repair cross-complementing protein 6 [Galeopterus 
variegatus]
Length=609

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 114/219 (52%), Gaps = 25/219 (11%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E+E + F++++ CI     ++II+   D +
Sbjct  31   YSGRDS----LIFLVDASRAMFES----QGEEELTPFDMSIQCILSVYTSKIISSDQDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY--GI  352
            A+ FY T + KN  +   +YV       +LD P A+ + E     DRF    G K+   +
Sbjct  83   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLEL----DRFKGPQGKKHFQDL  133

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
                 D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT   +
Sbjct  134  MGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--DDSAKASRART---K  188

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +    F++S+FY +++ + +DE
Sbjct  189  ASDLRDTGIFLDLMHLKK-HGGFDISMFYRDIISIAEDE  226



>ref|XP_009949739.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Leptosomus discolor]
Length=594

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 109/219 (50%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ V CI     ++II+   D +++ 
Sbjct  17   RFSGRDSLIFLVDASKAMFES-----DGDGVTPFDMTVQCIRNVYTSKIISSDRDLLSVV  71

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGI  352
            FY T + KN  D   VYV       +LD P A+ + E D          F K  G     
Sbjct  72   FYGTEKNKNSADFKHVYVLQ-----ELDNPGAKRVLELDQYRGDEGQVLFRKTFGH----  122

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  123  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  174

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  175  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINIAEDE  212



>ref|XP_009487326.1| PREDICTED: X-ray repair cross-complementing protein 5-like, partial 
[Pelecanus crispus]
Length=322

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 111/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ + CI     ++II+   D +++ 
Sbjct  34   RFSGRDSLIFLVDASQAMFES-----DGDGVTPFDMTIQCIRNVYTSKIISSDRDLLSVV  88

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T + KN  D   +YV       +LD P A+ + E D     E R  F +  G     
Sbjct  89   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRVLELDRYKGDEGRVLFHETFGH----  139

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  140  ---NADYSLGEALWACSNLFSDVQVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  191

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  192  AGDLRDTGIILDLMHLKKPG-GFDMSLFYRDIINIAEDE  229



>gb|KFR08939.1| X-ray repair cross-complementing protein 5, partial [Nipponia 
nippon]
Length=604

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 109/219 (50%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF       D    + F++ + CI     ++II+   D +++ 
Sbjct  33   RFSGRDSLIFLVDASKAMFEP-----DGDGVTPFDMTIQCIRNVYTSKIISSDRDLLSVV  87

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGI  352
            FY T + KN  D   VYV       +LD P A+ + E DH         F +  G     
Sbjct  88   FYGTEKNKNSADFKHVYVLQ-----ELDNPGAKRVLELDHYRGDDGRALFRETFGH----  138

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  139  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  190

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  191  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIVNIAEDE  228



>ref|XP_008701164.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Ursus maritimus]
Length=607

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 112/219 (51%), Gaps = 25/219 (11%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF +    + E E + F++++ CI      +II+   D +
Sbjct  30   YSGRDS----LIFLVDGSRAMFES----QGEVELTPFDMSIQCIQSVYTNKIISSDQDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY--GI  352
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  E G K+  G+
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGEQGKKHFQGL  132

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
                 + SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   +
Sbjct  133  IGHGAEYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNEDDPHG--DDSAKASRART---K  187

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L R    F++S+FY +++   +DE
Sbjct  188  AGDLRDTGIFLDLMHL-RKRGGFDISLFYRDIISTAEDE  225



>gb|KFP27662.1| X-ray repair cross-complementing protein 5, partial [Colius striatus]
Length=593

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 110/227 (48%), Gaps = 28/227 (12%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF +          + F++ + CI     ++II+   D +++ FY T + 
Sbjct  15   LIFLVDASKAMFESNGEG-----VTPFDMTMQCIRNVFTSKIISSDRDLLSVVFYGTEKN  69

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGIEPGSRDN  331
            KNL D   +YV       DL+ P A+ + E D          F +  G        + D 
Sbjct  70   KNLADFKHIYVLQ-----DLENPGAKRVLELDQYRGDDGRVLFRETFGH-------NADY  117

Query  330  SLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDL  151
            SL  ALW    L      K + KRI+LFTNEDDP        KA + RT   RA D +D 
Sbjct  118  SLGEALWACSNLFSDVRVKLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGDLRDT  172

Query  150  GISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
            GI ++L+ L +P   F++S+FY +++ + +DE    +    E+ E L
Sbjct  173  GIILDLMHLKKPG-GFDISLFYRDIINIAEDEDLGIQPEASEKLEHL  218



>gb|KFQ64475.1| X-ray repair cross-complementing protein 5, partial [Pelecanus 
crispus]
Length=323

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 111/219 (51%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ + CI     ++II+   D +++ 
Sbjct  35   RFSGRDSLIFLVDASQAMFES-----DGDGVTPFDMTIQCIRNVYTSKIISSDRDLLSVV  89

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYGI  352
            FY T + KN  D   +YV       +LD P A+ + E D     E R  F +  G     
Sbjct  90   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRVLELDRYKGDEGRVLFHETFGH----  140

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  141  ---NADYSLGEALWACSNLFSDVQVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  192

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  193  AGDLRDTGIILDLMHLKKPG-GFDMSLFYRDIINIAEDE  230



>ref|XP_009473520.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Nipponia nippon]
Length=610

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 109/219 (50%), Gaps = 28/219 (13%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF       D    + F++ + CI     ++II+   D +++ 
Sbjct  32   RFSGRDSLIFLVDASKAMFEP-----DGDGVTPFDMTIQCIRNVYTSKIISSDRDLLSVV  86

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED-----RFSKEIGSKYGI  352
            FY T + KN  D   VYV       +LD P A+ + E DH         F +  G     
Sbjct  87   FYGTEKNKNSADFKHVYVLQ-----ELDNPGAKRVLELDHYRGDDGRALFRETFGH----  137

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
               + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   R
Sbjct  138  ---NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---R  189

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  190  AGDLRDTGIILDLMHLKKPG-GFDISLFYRDIVNIAEDE  227



>ref|XP_005379417.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Chinchilla lanigera]
 ref|XP_005379418.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Chinchilla lanigera]
 ref|XP_005379419.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Chinchilla lanigera]
 ref|XP_005379420.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X4 [Chinchilla lanigera]
Length=609

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 121/234 (52%), Gaps = 33/234 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI     ++II+   D +
Sbjct  31   YSGRDS----LIFLVDASRAMFES----QGENELTPFDMSIQCIECVYTSKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
             + FY T++ KN  +   +YV       +LD P A+ + E D    RF  ++G  +    
Sbjct  83   GVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----RFKGQLGQNHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTN+DDP G      KA   RT   
Sbjct  134  IGHGS-DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNDDDPHGGDSA--KASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
            +A D +D GI ++L+ L +    F++S+FY +++ + +D      A +G  FE+
Sbjct  188  KASDLRDTGIFLDLMHLKK-RGGFDISLFYRDIISVAED------ADLGVHFEE  234



>ref|XP_008634857.1| PREDICTED: X-ray repair cross-complementing protein 6 [Corvus 
brachyrhynchos]
Length=593

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 112/224 (50%), Gaps = 28/224 (13%)
 Frame = -1

Query  711  EFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYD  532
             +   R + ++ L++LVDAS  MF +   AE     + F++ + CI     ++II+   D
Sbjct  10   HYSDHRFSGRDSLIFLVDASKAMFESDGDAE-----TPFDMTIQCIRNVYTSKIISSDRD  64

Query  531  EVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIG  367
             +++ FY T   KN  D   +YV       +LD P A+ + E D     E R  F +  G
Sbjct  65   LLSVVFYGTENNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGRALFRENFG  119

Query  366  SKYGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMR  187
                    + D SL  ALW    L      + + KRI+LFTNEDDP        KA + R
Sbjct  120  H-------NTDYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLAR  170

Query  186  TTFQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            T   RA D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  171  T---RAGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINVAEDE  210



>ref|XP_010409219.1| PREDICTED: X-ray repair cross-complementing protein 6 [Corvus 
cornix cornix]
Length=593

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 112/224 (50%), Gaps = 28/224 (13%)
 Frame = -1

Query  711  EFYQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYD  532
             +   R + ++ L++LVDAS  MF +   AE     + F++ + CI     ++II+   D
Sbjct  10   HYSDHRFSGRDSLIFLVDASKAMFESDGDAE-----TPFDMTIQCIRNVYTSKIISSDRD  64

Query  531  EVAICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIG  367
             +++ FY T   KN  D   +YV       +LD P A+ + E D     E R  F +  G
Sbjct  65   LLSVVFYGTENNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGRALFRENFG  119

Query  366  SKYGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMR  187
                    + D SL  ALW    L      + + KRI+LFTNEDDP        KA + R
Sbjct  120  H-------NTDYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLAR  170

Query  186  TTFQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            T   RA D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  171  T---RAGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINVAEDE  210



>ref|XP_001378778.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Monodelphis domestica]
 ref|XP_007506132.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Monodelphis domestica]
 ref|XP_007506133.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Monodelphis domestica]
Length=613

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 109/216 (50%), Gaps = 31/216 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF      +DE   + FE+ + CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFE----PQDEGPRTSFELTIQCIQSVYSSKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSK-----  361
            A+ FY T + KN  +   VYV +     +LD P A+ I E     DRF  E G +     
Sbjct  84   AVVFYGTDKAKNSVNFRSVYVLH-----ELDPPGAKRILEL----DRFKGEQGERNFREL  134

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
             G  P   D SL  ALWV   L      K + KRI+LFTNED P        KA   RT 
Sbjct  135  IGHGP---DYSLSEALWVCANLFSGVRLKMSHKRIMLFTNEDHPHA--NDGAKASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEML  73
              +A D +D GI ++L+ L +P   F+V++FY +++
Sbjct  189  --KASDLRDTGIFLDLMNLKKPG-GFDVALFYRDLI  221



>ref|XP_003202349.1| PREDICTED: X-ray repair cross-complementing protein 6 [Meleagris 
gallopavo]
Length=614

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 112/220 (51%), Gaps = 26/220 (12%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAI  520
             R + ++ L++LVDAS  MF    P EDE+ A+ F++ + CI     ++II+   D +++
Sbjct  33   HRFSGRDSLIFLVDASKAMFE---PYEDEEAATPFDMTMQCIRNVYTSKIISSDKDFLSV  89

Query  519  CFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYG  355
             FY T   KN      VYV       +LD P A+ I E D     E R  F +  G    
Sbjct  90   VFYGTENNKNSAGFKHVYVLQ-----ELDNPGAKRILELDQYRGDEGRLLFRESFGH---  141

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
                + D SL  ALW    L      + + KRI+LFTNED+P        KA + RT   
Sbjct  142  ----NADYSLGEALWACSNLFSNVQVRLSHKRIMLFTNEDNPHANDNA--KAKLART---  192

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            RA D +D GI ++L+ L +    F++S+FY +++ + +DE
Sbjct  193  RAGDLRDTGIILDLMHLKKLG-GFDISLFYRDIINIAEDE  231



>ref|XP_010981805.1| PREDICTED: X-ray repair cross-complementing protein 6 [Camelus 
dromedarius]
 ref|XP_010981806.1| PREDICTED: X-ray repair cross-complementing protein 6 [Camelus 
dromedarius]
 ref|XP_010981807.1| PREDICTED: X-ray repair cross-complementing protein 6 [Camelus 
dromedarius]
Length=609

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 115/220 (52%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI      +II+   D +
Sbjct  32   YSGRDS----LIFLVDASRAMFDS----QGEDELTPFDMSIQCIQSVYTNKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       +LD P A+ + E D    +F    G K+    
Sbjct  84   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDSPGAKRVLELD----QFKGPKGKKHFQDL  134

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  135  IGHGS-DYSLSEVLWVCANLFSNVQFKMSYKRIMLFTNEDDPHGGDSA--KASRART---  188

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++ + +DE
Sbjct  189  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDIISIAEDE  227



>ref|XP_004675683.1| PREDICTED: X-ray repair cross-complementing protein 6 [Condylura 
cristata]
Length=609

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/237 (33%), Positives = 116/237 (49%), Gaps = 31/237 (13%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI      +II+   D +
Sbjct  32   YSGRDS----LIFLVDASRAMFDS----QGENELTPFDMSIQCIQNVYTNKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ + E D       E  F K +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDTPGAKRVLELDQFKGQRGEKHFQKLLGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K + KRI+LFTNED+P         A   RT 
Sbjct  138  -----GS-DYSLSEVLWVCANLFSNVQFKMSHKRIMLFTNEDNPHA--NDSASASRART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
              +A D +D GI ++L+ L + D  F++S+FY +++ + +DE          R EDL
Sbjct  189  --KAGDLRDTGICLDLMHLKK-DGGFDISLFYRDIISVAEDEDLGVHCEASARLEDL  242



>ref|XP_006174761.1| PREDICTED: X-ray repair cross-complementing protein 6 [Camelus 
ferus]
Length=608

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 115/220 (52%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI      +II+   D +
Sbjct  31   YSGRDS----LIFLVDASRAMFDS----QGEDELTPFDMSIQCIQSVYTNKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       +LD P A+ + E D    +F    G K+    
Sbjct  83   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDSPGAKRVLELD----QFKGPKGKKHFQDL  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  134  IGHGS-DYSLSEVLWVCANLFSNVQFKMSYKRIMLFTNEDDPHGGDSA--KASRART---  187

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++ + +DE
Sbjct  188  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDIISIAEDE  226



>ref|XP_004610780.1| PREDICTED: X-ray repair cross-complementing protein 6 [Sorex 
araneus]
Length=608

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 114/222 (51%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E   + F++++ CI      +II+   D +
Sbjct  31   YSGRDS----LIFLVDASRAMFDS----QGEDGLTPFDMSIQCIQSVYTNKIISSDRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-----DRFSKEIGSK  361
            A+ FY T ++KN  D   +YV       +LD P A+ + E D  +     + F K +G  
Sbjct  83   AVVFYGTEKEKNSVDFKHIYVLQ-----ELDSPGAKRVLELDQFKGPQGKEHFQKLLG--  135

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
            +G E      SL   LWV   L      K + KRI+LFTNEDDP        KA   RT 
Sbjct  136  HGAE-----YSLSEVLWVCANLFSSVQVKMSHKRIMLFTNEDDPHRSDSA--KASRART-  187

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L + D  F++S+FY +++ + +DE
Sbjct  188  --KAGDLRDTGIFLDLMHLKK-DGGFDISLFYRDIISIAEDE  226



>ref|XP_008982115.1| PREDICTED: LOW QUALITY PROTEIN: X-ray repair cross-complementing 
protein 6 [Callithrix jacchus]
Length=609

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF + S    E E + F++++ CI     ++II+   D +
Sbjct  32   YSGRDS----LIFLVDDSRAMFESHS----EDELTSFDMSIQCILSVYISKIISSDXDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF + +G  
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELDQFKGQQGQKRFQELMGH-  137

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV+         K + +RI+LFT+ED+P G      KA   RT 
Sbjct  138  -----GS-DYSLSEVLWVSANFFSDVQFKMSHRRIMLFTDEDNPHG--NDSAKASQART-  188

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D QD GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  189  --KAGDLQDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  227



>ref|XP_006917436.1| PREDICTED: X-ray repair cross-complementing protein 6 [Pteropus 
alecto]
Length=607

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 114/220 (52%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L+++VDAS  MF + S    E E + F++++ CI      +II+   D +
Sbjct  29   YSGRDS----LIFVVDASRAMFESQS----EDELTPFDMSIQCIKSVYTNKIISSDRDLL  80

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY---G  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    RF  + G K+    
Sbjct  81   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----RFKGQQGKKHFQDM  131

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  G  D SL   LWV   L      K + KRI+LFTNED+P G      KA   RT   
Sbjct  132  IGHGC-DYSLNEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSAKASRART---  185

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++ + +DE
Sbjct  186  KAGDLRDTGIFLDLMHLKK-HGGFDISVFYRDIISIAEDE  224



>ref|XP_010958530.1| PREDICTED: X-ray repair cross-complementing protein 6 [Camelus 
bactrianus]
 ref|XP_010958531.1| PREDICTED: X-ray repair cross-complementing protein 6 [Camelus 
bactrianus]
 ref|XP_010958532.1| PREDICTED: X-ray repair cross-complementing protein 6 [Camelus 
bactrianus]
 gb|EPY88531.1| x-ray repair cross-complementing protein 6 [Camelus ferus]
Length=609

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 115/220 (52%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF +    + E E + F++++ CI      +II+   D +
Sbjct  32   YSGRDS----LIFLVDASRAMFDS----QGEDELTPFDMSIQCIQSVYTNKIISSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T++ KN  +   +YV       +LD P A+ + E D    +F    G K+    
Sbjct  84   AVVFYGTKKDKNSVNFKNIYVLQ-----ELDSPGAKRVLELD----QFKGPKGKKHFQDL  134

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KRI+LFTNEDDP G      KA   RT   
Sbjct  135  IGHGS-DYSLSEVLWVCANLFSNVQFKMSYKRIMLFTNEDDPHGGDSA--KASRART---  188

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L +    F++S+FY +++ + +DE
Sbjct  189  KAGDLRDTGIFLDLMHLKK-RGGFDISLFYRDIISIAEDE  227



>gb|KFO61326.1| X-ray repair cross-complementing protein 5, partial [Corvus brachyrhynchos]
Length=586

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 111/220 (50%), Gaps = 28/220 (13%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAI  520
             R + ++ L++LVDAS  MF +   AE     + F++ + CI     ++II+   D +++
Sbjct  7    HRFSGRDSLIFLVDASKAMFESDGDAE-----TPFDMTIQCIRNVYTSKIISSDRDLLSV  61

Query  519  CFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYG  355
             FY T   KN  D   +YV       +LD P A+ + E D     E R  F +  G    
Sbjct  62   VFYGTENNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGRALFRENFGH---  113

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
                + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   
Sbjct  114  ----NTDYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---  164

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            RA D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  165  RAGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINVAEDE  203



>ref|XP_009438053.1| PREDICTED: LOW QUALITY PROTEIN: X-ray repair cross-complementing 
protein 6-like [Pan troglodytes]
Length=786

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 115/222 (52%), Gaps = 31/222 (14%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y ERD+    L++LVDAS   F   SP+EDE   + F++++ CI     ++II+   D +
Sbjct  209  YSERDS----LIFLVDASKATFE--SPSEDE--LTPFDMSIQCIQSVYISKIISSDRDLL  260

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
            A+ FY T + KN  +   +YV       +LD P A+ I E D       + RF   +G  
Sbjct  261  AVVFYGTEKDKNSVNFKNIYVLX-----ELDNPGAKRILELDQFKGQQGQKRFQDLMGH-  314

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
                 GS D SL   LWV   L      K   K+I LFTNED+P G      KA   RT 
Sbjct  315  -----GS-DYSLSEVLWVRANLFSDVQFKMNHKKITLFTNEDNPHG--NESAKASQART-  365

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
              +A D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  366  --KAGDLRDTGIFLDLMHLKKPG-GFDISLFYRDIISIAEDE  404



>ref|XP_010222806.1| PREDICTED: X-ray repair cross-complementing protein 6 [Tinamus 
guttatus]
Length=611

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 111/209 (53%), Gaps = 21/209 (10%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF +      ++E S F++ + CI  +  ++II+   D +++ FY T + 
Sbjct  38   LIFLVDASEDMFESYK----DEEYSPFDMTMQCIRNAYISKIISSDKDLLSVVFYGTEKN  93

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP-GSRDN-SLY  322
            KN  D   VYV       +LD P A+ I E     D++  + G K   E  G  DN SL 
Sbjct  94   KNSADFKHVYVLQ-----ELDNPGAKRILEL----DKYRGDQGQKLFQETFGHNDNYSLG  144

Query  321  SALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGIS  142
             ALW    L      + + KRILLFTN+D+P        K+ + RT   RA D +D GI 
Sbjct  145  EALWACSNLFSDVRVRMSHKRILLFTNKDNPHA--NDSAKSKLART---RAGDLRDTGII  199

Query  141  IELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            ++LL L +P   F++S+FY +++   +DE
Sbjct  200  LDLLHLKKPG-GFDISLFYRDIINTAEDE  227



>ref|XP_009706116.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Cariama cristata]
Length=583

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 111/215 (52%), Gaps = 20/215 (9%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D      F+V + CI     ++II+   D +++ 
Sbjct  5    RFSGRDSLIFLVDASKAMFES-----DGAGVIPFDVTIQCIRNVYTSKIISSDKDLLSVV  59

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFD-HIEDRFSKEIGSKYGIEPGS  340
            FY T + KN  D   +YV       +LD P A+ + E D ++ D+        +G    +
Sbjct  60   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRVLELDEYMGDKGRVCFRETFG---HN  111

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
             D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D 
Sbjct  112  ADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGDL  166

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  167  RDTGIILDLMHLKKPG-GFDISLFYRDIINIAEDE  200



>ref|XP_008051748.1| PREDICTED: X-ray repair cross-complementing protein 6 [Tarsius 
syrichta]
Length=610

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 115/219 (53%), Gaps = 25/219 (11%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF + S    E E + F++++ CI     ++I++   D +
Sbjct  32   YSGRDS----LIFLVDASKAMFESQS----EDELTPFDMSIQCIQSVYISKIVSSDRDLL  83

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKY--GI  352
            A+ FY T + KN  +   +YV       +LD P A+ I E D    +F  + G K+   +
Sbjct  84   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRILELD----QFKGQQGKKHFQDL  134

Query  351  EPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQR  172
                 D SL   LWV   L      K + KRI+LFTNED+P G      +A   RT   +
Sbjct  135  MGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHG--NDSARASRART---K  189

Query  171  AKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            A D +D GI ++L+ L + +  F++S+FY +++ + +DE
Sbjct  190  AGDLRDTGIFLDLMHLKK-EGGFDISLFYRDIISIAEDE  227



>gb|KGL84030.1| X-ray repair cross-complementing protein 5, partial [Tinamus 
guttatus]
Length=609

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 111/209 (53%), Gaps = 21/209 (10%)
 Frame = -1

Query  675  LVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREK  496
            L++LVDAS  MF +      ++E S F++ + CI  +  ++II+   D +++ FY T + 
Sbjct  39   LIFLVDASEDMFESYK----DEEYSPFDMTMQCIRNAYISKIISSDKDLLSVVFYGTEKN  94

Query  495  KNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEP-GSRDN-SLY  322
            KN  D   VYV       +LD P A+ I E     D++  + G K   E  G  DN SL 
Sbjct  95   KNSADFKHVYVLQ-----ELDNPGAKRILEL----DKYRGDQGQKLFQETFGHNDNYSLG  145

Query  321  SALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGIS  142
             ALW    L      + + KRILLFTN+D+P        K+ + RT   RA D +D GI 
Sbjct  146  EALWACSNLFSDVRVRMSHKRILLFTNKDNPHA--NDSAKSKLART---RAGDLRDTGII  200

Query  141  IELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            ++LL L +P   F++S+FY +++   +DE
Sbjct  201  LDLLHLKKPG-GFDISLFYRDIINTAEDE  228



>ref|XP_005302658.1| PREDICTED: X-ray repair cross-complementing protein 6 [Chrysemys 
picta bellii]
 ref|XP_005302659.1| PREDICTED: X-ray repair cross-complementing protein 6 [Chrysemys 
picta bellii]
Length=610

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 111/213 (52%), Gaps = 19/213 (9%)
 Frame = -1

Query  690  ATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFY  511
            A ++ L++LVDAS  MF       D+ E + F++ + CI     ++II+   D +++ FY
Sbjct  32   AGRDSLIFLVDASKAMFEYY----DDDEWTPFDMTIQCIRNVYTSKIISSDRDLLSVVFY  87

Query  510  NTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPGSRD  334
             T + KN  D   VYV       +LD P A+ + E D  + D+        +G    + D
Sbjct  88   GTEKHKNSVDFKHVYVLQ-----ELDNPGAKRVLELDKYKGDQGKALFRESFG---HNAD  139

Query  333  NSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQD  154
             SL  ALW    L      K + KRI+LFTNED+P G      KA + RT   +A D +D
Sbjct  140  YSLGEALWACCNLFSDVQLKMSHKRIMLFTNEDNPHG--HDSTKAKLART---KAADLRD  194

Query  153  LGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
             GI ++L+ L +P   F++S+FY +++   +DE
Sbjct  195  TGIFLDLMHLKKPG-GFDISLFYRDIINTAEDE  226



>ref|XP_006027712.1| PREDICTED: X-ray repair cross-complementing protein 5-like isoform 
X3 [Alligator sinensis]
Length=568

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 107/213 (50%), Gaps = 15/213 (7%)
 Frame = -1

Query  645  MFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNTREKKNLQDLNCVY  466
            MF +    ED+ + + FE+ + CI      +II+   D ++I FY T + KNL D   VY
Sbjct  1    MFQSYEEGEDDDDWTPFEMTIQCIRNVYTNKIISSDRDLLSIVFYGTEKNKNLADFKHVY  60

Query  465  VYNVPERDDLDRPTARLIKEFDHIEDRFSKEI-GSKYGIEPGSRDNSLYSALWVAQALLR  289
            V       +LD P A+ + E D  +    K +    +G    S + SL  A W    L  
Sbjct  61   VLQ-----ELDNPGAQRVLELDQYKGNRGKALFRESFG---HSNEYSLGEAFWACSNLFS  112

Query  288  KGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDAQDLGISIELLPLSRPDE  109
                K + KRI+LFTNED+P        KA + RT   RA D +D GI ++L+ L +P  
Sbjct  113  DVQLKMSHKRIMLFTNEDNPHA--NDSTKAKLART---RAADLRDTGIILDLMHLKKPG-  166

Query  108  EFNVSIFYAEMLGLEDDELDQFKALIGERFEDL  10
             F++S+FY +++ + +DE    + +   + EDL
Sbjct  167  RFDISMFYRDIINVAEDEDLGVQPVESGKLEDL  199



>gb|EFB16518.1| hypothetical protein PANDA_019481 [Ailuropoda melanoleuca]
Length=582

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 113/220 (51%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF +    + E E + F++++ CI      +II+   D +
Sbjct  5    YSGRDS----LIFLVDGSRAMFES----QGEVELTPFDMSIQCIQSVYTNKIISSDQDLL  56

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  E G K+    
Sbjct  57   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGEQGKKHFQDL  107

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KR++LFTNEDDP G      KA   RT   
Sbjct  108  IGHGS-DYSLSEVLWVCANLFSDVRVKMSHKRVMLFTNEDDPHG--DDSAKASRART---  161

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L R    F++S+FY +++   +DE
Sbjct  162  KAGDLRDTGIFLDLMHL-RKRGGFDISLFYRDIISTAEDE  200



>ref|XP_002929325.1| PREDICTED: x-ray repair cross-complementing protein 6-like [Ailuropoda 
melanoleuca]
Length=607

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 113/220 (51%), Gaps = 27/220 (12%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF +    + E E + F++++ CI      +II+   D +
Sbjct  30   YSGRDS----LIFLVDGSRAMFES----QGEVELTPFDMSIQCIQSVYTNKIISSDQDLL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYG---  355
            A+ FY T + KN  +   +YV       +LD P A+ + E D    +F  E G K+    
Sbjct  82   AVVFYGTEKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELD----QFKGEQGKKHFQDL  132

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
            I  GS D SL   LWV   L      K + KR++LFTNEDDP G      KA   RT   
Sbjct  133  IGHGS-DYSLSEVLWVCANLFSDVRVKMSHKRVMLFTNEDDPHG--DDSAKASRART---  186

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +A D +D GI ++L+ L R    F++S+FY +++   +DE
Sbjct  187  KAGDLRDTGIFLDLMHL-RKRGGFDISLFYRDIISTAEDE  225



>ref|XP_010281700.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X1 [Phaethon lepturus]
Length=620

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 110/215 (51%), Gaps = 20/215 (9%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ + CI     ++II+   D +++ 
Sbjct  42   RFSGRDSLIFLVDASRAMFES-----DGDGVTPFDMTIRCIRSVYTSKIISSDRDLLSVV  96

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPGS  340
            FY T + KN  D   +YV       +LD P A+ I E D  + DR        +G    +
Sbjct  97   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRILELDQYKGDRGRVLFRDTFG---HN  148

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
             D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D 
Sbjct  149  ADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGDL  203

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +D GI ++L+ L +P   F +S+FY +++ + +DE
Sbjct  204  RDTGIILDLMHLKKPG-GFAISLFYRDIINIAEDE  237



>ref|XP_010281702.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X3 [Phaethon lepturus]
Length=610

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 110/215 (51%), Gaps = 20/215 (9%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ + CI     ++II+   D +++ 
Sbjct  32   RFSGRDSLIFLVDASRAMFES-----DGDGVTPFDMTIRCIRSVYTSKIISSDRDLLSVV  86

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPGS  340
            FY T + KN  D   +YV       +LD P A+ I E D  + DR        +G    +
Sbjct  87   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRILELDQYKGDRGRVLFRDTFG---HN  138

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
             D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D 
Sbjct  139  ADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGDL  193

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +D GI ++L+ L +P   F +S+FY +++ + +DE
Sbjct  194  RDTGIILDLMHLKKPG-GFAISLFYRDIINIAEDE  227



>ref|XP_010281701.1| PREDICTED: X-ray repair cross-complementing protein 6 isoform 
X2 [Phaethon lepturus]
Length=612

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 110/215 (51%), Gaps = 20/215 (9%)
 Frame = -1

Query  696  RDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAIC  517
            R + ++ L++LVDAS  MF +     D    + F++ + CI     ++II+   D +++ 
Sbjct  34   RFSGRDSLIFLVDASRAMFES-----DGDGVTPFDMTIRCIRSVYTSKIISSDRDLLSVV  88

Query  516  FYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIEPGS  340
            FY T + KN  D   +YV       +LD P A+ I E D  + DR        +G    +
Sbjct  89   FYGTEKNKNSADFKHIYVLQ-----ELDNPGAKRILELDQYKGDRGRVLFRDTFG---HN  140

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
             D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   RA D 
Sbjct  141  ADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---RAGDL  195

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            +D GI ++L+ L +P   F +S+FY +++ + +DE
Sbjct  196  RDTGIILDLMHLKKPG-GFAISLFYRDIINIAEDE  229



>gb|EFA79065.1| ATP-dependent DNA helicase [Polysphondylium pallidum PN500]
Length=775

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 106/214 (50%), Gaps = 22/214 (10%)
 Frame = -1

Query  684  KELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFYNT  505
            ++ +++L+D S  MF    P   EK    F+ A+ C+ Q++  +II    D + +C YNT
Sbjct  65   RDCIIFLIDTSKAMFEP-DPVTKEKP---FDNAIKCLIQTITDKIITSDSDLIGLCLYNT  120

Query  504  REKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIEDRFSKEIGSKYGIEPGSRDNSL  325
             + KNL D   +YV       DLD P  + I     +ED    +  S +G    ++D   
Sbjct  121  DKNKNLNDFENIYVLF-----DLDIPDPKTIL---LLEDILEGDYSS-FGGYTENKDMVF  171

Query  324  YSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRT-TFQRAKDAQDLG  148
              ALW    +    + K + KRI LFTN+D P          D  +    QRAKD  DLG
Sbjct  172  CDALWTCSTMFSNCNIKLSHKRIFLFTNQDQP------TQDNDNQKVIAIQRAKDLSDLG  225

Query  147  ISIELLPLSRP--DEEFNVSIFYAEMLGLEDDEL  52
            I IEL  ++    D  F+ S+FY E++ L+DD++
Sbjct  226  IEIELFSMNNALSDHPFDFSLFYQEIIILQDDQI  259



>gb|KFH70399.1| hypothetical protein MVEG_03249 [Mortierella verticillata NRRL 
6337]
Length=622

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/215 (30%), Positives = 105/215 (49%), Gaps = 24/215 (11%)
 Frame = -1

Query  690  ATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAICFY  511
            ++++ +++++D SP M        D++    F+ A+ C +  L  +I+    D V I  Y
Sbjct  29   SSRDSILFVIDCSPPMLQ-----PDQEGEVPFKTAIKCASAVLLNKIVTSETDLVGIVLY  83

Query  510  NTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIED---RFSKEIGSKYGIEPGS  340
             T + KN  +   +YV       DLD P    I + + IE+    F +EIG+  G     
Sbjct  84   GTAKSKNANNFENIYVLQ-----DLDAPDVHKILQLESIENESFNFDEEIGTSNG-----  133

Query  339  RDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRAKDA  160
               +L    W A  L    + K   KR+ LFTNEDDP     G+  A  +R     AKD 
Sbjct  134  -KYTLGEMFWTATNLFGASAQKVGSKRVFLFTNEDDPHRGDIGLRSASKVR-----AKDL  187

Query  159  QDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            Q+ GI ++L  + +P E+F+ ++FY ++L  + DE
Sbjct  188  QEFGILVDLFDIDKPGEKFDRTLFYQDLLLHDADE  222



>ref|XP_007053384.1| PREDICTED: X-ray repair cross-complementing protein 5-like [Chelonia 
mydas]
Length=610

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 113/218 (52%), Gaps = 23/218 (11%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF       D+ E + F++ + CI     ++II+ + D +
Sbjct  31   YSGRDS----LIFLVDASKAMFEYY----DDDEWTPFDMTIQCIRNVYTSKIISSNRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIE  349
            ++ FY T + KN  D   VYV       +LD P A+ + E D  + D+        +G  
Sbjct  83   SVVFYGTEKHKNSVDFKHVYVLQ-----ELDNPGAKRVLELDKYKGDQGKALFRESFG--  135

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
              + D SL  ALW    L      K + KRI+LFTNED+P G      KA + RT   +A
Sbjct  136  -HNADYSLGEALWACCNLFSDVRLKMSHKRIMLFTNEDNPHGY--DSTKAKLART---KA  189

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
             D +D GI ++L+ L +P   F++S+FY +++   +DE
Sbjct  190  ADLRDTGIFLDLMHLKKPG-GFDISLFYRDIVNTAEDE  226



>gb|EMP41869.1| X-ray repair cross-complementing protein 5, partial [Chelonia 
mydas]
Length=609

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 113/218 (52%), Gaps = 23/218 (11%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVDAS  MF       D+ E + F++ + CI     ++II+ + D +
Sbjct  31   YSGRDS----LIFLVDASKAMFEYY----DDDEWTPFDMTIQCIRNVYTSKIISSNRDLL  82

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHIE-DRFSKEIGSKYGIE  349
            ++ FY T + KN  D   VYV       +LD P A+ + E D  + D+        +G  
Sbjct  83   SVVFYGTEKHKNSVDFKHVYVLQ-----ELDNPGAKRVLELDKYKGDQGKALFRESFG--  135

Query  348  PGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQRA  169
              + D SL  ALW    L      K + KRI+LFTNED+P G      KA + RT   +A
Sbjct  136  -HNADYSLGEALWACCNLFSDVRLKMSHKRIMLFTNEDNPHGY--DSTKAKLART---KA  189

Query  168  KDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
             D +D GI ++L+ L +P   F++S+FY +++   +DE
Sbjct  190  ADLRDTGIFLDLMHLKKPG-GFDISLFYRDIVNTAEDE  226



>ref|XP_008929762.1| PREDICTED: X-ray repair cross-complementing protein 6, partial 
[Manacus vitellinus]
Length=606

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 110/220 (50%), Gaps = 28/220 (13%)
 Frame = -1

Query  699  ERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEVAI  520
             R   ++ L++LVDAS  MF +   AE     + F++ + CI     ++II+   D +++
Sbjct  27   HRFGGRDSLIFLVDASKAMFESDGDAE-----TPFDMTMQCIRNVYTSKIISSDRDLLSV  81

Query  519  CFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI---EDR--FSKEIGSKYG  355
             FY T   KN  D   +YV       +LD P A+ + E D     E R  F +  G    
Sbjct  82   VFYGTENNKNSADFKHIYVLQ-----ELDNPGAKRVLELDQYRGDEGRALFRESFGH---  133

Query  354  IEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTTFQ  175
                + D SL  ALW    L      + + KRI+LFTNEDDP        KA + RT   
Sbjct  134  ----NADYSLGEALWACSNLFSDVRVRLSHKRIMLFTNEDDPHA--NDSAKAKLART---  184

Query  174  RAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDE  55
            RA D +D GI ++L+ L +P   F++S+FY +++ + +DE
Sbjct  185  RAGDLRDTGIILDLMHLKKPG-GFDISLFYRDIINVAEDE  223



>ref|XP_004897785.1| PREDICTED: X-ray repair cross-complementing protein 6 [Heterocephalus 
glaber]
 ref|XP_004845565.1| PREDICTED: X-ray repair cross-complementing protein 6 [Heterocephalus 
glaber]
 gb|EHB11262.1| ATP-dependent DNA helicase 2 subunit 1 [Heterocephalus glaber]
Length=608

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 119/236 (50%), Gaps = 37/236 (16%)
 Frame = -1

Query  705  YQERDATKELLVYLVDASPKMFSTTSPAEDEKEASHFEVAVNCIAQSLRTQIINRSYDEV  526
            Y  RD+    L++LVD S  MF +    + E E + F++++ CI     ++II+   D +
Sbjct  30   YSGRDS----LIFLVDVSRPMFES----QGENELTPFDMSIQCIESVYTSKIISSDRDFL  81

Query  525  AICFYNTREKKNLQDLNCVYVYNVPERDDLDRPTARLIKEFDHI-----EDRFSKEIGSK  361
             + FY T++ KN  +   +YV       +LD P A+ + E D       ++ F   IG  
Sbjct  82   GVVFYGTKKDKNSVNFKNIYVLQ-----ELDNPGAKRVLELDQFKGQQGQNHFQDLIG--  134

Query  360  YGIEPGSRDNSLYSALWVAQALLRKGSAKTADKRILLFTNEDDPFGCIKGVIKADMMRTT  181
            +G      D SL   LWV   L      K + KRI+LFTN+DDP G      KA   RT 
Sbjct  135  HGC-----DYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNDDDPHGSDSA--KASRART-  186

Query  180  FQRAKDAQDLGISIELLPLSRPDEEFNVSIFYAEMLGLEDDELDQFKALIGERFED  13
              +A D +D GI ++L+ L +    F++S+FY +++ +E+D      A +G  FE+
Sbjct  187  --KASDLRDTGIFLDLMHLKK-HGGFDISLFYRDIISVEED------ADLGVHFEE  233



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1761970051296