BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c37115_g1_i1 len=992 path=[970:0-991]

Length=992
                                                                      Score     E

ref|XP_008221898.1|  PREDICTED: uncharacterized protein LOC103321...    416   9e-141   
ref|XP_008221900.1|  PREDICTED: uncharacterized protein LOC103321...    414   7e-140   
ref|XP_010650498.1|  PREDICTED: uncharacterized protein LOC100243914    414   1e-139   
gb|KDO82215.1|  hypothetical protein CISIN_1g013577mg                   409   4e-139   
ref|XP_007222781.1|  hypothetical protein PRUPE_ppa006602mg             412   5e-139   
ref|XP_006357596.1|  PREDICTED: uncharacterized protein LOC102579...    411   1e-138   
ref|XP_007222780.1|  hypothetical protein PRUPE_ppa006602mg             410   2e-138   
ref|XP_011086653.1|  PREDICTED: uncharacterized protein LOC105168320    410   3e-138   
ref|XP_006438248.1|  hypothetical protein CICLE_v10031670mg             409   2e-137   
ref|XP_009598212.1|  PREDICTED: uncharacterized protein LOC104094058    407   4e-137   
ref|XP_006601926.1|  PREDICTED: uncharacterized protein LOC100811...    407   4e-137   
gb|EYU30626.1|  hypothetical protein MIMGU_mgv1a007496mg                406   1e-136   
ref|XP_008221901.1|  PREDICTED: uncharacterized protein LOC103321...    404   4e-136   
ref|XP_010906956.1|  PREDICTED: uncharacterized protein LOC105033...    403   1e-135   
ref|XP_010248668.1|  PREDICTED: uncharacterized protein LOC104591513    403   2e-135   
ref|XP_010906955.1|  PREDICTED: uncharacterized protein LOC105033...    402   2e-135   
ref|XP_003551994.1|  PREDICTED: uncharacterized protein LOC100811...    402   3e-135   
emb|CBI16790.3|  unnamed protein product                                401   4e-135   
ref|XP_010906954.1|  PREDICTED: uncharacterized protein LOC105033...    402   4e-135   
ref|XP_004502391.1|  PREDICTED: uncharacterized protein LOC101511...    402   5e-135   
ref|XP_009359203.1|  PREDICTED: uncharacterized protein LOC103949...    402   6e-135   
ref|XP_003531333.1|  PREDICTED: uncharacterized protein LOC100805311    401   9e-135   
ref|XP_008340099.1|  PREDICTED: uncharacterized protein LOC103403...    401   1e-134   
gb|KEH35290.1|  lysine ketoglutarate reductase trans-splicing pro...    399   1e-134   
gb|KHN29026.1|  hypothetical protein glysoja_008361                     400   1e-134   
ref|XP_007163683.1|  hypothetical protein PHAVU_001G255300g             400   2e-134   
ref|XP_008360116.1|  PREDICTED: uncharacterized protein LOC103423...    400   2e-134   
ref|XP_009763116.1|  PREDICTED: uncharacterized protein LOC104215067    400   2e-134   
ref|XP_003601902.1|  hypothetical protein MTR_3g086610                  400   2e-134   
ref|XP_007159700.1|  hypothetical protein PHAVU_002G259800g             400   2e-134   
ref|XP_010251037.1|  PREDICTED: uncharacterized protein LOC104593065    400   3e-134   
ref|XP_008804224.1|  PREDICTED: uncharacterized protein LOC103717...    400   3e-134   
gb|AFK47373.1|  unknown                                                 400   3e-134   
ref|XP_009359205.1|  PREDICTED: uncharacterized protein LOC103949...    400   3e-134   
ref|XP_008804222.1|  PREDICTED: uncharacterized protein LOC103717...    399   6e-134   
ref|XP_008804220.1|  PREDICTED: uncharacterized protein LOC103717...    399   7e-134   
ref|XP_006357597.1|  PREDICTED: uncharacterized protein LOC102579...    398   7e-134   
ref|XP_006357623.1|  PREDICTED: uncharacterized protein LOC102588935    403   7e-134   
ref|XP_002530039.1|  conserved hypothetical protein                     399   8e-134   Ricinus communis
ref|XP_009382917.1|  PREDICTED: uncharacterized protein LOC103970734    399   8e-134   
ref|XP_010320937.1|  PREDICTED: uncharacterized protein LOC101248010    399   8e-134   
ref|XP_003525038.1|  PREDICTED: uncharacterized protein LOC100785...    399   8e-134   
ref|XP_010029096.1|  PREDICTED: uncharacterized protein LOC104419...    397   2e-133   
ref|XP_009370346.1|  PREDICTED: uncharacterized protein LOC103959709    397   2e-133   
ref|XP_002311761.1|  hypothetical protein POPTR_0008s18970g             397   2e-133   Populus trichocarpa [western balsam poplar]
gb|KEH20772.1|  lysine ketoglutarate reductase trans-splicing pro...    397   3e-133   
ref|XP_009419384.1|  PREDICTED: uncharacterized protein LOC103999363    396   7e-133   
ref|XP_010689522.1|  PREDICTED: uncharacterized protein LOC104903222    395   7e-133   
ref|XP_003538598.1|  PREDICTED: uncharacterized protein LOC100778486    395   2e-132   
ref|XP_011034057.1|  PREDICTED: uncharacterized protein LOC105132327    394   3e-132   
ref|XP_010557340.1|  PREDICTED: uncharacterized protein LOC104826374    394   3e-132   
ref|XP_004239135.1|  PREDICTED: uncharacterized protein LOC101244...    394   3e-132   
ref|XP_009371751.1|  PREDICTED: uncharacterized protein LOC103960971    394   4e-132   
ref|XP_009617481.1|  PREDICTED: uncharacterized protein LOC104109818    393   6e-132   
ref|XP_006340181.1|  PREDICTED: uncharacterized protein LOC102584998    393   7e-132   
emb|CDP13233.1|  unnamed protein product                                393   1e-131   
ref|XP_011101803.1|  PREDICTED: uncharacterized protein LOC105179...    393   1e-131   
ref|XP_004251145.1|  PREDICTED: uncharacterized protein LOC101261883    392   2e-131   
gb|KDP26690.1|  hypothetical protein JCGZ_17848                         392   2e-131   
gb|KDO82211.1|  hypothetical protein CISIN_1g013577mg                   394   2e-131   
ref|XP_002314593.1|  hypothetical protein POPTR_0010s05730g             392   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_011101800.1|  PREDICTED: uncharacterized protein LOC105179...    392   3e-131   
ref|XP_006852374.1|  hypothetical protein AMTR_s00049p00225510          392   3e-131   
gb|ACF86430.1|  unknown                                                 391   4e-131   Zea mays [maize]
ref|XP_009784116.1|  PREDICTED: uncharacterized protein LOC104232580    391   5e-131   
ref|XP_004304668.1|  PREDICTED: uncharacterized protein LOC101309467    392   6e-131   
ref|XP_004142781.1|  PREDICTED: uncharacterized protein LOC101219968    391   6e-131   
gb|KCW55940.1|  hypothetical protein EUGRSUZ_I01729                     390   6e-131   
ref|XP_008360119.1|  PREDICTED: uncharacterized protein LOC103423...    391   6e-131   
ref|XP_007044822.1|  Uncharacterized protein isoform 2                  390   8e-131   
ref|XP_007044821.1|  Uncharacterized protein isoform 1                  390   8e-131   
ref|XP_010029094.1|  PREDICTED: uncharacterized protein LOC104419...    391   1e-130   
gb|KHG25698.1|  hypothetical protein F383_04429                         390   1e-130   
ref|XP_004960543.1|  PREDICTED: uncharacterized protein LOC101781300    390   1e-130   
ref|XP_008362122.1|  PREDICTED: uncharacterized protein LOC103425...    390   1e-130   
ref|NP_001150432.1|  LOC100284062                                       390   1e-130   Zea mays [maize]
ref|XP_008362120.1|  PREDICTED: uncharacterized protein LOC103425...    390   2e-130   
ref|XP_009359206.1|  PREDICTED: uncharacterized protein LOC103949...    390   2e-130   
ref|XP_011042401.1|  PREDICTED: uncharacterized protein LOC105138...    390   2e-130   
ref|XP_008340102.1|  PREDICTED: uncharacterized protein LOC103403...    389   2e-130   
ref|XP_002272341.1|  PREDICTED: uncharacterized protein LOC100264636    390   2e-130   Vitis vinifera
ref|XP_011042400.1|  PREDICTED: uncharacterized protein LOC105138...    389   3e-130   
ref|XP_009349737.1|  PREDICTED: uncharacterized protein LOC103941267    388   4e-130   
ref|XP_008672947.1|  PREDICTED: LOC100284062 isoform X1                 389   5e-130   
ref|XP_008458831.1|  PREDICTED: uncharacterized protein LOC103498119    389   5e-130   
ref|XP_008230511.1|  PREDICTED: uncharacterized protein LOC103329778    389   6e-130   
ref|XP_002529935.1|  conserved hypothetical protein                     387   7e-130   Ricinus communis
ref|XP_006417735.1|  hypothetical protein EUTSA_v10007913mg             388   7e-130   
ref|XP_008463954.1|  PREDICTED: uncharacterized protein LOC103501955    388   9e-130   
ref|XP_008225886.1|  PREDICTED: uncharacterized protein LOC103325...    388   9e-130   
gb|KDP46396.1|  hypothetical protein JCGZ_10236                         388   1e-129   
ref|XP_008225894.1|  PREDICTED: uncharacterized protein LOC103325...    387   1e-129   
emb|CDX93598.1|  BnaA06g04500D                                          387   1e-129   
gb|EYU18817.1|  hypothetical protein MIMGU_mgv1a008100mg                387   2e-129   
ref|XP_009770312.1|  PREDICTED: uncharacterized protein LOC104221038    387   2e-129   
ref|XP_007031618.1|  Uncharacterized protein isoform 1                  387   2e-129   
ref|XP_007031621.1|  Uncharacterized protein isoform 4                  387   2e-129   
ref|XP_007207337.1|  hypothetical protein PRUPE_ppa008013mg             385   2e-129   
ref|XP_009148057.1|  PREDICTED: uncharacterized protein LOC103871548    386   2e-129   
ref|NP_001054429.1|  Os05g0108100                                       387   2e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007215510.1|  hypothetical protein PRUPE_ppa006988mg             387   3e-129   
gb|KHN44372.1|  hypothetical protein glysoja_014413                     386   3e-129   
ref|XP_009589970.1|  PREDICTED: uncharacterized protein LOC104087260    386   3e-129   
ref|XP_009402707.1|  PREDICTED: uncharacterized protein LOC103986416    387   3e-129   
gb|EYU44800.1|  hypothetical protein MIMGU_mgv1a007501mg                387   4e-129   
ref|XP_004971004.1|  PREDICTED: uncharacterized protein LOC101768...    385   4e-129   
ref|XP_010458024.1|  PREDICTED: uncharacterized protein LOC104739...    385   6e-129   
ref|XP_006653957.1|  PREDICTED: uncharacterized protein LOC102713904    386   6e-129   
ref|XP_007031622.1|  Uncharacterized protein isoform 5                  387   6e-129   
ref|XP_004145746.1|  PREDICTED: uncharacterized protein LOC101216740    386   7e-129   
ref|XP_009367055.1|  PREDICTED: uncharacterized protein LOC103956...    385   7e-129   
ref|XP_009367056.1|  PREDICTED: uncharacterized protein LOC103956...    385   7e-129   
ref|XP_010100413.1|  hypothetical protein L484_027724                   385   9e-129   
ref|XP_010253712.1|  PREDICTED: uncharacterized protein LOC104594...    385   1e-128   
ref|XP_011089275.1|  PREDICTED: uncharacterized protein LOC105170284    385   1e-128   
emb|CDX95100.1|  BnaC05g05710D                                          387   1e-128   
ref|XP_002323994.1|  hypothetical protein POPTR_0017s10560g             385   1e-128   Populus trichocarpa [western balsam poplar]
ref|XP_007016775.1|  T6D22.12 isoform 4                                 382   2e-128   
ref|XP_008359345.1|  PREDICTED: uncharacterized protein LOC103423...    384   2e-128   
ref|XP_010542587.1|  PREDICTED: uncharacterized protein LOC104815743    384   3e-128   
ref|XP_010475592.1|  PREDICTED: uncharacterized protein LOC104754984    384   3e-128   
gb|KDP44036.1|  hypothetical protein JCGZ_05503                         384   3e-128   
ref|XP_002314280.2|  hypothetical protein POPTR_0009s01620g             384   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_008359351.1|  PREDICTED: uncharacterized protein LOC103423...    384   3e-128   
ref|XP_004971002.1|  PREDICTED: uncharacterized protein LOC101768...    384   4e-128   
ref|XP_011101801.1|  PREDICTED: uncharacterized protein LOC105179...    383   5e-128   
ref|XP_011044400.1|  PREDICTED: uncharacterized protein LOC105139...    382   6e-128   
ref|XP_008379197.1|  PREDICTED: uncharacterized protein LOC103442207    384   6e-128   
ref|XP_011044399.1|  PREDICTED: uncharacterized protein LOC105139...    382   6e-128   
ref|XP_010043761.1|  PREDICTED: uncharacterized protein LOC104432886    382   7e-128   
ref|XP_006604007.1|  PREDICTED: uncharacterized protein LOC100776...    384   7e-128   
emb|CBI34843.3|  unnamed protein product                                383   7e-128   
dbj|BAJ92182.1|  predicted protein                                      384   7e-128   
ref|XP_004970998.1|  PREDICTED: uncharacterized protein LOC101768...    385   9e-128   
emb|CDM85600.1|  unnamed protein product                                383   1e-127   
ref|XP_006846795.1|  hypothetical protein AMTR_s00148p00059020          383   1e-127   
gb|KHG06071.1|  Trimethylguanosine synthase                             382   1e-127   
ref|XP_007016774.1|  T6D22.12 isoform 3                                 382   1e-127   
ref|XP_007016772.1|  T6D22.12 isoform 1                                 382   2e-127   
ref|XP_009379954.1|  PREDICTED: uncharacterized protein LOC103968...    382   2e-127   
ref|XP_004504126.1|  PREDICTED: uncharacterized protein LOC101498964    382   3e-127   
ref|XP_011014025.1|  PREDICTED: uncharacterized protein LOC105117916    382   3e-127   
ref|XP_009620378.1|  PREDICTED: uncharacterized protein LOC104112222    381   4e-127   
ref|XP_010232719.1|  PREDICTED: uncharacterized protein LOC100831...    381   5e-127   
ref|XP_009779721.1|  PREDICTED: uncharacterized protein LOC104228871    381   6e-127   
ref|XP_004231837.1|  PREDICTED: uncharacterized protein LOC101259691    381   6e-127   
ref|XP_004971001.1|  PREDICTED: uncharacterized protein LOC101768...    382   8e-127   
ref|NP_001045532.1|  Os01g0971200                                       380   1e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007031620.1|  Uncharacterized protein isoform 3                  381   1e-126   
ref|XP_007031624.1|  Uncharacterized protein isoform 7                  380   1e-126   
ref|XP_009127584.1|  PREDICTED: uncharacterized protein LOC103852432    380   1e-126   
ref|XP_006338630.1|  PREDICTED: uncharacterized protein LOC102584113    380   2e-126   
ref|XP_010320939.1|  PREDICTED: uncharacterized protein LOC101244...    379   2e-126   
ref|XP_004299222.1|  PREDICTED: uncharacterized protein LOC101313310    379   3e-126   
ref|XP_008225901.1|  PREDICTED: uncharacterized protein LOC103325...    379   3e-126   
ref|XP_009617942.1|  PREDICTED: uncharacterized protein LOC104110...    379   3e-126   
ref|XP_006645331.1|  PREDICTED: uncharacterized protein LOC102709326    379   4e-126   
ref|XP_009379952.1|  PREDICTED: uncharacterized protein LOC103968...    378   7e-126   
ref|XP_003564891.1|  PREDICTED: uncharacterized protein LOC100831...    378   8e-126   
gb|KHG01210.1|  hypothetical protein F383_22893                         378   8e-126   
emb|CDP16614.1|  unnamed protein product                                378   1e-125   
ref|XP_010528214.1|  PREDICTED: uncharacterized protein LOC104805...    377   1e-125   
ref|XP_004241278.1|  PREDICTED: uncharacterized protein LOC101263523    377   1e-125   
ref|XP_009797241.1|  PREDICTED: uncharacterized protein LOC104243...    378   1e-125   
ref|XP_010912960.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    378   1e-125   
ref|XP_002456820.1|  hypothetical protein SORBIDRAFT_03g043390          378   1e-125   Sorghum bicolor [broomcorn]
ref|XP_006391211.1|  hypothetical protein EUTSA_v10018653mg             377   1e-125   
ref|XP_010528212.1|  PREDICTED: uncharacterized protein LOC104805...    377   2e-125   
ref|XP_010044565.1|  PREDICTED: uncharacterized protein LOC104433498    377   3e-125   
ref|XP_008676605.1|  PREDICTED: uncharacterized protein LOC100193...    377   3e-125   
ref|XP_004952281.1|  PREDICTED: uncharacterized protein LOC101755...    377   4e-125   
gb|EPS63684.1|  hypothetical protein M569_11100                         374   4e-125   
ref|XP_010253713.1|  PREDICTED: uncharacterized protein LOC104594...    375   4e-125   
ref|XP_009617943.1|  PREDICTED: uncharacterized protein LOC104110...    376   5e-125   
gb|AFW75010.1|  hypothetical protein ZEAMMB73_885657                    376   6e-125   
ref|XP_009148552.1|  PREDICTED: uncharacterized protein LOC103871966    376   6e-125   
ref|XP_007150189.1|  hypothetical protein PHAVU_005G134100g             376   6e-125   
ref|XP_010531572.1|  PREDICTED: uncharacterized protein LOC104807...    375   6e-125   
ref|XP_006357566.1|  PREDICTED: uncharacterized protein LOC102597248    375   7e-125   
ref|XP_010415381.1|  PREDICTED: uncharacterized protein LOC104701401    375   1e-124   
ref|XP_010555939.1|  PREDICTED: uncharacterized protein LOC104825...    375   1e-124   
ref|XP_008446150.1|  PREDICTED: uncharacterized protein LOC103488962    375   1e-124   
ref|XP_010531554.1|  PREDICTED: uncharacterized protein LOC104807...    375   1e-124   
ref|XP_010089968.1|  hypothetical protein L484_008046                   376   1e-124   
ref|XP_010531567.1|  PREDICTED: uncharacterized protein LOC104807...    375   1e-124   
ref|NP_001141005.1|  lysine ketoglutarate reductase trans-splicing 1    375   1e-124   Zea mays [maize]
ref|XP_002892430.1|  hypothetical protein ARALYDRAFT_888027             374   2e-124   
ref|XP_003543467.1|  PREDICTED: uncharacterized protein LOC100806338    374   2e-124   
gb|EEC72009.1|  hypothetical protein OsI_04874                          374   2e-124   Oryza sativa Indica Group [Indian rice]
ref|XP_010233400.1|  PREDICTED: uncharacterized protein LOC100822631    373   3e-124   
ref|XP_004135276.1|  PREDICTED: uncharacterized protein LOC101222926    374   3e-124   
ref|XP_010470715.1|  PREDICTED: uncharacterized protein LOC104750595    374   3e-124   
gb|AAM20490.1|  unknown protein                                         372   3e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111574.1|  PREDICTED: uncharacterized protein LOC103836996    374   3e-124   
ref|XP_004952283.1|  PREDICTED: uncharacterized protein LOC101755...    374   3e-124   
gb|AFW62453.1|  hypothetical protein ZEAMMB73_667064                    374   3e-124   
gb|KHN21509.1|  hypothetical protein glysoja_021089                     374   4e-124   
emb|CDP07097.1|  unnamed protein product                                373   4e-124   
emb|CDY00154.1|  BnaC09g01470D                                          374   4e-124   
ref|XP_006391212.1|  hypothetical protein EUTSA_v10018653mg             374   5e-124   
gb|AFW62455.1|  hypothetical protein ZEAMMB73_667064                    374   5e-124   
ref|XP_006365731.1|  PREDICTED: uncharacterized protein LOC102598936    373   5e-124   
emb|CDY12672.1|  BnaA02g13400D                                          375   6e-124   
gb|AFW62454.1|  hypothetical protein ZEAMMB73_667064                    374   7e-124   
ref|XP_011089930.1|  PREDICTED: uncharacterized protein LOC105170731    372   8e-124   
ref|XP_009771349.1|  PREDICTED: uncharacterized protein LOC104221902    373   8e-124   
gb|KGN51347.1|  hypothetical protein Csa_5G522930                       392   8e-124   
ref|NP_850118.1|  uncharacterized protein                               372   8e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511750.1|  PREDICTED: uncharacterized protein LOC104787807    373   8e-124   
emb|CDX98020.1|  BnaA06g07710D                                          373   9e-124   
ref|XP_009804490.1|  PREDICTED: uncharacterized protein LOC104249...    372   1e-123   
ref|XP_009105088.1|  PREDICTED: uncharacterized protein LOC103831005    372   2e-123   
ref|NP_001132425.1|  uncharacterized protein LOC100193875               372   2e-123   Zea mays [maize]
emb|CDY70480.1|  BnaAnng33820D                                          372   2e-123   
ref|XP_010556214.1|  PREDICTED: uncharacterized protein LOC104825...    372   2e-123   
ref|XP_009617945.1|  PREDICTED: uncharacterized protein LOC104110200    372   2e-123   
ref|XP_010682266.1|  PREDICTED: uncharacterized protein LOC104897...    372   2e-123   
ref|NP_001149970.1|  lysine ketoglutarate reductase trans-splicin...    372   2e-123   Zea mays [maize]
emb|CDY30497.1|  BnaA04g16360D                                          371   2e-123   
ref|XP_009140891.1|  PREDICTED: uncharacterized protein LOC103864879    371   2e-123   
ref|XP_009804484.1|  PREDICTED: uncharacterized protein LOC104249...    373   2e-123   
ref|XP_010556216.1|  PREDICTED: uncharacterized protein LOC104825...    372   3e-123   
ref|XP_002875389.1|  hypothetical protein ARALYDRAFT_904991             372   3e-123   
ref|XP_009103671.1|  PREDICTED: uncharacterized protein LOC103829726    371   3e-123   
ref|XP_006303581.1|  hypothetical protein CARUB_v10011103mg             372   3e-123   
emb|CDM80653.1|  unnamed protein product                                372   3e-123   
ref|NP_172760.2|  uncharacterized protein                               372   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264658.1|  PREDICTED: uncharacterized protein LOC104602608    371   3e-123   
ref|XP_003539418.1|  PREDICTED: uncharacterized protein LOC100785818    371   3e-123   
ref|NP_189383.2|  uncharacterized protein                               371   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409854.1|  hypothetical protein EUTSA_v10016806mg             371   3e-123   
ref|XP_009804486.1|  PREDICTED: uncharacterized protein LOC104249...    371   4e-123   
ref|XP_002880936.1|  hypothetical protein ARALYDRAFT_481676             370   4e-123   
ref|XP_002892723.1|  hypothetical protein ARALYDRAFT_888652             371   4e-123   
gb|ABR16453.1|  unknown                                                 371   5e-123   Picea sitchensis
ref|XP_006417167.1|  hypothetical protein EUTSA_v10007793mg             371   6e-123   
ref|XP_010502749.1|  PREDICTED: uncharacterized protein LOC104779987    370   7e-123   
gb|KHN35448.1|  hypothetical protein glysoja_047673                     370   8e-123   
ref|XP_002887149.1|  hypothetical protein ARALYDRAFT_894542             370   1e-122   
ref|XP_006645202.1|  PREDICTED: uncharacterized protein LOC102718787    370   1e-122   
ref|XP_009617944.1|  PREDICTED: uncharacterized protein LOC104110...    369   1e-122   
ref|XP_010494848.1|  PREDICTED: uncharacterized protein LOC104771923    370   2e-122   
ref|XP_008807810.1|  PREDICTED: uncharacterized protein LOC103720060    369   2e-122   
ref|NP_001046611.1|  Os02g0297600                                       370   2e-122   Oryza sativa Japonica Group [Japonica rice]
ref|NP_566793.1|  uncharacterized protein                               369   2e-122   Arabidopsis thaliana [mouse-ear cress]
gb|AAL27511.1|AF439843_1  AT3g26440/F20C19_16                           369   2e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291706.1|  PREDICTED: uncharacterized protein LOC101295012    369   3e-122   
ref|XP_006647190.1|  PREDICTED: uncharacterized protein LOC102709338    369   3e-122   
gb|EEC72958.1|  hypothetical protein OsI_06843                          369   4e-122   Oryza sativa Indica Group [Indian rice]
ref|NP_001078211.1|  uncharacterized protein                            368   4e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285240.2|  PREDICTED: uncharacterized protein LOC100267...    368   4e-122   Vitis vinifera
ref|XP_010682268.1|  PREDICTED: uncharacterized protein LOC104897...    368   4e-122   
ref|XP_009797243.1|  PREDICTED: uncharacterized protein LOC104243...    368   5e-122   
ref|XP_009618474.1|  PREDICTED: uncharacterized protein LOC104110619    368   5e-122   
gb|EEE56778.1|  hypothetical protein OsJ_06354                          369   6e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010425515.1|  PREDICTED: uncharacterized protein LOC104710581    368   6e-122   
ref|XP_006395436.1|  hypothetical protein EUTSA_v10004352mg             368   6e-122   
ref|XP_011097369.1|  PREDICTED: uncharacterized protein LOC105176...    369   7e-122   
ref|XP_010458741.1|  PREDICTED: uncharacterized protein LOC104739957    368   7e-122   
ref|XP_010514453.1|  PREDICTED: uncharacterized protein LOC104790402    368   7e-122   
ref|XP_004504125.1|  PREDICTED: uncharacterized protein LOC101498637    368   7e-122   
ref|XP_006300986.1|  hypothetical protein CARUB_v10021375mg             368   9e-122   
ref|XP_004487097.1|  PREDICTED: uncharacterized protein LOC101508904    368   1e-121   
ref|XP_010510643.1|  PREDICTED: uncharacterized protein LOC104786889    367   1e-121   
ref|XP_010458026.1|  PREDICTED: uncharacterized protein LOC104739...    366   1e-121   
ref|XP_010414551.1|  PREDICTED: uncharacterized protein LOC104700705    365   3e-121   
ref|XP_010470103.1|  PREDICTED: uncharacterized protein LOC104750070    365   4e-121   
ref|XP_010476284.1|  PREDICTED: uncharacterized protein LOC104755...    366   4e-121   
ref|XP_010321885.1|  PREDICTED: uncharacterized protein LOC101246...    365   4e-121   
ref|XP_009405503.1|  PREDICTED: uncharacterized protein LOC103988...    365   4e-121   
gb|KEH20773.1|  lysine ketoglutarate reductase trans-splicing pro...    365   5e-121   
ref|XP_010651181.1|  PREDICTED: uncharacterized protein LOC100267...    365   6e-121   
ref|XP_009113820.1|  PREDICTED: uncharacterized protein LOC103839077    365   7e-121   
ref|XP_009405504.1|  PREDICTED: uncharacterized protein LOC103988...    365   9e-121   
emb|CDY56527.1|  BnaA07g38670D                                          367   9e-121   
emb|CDX77169.1|  BnaC04g39640D                                          365   9e-121   
ref|XP_010528098.1|  PREDICTED: uncharacterized protein LOC104805281    365   1e-120   
ref|XP_010315956.1|  PREDICTED: uncharacterized protein LOC101259...    365   1e-120   
ref|XP_004231836.1|  PREDICTED: uncharacterized protein LOC101259...    365   2e-120   
ref|XP_010108849.1|  hypothetical protein L484_020585                   369   2e-120   
ref|XP_010555936.1|  PREDICTED: uncharacterized protein LOC104825...    365   2e-120   
ref|XP_006395555.1|  hypothetical protein EUTSA_v10004356mg             364   2e-120   
ref|XP_002459174.1|  hypothetical protein SORBIDRAFT_03g047280          364   2e-120   
ref|XP_009405502.1|  PREDICTED: uncharacterized protein LOC103988...    365   2e-120   
gb|ACU23804.1|  unknown                                                 362   2e-120   
gb|KEH39336.1|  lysine ketoglutarate reductase trans-splicing-lik...    364   3e-120   
gb|AES67514.2|  lysine ketoglutarate reductase trans-splicing-lik...    363   3e-120   
ref|NP_564909.1|  uncharacterized protein                               364   4e-120   
ref|XP_010682024.1|  PREDICTED: uncharacterized protein LOC104896...    363   5e-120   
ref|XP_003524254.1|  PREDICTED: uncharacterized protein LOC100793...    363   6e-120   
ref|XP_003565154.1|  PREDICTED: uncharacterized protein LOC100832535    363   6e-120   
ref|XP_006424550.1|  hypothetical protein CICLE_v10028654mg             362   6e-120   
ref|XP_006585254.1|  PREDICTED: uncharacterized protein LOC100776631    362   9e-120   
gb|KDO49037.1|  hypothetical protein CISIN_1g015489mg                   363   1e-119   
gb|EYU22537.1|  hypothetical protein MIMGU_mgv1a026907mg                360   1e-119   
ref|XP_010514274.1|  PREDICTED: uncharacterized protein LOC104790263    362   1e-119   
emb|CDX84961.1|  BnaC05g20940D                                          361   1e-119   
ref|XP_002875321.1|  hypothetical protein ARALYDRAFT_322779             362   2e-119   
ref|XP_008811738.1|  PREDICTED: uncharacterized protein LOC103722823    362   2e-119   
ref|XP_010476286.1|  PREDICTED: uncharacterized protein LOC104755...    362   2e-119   
ref|XP_010499155.1|  PREDICTED: uncharacterized protein LOC104776741    361   3e-119   
emb|CDY27582.1|  BnaA09g28250D                                          360   3e-119   
emb|CDY28844.1|  BnaC06g26320D                                          364   3e-119   
ref|XP_010556403.1|  PREDICTED: uncharacterized protein LOC104825730    361   3e-119   
emb|CDY19405.1|  BnaC05g09140D                                          380   3e-119   
gb|AFW70892.1|  hypothetical protein ZEAMMB73_267727                    357   4e-119   
ref|XP_006446632.1|  hypothetical protein CICLE_v10015612mg             360   4e-119   
ref|XP_004173014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    361   7e-119   
ref|XP_008444374.1|  PREDICTED: uncharacterized protein LOC103487723    361   7e-119   
ref|XP_004142963.1|  PREDICTED: uncharacterized protein LOC101206771    361   8e-119   
emb|CBI16327.3|  unnamed protein product                                358   9e-119   
ref|NP_001189981.1|  uncharacterized protein                            359   1e-118   
ref|XP_006424551.1|  hypothetical protein CICLE_v10028654mg             358   1e-118   
ref|XP_010502568.1|  PREDICTED: uncharacterized protein LOC104779855    359   2e-118   
ref|XP_006291140.1|  hypothetical protein CARUB_v10017256mg             361   2e-118   
ref|XP_009103748.1|  PREDICTED: uncharacterized protein LOC103829800    358   2e-118   
ref|NP_563805.1|  uncharacterized protein                               358   2e-118   
ref|XP_010425333.1|  PREDICTED: uncharacterized protein LOC104710425    359   2e-118   
ref|XP_004977866.1|  PREDICTED: uncharacterized protein LOC101753754    359   2e-118   
ref|XP_010682025.1|  PREDICTED: uncharacterized protein LOC104896...    358   3e-118   
ref|XP_010477996.1|  PREDICTED: uncharacterized protein LOC104757...    357   7e-118   
ref|XP_010477994.1|  PREDICTED: uncharacterized protein LOC104757...    357   7e-118   
gb|KHN11221.1|  hypothetical protein glysoja_034450                     356   2e-117   
ref|XP_002521489.1|  conserved hypothetical protein                     356   2e-117   
ref|XP_006580252.1|  PREDICTED: uncharacterized protein LOC100793...    356   2e-117   
ref|XP_010460435.1|  PREDICTED: uncharacterized protein LOC104741...    356   2e-117   
ref|XP_010460429.1|  PREDICTED: uncharacterized protein LOC104741...    356   2e-117   
ref|XP_010321883.1|  PREDICTED: uncharacterized protein LOC101246...    356   3e-117   
gb|KHG02361.1|  hypothetical protein F383_25835                         358   3e-117   
ref|XP_011097376.1|  PREDICTED: uncharacterized protein LOC105176...    355   4e-117   
gb|KHG21523.1|  copii coat assembly sec16                               354   8e-117   
ref|XP_006291262.1|  hypothetical protein CARUB_v10017393mg             355   1e-116   
ref|XP_006303545.1|  hypothetical protein CARUB_v10010995mg             356   1e-116   
gb|KEH22115.1|  lysine ketoglutarate reductase trans-splicing-lik...    353   3e-116   
emb|CAN81864.1|  hypothetical protein VITISV_010591                     363   4e-116   
gb|KDO73331.1|  hypothetical protein CISIN_1g017018mg                   352   6e-116   
ref|XP_007159701.1|  hypothetical protein PHAVU_002G259900g             352   6e-116   
ref|XP_006294800.1|  hypothetical protein CARUB_v10023851mg             348   9e-116   
ref|XP_010476287.1|  PREDICTED: uncharacterized protein LOC104755...    352   9e-116   
dbj|BAA95722.1|  unnamed protein product                                351   2e-115   
ref|XP_009416743.1|  PREDICTED: uncharacterized protein LOC103997302    352   3e-115   
gb|AAD31054.1|AC007357_3  F3F19.3                                       350   4e-115   
ref|XP_004515512.1|  PREDICTED: uncharacterized protein LOC101505531    350   5e-115   
ref|XP_004971416.1|  PREDICTED: uncharacterized protein LOC101761...    350   7e-115   
ref|XP_004971417.1|  PREDICTED: uncharacterized protein LOC101761...    349   8e-115   
ref|XP_006470471.1|  PREDICTED: uncharacterized protein LOC102609262    349   1e-114   
ref|XP_004971411.1|  PREDICTED: uncharacterized protein LOC101761...    350   1e-114   
ref|XP_004971415.1|  PREDICTED: uncharacterized protein LOC101761...    349   2e-114   
gb|KEH30023.1|  lysine ketoglutarate reductase trans-splicing-lik...    348   2e-114   
gb|EMT33056.1|  hypothetical protein F775_17511                         353   2e-114   
gb|KDO73333.1|  hypothetical protein CISIN_1g017018mg                   345   2e-114   
ref|XP_010023456.1|  PREDICTED: uncharacterized protein LOC104414...    348   4e-114   
emb|CDX84963.1|  BnaC05g20920D                                          347   8e-114   
gb|EPS70966.1|  hypothetical protein M569_03794                         345   2e-113   
emb|CDX83619.1|  BnaC07g23590D                                          347   5e-113   
ref|XP_006604010.1|  PREDICTED: uncharacterized protein LOC100776...    342   8e-113   
ref|XP_006604009.1|  PREDICTED: uncharacterized protein LOC100776...    342   1e-112   
ref|XP_009152055.1|  PREDICTED: uncharacterized protein LOC103875...    344   1e-112   
ref|XP_006415818.1|  hypothetical protein EUTSA_v10009392mg             343   2e-112   
ref|XP_009152053.1|  PREDICTED: uncharacterized protein LOC103875...    343   4e-112   
ref|XP_006604008.1|  PREDICTED: uncharacterized protein LOC100776...    342   5e-112   
emb|CDY13634.1|  BnaA06g32890D                                          343   2e-111   
ref|XP_009113819.1|  PREDICTED: uncharacterized protein LOC103839...    338   2e-111   
ref|XP_006338796.1|  PREDICTED: uncharacterized protein LOC102581795    340   5e-111   
gb|KHN29027.1|  hypothetical protein glysoja_008362                     339   9e-111   
ref|XP_009113814.1|  PREDICTED: uncharacterized protein LOC103839...    339   1e-110   
ref|XP_009113818.1|  PREDICTED: uncharacterized protein LOC103839...    339   1e-110   
emb|CDP13232.1|  unnamed protein product                                338   1e-110   
ref|XP_003597263.1|  Lysine ketoglutarate reductase trans-splicin...    335   7e-110   
gb|AAF79841.1|AC026875_21  T6D22.12                                     339   1e-109   
ref|XP_010023459.1|  PREDICTED: uncharacterized protein LOC104414...    334   1e-109   
gb|EMS46005.1|  hypothetical protein TRIUR3_21403                       335   3e-109   
emb|CDY68593.1|  BnaCnng59670D                                          334   6e-109   
gb|EMT06881.1|  hypothetical protein F775_28460                         336   1e-108   
ref|XP_006303749.1|  hypothetical protein CARUB_v10011910mg             332   2e-108   
gb|KHN06548.1|  hypothetical protein glysoja_010892                     332   4e-108   
emb|CDY03878.1|  BnaC07g11030D                                          332   5e-108   
emb|CDY27580.1|  BnaA09g28270D                                          328   5e-107   
ref|XP_004499399.1|  PREDICTED: uncharacterized protein LOC101509620    329   6e-107   
gb|EYU36174.1|  hypothetical protein MIMGU_mgv1a0248542mg               325   7e-107   
gb|AAF97966.1|AC000103_16  F21J9.23                                     327   8e-107   
ref|XP_002893440.1|  hypothetical protein ARALYDRAFT_313424             328   9e-107   
gb|EEE55862.1|  hypothetical protein OsJ_04495                          327   1e-106   
gb|AAM15148.1|  unknown protein                                         324   3e-105   
gb|EMT02083.1|  hypothetical protein F775_18912                         325   3e-105   
ref|NP_683328.6|  uncharacterized protein                               320   2e-103   
gb|EMS47208.1|  hypothetical protein TRIUR3_01583                       319   2e-103   
ref|NP_001045154.2|  Os01g0910400                                       318   1e-102   
dbj|BAD82423.1|  putative lysine ketoglutarate reductase trans-sp...    317   3e-102   
dbj|BAB02205.1|  unnamed protein product                                311   2e-100   
ref|XP_006858380.1|  hypothetical protein AMTR_s00064p00205830          310   1e-98    
ref|XP_010646531.1|  PREDICTED: uncharacterized protein LOC100264208    305   3e-98    
emb|CBI37362.3|  unnamed protein product                                304   5e-98    
ref|XP_001764755.1|  predicted protein                                  299   6e-96    
gb|AAG28913.1|AC008113_29  F12A21.2                                     299   9e-96    
ref|XP_010646200.1|  PREDICTED: uncharacterized protein LOC100853772    288   1e-91    
gb|EEC72250.1|  hypothetical protein OsI_05383                          289   5e-91    
ref|XP_010501366.1|  PREDICTED: uncharacterized protein LOC104778611    284   1e-90    
ref|XP_010696376.1|  PREDICTED: uncharacterized protein LOC104908903    283   2e-90    
ref|XP_008344893.1|  PREDICTED: uncharacterized protein LOC103407794    283   2e-90    
ref|XP_008385408.1|  PREDICTED: uncharacterized protein LOC103447963    288   2e-90    
ref|XP_002966121.1|  hypothetical protein SELMODRAFT_85805              278   8e-88    
ref|XP_001770756.1|  predicted protein                                  277   1e-86    
ref|XP_001785179.1|  predicted protein                                  274   3e-86    
emb|CAN76844.1|  hypothetical protein VITISV_017377                     276   8e-86    
ref|XP_002989880.1|  hypothetical protein SELMODRAFT_45528              270   4e-85    
ref|XP_002991965.1|  hypothetical protein SELMODRAFT_162056             272   5e-85    
ref|XP_004967304.1|  PREDICTED: uncharacterized protein LOC101755016    270   4e-83    
ref|XP_004974626.1|  PREDICTED: uncharacterized protein LOC101763847    268   5e-83    
gb|EMT06570.1|  hypothetical protein F775_22103                         267   8e-83    
ref|XP_011072640.1|  PREDICTED: uncharacterized protein LOC105157841    263   2e-81    
gb|EMT15642.1|  hypothetical protein F775_21925                         262   4e-81    
gb|EYU21383.1|  hypothetical protein MIMGU_mgv1a0196831mg               256   2e-80    
ref|XP_008678503.1|  PREDICTED: uncharacterized protein LOC103653353    260   2e-80    
gb|AFW61950.1|  hypothetical protein ZEAMMB73_015847                    261   2e-80    
ref|XP_003560311.1|  PREDICTED: uncharacterized protein LOC100821456    258   2e-79    
ref|XP_002445415.1|  hypothetical protein SORBIDRAFT_07g016740          254   3e-79    
ref|NP_001058638.1|  Os06g0727700                                       252   4e-77    
gb|EMS54592.1|  hypothetical protein TRIUR3_08030                       254   6e-77    
gb|AAO33772.1|  unknown                                                 249   6e-77    
gb|EEE66391.1|  hypothetical protein OsJ_22726                          251   1e-76    
ref|XP_006657364.1|  PREDICTED: uncharacterized protein LOC102700909    251   1e-76    
dbj|BAD61819.1|  storage protein-like                                   251   2e-76    
gb|EEC81343.1|  hypothetical protein OsI_24529                          250   3e-76    
emb|CBI33098.3|  unnamed protein product                                239   8e-75    
gb|EMT08612.1|  hypothetical protein F775_01608                         245   3e-74    
ref|NP_001144633.1|  uncharacterized protein LOC100277652               244   5e-74    
ref|XP_010229702.1|  PREDICTED: uncharacterized protein LOC100822695    243   1e-73    
ref|XP_008677028.1|  PREDICTED: uncharacterized protein LOC100277...    243   1e-73    
ref|XP_008677025.1|  PREDICTED: uncharacterized protein LOC100277...    243   2e-73    
ref|NP_001141373.1|  hypothetical protein                               236   2e-72    
ref|XP_010239419.1|  PREDICTED: uncharacterized protein LOC100845122    239   5e-72    
gb|EMS54591.1|  hypothetical protein TRIUR3_08028                       237   2e-71    
ref|XP_002994664.1|  hypothetical protein SELMODRAFT_138968             233   6e-71    
emb|CDY13715.1|  BnaA06g32080D                                          234   6e-71    
dbj|BAD61817.1|  storage protein-like                                   235   7e-71    
gb|EEC81342.1|  hypothetical protein OsI_24528                          234   8e-71    
emb|CDX83697.1|  BnaC07g24370D                                          237   2e-70    
ref|XP_006656518.1|  PREDICTED: uncharacterized protein LOC102704897    233   2e-69    
ref|XP_002446074.1|  hypothetical protein SORBIDRAFT_06g001390          228   3e-68    
gb|EEE66389.1|  hypothetical protein OsJ_22724                          228   1e-67    
ref|XP_008650158.1|  PREDICTED: uncharacterized protein LOC103630900    223   3e-66    
tpg|DAA56217.1|  TPA: hypothetical protein ZEAMMB73_146797              216   2e-65    
ref|XP_007031625.1|  Uncharacterized protein isoform 8                  215   6e-65    
gb|EMT06568.1|  hypothetical protein F775_01217                         217   1e-64    
gb|EMT06569.1|  hypothetical protein F775_00088                         216   1e-63    
gb|AFW61951.1|  hypothetical protein ZEAMMB73_607785                    210   6e-61    
ref|XP_010527351.1|  PREDICTED: uncharacterized protein LOC104804...    208   5e-60    
ref|XP_010557744.1|  PREDICTED: uncharacterized protein LOC104826...    207   7e-60    
ref|XP_010557742.1|  PREDICTED: uncharacterized protein LOC104826...    207   1e-59    
ref|XP_010527349.1|  PREDICTED: uncharacterized protein LOC104804...    207   1e-59    
ref|XP_010527348.1|  PREDICTED: uncharacterized protein LOC104804...    207   1e-59    
ref|XP_002512624.1|  conserved hypothetical protein                     207   1e-59    
ref|XP_009626423.1|  PREDICTED: uncharacterized protein LOC104117127    207   2e-59    
emb|CDY60485.1|  BnaC04g55870D                                          207   2e-59    
ref|XP_009139663.1|  PREDICTED: uncharacterized protein LOC103863...    206   6e-59    
ref|XP_010111065.1|  hypothetical protein L484_015120                   205   7e-59    
ref|XP_009139660.1|  PREDICTED: uncharacterized protein LOC103863...    206   7e-59    
ref|XP_009139661.1|  PREDICTED: uncharacterized protein LOC103863...    205   1e-58    
ref|XP_010440627.1|  PREDICTED: uncharacterized protein LOC104723886    205   1e-58    
ref|XP_009139659.1|  PREDICTED: uncharacterized protein LOC103863...    205   1e-58    
ref|XP_011013916.1|  PREDICTED: uncharacterized protein LOC105117...    203   1e-58    
gb|EMS57722.1|  hypothetical protein TRIUR3_08624                       202   2e-58    
ref|XP_006285943.1|  hypothetical protein CARUB_v10007463mg             204   2e-58    
gb|KHG02335.1|  Protein kinase US3                                      203   3e-58    
ref|XP_010450249.1|  PREDICTED: uncharacterized protein LOC104732...    203   4e-58    
ref|XP_011080806.1|  PREDICTED: uncharacterized protein LOC105163967    202   4e-58    
ref|XP_010450248.1|  PREDICTED: uncharacterized protein LOC104732...    203   4e-58    
ref|XP_010450250.1|  PREDICTED: uncharacterized protein LOC104732...    203   4e-58    
gb|ACJ84904.1|  unknown                                                 197   4e-58    
ref|XP_010248154.1|  PREDICTED: uncharacterized protein LOC104590...    203   6e-58    
ref|XP_011013915.1|  PREDICTED: uncharacterized protein LOC105117...    202   7e-58    
ref|XP_001755157.1|  predicted protein                                  200   1e-57    
ref|XP_010435350.1|  PREDICTED: uncharacterized protein LOC104719...    201   1e-57    
ref|XP_002527278.1|  conserved hypothetical protein                     202   1e-57    
ref|XP_004292326.1|  PREDICTED: uncharacterized protein LOC101291991    203   1e-57    
gb|EEE66390.1|  hypothetical protein OsJ_22725                          196   2e-57    
ref|XP_008382541.1|  PREDICTED: uncharacterized protein LOC103445...    202   2e-57    
ref|XP_010435349.1|  PREDICTED: uncharacterized protein LOC104719...    201   2e-57    
ref|XP_008382542.1|  PREDICTED: uncharacterized protein LOC103445...    202   2e-57    
ref|NP_001154227.2|  uncharacterized protein                            201   3e-57    
ref|NP_193020.6|  uncharacterized protein                               201   3e-57    
ref|XP_002325467.2|  hypothetical protein POPTR_0019s08010g             201   3e-57    
ref|XP_010682053.1|  PREDICTED: uncharacterized protein LOC104896...    201   3e-57    
ref|XP_010682054.1|  PREDICTED: uncharacterized protein LOC104896...    201   4e-57    
ref|XP_010435347.1|  PREDICTED: uncharacterized protein LOC104719...    201   4e-57    
ref|XP_006353831.1|  PREDICTED: uncharacterized protein LOC102586...    201   4e-57    
ref|XP_010435348.1|  PREDICTED: uncharacterized protein LOC104719...    201   4e-57    
ref|XP_006353830.1|  PREDICTED: uncharacterized protein LOC102586...    201   4e-57    
ref|XP_002863207.1|  hypothetical protein ARALYDRAFT_359088             201   4e-57    
ref|XP_010248201.1|  PREDICTED: uncharacterized protein LOC104590...    199   4e-57    
ref|XP_009342401.1|  PREDICTED: uncharacterized protein LOC103934377    202   5e-57    
ref|XP_010326243.1|  PREDICTED: uncharacterized protein LOC101263...    201   6e-57    
ref|XP_004246997.2|  PREDICTED: uncharacterized protein LOC101263...    201   7e-57    
ref|XP_008235931.1|  PREDICTED: uncharacterized protein LOC103334736    200   9e-57    
ref|XP_008794582.1|  PREDICTED: uncharacterized protein LOC103710...    201   1e-56    
ref|XP_008794583.1|  PREDICTED: uncharacterized protein LOC103710...    200   1e-56    
ref|XP_008794581.1|  PREDICTED: uncharacterized protein LOC103710...    201   1e-56    
ref|XP_010248082.1|  PREDICTED: uncharacterized protein LOC104590...    201   1e-56    
ref|XP_006414995.1|  hypothetical protein EUTSA_v10025444mg             199   1e-56    



>ref|XP_008221898.1| PREDICTED: uncharacterized protein LOC103321836 isoform X1 [Prunus 
mume]
 ref|XP_008221899.1| PREDICTED: uncharacterized protein LOC103321836 isoform X1 [Prunus 
mume]
Length=403

 Score =   416 bits (1070),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 231/301 (77%), Gaps = 26/301 (9%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M      + G++ NET++L+V   +GV+FG  IG SFP L L KLN+++SL+ NVD S N
Sbjct  1    MGTLSRSAGGRKPNETMRLIVTTFVGVVFGFLIGVSFPTLSLTKLNLSSSLLPNVDLSYN  60

Query  342  ------------------------LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDF  449
                                     T+ Q+     +IWVPSNPRGAERLPP I+  ESDF
Sbjct  61   EDQKSDISRQTILNAWSSTRSNDSSTKAQSSNGTARIWVPSNPRGAERLPPGILAAESDF  120

Query  450  YLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDE  629
            YLRRLWG+PS+DLT+KP+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTEWDE
Sbjct  121  YLRRLWGKPSEDLTIKPRYLVTFTVGLNQKKNIDAAVKKFSENFTILLFHYDGQTTEWDE  180

Query  630  FEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKH  809
            FEWSKRAIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLV+KH
Sbjct  181  FEWSKRAIHVSVRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVRKH  240

Query  810  GLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVF  989
            GLEISQPGLE  KG  LTW+MT+R+ + EVHK+T EK GWC+DPHLPPCAAFVEIMAPVF
Sbjct  241  GLEISQPGLEPNKG--LTWQMTKRRGDREVHKQTVEKPGWCTDPHLPPCAAFVEIMAPVF  298

Query  990  S  992
            S
Sbjct  299  S  299



>ref|XP_008221900.1| PREDICTED: uncharacterized protein LOC103321836 isoform X2 [Prunus 
mume]
Length=398

 Score =   414 bits (1064),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 199/294 (68%), Positives = 230/294 (78%), Gaps = 26/294 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN-------  341
            + G++ NET++L+V   +GV+FG  IG SFP L L KLN+++SL+ NVD S N       
Sbjct  3    AGGRKPNETMRLIVTTFVGVVFGFLIGVSFPTLSLTKLNLSSSLLPNVDLSYNEDQKSDI  62

Query  342  -----------------LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
                              T+ Q+     +IWVPSNPRGAERLPP I+  ESDFYLRRLWG
Sbjct  63   SRQTILNAWSSTRSNDSSTKAQSSNGTARIWVPSNPRGAERLPPGILAAESDFYLRRLWG  122

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
            +PS+DLT+KP+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTEWDEFEWSKRA
Sbjct  123  KPSEDLTIKPRYLVTFTVGLNQKKNIDAAVKKFSENFTILLFHYDGQTTEWDEFEWSKRA  182

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLV+KHGLEISQP
Sbjct  183  IHVSVRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVRKHGLEISQP  242

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE  KG  LTW+MT+R+ + EVHK+T EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  243  GLEPNKG--LTWQMTKRRGDREVHKQTVEKPGWCTDPHLPPCAAFVEIMAPVFS  294



>ref|XP_010650498.1| PREDICTED: uncharacterized protein LOC100243914 [Vitis vinifera]
 ref|XP_010650503.1| PREDICTED: uncharacterized protein LOC100243914 [Vitis vinifera]
Length=401

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 197/299 (66%), Positives = 235/299 (79%), Gaps = 24/299 (8%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M+N G     ++ NET++L+V +++GV+FG  IG SFP L + KLN+ +SL+ NVD    
Sbjct  1    MRNVGRSVIVRKPNETMRLIVTISVGVVFGFLIGISFPTLSITKLNLPSSLLPNVDIAYI  60

Query  330  -DSS-----------------NLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYL  455
             D S                 N T+ Q +   +KIW PSNPRGAERLPP I+  ESDFYL
Sbjct  61   RDKSSGFSTQALLDALSSAKYNRTQAQNLNGTSKIWAPSNPRGAERLPPGIVAAESDFYL  120

Query  456  RRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFE  635
            RRLWG+PS+DLT+KPKYL+T TVGY QK N+DA VKKFS++FTILLFHYDG+TTEWDEFE
Sbjct  121  RRLWGKPSEDLTIKPKYLVTFTVGYDQKKNVDAAVKKFSEDFTILLFHYDGRTTEWDEFE  180

Query  636  WSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGL  815
            WSKRAIHVS  +QTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYI+LV+K+GL
Sbjct  181  WSKRAIHVSVRRQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIRLVRKYGL  240

Query  816  EISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            EISQPGLE  KG  LTW+MT+R+ + EVHKET+EK GWC +PHLPPCAAFVEIMAPVFS
Sbjct  241  EISQPGLEPNKG--LTWQMTKRRGDREVHKETEEKPGWCPNPHLPPCAAFVEIMAPVFS  297



>gb|KDO82215.1| hypothetical protein CISIN_1g013577mg [Citrus sinensis]
Length=324

 Score =   409 bits (1051),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 197/300 (66%), Positives = 231/300 (77%), Gaps = 25/300 (8%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNV----D  329
            M      S  ++ NE+++L+V   +GV+FG FIG SFP L L KL + +SL+  V    D
Sbjct  14   MGTAARSSINRKTNESMRLIVTTFVGVVFGFFIGVSFPTLSLTKLTLPSSLLPTVEYVED  73

Query  330  DSSNL-------------------TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFY  452
              S L                   T  Q + D +KIWVP+NPRGAERLPP I+  ESDFY
Sbjct  74   QRSGLSTQRFLNVFNPLNRNNGSSTRAQVLNDTSKIWVPTNPRGAERLPPKIVRAESDFY  133

Query  453  LRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEF  632
            LRRLWG P++DLT +PKYL+T TVGY QK+NI+A +KKFSDNFTI+LFHYDG+TTEW+EF
Sbjct  134  LRRLWGNPNEDLTSQPKYLVTFTVGYDQKNNINAAIKKFSDNFTIVLFHYDGRTTEWNEF  193

Query  633  EWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHG  812
            EWSKRAIHVS  KQTKWWYAKRFLHPDIVASY+YIFIWDEDLGVEHF+AEEYIKLV+KHG
Sbjct  194  EWSKRAIHVSVRKQTKWWYAKRFLHPDIVASYDYIFIWDEDLGVEHFNAEEYIKLVRKHG  253

Query  813  LEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LEISQPGLE  KG  LTW+MT+R+ + EVHKET+EK GWCS+PHLPPCAAFVEIMAPVFS
Sbjct  254  LEISQPGLEPNKG--LTWQMTKRRGDREVHKETEEKPGWCSNPHLPPCAAFVEIMAPVFS  311



>ref|XP_007222781.1| hypothetical protein PRUPE_ppa006602mg [Prunus persica]
 gb|EMJ23980.1| hypothetical protein PRUPE_ppa006602mg [Prunus persica]
Length=403

 Score =   412 bits (1059),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 198/301 (66%), Positives = 232/301 (77%), Gaps = 26/301 (9%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M      + G++ NET++L+V   +GV+FG  IG SFP L L KLN+++SL+ NVD    
Sbjct  1    MGTLSRSAGGRKPNETMRLIVTTFVGVVFGFLIGVSFPTLSLTKLNLSSSLLPNVDLTYN  60

Query  330  -DSSNLTEDQTVMDP-------------------TKIWVPSNPRGAERLPPDIIVPESDF  449
             D  +    QT+++                     +IWVPSNPRGAERLPP I+  ESDF
Sbjct  61   EDQKSDISRQTILNAWSSTRSNNSSTKAQSSNGTGRIWVPSNPRGAERLPPGILAAESDF  120

Query  450  YLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDE  629
            YLRRLWG+PS+DLT+KP+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTEWDE
Sbjct  121  YLRRLWGKPSEDLTIKPRYLVTFTVGLNQKKNIDAAVKKFSENFTILLFHYDGQTTEWDE  180

Query  630  FEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKH  809
            FEWS+RAIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLV+KH
Sbjct  181  FEWSERAIHVSVRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVRKH  240

Query  810  GLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVF  989
            GLEISQPGLE  KG  LTW+MT+R+ + EVHK+T EK GWC+DPHLPPCAAFVEIMAPVF
Sbjct  241  GLEISQPGLEPNKG--LTWQMTKRRGDREVHKQTVEKPGWCTDPHLPPCAAFVEIMAPVF  298

Query  990  S  992
            S
Sbjct  299  S  299



>ref|XP_006357596.1| PREDICTED: uncharacterized protein LOC102579567 isoform X1 [Solanum 
tuberosum]
Length=392

 Score =   411 bits (1056),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 195/290 (67%), Positives = 232/290 (80%), Gaps = 15/290 (5%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNN---VDD  332
            M++FG   N  +  ET++L+++V  G+IFGL +G S P+  L KLN+T+S+V+N     D
Sbjct  1    MRSFGRGFNSLKSTETMRLMLSVCCGIIFGLIVGISLPSSSLTKLNITSSIVSNFPIARD  60

Query  333  SSNLTEDQTVMDPT----------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
             +N+  DQ   DP+          KIWVPSNPRGAERLPP I+  ESD+Y RRLWG+PS+
Sbjct  61   RNNVVSDQKPADPSIKIQNATDQLKIWVPSNPRGAERLPPGIVASESDYYPRRLWGKPSE  120

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DL  KPKYL+T TVG KQK NIDA VKKFSD+FTILLFHYDG+TTEWDEFEWSK+AIHVS
Sbjct  121  DLQSKPKYLVTFTVGIKQKHNIDAAVKKFSDDFTILLFHYDGKTTEWDEFEWSKKAIHVS  180

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFDA+EYIKLVKKHGLEISQPGL+ 
Sbjct  181  VRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDAKEYIKLVKKHGLEISQPGLDP  240

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            ++G   TW+MT+R+ + EVH  T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  241  RRGT--TWQMTKRRGDREVHTTTEEKPGWCADPHLPPCAAFVEIMAPVFS  288



>ref|XP_007222780.1| hypothetical protein PRUPE_ppa006602mg [Prunus persica]
 gb|EMJ23979.1| hypothetical protein PRUPE_ppa006602mg [Prunus persica]
Length=398

 Score =   410 bits (1054),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 197/294 (67%), Positives = 231/294 (79%), Gaps = 26/294 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSSNLT  347
            + G++ NET++L+V   +GV+FG  IG SFP L L KLN+++SL+ NVD     D  +  
Sbjct  3    AGGRKPNETMRLIVTTFVGVVFGFLIGVSFPTLSLTKLNLSSSLLPNVDLTYNEDQKSDI  62

Query  348  EDQTVMDP-------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
              QT+++                     +IWVPSNPRGAERLPP I+  ESDFYLRRLWG
Sbjct  63   SRQTILNAWSSTRSNNSSTKAQSSNGTGRIWVPSNPRGAERLPPGILAAESDFYLRRLWG  122

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
            +PS+DLT+KP+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTEWDEFEWS+RA
Sbjct  123  KPSEDLTIKPRYLVTFTVGLNQKKNIDAAVKKFSENFTILLFHYDGQTTEWDEFEWSERA  182

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLV+KHGLEISQP
Sbjct  183  IHVSVRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVRKHGLEISQP  242

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE  KG  LTW+MT+R+ + EVHK+T EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  243  GLEPNKG--LTWQMTKRRGDREVHKQTVEKPGWCTDPHLPPCAAFVEIMAPVFS  294



>ref|XP_011086653.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086655.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086656.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086657.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086658.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086659.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086660.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086661.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086662.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086663.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086664.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
Length=400

 Score =   410 bits (1054),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 233/288 (81%), Gaps = 15/288 (5%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNN--------  323
            N G  +  ++ NET+++ + + +G++FG FIG SFP   L KLN+T++++++        
Sbjct  11   NGGRSTLARKPNETMRVFITICVGIMFGFFIGVSFPTFPLTKLNITSAILHDFAVIGNKS  70

Query  324  ----VDDSSNL-TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL  488
                 DD  N+ T++Q V D TKIWVPSNP+GAERLPP+I+  ESD YLRRLWG PS+DL
Sbjct  71   AAISTDDIRNISTKNQVVKDVTKIWVPSNPKGAERLPPNIVASESDLYLRRLWGLPSEDL  130

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
              KPKYL+T TVGY Q++NIDA VKKFS NFTILLFHYDG+TTEWD+FEWSKRAIH+SA 
Sbjct  131  ANKPKYLVTFTVGYDQRNNIDAAVKKFSQNFTILLFHYDGRTTEWDDFEWSKRAIHISAR  190

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFDAEEYIKLV+KHGLEISQPGLE  K
Sbjct  191  KQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDAEEYIKLVRKHGLEISQPGLEPTK  250

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
                TW+MT+++ + EVHKET+EK GWCS+PHLPPCAAFVEIMAPVFS
Sbjct  251  ST--TWQMTKKRDDREVHKETEEKPGWCSNPHLPPCAAFVEIMAPVFS  296



>ref|XP_006438248.1| hypothetical protein CICLE_v10031670mg [Citrus clementina]
 ref|XP_006438249.1| hypothetical protein CICLE_v10031670mg [Citrus clementina]
 ref|XP_006483955.1| PREDICTED: uncharacterized protein LOC102616998 isoform X1 [Citrus 
sinensis]
 ref|XP_006483956.1| PREDICTED: uncharacterized protein LOC102616998 isoform X2 [Citrus 
sinensis]
 gb|ESR51488.1| hypothetical protein CICLE_v10031670mg [Citrus clementina]
 gb|ESR51489.1| hypothetical protein CICLE_v10031670mg [Citrus clementina]
 gb|KDO82212.1| hypothetical protein CISIN_1g013577mg [Citrus sinensis]
 gb|KDO82213.1| hypothetical protein CISIN_1g013577mg [Citrus sinensis]
 gb|KDO82214.1| hypothetical protein CISIN_1g013577mg [Citrus sinensis]
Length=415

 Score =   409 bits (1050),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/300 (66%), Positives = 231/300 (77%), Gaps = 25/300 (8%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNV----D  329
            M      S  ++ NE+++L+V   +GV+FG FIG SFP L L KL + +SL+  V    D
Sbjct  14   MGTAARSSINRKTNESMRLIVTTFVGVVFGFFIGVSFPTLSLTKLTLPSSLLPTVEYVED  73

Query  330  DSSNL-------------------TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFY  452
              S L                   T  Q + D +KIWVP+NPRGAERLPP I+  ESDFY
Sbjct  74   QRSGLSTQRFLNVFNPLNRNNGSSTRAQVLNDTSKIWVPTNPRGAERLPPKIVRAESDFY  133

Query  453  LRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEF  632
            LRRLWG P++DLT +PKYL+T TVGY QK+NI+A +KKFSDNFTI+LFHYDG+TTEW+EF
Sbjct  134  LRRLWGNPNEDLTSQPKYLVTFTVGYDQKNNINAAIKKFSDNFTIVLFHYDGRTTEWNEF  193

Query  633  EWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHG  812
            EWSKRAIHVS  KQTKWWYAKRFLHPDIVASY+YIFIWDEDLGVEHF+AEEYIKLV+KHG
Sbjct  194  EWSKRAIHVSVRKQTKWWYAKRFLHPDIVASYDYIFIWDEDLGVEHFNAEEYIKLVRKHG  253

Query  813  LEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LEISQPGLE  KG  LTW+MT+R+ + EVHKET+EK GWCS+PHLPPCAAFVEIMAPVFS
Sbjct  254  LEISQPGLEPNKG--LTWQMTKRRGDREVHKETEEKPGWCSNPHLPPCAAFVEIMAPVFS  311



>ref|XP_009598212.1| PREDICTED: uncharacterized protein LOC104094058 [Nicotiana tomentosiformis]
Length=416

 Score =   407 bits (1047),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 229/295 (78%), Gaps = 20/295 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNN------  323
            M+NFG  SN     ET++L+V++  G+IFGLFIG SFP   L KLN+TAS+V+N      
Sbjct  1    MRNFGRGSNSLMSAETMRLIVSICCGIIFGLFIGISFPTSSLTKLNITASIVSNFPIARD  60

Query  324  ----------VDDSSNLTE--DQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLW  467
                       D SSN  +  +Q      +IWV SNPRGAERLPP I+  ESDFY RRLW
Sbjct  61   RNNIVSAQKHADSSSNTMDISNQNATGQLQIWVQSNPRGAERLPPGIVNSESDFYPRRLW  120

Query  468  GEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKR  647
            G+PS+DL  KPKYL+T TVG  QK NIDA VKKFSD+FT+LLFHYDG+TTEWDEFEWSKR
Sbjct  121  GKPSEDLPSKPKYLVTFTVGLNQKHNIDAAVKKFSDDFTVLLFHYDGKTTEWDEFEWSKR  180

Query  648  AIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ  827
            AIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+EHFDA+EYI+LVKKHGLEISQ
Sbjct  181  AIHVSVQKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGIEHFDAKEYIRLVKKHGLEISQ  240

Query  828  PGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            PGL+ +KG   TW+MT+R+ + EVH  T+EK GWCS+PHLPPCAAFVEIMAPVFS
Sbjct  241  PGLDPRKGT--TWQMTKRRGDREVHTITEEKPGWCSNPHLPPCAAFVEIMAPVFS  293



>ref|XP_006601926.1| PREDICTED: uncharacterized protein LOC100811265 isoform X2 [Glycine 
max]
Length=403

 Score =   407 bits (1046),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 194/300 (65%), Positives = 230/300 (77%), Gaps = 22/300 (7%)
 Frame = +3

Query  153  VCTMKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-  329
            V   +   +CS G++ +E +K  +   IG++FG FIG S P L + KLN+ + L+ ++D 
Sbjct  2    VIITRRSNNCSAGRKPSEIMKFFLTTFIGIVFGFFIGVSIPTLSITKLNLPSGLLPSIDL  61

Query  330  -------------------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFY  452
                               +  + ++ Q   D +KIWVPSNPRGAERLPP I+  ESDFY
Sbjct  62   SYIEDRYAGRQAWSFMNNGNKRSSSQVQLSSDTSKIWVPSNPRGAERLPPGIVEAESDFY  121

Query  453  LRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEF  632
            LRRLWG+PS+DLT +P YL+T TVGY QK+NIDA VKKFS NFTILLFHYDG+TTEWDEF
Sbjct  122  LRRLWGKPSEDLTSRPNYLVTFTVGYDQKNNIDAAVKKFSGNFTILLFHYDGRTTEWDEF  181

Query  633  EWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHG  812
            EWSK+AIHVS HKQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLV+KHG
Sbjct  182  EWSKQAIHVSVHKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVRKHG  241

Query  813  LEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LEISQPGLE  KG  LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  242  LEISQPGLEPNKG--LTWQMTKRRGDQEVHKVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  299



>gb|EYU30626.1| hypothetical protein MIMGU_mgv1a007496mg [Erythranthe guttata]
Length=405

 Score =   406 bits (1044),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/282 (68%), Positives = 231/282 (82%), Gaps = 16/282 (6%)
 Frame = +3

Query  189  GKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNN------------VDD  332
             K+ NET+++ + + +G++FG FIG SFP+L   KLN+T++L+ +             D+
Sbjct  20   AKKPNETMRVFITICVGIMFGFFIGVSFPSLPFTKLNITSALLRDFVIIGNKSAAQFTDN  79

Query  333  SSN--LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKY  506
            SSN   T +QTV+D +KIWV SNP+GAERLPP I+  ESD YLRRLWG+PS+DLT KP Y
Sbjct  80   SSNKSSTANQTVIDVSKIWVQSNPKGAERLPPGIVASESDLYLRRLWGKPSEDLTSKPNY  139

Query  507  LLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWW  686
            L+T TVGY Q++NIDA VKKFS NFTILLFHYDG+T+EWDEFEWSKRAIHVSA KQTKWW
Sbjct  140  LVTFTVGYDQRNNIDAAVKKFSGNFTILLFHYDGRTSEWDEFEWSKRAIHVSAIKQTKWW  199

Query  687  YAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTW  866
            YAKRFLHPDIVA Y+YIFIWDEDLGVEHFDAEEYIKLV+K+GLEISQPGL+  +G   TW
Sbjct  200  YAKRFLHPDIVAPYDYIFIWDEDLGVEHFDAEEYIKLVRKYGLEISQPGLDPSRGT--TW  257

Query  867  EMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            EMT+R+ + +VH ET+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  258  EMTKRRNDRDVHMETEERPGWCSDPHLPPCAAFVEIMAPVFS  299



>ref|XP_008221901.1| PREDICTED: uncharacterized protein LOC103321836 isoform X3 [Prunus 
mume]
 ref|XP_008221902.1| PREDICTED: uncharacterized protein LOC103321836 isoform X3 [Prunus 
mume]
Length=387

 Score =   404 bits (1038),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 223/285 (78%), Gaps = 26/285 (9%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN----------------  341
            ++L+V   +GV+FG  IG SFP L L KLN+++SL+ NVD S N                
Sbjct  1    MRLIVTTFVGVVFGFLIGVSFPTLSLTKLNLSSSLLPNVDLSYNEDQKSDISRQTILNAW  60

Query  342  --------LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                     T+ Q+     +IWVPSNPRGAERLPP I+  ESDFYLRRLWG+PS+DLT+K
Sbjct  61   SSTRSNDSSTKAQSSNGTARIWVPSNPRGAERLPPGILAAESDFYLRRLWGKPSEDLTIK  120

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            P+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTEWDEFEWSKRAIHVS  KQT
Sbjct  121  PRYLVTFTVGLNQKKNIDAAVKKFSENFTILLFHYDGQTTEWDEFEWSKRAIHVSVRKQT  180

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLV+KHGLEISQPGLE  KG  
Sbjct  181  KWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVRKHGLEISQPGLEPNKG--  238

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHK+T EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  239  LTWQMTKRRGDREVHKQTVEKPGWCTDPHLPPCAAFVEIMAPVFS  283



>ref|XP_010906956.1| PREDICTED: uncharacterized protein LOC105033746 isoform X3 [Elaeis 
guineensis]
Length=397

 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 231/296 (78%), Gaps = 22/296 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M   G+ S  ++ NET++L++   +GV+ G FIG SFP + + KL+  +S+++ ++D ++
Sbjct  1    MAKLGNTSR-RKPNETMRLIITTIVGVVLGFFIGISFPTVSITKLHFPSSIISYIEDRNS  59

Query  342  LTEDQTVM-------------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRL  464
                Q ++                   D  KI+VP+NPRGAERLPP I+V ESDFYLRRL
Sbjct  60   GLATQALLNHALTSARNQNRNNSKDFNDTLKIYVPTNPRGAERLPPGIVVSESDFYLRRL  119

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSK  644
            WG P +DL MK KYL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+T+EWDEFEWSK
Sbjct  120  WGNPDEDLKMKQKYLVTFTVGYDQKKNIDAAVKKFSENFTIVLFHYDGRTSEWDEFEWSK  179

Query  645  RAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEIS  824
            RAIHVSA KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHF+AEEYIKLVKKHGLEIS
Sbjct  180  RAIHVSARKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFNAEEYIKLVKKHGLEIS  239

Query  825  QPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            QPGLE  +G  LTW+MT+R+ + EVHKET+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  240  QPGLEPNRG--LTWQMTKRRGDREVHKETEERPGWCSDPHLPPCAAFVEIMATVFS  293



>ref|XP_010248668.1| PREDICTED: uncharacterized protein LOC104591513 [Nelumbo nucifera]
 ref|XP_010248669.1| PREDICTED: uncharacterized protein LOC104591513 [Nelumbo nucifera]
 ref|XP_010248670.1| PREDICTED: uncharacterized protein LOC104591513 [Nelumbo nucifera]
 ref|XP_010248671.1| PREDICTED: uncharacterized protein LOC104591513 [Nelumbo nucifera]
Length=408

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 236/306 (77%), Gaps = 28/306 (9%)
 Frame = +3

Query  153  VCTMKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDD  332
            +  M   G     ++ NE+++L++   +GV+FG  IG SFP + L +LN+ +S++ ++D 
Sbjct  1    MSKMGTLGRSGIIRKPNESMRLIITTFVGVVFGFLIGVSFPTISLTRLNLPSSILPSIDL  60

Query  333  S------SNLT--------------------EDQTVMDPTKIWVPSNPRGAERLPPDIIV  434
            S      S L+                    + Q + D +KIWVP+NPRGAERLPP I+ 
Sbjct  61   SYFDDKNSGLSTQTSFQHDWTSVSSNRSGSSQAQNLSDTSKIWVPTNPRGAERLPPGIVA  120

Query  435  PESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQT  614
             ESDFYLRRLWG+PS+DLT++ KYL+T TVGY+QK+NIDA VKKFSDNFTILLFHYDG+T
Sbjct  121  SESDFYLRRLWGKPSEDLTIRQKYLVTFTVGYEQKNNIDAAVKKFSDNFTILLFHYDGRT  180

Query  615  TEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIK  794
            +EW+EFEWS+RAIHVSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFDAEEYIK
Sbjct  181  SEWEEFEWSRRAIHVSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDAEEYIK  240

Query  795  LVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEI  974
            LV+KHGLEISQPGLE  KG  LTW+MT+R+ + EVHKET+EK GWC++PHLPPCAAFVEI
Sbjct  241  LVRKHGLEISQPGLEPNKG--LTWQMTKRRGDREVHKETEEKPGWCTNPHLPPCAAFVEI  298

Query  975  MAPVFS  992
            MA VFS
Sbjct  299  MATVFS  304



>ref|XP_010906955.1| PREDICTED: uncharacterized protein LOC105033746 isoform X2 [Elaeis 
guineensis]
Length=401

 Score =   402 bits (1034),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 231/299 (77%), Gaps = 24/299 (8%)
 Frame = +3

Query  162  MKNFGHCSNG---KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDD  332
            M   G+ S     ++ NET++L++   +GV+ G FIG SFP + + KL+  +S+++ ++D
Sbjct  1    MAKLGNTSRSGLFRKPNETMRLIITTIVGVVLGFFIGISFPTVSITKLHFPSSIISYIED  60

Query  333  SSNLTEDQTVM-------------------DPTKIWVPSNPRGAERLPPDIIVPESDFYL  455
             ++    Q ++                   D  KI+VP+NPRGAERLPP I+V ESDFYL
Sbjct  61   RNSGLATQALLNHALTSARNQNRNNSKDFNDTLKIYVPTNPRGAERLPPGIVVSESDFYL  120

Query  456  RRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFE  635
            RRLWG P +DL MK KYL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+T+EWDEFE
Sbjct  121  RRLWGNPDEDLKMKQKYLVTFTVGYDQKKNIDAAVKKFSENFTIVLFHYDGRTSEWDEFE  180

Query  636  WSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGL  815
            WSKRAIHVSA KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHF+AEEYIKLVKKHGL
Sbjct  181  WSKRAIHVSARKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFNAEEYIKLVKKHGL  240

Query  816  EISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            EISQPGLE  +G  LTW+MT+R+ + EVHKET+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  241  EISQPGLEPNRG--LTWQMTKRRGDREVHKETEERPGWCSDPHLPPCAAFVEIMATVFS  297



>ref|XP_003551994.1| PREDICTED: uncharacterized protein LOC100811265 isoform X1 [Glycine 
max]
 gb|KHN43983.1| hypothetical protein glysoja_048217 [Glycine soja]
Length=399

 Score =   402 bits (1033),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/290 (66%), Positives = 226/290 (78%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------  329
            S G++ +E +K  +   IG++FG FIG S P L + KLN+ + L+ ++D           
Sbjct  8    SAGRKPSEIMKFFLTTFIGIVFGFFIGVSIPTLSITKLNLPSGLLPSIDLSYIEDRYAGR  67

Query  330  ---------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
                     +  + ++ Q   D +KIWVPSNPRGAERLPP I+  ESDFYLRRLWG+PS+
Sbjct  68   QAWSFMNNGNKRSSSQVQLSSDTSKIWVPSNPRGAERLPPGIVEAESDFYLRRLWGKPSE  127

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT +P YL+T TVGY QK+NIDA VKKFS NFTILLFHYDG+TTEWDEFEWSK+AIHVS
Sbjct  128  DLTSRPNYLVTFTVGYDQKNNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQAIHVS  187

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
             HKQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLV+KHGLEISQPGLE 
Sbjct  188  VHKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVRKHGLEISQPGLEP  247

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             KG  LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  NKG--LTWQMTKRRGDQEVHKVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  295



>emb|CBI16790.3| unnamed protein product [Vitis vinifera]
Length=385

 Score =   401 bits (1031),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 191/283 (67%), Positives = 226/283 (80%), Gaps = 24/283 (8%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSS------------  338
            ++L+V +++GV+FG  IG SFP L + KLN+ +SL+ NVD     D S            
Sbjct  1    MRLIVTISVGVVFGFLIGISFPTLSITKLNLPSSLLPNVDIAYIRDKSSGFSTQALLDAL  60

Query  339  -----NLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPK  503
                 N T+ Q +   +KIW PSNPRGAERLPP I+  ESDFYLRRLWG+PS+DLT+KPK
Sbjct  61   SSAKYNRTQAQNLNGTSKIWAPSNPRGAERLPPGIVAAESDFYLRRLWGKPSEDLTIKPK  120

Query  504  YLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKW  683
            YL+T TVGY QK N+DA VKKFS++FTILLFHYDG+TTEWDEFEWSKRAIHVS  +QTKW
Sbjct  121  YLVTFTVGYDQKKNVDAAVKKFSEDFTILLFHYDGRTTEWDEFEWSKRAIHVSVRRQTKW  180

Query  684  WYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLT  863
            WYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYI+LV+K+GLEISQPGLE  KG  LT
Sbjct  181  WYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIRLVRKYGLEISQPGLEPNKG--LT  238

Query  864  WEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            W+MT+R+ + EVHKET+EK GWC +PHLPPCAAFVEIMAPVFS
Sbjct  239  WQMTKRRGDREVHKETEEKPGWCPNPHLPPCAAFVEIMAPVFS  281



>ref|XP_010906954.1| PREDICTED: uncharacterized protein LOC105033746 isoform X1 [Elaeis 
guineensis]
Length=404

 Score =   402 bits (1033),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 189/286 (66%), Positives = 227/286 (79%), Gaps = 21/286 (7%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVM--  365
            ++ NET++L++   +GV+ G FIG SFP + + KL+  +S+++ ++D ++    Q ++  
Sbjct  17   RKPNETMRLIITTIVGVVLGFFIGISFPTVSITKLHFPSSIISYIEDRNSGLATQALLNH  76

Query  366  -----------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTM  494
                             D  KI+VP+NPRGAERLPP I+V ESDFYLRRLWG P +DL M
Sbjct  77   ALTSARNQNRNNSKDFNDTLKIYVPTNPRGAERLPPGIVVSESDFYLRRLWGNPDEDLKM  136

Query  495  KPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQ  674
            K KYL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+T+EWDEFEWSKRAIHVSA KQ
Sbjct  137  KQKYLVTFTVGYDQKKNIDAAVKKFSENFTIVLFHYDGRTSEWDEFEWSKRAIHVSARKQ  196

Query  675  TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGV  854
            TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHF+AEEYIKLVKKHGLEISQPGLE  +G 
Sbjct  197  TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFNAEEYIKLVKKHGLEISQPGLEPNRG-  255

Query  855  WLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             LTW+MT+R+ + EVHKET+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  256  -LTWQMTKRRGDREVHKETEERPGWCSDPHLPPCAAFVEIMATVFS  300



>ref|XP_004502391.1| PREDICTED: uncharacterized protein LOC101511137 isoform X1 [Cicer 
arietinum]
 ref|XP_004502392.1| PREDICTED: uncharacterized protein LOC101511137 isoform X2 [Cicer 
arietinum]
Length=398

 Score =   402 bits (1032),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 225/289 (78%), Gaps = 21/289 (7%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------  329
            S G++ +E ++L+V    G++FG F+G SFP L L K N+ + L+ ++D           
Sbjct  8    STGRKPSEIMRLIVTTFTGIVFGFFLGVSFPTLSLTKFNLPSGLLPSIDLSYIEDRYTGR  67

Query  330  --------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
                     +   + +    D +KIWVPSNPRGAE LPP I+  ESDFYLRRLWG+PS+D
Sbjct  68   HAWSFMNHSNRRYSPNHLSNDTSKIWVPSNPRGAESLPPGIVEAESDFYLRRLWGKPSED  127

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            LT KPKYL+T TVGY QK NIDA VKKFS+NFTILLFHYDG+TTEWDEFEWSK+AIHVSA
Sbjct  128  LTSKPKYLVTFTVGYDQKKNIDAAVKKFSENFTILLFHYDGRTTEWDEFEWSKQAIHVSA  187

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEY+KLVKKHGLEISQPGLE  
Sbjct  188  RKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYLKLVKKHGLEISQPGLEPN  247

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            KG  LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  KG--LTWQMTKRRGDKEVHKVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  294



>ref|XP_009359203.1| PREDICTED: uncharacterized protein LOC103949812 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009359204.1| PREDICTED: uncharacterized protein LOC103949812 isoform X1 [Pyrus 
x bretschneideri]
Length=412

 Score =   402 bits (1033),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 230/304 (76%), Gaps = 26/304 (9%)
 Frame = +3

Query  153  VCTMKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDD  332
            V  M      + G++ NET++L+V   +GV+FG  IG SFP L L +LN+++SL   +D 
Sbjct  7    VNNMGILSRSAGGRKPNETMRLIVTTFVGVVFGFLIGASFPTLSLTRLNLSSSLHPTIDL  66

Query  333  SSN------------------------LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPE  440
            S N                         ++DQ+    ++IWVPSNPRGAE LPP I+  E
Sbjct  67   SYNEDLKSDISSQALLSSWSSARSKNSTSQDQSSNGTSRIWVPSNPRGAEMLPPGIVAAE  126

Query  441  SDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTE  620
            SDFYLRRLWG P++D+T+KP+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTE
Sbjct  127  SDFYLRRLWGNPNEDVTIKPRYLVTFTVGLNQKRNIDAAVKKFSENFTILLFHYDGQTTE  186

Query  621  WDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLV  800
            WD+ EWSKRAIH+S  KQTKWWYAKRFLHPDIVASY+YIFIWDEDLGVEHF++EEYI+LV
Sbjct  187  WDDLEWSKRAIHISVRKQTKWWYAKRFLHPDIVASYDYIFIWDEDLGVEHFNSEEYIRLV  246

Query  801  KKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMA  980
            +KHGLEISQPGLE  KG  LTW+MT+R+ + EVHK+T+EK GWC+DP LPPCAAF+EIMA
Sbjct  247  RKHGLEISQPGLEPNKG--LTWQMTKRRGDREVHKQTEEKPGWCTDPLLPPCAAFIEIMA  304

Query  981  PVFS  992
            PVFS
Sbjct  305  PVFS  308



>ref|XP_003531333.1| PREDICTED: uncharacterized protein LOC100805311 [Glycine max]
Length=397

 Score =   401 bits (1030),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 232/289 (80%), Gaps = 22/289 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------  329
            S+ ++ +++++L+V   +G++FG FIG SFPAL   KLN+ +SL+  +D           
Sbjct  8    SSNRKPSDSMRLIVTTFVGIVFGFFIGVSFPAL-TTKLNLPSSLLPAIDISYIQEKYAGG  66

Query  330  --------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
                    ++S  ++ + + D  KIWVPSNPRGAERLPP+II  E+DFYLRRLWG+PS+D
Sbjct  67   NAPSFVKNNNSISSKHRLINDTFKIWVPSNPRGAERLPPEIIEAETDFYLRRLWGQPSED  126

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            LT KPKYL+T TVGY Q+ NIDA VKKFS+NFTI+LFHYDG TTEWDEFEWSKRAIHVS 
Sbjct  127  LTSKPKYLVTFTVGYNQRYNIDANVKKFSENFTIVLFHYDGHTTEWDEFEWSKRAIHVSV  186

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEY+KLVKKHGLEISQPGLE  
Sbjct  187  RKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYLKLVKKHGLEISQPGLEPN  246

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            KG  LTW+MT+R+ + EVHKET+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  247  KG--LTWQMTKRRGDREVHKETEEKPGWCADPHLPPCAAFVEIMAPVFS  293



>ref|XP_008340099.1| PREDICTED: uncharacterized protein LOC103403062 isoform X1 [Malus 
domestica]
 ref|XP_008340100.1| PREDICTED: uncharacterized protein LOC103403062 isoform X1 [Malus 
domestica]
 ref|XP_008340101.1| PREDICTED: uncharacterized protein LOC103403062 isoform X1 [Malus 
domestica]
Length=412

 Score =   401 bits (1031),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/304 (63%), Positives = 228/304 (75%), Gaps = 26/304 (9%)
 Frame = +3

Query  153  VCTMKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDD  332
            V  M      + G++ NET++L+V   +GV+FG  IG SFP L L KLN+++SL   +D 
Sbjct  7    VNKMGILSRSAGGRKPNETMRLIVTTFVGVVFGFLIGASFPTLSLTKLNLSSSLRPTIDL  66

Query  333  SSN------------------------LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPE  440
            S N                         ++DQ+     +IWVPSNPRGAE LPP I+  E
Sbjct  67   SYNEDLKSDISSQALLSSWSSARSKNSTSQDQSSNGTLRIWVPSNPRGAEMLPPGIVAAE  126

Query  441  SDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTE  620
            SDFYLRRLWG PS+D+T+KP+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTE
Sbjct  127  SDFYLRRLWGNPSEDVTIKPRYLVTFTVGLNQKRNIDAAVKKFSENFTILLFHYDGQTTE  186

Query  621  WDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLV  800
            WD+ EWSKRAIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF++EEYI+LV
Sbjct  187  WDDLEWSKRAIHVSVRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNSEEYIRLV  246

Query  801  KKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMA  980
            +KHGLEISQPGLE  KG  LTW+MT+R+ + EVHK+T+EK GWC+DP LPPCAAF+EIMA
Sbjct  247  RKHGLEISQPGLEPNKG--LTWQMTKRRGDREVHKQTEEKPGWCTDPLLPPCAAFIEIMA  304

Query  981  PVFS  992
            PVFS
Sbjct  305  PVFS  308



>gb|KEH35290.1| lysine ketoglutarate reductase trans-splicing protein [Medicago 
truncatula]
Length=368

 Score =   399 bits (1026),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 194/296 (66%), Positives = 228/296 (77%), Gaps = 21/296 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M       NG++ +E ++L+V   IGV+FG F+G SFP L L K N+ + L+ ++D    
Sbjct  1    MGTVTRSPNGRKPSEIMRLIVTTFIGVVFGFFLGVSFPTLSLTKFNLPSGLLPSIDLSYI  60

Query  330  -------------DSSN--LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRL  464
                         ++SN     ++   D +KIWVPSNPRGAE LPP I+  ESDFYLRRL
Sbjct  61   EERYTGRRAWSFINNSNRRALPNRLSNDTSKIWVPSNPRGAESLPPGIVEAESDFYLRRL  120

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSK  644
            WG+PS+DLT KPKYL+T TVGY+ K NIDA VKKFS+NFTILLFHYDG+  EWDEFEWSK
Sbjct  121  WGKPSEDLTFKPKYLVTFTVGYEMKKNIDAAVKKFSENFTILLFHYDGRANEWDEFEWSK  180

Query  645  RAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEIS  824
            +AIHVSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEY+KLVKKHGLEIS
Sbjct  181  KAIHVSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYLKLVKKHGLEIS  240

Query  825  QPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            QPGLE  KG  LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  241  QPGLEPNKG--LTWQMTKRRGDKEVHKVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  294



>gb|KHN29026.1| hypothetical protein glysoja_008361, partial [Glycine soja]
Length=390

 Score =   400 bits (1028),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 232/289 (80%), Gaps = 22/289 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------  329
            S+ ++ +++++L+V   +G++FG FIG SFPAL   KLN+ +SL+  +D           
Sbjct  1    SSNRKPSDSMRLIVTTFVGIVFGFFIGVSFPAL-TTKLNLPSSLLPAIDISYIQEKYAGG  59

Query  330  --------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
                    ++S  ++ + + D  KIWVPSNPRGAERLPP+II  E+DFYLRRLWG+PS+D
Sbjct  60   NAPSFVKNNNSISSKHRLINDTFKIWVPSNPRGAERLPPEIIEAETDFYLRRLWGQPSED  119

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            LT KPKYL+T TVGY Q+ NIDA VKKFS+NFTI+LFHYDG TTEWDEFEWSKRAIHVS 
Sbjct  120  LTSKPKYLVTFTVGYNQRYNIDANVKKFSENFTIVLFHYDGHTTEWDEFEWSKRAIHVSV  179

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEY+KLVKKHGLEISQPGLE  
Sbjct  180  RKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYLKLVKKHGLEISQPGLEPN  239

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            KG  LTW+MT+R+ + EVHKET+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  240  KG--LTWQMTKRRGDREVHKETEEKPGWCADPHLPPCAAFVEIMAPVFS  286



>ref|XP_007163683.1| hypothetical protein PHAVU_001G255300g [Phaseolus vulgaris]
 ref|XP_007163684.1| hypothetical protein PHAVU_001G255300g [Phaseolus vulgaris]
 gb|ESW35677.1| hypothetical protein PHAVU_001G255300g [Phaseolus vulgaris]
 gb|ESW35678.1| hypothetical protein PHAVU_001G255300g [Phaseolus vulgaris]
Length=399

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/290 (66%), Positives = 226/290 (78%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------  329
            S  ++ +E ++  V   IG++FG FIG S P L + KLN+ + L+ ++D           
Sbjct  8    SASRKPSEIMRFFVTTFIGIVFGFFIGVSVPTLSITKLNLPSGLLPSIDLSYIEDRYTGR  67

Query  330  ---------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
                     +  + ++ + + D +KIWVPSNPRGAERLPP I+  ESDFYLRRLWG+PS+
Sbjct  68   QAWSFMNNGNKRSSSQVKALNDTSKIWVPSNPRGAERLPPGIVEAESDFYLRRLWGKPSE  127

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT KPKYL+T TVGY+QK NIDA VKKFS NF++LLFHYDG+TTEWDEFEWSKRAIHVS
Sbjct  128  DLTSKPKYLVTFTVGYEQKKNIDAAVKKFSGNFSVLLFHYDGRTTEWDEFEWSKRAIHVS  187

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
            A KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFDAEEYIKLV+KHGLEISQPGLE 
Sbjct  188  ARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDAEEYIKLVRKHGLEISQPGLEP  247

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             KG  LTW+MT+R+ + EVHK T EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  NKG--LTWQMTKRRGDREVHKVTMEKPGWCSDPHLPPCAAFVEIMAPVFS  295



>ref|XP_008360116.1| PREDICTED: uncharacterized protein LOC103423810 isoform X1 [Malus 
domestica]
 ref|XP_008360117.1| PREDICTED: uncharacterized protein LOC103423810 isoform X1 [Malus 
domestica]
 ref|XP_008360118.1| PREDICTED: uncharacterized protein LOC103423810 isoform X1 [Malus 
domestica]
Length=403

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/301 (63%), Positives = 230/301 (76%), Gaps = 26/301 (9%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS--  335
            M      + GK+ NE ++L+V   +G+ FG  IG SFP L L KLN+++SL+  VD S  
Sbjct  1    MGILSRSAGGKKPNENMRLIVTTFVGLAFGFLIGVSFPTLSLTKLNLSSSLLPTVDLSYT  60

Query  336  ----------------------SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDF  449
                                  ++ ++DQ++   ++IWVPSNPRGAE LPP I+  ESDF
Sbjct  61   EDKKSDISSQSLPSSWPSETSKNSSSQDQSLNGKSRIWVPSNPRGAEMLPPGIVAAESDF  120

Query  450  YLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDE  629
            YLRRLWG+PS+DLT+KP+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTEWD+
Sbjct  121  YLRRLWGKPSEDLTIKPRYLVTFTVGLNQKKNIDAAVKKFSENFTILLFHYDGQTTEWDD  180

Query  630  FEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKH  809
             EWSKRAIH+SA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE Y++LVKKH
Sbjct  181  LEWSKRAIHISARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEVYLRLVKKH  240

Query  810  GLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVF  989
            GLEISQPGLE  KG  LTW+MT+R+ + EVHK+T+EK GWC+DP LPPCAAF+EIMAPVF
Sbjct  241  GLEISQPGLEPNKG--LTWQMTKRRGDREVHKQTEEKPGWCTDPLLPPCAAFIEIMAPVF  298

Query  990  S  992
            S
Sbjct  299  S  299



>ref|XP_009763116.1| PREDICTED: uncharacterized protein LOC104215067 [Nicotiana sylvestris]
Length=397

 Score =   400 bits (1028),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 224/295 (76%), Gaps = 20/295 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNN------  323
            M+N G  SN     ET++L V++  G+IFGLFIG SFP   L KLN+TAS+V+N      
Sbjct  1    MRNLGRGSNSLMSAETMRLSVSICCGIIFGLFIGISFPTSSLTKLNITASIVSNFPIARD  60

Query  324  ----------VDDSSNLTE--DQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLW  467
                       D SSN  +  +Q      +IWV SNPRGAERLPP I+  ESDFY RRLW
Sbjct  61   RNNIVSAQKHADSSSNTMDISNQNATGQLQIWVQSNPRGAERLPPGIVNSESDFYPRRLW  120

Query  468  GEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKR  647
            G+PS+DL  KPKYL+T TVG  QK NIDA VKKFSD FTILLFHYDG+TTEWDEFEWSKR
Sbjct  121  GKPSEDLPSKPKYLVTFTVGLNQKHNIDAAVKKFSDEFTILLFHYDGKTTEWDEFEWSKR  180

Query  648  AIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ  827
            AIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFDA+EYI+LVKKHGLEISQ
Sbjct  181  AIHVSVQKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDAKEYIRLVKKHGLEISQ  240

Query  828  PGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            PGL+ +KG   TW+MT+R+ + EVH  T+EK GWCS P LPPCAAFVEIMAPVFS
Sbjct  241  PGLDPRKGT--TWQMTKRRGDHEVHTITEEKPGWCSSPLLPPCAAFVEIMAPVFS  293



>ref|XP_003601902.1| hypothetical protein MTR_3g086610 [Medicago truncatula]
 gb|AES72153.1| lysine ketoglutarate reductase trans-splicing protein [Medicago 
truncatula]
Length=399

 Score =   400 bits (1028),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/296 (66%), Positives = 228/296 (77%), Gaps = 21/296 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M       NG++ +E ++L+V   IGV+FG F+G SFP L L K N+ + L+ ++D    
Sbjct  1    MGTVTRSPNGRKPSEIMRLIVTTFIGVVFGFFLGVSFPTLSLTKFNLPSGLLPSIDLSYI  60

Query  330  -------------DSSNLTE--DQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRL  464
                         ++SN     ++   D +KIWVPSNPRGAE LPP I+  ESDFYLRRL
Sbjct  61   EERYTGRRAWSFINNSNRRALPNRLSNDTSKIWVPSNPRGAESLPPGIVEAESDFYLRRL  120

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSK  644
            WG+PS+DLT KPKYL+T TVGY+ K NIDA VKKFS+NFTILLFHYDG+  EWDEFEWSK
Sbjct  121  WGKPSEDLTFKPKYLVTFTVGYEMKKNIDAAVKKFSENFTILLFHYDGRANEWDEFEWSK  180

Query  645  RAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEIS  824
            +AIHVSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEY+KLVKKHGLEIS
Sbjct  181  KAIHVSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYLKLVKKHGLEIS  240

Query  825  QPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            QPGLE  KG  LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  241  QPGLEPNKG--LTWQMTKRRGDKEVHKVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  294



>ref|XP_007159700.1| hypothetical protein PHAVU_002G259800g [Phaseolus vulgaris]
 gb|ESW31694.1| hypothetical protein PHAVU_002G259800g [Phaseolus vulgaris]
Length=397

 Score =   400 bits (1027),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 232/289 (80%), Gaps = 22/289 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------  329
            S  ++ +++++L+V   +G++FG FIG SFPAL   KLN+ +SL+  +D           
Sbjct  8    STNRKPSDSMRLIVTTFVGIVFGFFIGVSFPAL-TTKLNLPSSLLPAIDISYIQEKYAVG  66

Query  330  --------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
                    ++ + ++ + + D  KIWVPSNPRGAERLPP+II  E+DFYLRRLWG+PS+D
Sbjct  67   NAPSSVKSNNGDSSQQKLINDTLKIWVPSNPRGAERLPPEIIEAETDFYLRRLWGQPSED  126

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            LT+KPKYL+T TVG+ Q+ +IDA VKKFS+NFTI+LFHYDGQTTEWDEFEWSKRAIHVS 
Sbjct  127  LTLKPKYLVTFTVGHNQRYDIDANVKKFSENFTIVLFHYDGQTTEWDEFEWSKRAIHVSV  186

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE+Y+KLVKKHGLEISQPGLE  
Sbjct  187  RKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEKYLKLVKKHGLEISQPGLEPN  246

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            KG  LTW+MT+R  + EVHKET+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  247  KG--LTWQMTKRLGDREVHKETEEKPGWCSDPHLPPCAAFVEIMAPVFS  293



>ref|XP_010251037.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251038.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251039.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251040.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251041.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251042.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251043.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
Length=408

 Score =   400 bits (1028),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 232/306 (76%), Gaps = 28/306 (9%)
 Frame = +3

Query  153  VCTMKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-  329
            +  M   G     ++ NE+++L++   +GV+FG  +G SFP + L KLN  +SL+ ++D 
Sbjct  1    MSKMGTLGRSGIIRKPNESMRLIITTFVGVVFGFLVGVSFPTISLTKLNFPSSLLPSIDL  60

Query  330  -------------------------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIV  434
                                     + S+ ++ Q + + +KIWVP+NPRGAERLPP I+ 
Sbjct  61   SYIEDKNSGRPSETFLPRSWPSPKFNRSSSSQGQNLNETSKIWVPTNPRGAERLPPGIVA  120

Query  435  PESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQT  614
             ESD YLRRLWG+PS+DLT++ KYL+T TVGY+QK+NIDA VKKFS+NFTILLFHYDG+T
Sbjct  121  SESDLYLRRLWGKPSEDLTIRQKYLVTFTVGYEQKNNIDAAVKKFSENFTILLFHYDGRT  180

Query  615  TEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIK  794
            +EWDEFEWSKRAIHVSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFDAEEYIK
Sbjct  181  SEWDEFEWSKRAIHVSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDAEEYIK  240

Query  795  LVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEI  974
            LV+KHGLEISQPGLE      LTW+MT+R+ + EVHK+T+EK GWC DPHLPPCAAFVEI
Sbjct  241  LVRKHGLEISQPGLEPNNR--LTWQMTKRRGDQEVHKQTEEKPGWCPDPHLPPCAAFVEI  298

Query  975  MAPVFS  992
            MAPVFS
Sbjct  299  MAPVFS  304



>ref|XP_008804224.1| PREDICTED: uncharacterized protein LOC103717560 isoform X3 [Phoenix 
dactylifera]
Length=397

 Score =   400 bits (1027),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 227/296 (77%), Gaps = 22/296 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M   G  S  ++ NET++L++   +GV+ G FIG SFP + + KL+  +S+++ ++D ++
Sbjct  1    MAKLGSTSR-RKPNETMRLIITTIVGVVLGFFIGISFPTVSITKLHFPSSIISYIEDRNS  59

Query  342  LTEDQTVM-------------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRL  464
                Q  +                   D  KI+VP+NPRGAERLPP I+V ESDFYLRRL
Sbjct  60   GLATQAFLNQALTSARNQNRNNSKDFNDTLKIYVPTNPRGAERLPPGIVVSESDFYLRRL  119

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSK  644
            WG P  DLTMK KYL+T TVGY QK NIDA VKKFS NFTILLFHYDG+T+EWDEFEWSK
Sbjct  120  WGNPDDDLTMKQKYLVTFTVGYDQKKNIDAAVKKFSQNFTILLFHYDGRTSEWDEFEWSK  179

Query  645  RAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEIS  824
            RAIHVSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLVKKHGLEIS
Sbjct  180  RAIHVSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVKKHGLEIS  239

Query  825  QPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            QPGLE  +G  LTW+MT+R+ + EVHKET+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  240  QPGLEPNRG--LTWQMTKRRGDREVHKETEERPGWCSDPHLPPCAAFVEIMATVFS  293



>gb|AFK47373.1| unknown [Medicago truncatula]
Length=399

 Score =   400 bits (1027),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/296 (66%), Positives = 228/296 (77%), Gaps = 21/296 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M       NG++ +E ++L+V   IGV+FG F+G SFP L L K N+ + L+ ++D    
Sbjct  1    MGTVTRSPNGRKPSEIMRLIVTTFIGVVFGFFLGVSFPTLSLTKFNLPSGLLPSIDLSYI  60

Query  330  -------------DSSNLTE--DQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRL  464
                         ++SN     ++   D +KIWVPSNPRGAE LPP I+  ESDFYLRRL
Sbjct  61   EERYTGRRAWSFINNSNRRALPNRLSNDTSKIWVPSNPRGAESLPPGIVEAESDFYLRRL  120

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSK  644
            WG+PS+DLT KPKYL+T TVGY+ K NIDA VKKFS+NFTILLFHYDG+  EWDEFEWSK
Sbjct  121  WGKPSEDLTFKPKYLVTFTVGYEMKKNIDAAVKKFSENFTILLFHYDGRANEWDEFEWSK  180

Query  645  RAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEIS  824
            +AIHVSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEY+KLVKKHGLEIS
Sbjct  181  KAIHVSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYLKLVKKHGLEIS  240

Query  825  QPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            QPGLE  KG  LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  241  QPGLEPNKG--LTWQMTKRRGDKEVHKVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  294



>ref|XP_009359205.1| PREDICTED: uncharacterized protein LOC103949812 isoform X2 [Pyrus 
x bretschneideri]
Length=398

 Score =   400 bits (1027),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 228/294 (78%), Gaps = 26/294 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN-------  341
            + G++ NET++L+V   +GV+FG  IG SFP L L +LN+++SL   +D S N       
Sbjct  3    AGGRKPNETMRLIVTTFVGVVFGFLIGASFPTLSLTRLNLSSSLHPTIDLSYNEDLKSDI  62

Query  342  -----------------LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
                              ++DQ+    ++IWVPSNPRGAE LPP I+  ESDFYLRRLWG
Sbjct  63   SSQALLSSWSSARSKNSTSQDQSSNGTSRIWVPSNPRGAEMLPPGIVAAESDFYLRRLWG  122

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
             P++D+T+KP+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTEWD+ EWSKRA
Sbjct  123  NPNEDVTIKPRYLVTFTVGLNQKRNIDAAVKKFSENFTILLFHYDGQTTEWDDLEWSKRA  182

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IH+S  KQTKWWYAKRFLHPDIVASY+YIFIWDEDLGVEHF++EEYI+LV+KHGLEISQP
Sbjct  183  IHISVRKQTKWWYAKRFLHPDIVASYDYIFIWDEDLGVEHFNSEEYIRLVRKHGLEISQP  242

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE  KG  LTW+MT+R+ + EVHK+T+EK GWC+DP LPPCAAF+EIMAPVFS
Sbjct  243  GLEPNKG--LTWQMTKRRGDREVHKQTEEKPGWCTDPLLPPCAAFIEIMAPVFS  294



>ref|XP_008804222.1| PREDICTED: uncharacterized protein LOC103717560 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008804223.1| PREDICTED: uncharacterized protein LOC103717560 isoform X2 [Phoenix 
dactylifera]
Length=401

 Score =   399 bits (1025),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 227/299 (76%), Gaps = 24/299 (8%)
 Frame = +3

Query  162  MKNFGHCSNG---KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDD  332
            M   G  S     ++ NET++L++   +GV+ G FIG SFP + + KL+  +S+++ ++D
Sbjct  1    MAKLGSTSRSGLFRKPNETMRLIITTIVGVVLGFFIGISFPTVSITKLHFPSSIISYIED  60

Query  333  SSNLTEDQTVM-------------------DPTKIWVPSNPRGAERLPPDIIVPESDFYL  455
             ++    Q  +                   D  KI+VP+NPRGAERLPP I+V ESDFYL
Sbjct  61   RNSGLATQAFLNQALTSARNQNRNNSKDFNDTLKIYVPTNPRGAERLPPGIVVSESDFYL  120

Query  456  RRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFE  635
            RRLWG P  DLTMK KYL+T TVGY QK NIDA VKKFS NFTILLFHYDG+T+EWDEFE
Sbjct  121  RRLWGNPDDDLTMKQKYLVTFTVGYDQKKNIDAAVKKFSQNFTILLFHYDGRTSEWDEFE  180

Query  636  WSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGL  815
            WSKRAIHVSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLVKKHGL
Sbjct  181  WSKRAIHVSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVKKHGL  240

Query  816  EISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            EISQPGLE  +G  LTW+MT+R+ + EVHKET+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  241  EISQPGLEPNRG--LTWQMTKRRGDREVHKETEERPGWCSDPHLPPCAAFVEIMATVFS  297



>ref|XP_008804220.1| PREDICTED: uncharacterized protein LOC103717560 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008804221.1| PREDICTED: uncharacterized protein LOC103717560 isoform X1 [Phoenix 
dactylifera]
Length=404

 Score =   399 bits (1025),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/286 (66%), Positives = 224/286 (78%), Gaps = 21/286 (7%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVM--  365
            ++ NET++L++   +GV+ G FIG SFP + + KL+  +S+++ ++D ++    Q  +  
Sbjct  17   RKPNETMRLIITTIVGVVLGFFIGISFPTVSITKLHFPSSIISYIEDRNSGLATQAFLNQ  76

Query  366  -----------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTM  494
                             D  KI+VP+NPRGAERLPP I+V ESDFYLRRLWG P  DLTM
Sbjct  77   ALTSARNQNRNNSKDFNDTLKIYVPTNPRGAERLPPGIVVSESDFYLRRLWGNPDDDLTM  136

Query  495  KPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQ  674
            K KYL+T TVGY QK NIDA VKKFS NFTILLFHYDG+T+EWDEFEWSKRAIHVSA KQ
Sbjct  137  KQKYLVTFTVGYDQKKNIDAAVKKFSQNFTILLFHYDGRTSEWDEFEWSKRAIHVSARKQ  196

Query  675  TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGV  854
            TKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLVKKHGLEISQPGLE  +G 
Sbjct  197  TKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVKKHGLEISQPGLEPNRG-  255

Query  855  WLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             LTW+MT+R+ + EVHKET+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  256  -LTWQMTKRRGDREVHKETEERPGWCSDPHLPPCAAFVEIMATVFS  300



>ref|XP_006357597.1| PREDICTED: uncharacterized protein LOC102579567 isoform X2 [Solanum 
tuberosum]
Length=376

 Score =   398 bits (1022),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 223/274 (81%), Gaps = 15/274 (5%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNN---VDDSSNLTEDQTVMDPT--  374
            ++L+++V  G+IFGL +G S P+  L KLN+T+S+V+N     D +N+  DQ   DP+  
Sbjct  1    MRLMLSVCCGIIFGLIVGISLPSSSLTKLNITSSIVSNFPIARDRNNVVSDQKPADPSIK  60

Query  375  --------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGY  530
                    KIWVPSNPRGAERLPP I+  ESD+Y RRLWG+PS+DL  KPKYL+T TVG 
Sbjct  61   IQNATDQLKIWVPSNPRGAERLPPGIVASESDYYPRRLWGKPSEDLQSKPKYLVTFTVGI  120

Query  531  KQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHP  710
            KQK NIDA VKKFSD+FTILLFHYDG+TTEWDEFEWSK+AIHVS  KQTKWWYAKRFLHP
Sbjct  121  KQKHNIDAAVKKFSDDFTILLFHYDGKTTEWDEFEWSKKAIHVSVRKQTKWWYAKRFLHP  180

Query  711  DIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKAN  890
            DIVA Y+YIFIWDEDLGVEHFDA+EYIKLVKKHGLEISQPGL+ ++G   TW+MT+R+ +
Sbjct  181  DIVAPYDYIFIWDEDLGVEHFDAKEYIKLVKKHGLEISQPGLDPRRGT--TWQMTKRRGD  238

Query  891  SEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             EVH  T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  239  REVHTTTEEKPGWCADPHLPPCAAFVEIMAPVFS  272



>ref|XP_006357623.1| PREDICTED: uncharacterized protein LOC102588935 [Solanum tuberosum]
Length=516

 Score =   403 bits (1035),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 227/290 (78%), Gaps = 15/290 (5%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLV--------  317
            MKNFG  S+  +  ET++L+ +V  GV+FG+F+G SF    L KLN+TAS+V        
Sbjct  113  MKNFGRSSSSLKSAETMRLIFSVACGVMFGVFLGISFSTSSLTKLNITASIVSNFPIARD  172

Query  318  -NNVDDSSNLTED----QTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
             NN+  S N T+     Q   +  KIWVPSNP+GAERLPP ++  ESD+YLRRLWG PS+
Sbjct  173  RNNIVSSQNHTDSSIKIQNATEQLKIWVPSNPKGAERLPPGLVASESDYYLRRLWGNPSE  232

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DL  KPK L+T TVG KQK NIDA VKKFS++FTILLFHYDG+TTEWDEFEWSKRAIHVS
Sbjct  233  DLPSKPKCLVTFTVGVKQKHNIDAAVKKFSNDFTILLFHYDGKTTEWDEFEWSKRAIHVS  292

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
            AHKQTKWWYAKRFLHPDIV+ Y+YIFIWDEDLGVEHFDA EYIKLVKKHGLEISQPGL+ 
Sbjct  293  AHKQTKWWYAKRFLHPDIVSPYDYIFIWDEDLGVEHFDANEYIKLVKKHGLEISQPGLDP  352

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            +KG   TW MT R+ N EVH  T+EK G C+DPHLPPCAAFVEIMAPVFS
Sbjct  353  RKGT--TWPMTIRRGNGEVHTLTEEKPGKCADPHLPPCAAFVEIMAPVFS  400



>ref|XP_002530039.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32339.1| conserved hypothetical protein [Ricinus communis]
Length=395

 Score =   399 bits (1024),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 191/293 (65%), Positives = 227/293 (77%), Gaps = 18/293 (6%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS--  335
            M  F      ++ NET++L+V   +GV FG  IG SFPAL L+KLN+++SL+ +VD S  
Sbjct  1    MGIFSRSMVSRKPNETMRLIVTTFLGVAFGFLIGISFPALSLSKLNISSSLLPSVDISYI  60

Query  336  --------------SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
                          ++ T      D +KIW P NPRGAERLPP II  ESD+YLRRLWG 
Sbjct  61   NEKTFGYTWSSRKNNSTTGAPNSNDTSKIWAPLNPRGAERLPPGIIEAESDYYLRRLWGN  120

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            P++DL  KPKYL+T TVGY Q+ NIDA VKKFS+NFT+LLFHYDG+ +EWDEFEWSKRAI
Sbjct  121  PNEDLISKPKYLVTFTVGYDQRKNIDANVKKFSENFTVLLFHYDGRVSEWDEFEWSKRAI  180

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVSA KQTKWWYAKRFLHPDI+A Y+YIFIWDEDLGVEHF+AEEY+K+VKKHGLEISQPG
Sbjct  181  HVSARKQTKWWYAKRFLHPDIIAPYDYIFIWDEDLGVEHFNAEEYLKIVKKHGLEISQPG  240

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE  KG  LTW+MT+R+ + EVHK T+EK GWC+DPHLPPCAAF+EIMAPVFS
Sbjct  241  LEPNKG--LTWQMTKRRGDREVHKITEEKPGWCTDPHLPPCAAFIEIMAPVFS  291



>ref|XP_009382917.1| PREDICTED: uncharacterized protein LOC103970734 [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   399 bits (1024),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 187/286 (65%), Positives = 229/286 (80%), Gaps = 21/286 (7%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVM--  365
            ++ NE+++++++  IG++ G  IG SFP + + KL+  +S+V+ ++D ++    QT++  
Sbjct  14   RKSNESMRIIISTVIGIVLGYLIGISFPTVSITKLHFPSSIVSYIEDRNSGLTTQTLLNH  73

Query  366  -----------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTM  494
                             D  KI+VP+NPRGAERLPP I+VPESDFYLRRLWG P +DL +
Sbjct  74   AWDSANRNRNNSTSNTDDTPKIYVPTNPRGAERLPPCIVVPESDFYLRRLWGNPDEDLIV  133

Query  495  KPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQ  674
            + KYL+T TVGY+QK+NIDA VKKFS+NFTILLFHYDG+TTEWDEFEWSKRAIHVSA KQ
Sbjct  134  QQKYLVTFTVGYEQKNNIDAAVKKFSENFTILLFHYDGRTTEWDEFEWSKRAIHVSARKQ  193

Query  675  TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGV  854
            TKWWYAKRFLHPDIVA YEYIFIWDEDLG+EHFDAEEYIKLVKKHGLEISQPGLE   G 
Sbjct  194  TKWWYAKRFLHPDIVARYEYIFIWDEDLGLEHFDAEEYIKLVKKHGLEISQPGLEPNNG-  252

Query  855  WLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             LTW+MT+R+ + EVHKET+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  253  -LTWQMTKRRGDHEVHKETEERPGWCADPHLPPCAAFVEIMATVFS  297



>ref|XP_010320937.1| PREDICTED: uncharacterized protein LOC101248010 [Solanum lycopersicum]
Length=404

 Score =   399 bits (1024),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 222/290 (77%), Gaps = 15/290 (5%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLV--------  317
            MKNFG  S+  +  ET++L+  V  GV+FG+F+G SF    L KLN+TAS+V        
Sbjct  1    MKNFGRSSSSLKSAETMRLIFCVACGVMFGVFVGISFSTSSLTKLNITASIVSNFPIARD  60

Query  318  -NNVDDSSNLTED----QTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
             NN+  S N T+     Q   +  KIWVPSNP+GAERLPP ++  ESD+YLRRLWG PS+
Sbjct  61   RNNIVSSQNHTDSSIKIQNATEQLKIWVPSNPKGAERLPPGLVASESDYYLRRLWGNPSE  120

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DL+ KPK L+T TVG KQK NID  VKKFSD+FTILLFHYDG+TTEWDEFEWSKRAIHVS
Sbjct  121  DLSSKPKCLVTFTVGVKQKHNIDVAVKKFSDDFTILLFHYDGKTTEWDEFEWSKRAIHVS  180

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
            A KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFDA EYIKLVKKHGLEISQPGL+ 
Sbjct  181  ARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDANEYIKLVKKHGLEISQPGLDP  240

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             KG   TW MT R+ N EVH   +EK G C DPHLPPCAAFVEIMAPVFS
Sbjct  241  IKGT--TWPMTIRRGNGEVHTLAEEKPGKCQDPHLPPCAAFVEIMAPVFS  288



>ref|XP_003525038.1| PREDICTED: uncharacterized protein LOC100785650 isoformX1 [Glycine 
max]
 ref|XP_006580249.1| PREDICTED: uncharacterized protein LOC100785650 isoform X2 [Glycine 
max]
 ref|XP_006580250.1| PREDICTED: uncharacterized protein LOC100785650 isoform X3 [Glycine 
max]
 gb|KHN06547.1| hypothetical protein glysoja_010891 [Glycine soja]
Length=397

 Score =   399 bits (1024),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 230/289 (80%), Gaps = 22/289 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------  329
            S  ++ +++++L++   +G++FG FIG SFPAL   KLN+ +SL+  +D           
Sbjct  8    STNRKPSDSMRLIMTTFVGIVFGFFIGVSFPAL-TTKLNLPSSLLPAIDISYIQEKYAGG  66

Query  330  --------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
                    ++S  ++ Q + D  KIWVPSNPRGAERLPP+II  E+D YLRRLWG+PS+D
Sbjct  67   NAPSFVKNNNSISSKHQLINDTLKIWVPSNPRGAERLPPEIIEAETDLYLRRLWGQPSED  126

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            LT KPKYL+T TVGY Q+ NIDA VKKFS+NFTI+LFHYDG+TTEW EFEWSKRAIHVS 
Sbjct  127  LTSKPKYLVTFTVGYSQRYNIDANVKKFSENFTIVLFHYDGKTTEWGEFEWSKRAIHVSV  186

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEY+KLVKKHGLEISQPGLE  
Sbjct  187  RKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYLKLVKKHGLEISQPGLEPN  246

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            KG  LTW+MT+R+ + EVHKET+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  247  KG--LTWQMTKRRGDREVHKETEEKPGWCSDPHLPPCAAFVEIMAPVFS  293



>ref|XP_010029096.1| PREDICTED: uncharacterized protein LOC104419210 isoform X2 [Eucalyptus 
grandis]
 gb|KCW55939.1| hypothetical protein EUGRSUZ_I01729 [Eucalyptus grandis]
Length=377

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 188/272 (69%), Positives = 223/272 (82%), Gaps = 8/272 (3%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNK--LNVTASLVNNVDDSSNLTEDQ  356
             N ++ NET++L+V   +GV+FG  +G SFP L L K  LN  +SL  N   +S++ E  
Sbjct  8    GNIRKPNETMRLLVTTFMGVVFGFLLGVSFPTLSLTKALLNAWSSLKGNGGSASSIVE--  65

Query  357  TVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQ  536
               + +KIWVP+NPRGAERLPP II  ESDFYLRRLWG PS+DL  KPKYL+T TVGY+Q
Sbjct  66   --FNSSKIWVPTNPRGAERLPPGIIAAESDFYLRRLWGLPSEDLMTKPKYLVTFTVGYEQ  123

Query  537  KDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDI  716
            + NIDA VKKFS +FTI+LFHYDG+TTEW+EFEWSK AIHVS  KQTKWWYAKRFLHP+I
Sbjct  124  RKNIDAAVKKFSKDFTIMLFHYDGRTTEWEEFEWSKTAIHVSVRKQTKWWYAKRFLHPNI  183

Query  717  VASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSE  896
            VA+Y+YIF+WDEDLGVEHFDAEEYIKL+KKHGLEISQPGLE   G  LTW+MT+R+ +SE
Sbjct  184  VAAYDYIFMWDEDLGVEHFDAEEYIKLIKKHGLEISQPGLEPNSG--LTWQMTKRRGDSE  241

Query  897  VHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            VHK T+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  242  VHKVTEERPGWCTDPHLPPCAAFVEIMAPVFS  273



>ref|XP_009370346.1| PREDICTED: uncharacterized protein LOC103959709 [Pyrus x bretschneideri]
Length=402

 Score =   397 bits (1021),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/293 (65%), Positives = 226/293 (77%), Gaps = 25/293 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS---------  335
             N +  NET++LVV + +GV+ G F+G SFP L L K+N+ ++L  ++D S         
Sbjct  8    GNLRNPNETMRLVVTIFVGVVIGFFVGVSFPTLSLTKMNLPSTLFPSIDLSYIEEKYSGF  67

Query  336  --------------SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
                          + +  ++ V   TKIWVP+NPRGAE LPP II  ESDFYLRRLWG 
Sbjct  68   STQALLNSWSSLKGNEVRTEKYVSQETKIWVPTNPRGAESLPPGIIASESDFYLRRLWGL  127

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            PS+DL +KPKYL+T TVGY QK N+DA VKKFS+NFTILLFHYDG T+EWDEFEWSKRAI
Sbjct  128  PSEDLLVKPKYLVTFTVGYAQKKNVDAAVKKFSENFTILLFHYDGLTSEWDEFEWSKRAI  187

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVS  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLG+EHF+AE+YIKLVKKHGLEISQPG
Sbjct  188  HVSIQKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGLEHFNAEKYIKLVKKHGLEISQPG  247

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE  +G  LTW+MT+R+ +SEVH +T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  248  LEPNRG--LTWQMTKRRGDSEVHMQTEEKPGWCNDPHLPPCAAFVEIMAPVFS  298



>ref|XP_002311761.1| hypothetical protein POPTR_0008s18970g [Populus trichocarpa]
 gb|EEE89128.1| hypothetical protein POPTR_0008s18970g [Populus trichocarpa]
Length=396

 Score =   397 bits (1020),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 224/294 (76%), Gaps = 19/294 (6%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M  F   + G++ NET+K+++   +GV FG  IG SFP L L KLN++ + + ++D    
Sbjct  1    MGIFSRSAAGRKPNETIKIILTTFLGVAFGFLIGVSFPTLSLTKLNISPNFIPSIDISYK  60

Query  330  -------------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
                         ++S   +   + + +KIWVPSNPRGAERLPP I+  ESD YLRRLWG
Sbjct  61   EGLTPQNTRSSKGNNSGSMQAPNLNNTSKIWVPSNPRGAERLPPRIVAAESDLYLRRLWG  120

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
             P++DLT  PKYL+T TVGY Q+ NIDA VKKFS+NFTILLFHYDG+  EWDEFEWS RA
Sbjct  121  NPNEDLTSTPKYLVTFTVGYDQRMNIDACVKKFSENFTILLFHYDGRIAEWDEFEWSTRA  180

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  +QTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEY+KLVKKHGLEISQP
Sbjct  181  IHVSVRRQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEEYLKLVKKHGLEISQP  240

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE  KG  LTW+MT+R+ + EVHK TDEK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  241  GLEPSKG--LTWQMTKRRDDREVHKITDEKPGWCTDPHLPPCAAFVEIMAPVFS  292



>gb|KEH20772.1| lysine ketoglutarate reductase trans-splicing protein [Medicago 
truncatula]
Length=397

 Score =   397 bits (1020),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/296 (65%), Positives = 229/296 (77%), Gaps = 22/296 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M      S  ++ NE+++LV+   +G++FG  IG S+P L   KL +++ L+ ++D    
Sbjct  1    MGTNTRSSTNRKPNESMRLVLTTFVGIVFGFLIGISYPTL-TTKLTISSRLLPSIDVSSI  59

Query  330  ---------------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRL  464
                           +SS+ ++ + + D  KIWVPSNPRGAERLPP II  ESDFYLRRL
Sbjct  60   EDEYESGNGRSFMKNNSSDSSKYKLLNDTLKIWVPSNPRGAERLPPAIIEAESDFYLRRL  119

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSK  644
            WGEPS+DLT KP+YL+T TVGY QK NIDA VKKFS +FTILLFHYDG+TTEWDEFEWSK
Sbjct  120  WGEPSEDLTSKPRYLVTFTVGYDQKRNIDAAVKKFSGDFTILLFHYDGRTTEWDEFEWSK  179

Query  645  RAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEIS  824
            +AIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEY++LV+KHGLEIS
Sbjct  180  QAIHVSVRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYLRLVRKHGLEIS  239

Query  825  QPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            QPGLE   G  LTW+MT+R+ + EVHKET+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  240  QPGLEPNNG--LTWQMTKRRGDREVHKETEEKPGWCSDPHLPPCAAFVEIMAPVFS  293



>ref|XP_009419384.1| PREDICTED: uncharacterized protein LOC103999363 [Musa acuminata 
subsp. malaccensis]
Length=402

 Score =   396 bits (1018),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 187/293 (64%), Positives = 226/293 (77%), Gaps = 22/293 (8%)
 Frame = +3

Query  174  GHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTED  353
            G  +  ++ NE ++L+++  IG++ G  IG SFP + + KL+  +S+++ ++D ++    
Sbjct  8    GRSALPRKSNENMRLIISTVIGIVLGYLIGISFPTVSITKLHFPSSIISYIEDRNSGITT  67

Query  354  QTVM--------------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
            QT++                    D  KI+VP+NPRGAERLPP IIVPESDFYLRRLWG 
Sbjct  68   QTLLNHAWTSANNQNRNNATSNTTDTLKIYVPTNPRGAERLPPGIIVPESDFYLRRLWGN  127

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            P +DL  + KYL+T TVGY QK NIDA VKKFS+NF ILLFHYDG+T+EWDEFEWSKRAI
Sbjct  128  PDEDLITRQKYLVTFTVGYDQKKNIDAAVKKFSENFAILLFHYDGRTSEWDEFEWSKRAI  187

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVS  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLGV+HFDAEEYI+LVKKHGLEISQPG
Sbjct  188  HVSTRKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGVQHFDAEEYIRLVKKHGLEISQPG  247

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE  KG  LTW+MT+R+ + EVHKET+EK GWC+DPHLPPCAAFVEIMA VFS
Sbjct  248  LEPDKG--LTWQMTKRRGDREVHKETEEKPGWCADPHLPPCAAFVEIMATVFS  298



>ref|XP_010689522.1| PREDICTED: uncharacterized protein LOC104903222 [Beta vulgaris 
subsp. vulgaris]
Length=378

 Score =   395 bits (1016),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 226/274 (82%), Gaps = 10/274 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-------DSSNLTE  350
            KR N++ +LV+   +G++FG FIG SFP++  +K+ +++ L+++ D        S+   E
Sbjct  11   KRSNDSARLVMTTIMGIVFGFFIGVSFPSVS-DKIKLSSRLISSFDGNLAGGKSSAKSLE  69

Query  351  DQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGY  530
            D   +   KI+VPSNPRGAE LPP I+VPESDFYLRRLWGEPS+DL  KPKYL+TLTVG+
Sbjct  70   DLGSVTIPKIYVPSNPRGAEMLPPGIVVPESDFYLRRLWGEPSEDLKKKPKYLVTLTVGF  129

Query  531  KQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHP  710
             QKDN++A +KKFSD+F ILLFHYDG+ TEWD+FEWSKRAIHVSA KQTKWWYAKRFLHP
Sbjct  130  DQKDNVNAAIKKFSDDFQILLFHYDGRVTEWDQFEWSKRAIHVSARKQTKWWYAKRFLHP  189

Query  711  DIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKAN  890
            D+VA+Y+YIFIWDEDLGVEHF+AE YI+LVKK+GLEISQPGLE   G  LTWEMT+R+ +
Sbjct  190  DVVAAYDYIFIWDEDLGVEHFNAERYIQLVKKYGLEISQPGLEPNNG--LTWEMTKRRGD  247

Query  891  SEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             EVHKET EK GWCS+PHLPPCAAFVEIMAPVFS
Sbjct  248  REVHKETKEKPGWCSNPHLPPCAAFVEIMAPVFS  281



>ref|XP_003538598.1| PREDICTED: uncharacterized protein LOC100778486 [Glycine max]
Length=399

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/290 (65%), Positives = 224/290 (77%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------  329
            S G++ +E ++  V   I ++ G FIG S P L + KLN+ + L+ ++D           
Sbjct  8    SAGRKPSEIMRFFVTTFISIVLGFFIGVSVPTLSITKLNLPSGLLPSIDLSYIEDRYTGR  67

Query  330  ---------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
                     +  + ++ Q   D +KIWVPSNPRGAERLPP I+  ESD+YLRRLWG+PS+
Sbjct  68   QAWSFMNNGNKRSSSQVQLSNDTSKIWVPSNPRGAERLPPGIVEAESDYYLRRLWGKPSE  127

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT +P YL+T TVGY QK+NIDA VKKFS NFTILLFHYDG+TTEWDEFEWSK+AIHVS
Sbjct  128  DLTSRPNYLVTFTVGYDQKNNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQAIHVS  187

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
             HKQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLV+KHGLEISQPGLE 
Sbjct  188  VHKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVRKHGLEISQPGLEP  247

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +G  LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  NRG--LTWQMTKRRGDQEVHKVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  295



>ref|XP_011034057.1| PREDICTED: uncharacterized protein LOC105132327 [Populus euphratica]
Length=396

 Score =   394 bits (1013),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/285 (66%), Positives = 222/285 (78%), Gaps = 19/285 (7%)
 Frame = +3

Query  189  GKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-------------  329
            G++ NET+K+++   +GV FG  IG SFP L L KLN++ + ++++D             
Sbjct  10   GRKPNETIKIILTTFLGVAFGFLIGVSFPTLSLTKLNISPNFIHSIDISYKEGLTPQNSR  69

Query  330  ----DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                ++S+  +   + + +KIWVPSNPRGAERLPP I+  ESD YLRRLWG P++DLT  
Sbjct  70   SSKGNNSSSMQAPNLNNKSKIWVPSNPRGAERLPPRIVAVESDLYLRRLWGNPNEDLTSA  129

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            PKYL+T TVGY Q+ NIDA VKKFS+NFTILLFHYDG+  EWDEFEWSKRAIHVS  +QT
Sbjct  130  PKYLVTFTVGYDQRMNIDACVKKFSENFTILLFHYDGRIAEWDEFEWSKRAIHVSVRRQT  189

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIF WDEDLGVEHF+AEEYIKLVKKHGLEISQPGLE  KG  
Sbjct  190  KWWYAKRFLHPDIVAPYDYIFNWDEDLGVEHFNAEEYIKLVKKHGLEISQPGLEPSKG--  247

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHK TDEK GWC DPHLPPCAAFVEIMAPVFS
Sbjct  248  LTWQMTKRRDDREVHKITDEKPGWCKDPHLPPCAAFVEIMAPVFS  292



>ref|XP_010557340.1| PREDICTED: uncharacterized protein LOC104826374 [Tarenaya hassleriana]
Length=378

 Score =   394 bits (1012),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 185/282 (66%), Positives = 226/282 (80%), Gaps = 12/282 (4%)
 Frame = +3

Query  177  HCSNG-KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------  329
            H S G +R NE+ KL++   +G++ G FIG +FP+L L K+N+ + L++++D        
Sbjct  2    HRSGGPRRTNESAKLIITTIVGMVVGFFIGITFPSLSLTKINLPSGLISSLDVAISDGRL  61

Query  330  -DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKY  506
              S    ED    +  KI+VP+NPRGAE LPP I+V E+DFYLRRLWGEPS+DL  KPKY
Sbjct  62   FSSGKSPEDFGSREFPKIYVPTNPRGAELLPPGIVVAETDFYLRRLWGEPSEDLKKKPKY  121

Query  507  LLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWW  686
            L+  TVG++Q++N+DA VKKFSD+F ILLFHYDG+TTEWD+ EWSK AIH+SA +QTKWW
Sbjct  122  LVAFTVGFEQRNNVDAAVKKFSDDFQILLFHYDGRTTEWDQLEWSKNAIHISARRQTKWW  181

Query  687  YAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTW  866
            YAKRFLHPDIV++YEYIFIWDEDLGVEHF+AE+YI+LVKKHGLEISQPGLE   G  LTW
Sbjct  182  YAKRFLHPDIVSAYEYIFIWDEDLGVEHFNAEKYIELVKKHGLEISQPGLEPNNG--LTW  239

Query  867  EMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            EMT+R+ + EVHKET EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  240  EMTKRRGDREVHKETKEKPGWCSDPHLPPCAAFVEIMAPVFS  281



>ref|XP_004239135.1| PREDICTED: uncharacterized protein LOC101244185 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010320938.1| PREDICTED: uncharacterized protein LOC101244185 isoform X1 [Solanum 
lycopersicum]
Length=392

 Score =   394 bits (1013),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 235/290 (81%), Gaps = 15/290 (5%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNN---VDD  332
            M++FG  SN  +  ET++L+++V  G+IFGL IG SFP+  L KLN+T+S+++N     D
Sbjct  1    MRSFGRGSNSLKSTETMRLMLSVCCGIIFGLIIGISFPSSSLTKLNITSSIISNFPIARD  60

Query  333  SSNLTEDQTVMDPT----------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
             +N+  D+   DP+          KIWVPSNPRGAERLPP I+  ESD+Y RRLWG+PS+
Sbjct  61   RNNVVSDEKPADPSIKTQNATDQLKIWVPSNPRGAERLPPGIVASESDYYPRRLWGKPSE  120

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DL  KPKYL+T TVG KQK NIDA VKKFSD+FTILLFHYDG+TTEWDEFEWSK+AIHVS
Sbjct  121  DLQSKPKYLVTFTVGIKQKRNIDAAVKKFSDDFTILLFHYDGKTTEWDEFEWSKKAIHVS  180

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFDA+EYIKLVKKHGLEISQPGL+ 
Sbjct  181  VRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDAKEYIKLVKKHGLEISQPGLDP  240

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            ++G   TW+MT+R+ + EVH +T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  241  RRGT--TWQMTKRRGDREVHMKTEEKPGWCADPHLPPCAAFVEIMAPVFS  288



>ref|XP_009371751.1| PREDICTED: uncharacterized protein LOC103960971 [Pyrus x bretschneideri]
 ref|XP_009371752.1| PREDICTED: uncharacterized protein LOC103960971 [Pyrus x bretschneideri]
Length=402

 Score =   394 bits (1013),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 224/293 (76%), Gaps = 25/293 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS---------  335
             N +  NET++LVV + +GV+ G F+G SFP L L K+N+ ++L  ++D S         
Sbjct  8    GNLRNPNETMRLVVTIFVGVVIGFFVGVSFPTLSLTKMNLPSTLFPSIDLSYIEEKYSGF  67

Query  336  --------------SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
                          + +  ++ V    KIWVP+NPRGAE LPP I+  ESDFYLRRLWG 
Sbjct  68   STQALLNAWSSLKGNEVRTEKYVSQEAKIWVPTNPRGAESLPPGIVASESDFYLRRLWGL  127

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            PS+DL +KPKYL+T TVGY QK N+DA VKKFS+NFTILLFHYDG T+EWDEFEWSKRAI
Sbjct  128  PSEDLLVKPKYLVTFTVGYAQKKNVDAAVKKFSENFTILLFHYDGLTSEWDEFEWSKRAI  187

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVS  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLG+EHF+AE+YIKLVKKHGLEISQPG
Sbjct  188  HVSIQKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGLEHFNAEKYIKLVKKHGLEISQPG  247

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE   G  LTW+MT+R+ +SEVH +T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  248  LEPNSG--LTWQMTKRRGDSEVHMQTEEKPGWCNDPHLPPCAAFVEIMAPVFS  298



>ref|XP_009617481.1| PREDICTED: uncharacterized protein LOC104109818 [Nicotiana tomentosiformis]
Length=387

 Score =   393 bits (1010),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 228/281 (81%), Gaps = 17/281 (6%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------  335
            KR N++ +LV+   +G++FG F+G SFP++ L K+N+ +SL++ +D +            
Sbjct  11   KRSNDSARLVITTIMGMVFGYFVGISFPSVSLTKINLPSSLMSTLDYAFNDDRTRNTERS  70

Query  336  --SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
               NL    T + P KI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+DLT KPKYL
Sbjct  71   FPENLGSGSTPLTP-KIYVPTNPRGAESLPPGIVVSESDFYLRRLWGEPSEDLTKKPKYL  129

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG  QK+NIDA VKKFS++F ILLFHYDG+T+EWD+FEWSKRA+H+S  KQTKWWY
Sbjct  130  VTFTVGLDQKNNIDAAVKKFSEDFQILLFHYDGRTSEWDQFEWSKRAVHISVRKQTKWWY  189

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPD+VA+Y+YIFIWDEDLGVEHF+AE+YI+LVKKHGL+ISQPGLE   G  LTW+
Sbjct  190  AKRFLHPDVVAAYDYIFIWDEDLGVEHFNAEKYIQLVKKHGLDISQPGLEPNNG--LTWQ  247

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  MTKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  288



>ref|XP_006340181.1| PREDICTED: uncharacterized protein LOC102584998 [Solanum tuberosum]
Length=387

 Score =   393 bits (1010),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 185/281 (66%), Positives = 227/281 (81%), Gaps = 17/281 (6%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------  335
            KR N++ +LV+   +G++FG F+G SFP++ L K+N+ +SL++ +D +            
Sbjct  11   KRSNDSTRLVITTIMGMVFGYFVGISFPSVSLTKINLPSSLISTLDYAFNDDHRRAIERT  70

Query  336  --SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
               NL    T + P KI+VPSNPRGAE LPP I+V ESDFYLRRLWGEPS+DLT KPKYL
Sbjct  71   FPENLGSGSTPLTP-KIYVPSNPRGAESLPPGIVVSESDFYLRRLWGEPSEDLTKKPKYL  129

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG  QK NIDA VKKFS++F ILLFHYDG+TTEWD+FEWSKRA+H+S  KQTKWWY
Sbjct  130  VTFTVGLDQKYNIDAAVKKFSEDFQILLFHYDGRTTEWDQFEWSKRAVHISVKKQTKWWY  189

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPD+VA+Y+YIFIWDEDLGVEHF+AE+Y++LVKKHGL+ISQPGLE   G  LTW+
Sbjct  190  AKRFLHPDVVAAYDYIFIWDEDLGVEHFNAEKYMQLVKKHGLDISQPGLEPNNG--LTWQ  247

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  MTKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  288



>emb|CDP13233.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   393 bits (1009),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 222/285 (78%), Gaps = 26/285 (9%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLV---------------NNVDDS---  335
            +K+ VAV IG +FG  +GFSFP+L L KLN+T+SL+                N+ D+   
Sbjct  1    MKIFVAVFIGSLFGFLVGFSFPSLSLTKLNITSSLICDFSKVGHKFSSNSSRNIRDALPS  60

Query  336  -----SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKP  500
                 +N  +   + D  KIWVPSNPRGAERLPP II  ESDF+ RRLWG+PS+DLT KP
Sbjct  61   LIGSRNNSLQSPNMTDLLKIWVPSNPRGAERLPPRIIANESDFFPRRLWGKPSEDLTHKP  120

Query  501  KYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTK  680
            KYL+T TVG  QK+NI+A VKKFS+NFTILLFHYDG+T+EWDEFEWSKRAIHVS HKQTK
Sbjct  121  KYLVTFTVGLNQKNNINAAVKKFSENFTILLFHYDGKTSEWDEFEWSKRAIHVSVHKQTK  180

Query  681  WWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGL-ERKKGVW  857
            WWYAKRFLHP IVA Y+YIFIWDEDLGVEHFDAE+YIKLVKKHGLEISQPGL    KG  
Sbjct  181  WWYAKRFLHPSIVAPYDYIFIWDEDLGVEHFDAEQYIKLVKKHGLEISQPGLGPSNKG--  238

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHKET EK GWCSDPH PPCAAFVEIMAPVFS
Sbjct  239  LTWQMTKRRGDEEVHKETTEKPGWCSDPHRPPCAAFVEIMAPVFS  283



>ref|XP_011101803.1| PREDICTED: uncharacterized protein LOC105179859 isoform X3 [Sesamum 
indicum]
Length=404

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/305 (61%), Positives = 235/305 (77%), Gaps = 24/305 (8%)
 Frame = +3

Query  135  LSSGNRVCTMKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASL  314
            + +  R  T+ N  H    +R NET++L++   +G+IFG  +G SFP L L+K+NV++++
Sbjct  1    MGTPMRRSTVPNSWHV---RRTNETMRLIITTFVGIIFGFLLGVSFPKLSLSKVNVSSNI  57

Query  315  VNNVD-----DSSNLTEDQTVMD--------------PTKIWVPSNPRGAERLPPDIIVP  437
             +++D     D  +    Q +++               T+IWVP+NPRGAERLPP IIVP
Sbjct  58   FSSIDLTYVEDKHSGLSTQALLNIWSHLRGRRARKSNDTEIWVPTNPRGAERLPPGIIVP  117

Query  438  ESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTT  617
            E+DFY RRLWG P +DL +KP+YL T TVGY+QK+NIDA VKK ++NFTILLFHYDG+T+
Sbjct  118  ETDFYTRRLWGLPGEDLIIKPRYLFTFTVGYEQKNNIDAAVKKLTENFTILLFHYDGRTS  177

Query  618  EWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKL  797
            EWDEFEWSKRAIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVE+FD EEYIKL
Sbjct  178  EWDEFEWSKRAIHVSVRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVENFDPEEYIKL  237

Query  798  VKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIM  977
            VKKHGLEISQPGL    G  +TW+MT+R+ ++EVHK+T+E+ GWC+DPHLPPCAAFVEIM
Sbjct  238  VKKHGLEISQPGLSPDSG--MTWQMTKRREDTEVHKDTEERPGWCTDPHLPPCAAFVEIM  295

Query  978  APVFS  992
            APVFS
Sbjct  296  APVFS  300



>ref|XP_004251145.1| PREDICTED: uncharacterized protein LOC101261883 [Solanum lycopersicum]
Length=387

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/281 (66%), Positives = 226/281 (80%), Gaps = 17/281 (6%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------  335
            KR N++  LV+   +G++FG F+G SFP++ L K+N+ +SL++ +D +            
Sbjct  11   KRSNDSTTLVITTIMGMVFGYFVGISFPSVSLTKINLPSSLISTLDYAFNDEHRRAIERT  70

Query  336  --SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
               NL    T + P KI+VPSNPRGAE LPP I+V ESDFYLRRLWGEPS+DLT KPKYL
Sbjct  71   FPENLGSGSTPLTP-KIYVPSNPRGAESLPPGIVVSESDFYLRRLWGEPSEDLTKKPKYL  129

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG  QK NIDA VKKFS++F ILLFHYDG+TTEWD+FEWSKRA+H+S  KQTKWWY
Sbjct  130  VTFTVGLDQKYNIDAAVKKFSEDFQILLFHYDGRTTEWDQFEWSKRAVHISVKKQTKWWY  189

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPD+VA+Y+YIFIWDEDLGVEHF+AE+Y++LVKKHGL+ISQPGLE   G  LTW+
Sbjct  190  AKRFLHPDVVAAYDYIFIWDEDLGVEHFNAEKYMQLVKKHGLDISQPGLEPNNG--LTWQ  247

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  MTKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  288



>gb|KDP26690.1| hypothetical protein JCGZ_17848 [Jatropha curcas]
Length=383

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/281 (67%), Positives = 222/281 (79%), Gaps = 22/281 (8%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------------  335
            ++L+V   +GV+FG  IG SFP L L+KLN+++SL+ + D S                  
Sbjct  1    MRLIVTTFLGVVFGFLIGVSFPTLSLSKLNISSSLLPSADLSYVDDKKLGFSTNSWSSRK  60

Query  336  --SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
               +  + Q + D +KIW PSNPRGAERLPP II  ESDFYLRRLWG+PS+DLT  P+YL
Sbjct  61   YNDSTKQRQNLNDTSKIWAPSNPRGAERLPPGIIEAESDFYLRRLWGKPSEDLTSTPRYL  120

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVGY Q+ NIDA VKKFS+NFTILLFHYDG+ +EWDEFEWSKRAIHVSA KQTKWWY
Sbjct  121  VTFTVGYDQRKNIDANVKKFSENFTILLFHYDGRVSEWDEFEWSKRAIHVSARKQTKWWY  180

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPDIVA+Y+YIFIWDEDLGVEHF+AEEY++LVKKHGLEISQPGLE  KG  LTW+
Sbjct  181  AKRFLHPDIVAAYDYIFIWDEDLGVEHFNAEEYLRLVKKHGLEISQPGLEPNKG--LTWQ  238

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + EVHK T+EK GWC+DP+LPPCAAFVEIMA VFS
Sbjct  239  MTKRRGDREVHKITEEKPGWCTDPYLPPCAAFVEIMATVFS  279



>gb|KDO82211.1| hypothetical protein CISIN_1g013577mg [Citrus sinensis]
Length=440

 Score =   394 bits (1012),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 197/325 (61%), Positives = 231/325 (71%), Gaps = 50/325 (15%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNV----D  329
            M      S  ++ NE+++L+V   +GV+FG FIG SFP L L KL + +SL+  V    D
Sbjct  14   MGTAARSSINRKTNESMRLIVTTFVGVVFGFFIGVSFPTLSLTKLTLPSSLLPTVEYVED  73

Query  330  DSSNL-------------------TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFY  452
              S L                   T  Q + D +KIWVP+NPRGAERLPP I+  ESDFY
Sbjct  74   QRSGLSTQRFLNVFNPLNRNNGSSTRAQVLNDTSKIWVPTNPRGAERLPPKIVRAESDFY  133

Query  453  LRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKK----------------------  566
            LRRLWG P++DLT +PKYL+T TVGY QK+NI+A +KK                      
Sbjct  134  LRRLWGNPNEDLTSQPKYLVTFTVGYDQKNNINAAIKKVGFCFPPTIFFLCVHLCVTNIC  193

Query  567  ---FSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYI  737
               FSDNFTI+LFHYDG+TTEW+EFEWSKRAIHVS  KQTKWWYAKRFLHPDIVASY+YI
Sbjct  194  SKQFSDNFTIVLFHYDGRTTEWNEFEWSKRAIHVSVRKQTKWWYAKRFLHPDIVASYDYI  253

Query  738  FIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDE  917
            FIWDEDLGVEHF+AEEYIKLV+KHGLEISQPGLE  KG  LTW+MT+R+ + EVHKET+E
Sbjct  254  FIWDEDLGVEHFNAEEYIKLVRKHGLEISQPGLEPNKG--LTWQMTKRRGDREVHKETEE  311

Query  918  KQGWCSDPHLPPCAAFVEIMAPVFS  992
            K GWCS+PHLPPCAAFVEIMAPVFS
Sbjct  312  KPGWCSNPHLPPCAAFVEIMAPVFS  336



>ref|XP_002314593.1| hypothetical protein POPTR_0010s05730g [Populus trichocarpa]
 gb|EEF00764.1| hypothetical protein POPTR_0010s05730g [Populus trichocarpa]
Length=401

 Score =   392 bits (1008),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 222/292 (76%), Gaps = 24/292 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--DSSNLTEDQ  356
            +  ++ NET+++++    GV+FG  IG SFP L L K N ++     +D   S N    +
Sbjct  8    AGSRKPNETMRILLTTFFGVVFGFLIGVSFPTLSLTKSNKSSGFFPVIDLAYSENKPGSK  67

Query  357  TVMDP--------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEP  476
            TV+ P                    +KIWVPSNPRGAERLPP  +V ESD+YLRRLWG+P
Sbjct  68   TVLSPWSSMKGNNSSSMQAPNSKDKSKIWVPSNPRGAERLPPGFVVAESDYYLRRLWGDP  127

Query  477  SQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIH  656
             +DLT  P+YL+T TVGY Q+ NIDA VKKFS+NFTILLFHYDG+ +EWDEFEWSK AIH
Sbjct  128  KEDLTRAPRYLVTFTVGYDQRKNIDACVKKFSENFTILLFHYDGRVSEWDEFEWSKSAIH  187

Query  657  VSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGL  836
            VSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLVKKHGLEISQPGL
Sbjct  188  VSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVKKHGLEISQPGL  247

Query  837  ERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            E  KG  LTW+MT+R+ +SEVHK TDEK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  248  EPNKG--LTWQMTKRRGDSEVHKITDEKPGWCTDPHLPPCAAFVEIMAPVFS  297



>ref|XP_011101800.1| PREDICTED: uncharacterized protein LOC105179859 isoform X1 [Sesamum 
indicum]
Length=403

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/286 (64%), Positives = 228/286 (80%), Gaps = 21/286 (7%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSSNLTEDQ  356
            +R NET++L++   +G+IFG  +G SFP L L+K+NV++++ +++D     D  +    Q
Sbjct  16   RRTNETMRLIITTFVGIIFGFLLGVSFPKLSLSKVNVSSNIFSSIDLTYVEDKHSGLSTQ  75

Query  357  TVMD--------------PTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTM  494
             +++               T+IWVP+NPRGAERLPP IIVPE+DFY RRLWG P +DL +
Sbjct  76   ALLNIWSHLRGRRARKSNDTEIWVPTNPRGAERLPPGIIVPETDFYTRRLWGLPGEDLII  135

Query  495  KPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQ  674
            KP+YL T TVGY+QK+NIDA VKK ++NFTILLFHYDG+T+EWDEFEWSKRAIHVS  KQ
Sbjct  136  KPRYLFTFTVGYEQKNNIDAAVKKLTENFTILLFHYDGRTSEWDEFEWSKRAIHVSVRKQ  195

Query  675  TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGV  854
            TKWWYAKRFLHPDIVA Y+YIFIWDEDLGVE+FD EEYIKLVKKHGLEISQPGL    G 
Sbjct  196  TKWWYAKRFLHPDIVAPYDYIFIWDEDLGVENFDPEEYIKLVKKHGLEISQPGLSPDSG-  254

Query  855  WLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +TW+MT+R+ ++EVHK+T+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  255  -MTWQMTKRREDTEVHKDTEERPGWCTDPHLPPCAAFVEIMAPVFS  299



>ref|XP_006852374.1| hypothetical protein AMTR_s00049p00225510 [Amborella trichopoda]
 gb|ERN13841.1| hypothetical protein AMTR_s00049p00225510 [Amborella trichopoda]
Length=403

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 184/290 (63%), Positives = 228/290 (79%), Gaps = 25/290 (9%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------  335
            ++ NET++L++    GV+FG  IGFSFP+  L K N    L+++VD S            
Sbjct  11   RKPNETMRLIITTVFGVVFGFLIGFSFPSSSLTKFNFPTGLLSSVDLSFIEDKDSGIATQ  70

Query  336  ---------SNLTEDQTVMD--PTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
                      N+ + +++ +   TKI++P+NPRGAE LPP II  ESD+YLRRLWG+PS+
Sbjct  71   ALLNHAWTTRNMNKSRSMQNHNSTKIYIPTNPRGAETLPPGIIASESDYYLRRLWGKPSE  130

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT+K KYL+T TVGY QK NI+A VKKFS+NFTILLFHYDG+T+EWDEFEWS+RAIHVS
Sbjct  131  DLTVKQKYLVTFTVGYDQKSNIEAAVKKFSENFTILLFHYDGRTSEWDEFEWSRRAIHVS  190

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
            A +QTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE+YI+L++KHGLEISQPGL+ 
Sbjct  191  ARRQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEKYIELIRKHGLEISQPGLDP  250

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +G  LTW+MT+R+ NSEVH ET+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  251  NRG--LTWQMTKRRGNSEVHTETEERPGWCSDPHLPPCAAFVEIMAPVFS  298



>gb|ACF86430.1| unknown [Zea mays]
Length=379

 Score =   391 bits (1004),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/290 (63%), Positives = 225/290 (78%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S+ +R NE ++++ +  IGV+ G   G SFP + + KL+  +S+++ ++D ++    QT+
Sbjct  10   SSAQRSNEGMRIIFSAVIGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITTQTL  69

Query  363  MDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+VP+NP+GAERLPP I+V E+D YLRRLWGEPS+
Sbjct  70   LNHAWTSAATHKKNNSASNSDEIPKIYVPTNPKGAERLPPGIVVSETDLYLRRLWGEPSE  129

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT KP+YL+T TVGY QK NIDA VKKFSDNFTI+LFHYDG+TTEWDEFEWSKRA+HVS
Sbjct  130  DLTTKPRYLVTFTVGYSQKANIDAAVKKFSDNFTIMLFHYDGRTTEWDEFEWSKRAVHVS  189

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE YIKLV+KHGLEISQPGLE 
Sbjct  190  VTKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEAYIKLVRKHGLEISQPGLEP  249

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             KG  LTW+MT+R+ + EVHK T+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  250  DKG--LTWQMTKRRGDQEVHKVTEERPGWCSDPHLPPCAAFVEIMATVFS  297



>ref|XP_009784116.1| PREDICTED: uncharacterized protein LOC104232580 [Nicotiana sylvestris]
Length=385

 Score =   391 bits (1004),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/281 (65%), Positives = 228/281 (81%), Gaps = 17/281 (6%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------  335
            KR N++ +LV+   +G++FG F+G SFP++ L K+N+ +SL++ +D +            
Sbjct  11   KRSNDSARLVITTIMGMVFGYFVGISFPSVSLTKINLPSSLMSTLDYAFNDDHTRNTERS  70

Query  336  --SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
               NL    T + P KI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+DLT KPKYL
Sbjct  71   FPENLGSGSTPLTP-KIYVPTNPRGAESLPPGIVVSESDFYLRRLWGEPSEDLTKKPKYL  129

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG  QK+NIDA VKKFS++F ILLFHYDG+T+EWD+FEWSKRA+H+S  KQTKWWY
Sbjct  130  VTFTVGLDQKNNIDAAVKKFSEDFQILLFHYDGRTSEWDQFEWSKRAVHISVRKQTKWWY  189

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFL+PD+VA+Y+YIFIWDEDLGVEHF+AE+YI+LVKKHGL+ISQPGLE   G  LTW+
Sbjct  190  AKRFLNPDVVAAYDYIFIWDEDLGVEHFNAEKYIQLVKKHGLDISQPGLEPNNG--LTWQ  247

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  MTKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  288



>ref|XP_004304668.1| PREDICTED: uncharacterized protein LOC101309467 [Fragaria vesca 
subsp. vesca]
Length=404

 Score =   392 bits (1006),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 226/293 (77%), Gaps = 25/293 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS---------  335
             N ++  E +K V    + ++FG FIG SFP + L K+N+ +SL  ++D S         
Sbjct  8    GNIRKPKEKMKFVATALVSIVFGFFIGVSFPTISLTKMNLPSSLFPSIDLSYIEEKYSGF  67

Query  336  ---------SNLTEDQ-----TVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
                     S+L E++      + +  KIWVP+NP GAERLPP I+  ESDFYLRRLWG 
Sbjct  68   STQALVDAWSSLKENKHASVKYIPNDAKIWVPTNPPGAERLPPGIVESESDFYLRRLWGL  127

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            PS+DLT+KPKYL+T TVGY QK NI+A VKKFS+NFTI+LFHYDG+T+EWDEFEWSKRAI
Sbjct  128  PSEDLTIKPKYLVTFTVGYAQKKNINAAVKKFSENFTIVLFHYDGRTSEWDEFEWSKRAI  187

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVS  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHF+AEEYIKLV+KHGLEISQPG
Sbjct  188  HVSIQKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFNAEEYIKLVRKHGLEISQPG  247

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE   G  LTW+MT+R+ +S+VH +T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  248  LEPNNG--LTWQMTKRRGDSQVHMQTEEKPGWCNDPHLPPCAAFVEIMAPVFS  298



>ref|XP_004142781.1| PREDICTED: uncharacterized protein LOC101219968 [Cucumis sativus]
 ref|XP_004156693.1| PREDICTED: uncharacterized LOC101219968 [Cucumis sativus]
Length=402

 Score =   391 bits (1005),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 232/300 (77%), Gaps = 25/300 (8%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS--  335
            M N     N ++ NE ++++V   +G +FG F+G SFP L L++LN  +SL+ ++D +  
Sbjct  1    MVNPIRGGNMRKPNEIMRILVTTFVGGVFGFFLGVSFPTLSLSQLNFPSSLIPSIDLTYI  60

Query  336  ----SNLTED-----------------QTVMDPTKIWVPSNPRGAERLPPDIIVPESDFY  452
                S L+ +                 Q  ++ TKIWVP+NPRGAERLPP I+ PESDF 
Sbjct  61   EDKYSGLSTEAFLNAWSSLKGNRGISSQFSLNETKIWVPTNPRGAERLPPGIVEPESDFN  120

Query  453  LRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEF  632
            LRRLWG PS+DL +KPKYL+T TVG+ QK NIDA VKKFS+NFTILLFHYDG+ +EW++ 
Sbjct  121  LRRLWGMPSEDLAIKPKYLVTFTVGFDQKKNIDAAVKKFSENFTILLFHYDGRASEWEDL  180

Query  633  EWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHG  812
            EWSKRAIHVS +KQTKWWYAKRFLHPDIVASY+YIF+WDEDLGVEHF+AEEYIKLV+KHG
Sbjct  181  EWSKRAIHVSVYKQTKWWYAKRFLHPDIVASYDYIFVWDEDLGVEHFNAEEYIKLVRKHG  240

Query  813  LEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LEISQPGLE  +G  LTW+MT+R+ +SEVHKET+EK GWC+DPHLPPCAAFVEIMA VFS
Sbjct  241  LEISQPGLEPNQG--LTWQMTKRRGDSEVHKETEEKPGWCTDPHLPPCAAFVEIMATVFS  298



>gb|KCW55940.1| hypothetical protein EUGRSUZ_I01729 [Eucalyptus grandis]
Length=380

 Score =   390 bits (1003),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 226/294 (77%), Gaps = 26/294 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSSNLT  347
             N ++ NET++L+V   +GV+FG  +G SFP L L KLN+ ++L  ++D     D  +  
Sbjct  8    GNIRKPNETMRLLVTTFMGVVFGFLLGVSFPTLSLTKLNLPSALFPSIDFAYIEDKYSGL  67

Query  348  EDQTVMDP-------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
              Q +++                    +KIWVP+NPRGAERLPP II  ESDFYLRRLWG
Sbjct  68   STQALLNAWSSLKGNGGSASSIVEFNSSKIWVPTNPRGAERLPPGIIAAESDFYLRRLWG  127

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
             PS+DL  KPKYL+T TVGY+Q+ NIDA VKKFS +FTI+LFHYDG+TTEW+EFEWSK A
Sbjct  128  LPSEDLMTKPKYLVTFTVGYEQRKNIDAAVKKFSKDFTIMLFHYDGRTTEWEEFEWSKTA  187

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHP+IVA+Y+YIF+WDEDLGVEHFDAEEYIKL+KKHGLEISQP
Sbjct  188  IHVSVRKQTKWWYAKRFLHPNIVAAYDYIFMWDEDLGVEHFDAEEYIKLIKKHGLEISQP  247

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE   G  LTW+MT+R+ +SEVHK T+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  248  GLEPNSG--LTWQMTKRRGDSEVHKVTEERPGWCTDPHLPPCAAFVEIMAPVFS  299



>ref|XP_008360119.1| PREDICTED: uncharacterized protein LOC103423810 isoform X2 [Malus 
domestica]
Length=387

 Score =   391 bits (1004),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 185/285 (65%), Positives = 223/285 (78%), Gaps = 26/285 (9%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------------  335
            ++L+V   +G+ FG  IG SFP L L KLN+++SL+  VD S                  
Sbjct  1    MRLIVTTFVGLAFGFLIGVSFPTLSLTKLNLSSSLLPTVDLSYTEDKKSDISSQSLPSSW  60

Query  336  ------SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                  ++ ++DQ++   ++IWVPSNPRGAE LPP I+  ESDFYLRRLWG+PS+DLT+K
Sbjct  61   PSETSKNSSSQDQSLNGKSRIWVPSNPRGAEMLPPGIVAAESDFYLRRLWGKPSEDLTIK  120

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            P+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTEWD+ EWSKRAIH+SA KQT
Sbjct  121  PRYLVTFTVGLNQKKNIDAAVKKFSENFTILLFHYDGQTTEWDDLEWSKRAIHISARKQT  180

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE Y++LVKKHGLEISQPGLE  KG  
Sbjct  181  KWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEVYLRLVKKHGLEISQPGLEPNKG--  238

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHK+T+EK GWC+DP LPPCAAF+EIMAPVFS
Sbjct  239  LTWQMTKRRGDREVHKQTEEKPGWCTDPLLPPCAAFIEIMAPVFS  283



>ref|XP_007044822.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY00654.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=393

 Score =   390 bits (1003),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 224/295 (76%), Gaps = 20/295 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M  F      ++ NE+++L++   +GV+FG  IG SFP L   KLN+++S++ ++D S  
Sbjct  1    MGIFTRSKVSRKPNESMRLIITTFVGVVFGFLIGVSFPTLSFTKLNLSSSILTSIDFSYT  60

Query  342  LTEDQTVMDPT------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLW  467
              ++    + T                  KIWVPSNPRGAERL P I+  ESD YLRRLW
Sbjct  61   QYKNSGPSNSTHVPPPIGNNGSSANVTSKKIWVPSNPRGAERLAPGIVRAESDLYLRRLW  120

Query  468  GEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKR  647
            G+PS+DLT  PKYL+T TVGY Q+ NIDA VKKFS NFTILLFHYDG+TTEWDEFEWSK+
Sbjct  121  GKPSEDLTSTPKYLVTFTVGYNQRMNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQ  180

Query  648  AIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ  827
            AIHVS  +QTKWWYAKRFLHPDI+A Y+YIFIWDEDLGVEHF+AEEYIKLV+K+GLEISQ
Sbjct  181  AIHVSVRRQTKWWYAKRFLHPDIIAPYDYIFIWDEDLGVEHFNAEEYIKLVRKYGLEISQ  240

Query  828  PGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            PGLE  KG  LTW+MT+R+ + EVHKET+EK GWC+ PHLPPCAAFVEIMAPVFS
Sbjct  241  PGLEPNKG--LTWQMTKRRGDREVHKETEEKPGWCNHPHLPPCAAFVEIMAPVFS  293



>ref|XP_007044821.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY00653.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=392

 Score =   390 bits (1003),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 224/295 (76%), Gaps = 20/295 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M  F      ++ NE+++L++   +GV+FG  IG SFP L   KLN+++S++ ++D S  
Sbjct  1    MGIFTRSKVSRKPNESMRLIITTFVGVVFGFLIGVSFPTLSFTKLNLSSSILTSIDFSYT  60

Query  342  LTEDQTVMDPT------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLW  467
              ++    + T                  KIWVPSNPRGAERL P I+  ESD YLRRLW
Sbjct  61   QYKNSGPSNSTHVPPPIGNNGSSANVTSKKIWVPSNPRGAERLAPGIVRAESDLYLRRLW  120

Query  468  GEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKR  647
            G+PS+DLT  PKYL+T TVGY Q+ NIDA VKKFS NFTILLFHYDG+TTEWDEFEWSK+
Sbjct  121  GKPSEDLTSTPKYLVTFTVGYNQRMNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQ  180

Query  648  AIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ  827
            AIHVS  +QTKWWYAKRFLHPDI+A Y+YIFIWDEDLGVEHF+AEEYIKLV+K+GLEISQ
Sbjct  181  AIHVSVRRQTKWWYAKRFLHPDIIAPYDYIFIWDEDLGVEHFNAEEYIKLVRKYGLEISQ  240

Query  828  PGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            PGLE  KG  LTW+MT+R+ + EVHKET+EK GWC+ PHLPPCAAFVEIMAPVFS
Sbjct  241  PGLEPNKG--LTWQMTKRRGDREVHKETEEKPGWCNHPHLPPCAAFVEIMAPVFS  293



>ref|XP_010029094.1| PREDICTED: uncharacterized protein LOC104419210 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010029095.1| PREDICTED: uncharacterized protein LOC104419210 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55936.1| hypothetical protein EUGRSUZ_I01729 [Eucalyptus grandis]
 gb|KCW55937.1| hypothetical protein EUGRSUZ_I01729 [Eucalyptus grandis]
 gb|KCW55938.1| hypothetical protein EUGRSUZ_I01729 [Eucalyptus grandis]
Length=403

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 226/294 (77%), Gaps = 26/294 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSSNLT  347
             N ++ NET++L+V   +GV+FG  +G SFP L L KLN+ ++L  ++D     D  +  
Sbjct  8    GNIRKPNETMRLLVTTFMGVVFGFLLGVSFPTLSLTKLNLPSALFPSIDFAYIEDKYSGL  67

Query  348  EDQTVMDP-------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
              Q +++                    +KIWVP+NPRGAERLPP II  ESDFYLRRLWG
Sbjct  68   STQALLNAWSSLKGNGGSASSIVEFNSSKIWVPTNPRGAERLPPGIIAAESDFYLRRLWG  127

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
             PS+DL  KPKYL+T TVGY+Q+ NIDA VKKFS +FTI+LFHYDG+TTEW+EFEWSK A
Sbjct  128  LPSEDLMTKPKYLVTFTVGYEQRKNIDAAVKKFSKDFTIMLFHYDGRTTEWEEFEWSKTA  187

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHP+IVA+Y+YIF+WDEDLGVEHFDAEEYIKL+KKHGLEISQP
Sbjct  188  IHVSVRKQTKWWYAKRFLHPNIVAAYDYIFMWDEDLGVEHFDAEEYIKLIKKHGLEISQP  247

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE   G  LTW+MT+R+ +SEVHK T+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  248  GLEPNSG--LTWQMTKRRGDSEVHKVTEERPGWCTDPHLPPCAAFVEIMAPVFS  299



>gb|KHG25698.1| hypothetical protein F383_04429 [Gossypium arboreum]
Length=392

 Score =   390 bits (1002),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 224/295 (76%), Gaps = 20/295 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M  F      ++ NE+++L+V    GV+FG  IG  FP L L K +++ S++  +D    
Sbjct  1    MGIFTRSIVSRKPNESMRLIVTTFFGVVFGFLIGLCFPKLSLTKFSLSTSILTAIDFKYT  60

Query  330  ------------DSSNLTEDQTVMDPT--KIWVPSNPRGAERLPPDIIVPESDFYLRRLW  467
                         S  +  + +  + T  KIWVPSNPRGAERLPP I+  ESD YLRRLW
Sbjct  61   EYTKLGPSSSTHVSHPVGNNGSCANVTLRKIWVPSNPRGAERLPPGIVRAESDLYLRRLW  120

Query  468  GEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKR  647
            G+PS+DLT KPKYL+T TVGY Q+ NIDA VKKFS NFTILLFHYDG+TTEWDEFEWSK+
Sbjct  121  GKPSEDLTSKPKYLVTFTVGYDQRKNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKK  180

Query  648  AIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ  827
            AIHVS  +QTKWWYAKRFLHPDIVA+Y+YIFIWDEDLGVEHF+AEEYIKLVKKHGLEISQ
Sbjct  181  AIHVSVRRQTKWWYAKRFLHPDIVATYDYIFIWDEDLGVEHFNAEEYIKLVKKHGLEISQ  240

Query  828  PGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            PGLE  KG  LTW+MT+R+ + EVHKET+EK GWC+ PH+PPCAAFVEIMAPVFS
Sbjct  241  PGLEPNKG--LTWQMTKRRGDREVHKETEEKPGWCNHPHVPPCAAFVEIMAPVFS  293



>ref|XP_004960543.1| PREDICTED: uncharacterized protein LOC101781300 [Setaria italica]
Length=401

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 224/284 (79%), Gaps = 22/284 (8%)
 Frame = +3

Query  201  NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVM-----  365
            NE+++LV+   IG + G FIG SFP++ + KL+  AS V+ ++D ++    Q ++     
Sbjct  16   NESMRLVMVTIIGAVLGFFIGISFPSVSITKLHFPASFVSYIEDKNSGLTTQAILNHAWT  75

Query  366  ----------DPT-----KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKP  500
                      +PT     KI+VP+NP+GAERL P I+VPESDF+LRRLWGEPS+DL  KP
Sbjct  76   SARNARGNGTEPTSNSSLKIYVPTNPKGAERLAPGIVVPESDFHLRRLWGEPSEDLPFKP  135

Query  501  KYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTK  680
            KYL+T TVG  QK+NI+  VKKFSDNF ILLFHYDG+ TEWDEFEWSKRAIH+S  KQTK
Sbjct  136  KYLVTFTVGIAQKENINRAVKKFSDNFAILLFHYDGRVTEWDEFEWSKRAIHISVRKQTK  195

Query  681  WWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWL  860
            WWYAKRFLHPDIV++YEYIFIWDEDLGVEHF+AEEYIKLVKKH LEISQPGLE  +G  L
Sbjct  196  WWYAKRFLHPDIVSAYEYIFIWDEDLGVEHFNAEEYIKLVKKHNLEISQPGLEPDRG--L  253

Query  861  TWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            TW+MT+R+ + EVHK+T+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  254  TWQMTKRRGDREVHKDTEERPGWCSDPHLPPCAAFVEIMAPVFS  297



>ref|XP_008362122.1| PREDICTED: uncharacterized protein LOC103425798 isoform X2 [Malus 
domestica]
Length=401

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/292 (65%), Positives = 223/292 (76%), Gaps = 25/292 (9%)
 Frame = +3

Query  186  NGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS----------  335
            N +  NET++L V + +GV+ G F+G SFP L L K+N+ ++L  ++D S          
Sbjct  8    NLRNPNETMRLXVTIFVGVVIGFFLGVSFPTLSLTKMNLPSTLFPSIDLSYIEEKYSGFS  67

Query  336  -------------SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEP  476
                         + +  ++ V   TKIWVP+NPRGAE LPP II  ESDFYLRRLWG P
Sbjct  68   TQALLNAWSSLKGNEVRTEKYVSXETKIWVPTNPRGAESLPPGIIASESDFYLRRLWGLP  127

Query  477  SQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIH  656
            S+DL +KPKYL+T TVGY QK N+DA VKKFS+NFTILLFHYDG T+EWDEFEWSKRAIH
Sbjct  128  SEDLLVKPKYLVTFTVGYAQKKNVDAAVKKFSENFTILLFHYDGLTSEWDEFEWSKRAIH  187

Query  657  VSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGL  836
            VS  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLG+EHF+AE+YI LVKKHGLEISQPGL
Sbjct  188  VSIPKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGLEHFNAEKYIXLVKKHGLEISQPGL  247

Query  837  ERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            E   G  LTW+MT+R+ +SEVH +T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  248  EPNSG--LTWQMTKRRGDSEVHMQTEEKPGWCNDPHLPPCAAFVEIMAPVFS  297



>ref|NP_001150432.1| LOC100284062 [Zea mays]
 gb|ACG39074.1| lysine ketoglutarate reductase trans-splicing related 1 [Zea 
mays]
 tpg|DAA56218.1| TPA: lysine ketoglutarate reductase trans-splicing 1 [Zea mays]
Length=401

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/290 (63%), Positives = 225/290 (78%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S+ +R NE ++++ +  IGV+ G   G SFP + + KL+  +S+++ ++D ++    QT+
Sbjct  10   SSAQRSNEGMRIIFSAVIGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITTQTL  69

Query  363  MDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+VP+NP+GAERLPP I+V E+D YLRRLWGEPS+
Sbjct  70   LNHAWTSAATHKKNNSASNSDEIPKIYVPTNPKGAERLPPGIVVSETDLYLRRLWGEPSE  129

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT KP+YL+T TVGY QK NIDA VKKFSDNFTI+LFHYDG+TTEWDEFEWSKRA+HVS
Sbjct  130  DLTTKPRYLVTFTVGYSQKANIDAAVKKFSDNFTIMLFHYDGRTTEWDEFEWSKRAVHVS  189

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE YIKLV+KHGLEISQPGLE 
Sbjct  190  VTKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEAYIKLVRKHGLEISQPGLEP  249

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             KG  LTW+MT+R+ + EVHK T+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  250  DKG--LTWQMTKRRGDQEVHKVTEERPGWCSDPHLPPCAAFVEIMATVFS  297



>ref|XP_008362120.1| PREDICTED: uncharacterized protein LOC103425798 isoform X1 [Malus 
domestica]
 ref|XP_008362121.1| PREDICTED: uncharacterized protein LOC103425798 isoform X1 [Malus 
domestica]
Length=402

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/292 (65%), Positives = 223/292 (76%), Gaps = 25/292 (9%)
 Frame = +3

Query  186  NGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS----------  335
            N +  NET++L V + +GV+ G F+G SFP L L K+N+ ++L  ++D S          
Sbjct  9    NLRNPNETMRLXVTIFVGVVIGFFLGVSFPTLSLTKMNLPSTLFPSIDLSYIEEKYSGFS  68

Query  336  -------------SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEP  476
                         + +  ++ V   TKIWVP+NPRGAE LPP II  ESDFYLRRLWG P
Sbjct  69   TQALLNAWSSLKGNEVRTEKYVSXETKIWVPTNPRGAESLPPGIIASESDFYLRRLWGLP  128

Query  477  SQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIH  656
            S+DL +KPKYL+T TVGY QK N+DA VKKFS+NFTILLFHYDG T+EWDEFEWSKRAIH
Sbjct  129  SEDLLVKPKYLVTFTVGYAQKKNVDAAVKKFSENFTILLFHYDGLTSEWDEFEWSKRAIH  188

Query  657  VSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGL  836
            VS  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLG+EHF+AE+YI LVKKHGLEISQPGL
Sbjct  189  VSIPKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGLEHFNAEKYIXLVKKHGLEISQPGL  248

Query  837  ERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            E   G  LTW+MT+R+ +SEVH +T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  249  EPNSG--LTWQMTKRRGDSEVHMQTEEKPGWCNDPHLPPCAAFVEIMAPVFS  298



>ref|XP_009359206.1| PREDICTED: uncharacterized protein LOC103949812 isoform X3 [Pyrus 
x bretschneideri]
Length=387

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 221/285 (78%), Gaps = 26/285 (9%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN----------------  341
            ++L+V   +GV+FG  IG SFP L L +LN+++SL   +D S N                
Sbjct  1    MRLIVTTFVGVVFGFLIGASFPTLSLTRLNLSSSLHPTIDLSYNEDLKSDISSQALLSSW  60

Query  342  --------LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                     ++DQ+    ++IWVPSNPRGAE LPP I+  ESDFYLRRLWG P++D+T+K
Sbjct  61   SSARSKNSTSQDQSSNGTSRIWVPSNPRGAEMLPPGIVAAESDFYLRRLWGNPNEDVTIK  120

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            P+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTEWD+ EWSKRAIH+S  KQT
Sbjct  121  PRYLVTFTVGLNQKRNIDAAVKKFSENFTILLFHYDGQTTEWDDLEWSKRAIHISVRKQT  180

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVASY+YIFIWDEDLGVEHF++EEYI+LV+KHGLEISQPGLE  KG  
Sbjct  181  KWWYAKRFLHPDIVASYDYIFIWDEDLGVEHFNSEEYIRLVRKHGLEISQPGLEPNKG--  238

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHK+T+EK GWC+DP LPPCAAF+EIMAPVFS
Sbjct  239  LTWQMTKRRGDREVHKQTEEKPGWCTDPLLPPCAAFIEIMAPVFS  283



>ref|XP_011042401.1| PREDICTED: uncharacterized protein LOC105138096 isoform X2 [Populus 
euphratica]
 ref|XP_011042402.1| PREDICTED: uncharacterized protein LOC105138096 isoform X2 [Populus 
euphratica]
Length=401

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/293 (65%), Positives = 222/293 (76%), Gaps = 25/293 (9%)
 Frame = +3

Query  183  SNGKRQ-NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----------  329
            S G R+ NET+++++   +GV+FG  IG SFP L L K N ++     +D          
Sbjct  7    STGSRKPNETMRILLTTFLGVVFGFLIGVSFPTLSLTKSNKSSGFFPVIDLAYSEDKPGS  66

Query  330  ------------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
                        ++S+  +     D +KIWVPSNPRGAERLPP  +V ESD+YLRRLWG+
Sbjct  67   KTVLSPWSSMKGNNSSSMQAPNSKDKSKIWVPSNPRGAERLPPGFVVAESDYYLRRLWGD  126

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            P +DLT  P+YL+T TVGY Q+ NIDA VKKFS NFTILLFHYDG+ +EWDEFEWSK AI
Sbjct  127  PKEDLTSAPRYLVTFTVGYDQRKNIDACVKKFSKNFTILLFHYDGRVSEWDEFEWSKSAI  186

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE+YIKLVKKHGLEISQPG
Sbjct  187  HVSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEQYIKLVKKHGLEISQPG  246

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE  KG  LTW+MT+R+ +SEVHK TDEK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  247  LEPNKG--LTWQMTKRRGDSEVHKITDEKPGWCTDPHLPPCAAFVEIMAPVFS  297



>ref|XP_008340102.1| PREDICTED: uncharacterized protein LOC103403062 isoform X2 [Malus 
domestica]
Length=387

 Score =   389 bits (1000),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/285 (65%), Positives = 219/285 (77%), Gaps = 26/285 (9%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN----------------  341
            ++L+V   +GV+FG  IG SFP L L KLN+++SL   +D S N                
Sbjct  1    MRLIVTTFVGVVFGFLIGASFPTLSLTKLNLSSSLRPTIDLSYNEDLKSDISSQALLSSW  60

Query  342  --------LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                     ++DQ+     +IWVPSNPRGAE LPP I+  ESDFYLRRLWG PS+D+T+K
Sbjct  61   SSARSKNSTSQDQSSNGTLRIWVPSNPRGAEMLPPGIVAAESDFYLRRLWGNPSEDVTIK  120

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            P+YL+T TVG  QK NIDA VKKFS+NFTILLFHYDGQTTEWD+ EWSKRAIHVS  KQT
Sbjct  121  PRYLVTFTVGLNQKRNIDAAVKKFSENFTILLFHYDGQTTEWDDLEWSKRAIHVSVRKQT  180

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF++EEYI+LV+KHGLEISQPGLE  KG  
Sbjct  181  KWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNSEEYIRLVRKHGLEISQPGLEPNKG--  238

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHK+T+EK GWC+DP LPPCAAF+EIMAPVFS
Sbjct  239  LTWQMTKRRGDREVHKQTEEKPGWCTDPLLPPCAAFIEIMAPVFS  283



>ref|XP_002272341.1| PREDICTED: uncharacterized protein LOC100264636 [Vitis vinifera]
Length=402

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 229/292 (78%), Gaps = 27/292 (9%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASL-----VNNVDDSSNLTEDQ  356
            ++ NET++L+V   IGV+ G F+G SFP L L K+++ +SL     +N ++D  +    Q
Sbjct  9    RKPNETMRLIVTAFIGVVVGFFLGVSFPTLSLTKMSLPSSLFPSIDLNYLEDKYSGLSTQ  68

Query  357  TVMD-------------------PTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPS  479
             +++                    TKIWVP+NPRGAERLPP IIV ESDFYLRRLWG PS
Sbjct  69   ALLNVWSSLKRNRGTASHFYKFNETKIWVPTNPRGAERLPPGIIVSESDFYLRRLWGLPS  128

Query  480  QDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHV  659
            +DLT+KP+YL+T TVG  QK+NIDA VKKFS++FTILLFHYDG+ +EWDEFEWSKRAIHV
Sbjct  129  EDLTIKPRYLVTFTVGIAQKNNIDAAVKKFSESFTILLFHYDGRVSEWDEFEWSKRAIHV  188

Query  660  SAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLE  839
            S  KQTKWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHFDAEEYIKLV+KHGLEISQPGL+
Sbjct  189  SVQKQTKWWYAKRFLHPDIVAPYDYIFMWDEDLGVEHFDAEEYIKLVRKHGLEISQPGLD  248

Query  840  -RKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + KG  LTW+MT+++ NSEVHKET E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  249  PQSKG--LTWQMTKKRDNSEVHKETQERPGWCTDPHLPPCAAFVEIMATVFS  298



>ref|XP_011042400.1| PREDICTED: uncharacterized protein LOC105138096 isoform X1 [Populus 
euphratica]
Length=403

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/292 (64%), Positives = 221/292 (76%), Gaps = 24/292 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------  329
            +  ++ NET+++++   +GV+FG  IG SFP L L K N ++     +D           
Sbjct  10   TGSRKPNETMRILLTTFLGVVFGFLIGVSFPTLSLTKSNKSSGFFPVIDLAYSEDKPGSK  69

Query  330  -----------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEP  476
                       ++S+  +     D +KIWVPSNPRGAERLPP  +V ESD+YLRRLWG+P
Sbjct  70   TVLSPWSSMKGNNSSSMQAPNSKDKSKIWVPSNPRGAERLPPGFVVAESDYYLRRLWGDP  129

Query  477  SQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIH  656
             +DLT  P+YL+T TVGY Q+ NIDA VKKFS NFTILLFHYDG+ +EWDEFEWSK AIH
Sbjct  130  KEDLTSAPRYLVTFTVGYDQRKNIDACVKKFSKNFTILLFHYDGRVSEWDEFEWSKSAIH  189

Query  657  VSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGL  836
            VSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE+YIKLVKKHGLEISQPGL
Sbjct  190  VSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEQYIKLVKKHGLEISQPGL  249

Query  837  ERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            E  KG  LTW+MT+R+ +SEVHK TDEK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  250  EPNKG--LTWQMTKRRGDSEVHKITDEKPGWCTDPHLPPCAAFVEIMAPVFS  299



>ref|XP_009349737.1| PREDICTED: uncharacterized protein LOC103941267, partial [Pyrus 
x bretschneideri]
Length=358

 Score =   388 bits (996),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 224/285 (79%), Gaps = 15/285 (5%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------  329
            H S  K+ N++ +L+    +GVIFG FIG S P + L+K+ + +SL+ ++D         
Sbjct  5    HRSGVKKSNDSARLIFTTILGVIFGFFIGVSLPMVSLSKIRLPSSLITSLDVAFTQLRRP  64

Query  330  ----DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                 S+   ED+      KI+VP+NPRGAE LPP IIVP+SD Y+RRLWGEPS+DL + 
Sbjct  65   STPSPSNKSLEDEGSEGVPKIYVPTNPRGAETLPPGIIVPQSDLYIRRLWGEPSEDLKVT  124

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            PKYL++ TVG  QK NIDA VKKFS+NFTILLFHYDG+T+EW+EFEWSKRAIHVS  +Q 
Sbjct  125  PKYLVSFTVGINQKMNIDAAVKKFSENFTILLFHYDGRTSEWEEFEWSKRAIHVSVKRQA  184

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPD+VA+YEYIFIWDEDLGVEHF+AE+YI+LVKK+GLEISQPGLE   G  
Sbjct  185  KWWYAKRFLHPDVVAAYEYIFIWDEDLGVEHFNAEKYIQLVKKYGLEISQPGLEPNDG--  242

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTWEMT+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  243  LTWEMTKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  287



>ref|XP_008672947.1| PREDICTED: LOC100284062 isoform X1 [Zea mays]
 tpg|DAA56216.1| TPA: hypothetical protein ZEAMMB73_146797 [Zea mays]
Length=400

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 182/289 (63%), Positives = 224/289 (78%), Gaps = 22/289 (8%)
 Frame = +3

Query  186  NGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVM  365
            + +R NE ++++ +  IGV+ G   G SFP + + KL+  +S+++ ++D ++    QT++
Sbjct  10   SAQRSNEGMRIIFSAVIGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITTQTLL  69

Query  366  DPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
            +                      KI+VP+NP+GAERLPP I+V E+D YLRRLWGEPS+D
Sbjct  70   NHAWTSAATHKKNNSASNSDEIPKIYVPTNPKGAERLPPGIVVSETDLYLRRLWGEPSED  129

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            LT KP+YL+T TVGY QK NIDA VKKFSDNFTI+LFHYDG+TTEWDEFEWSKRA+HVS 
Sbjct  130  LTTKPRYLVTFTVGYSQKANIDAAVKKFSDNFTIMLFHYDGRTTEWDEFEWSKRAVHVSV  189

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE YIKLV+KHGLEISQPGLE  
Sbjct  190  TKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEAYIKLVRKHGLEISQPGLEPD  249

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            KG  LTW+MT+R+ + EVHK T+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  250  KG--LTWQMTKRRGDQEVHKVTEERPGWCSDPHLPPCAAFVEIMATVFS  296



>ref|XP_008458831.1| PREDICTED: uncharacterized protein LOC103498119 [Cucumis melo]
 ref|XP_008458832.1| PREDICTED: uncharacterized protein LOC103498119 [Cucumis melo]
Length=402

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 230/300 (77%), Gaps = 25/300 (8%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS--  335
            M N     N ++ NE ++++V   +G +FG F+G SFP L L++LN  +SL+ ++D +  
Sbjct  1    MVNPIRSGNMRKPNEIMRILVTTFVGGVFGFFLGVSFPTLSLSQLNFPSSLIPSIDLTYI  60

Query  336  ----SNLTED-----------------QTVMDPTKIWVPSNPRGAERLPPDIIVPESDFY  452
                S L+ +                 Q  ++ TKIWVP+NPRGAERLPP I+  ESDF 
Sbjct  61   EDKYSGLSTEAFLNAWSSLKGNRGSSLQFSLNETKIWVPTNPRGAERLPPGIVESESDFN  120

Query  453  LRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEF  632
            LRRLWG PS+DL +KPKYL+T TVG  QK NIDA VKKFS+NFTILLFHYDG+ +EW++ 
Sbjct  121  LRRLWGMPSEDLAIKPKYLVTFTVGIDQKKNIDAAVKKFSENFTILLFHYDGRASEWEDL  180

Query  633  EWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHG  812
            EWSKRAIHVS +KQTKWWYAKRFLHPDIVASY+YIF+WDEDLGVEHF+AEEYIKLV+KHG
Sbjct  181  EWSKRAIHVSVYKQTKWWYAKRFLHPDIVASYDYIFVWDEDLGVEHFNAEEYIKLVRKHG  240

Query  813  LEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LEISQPGLE  +G  LTW+MT+R+ NSEVHKET+EK GWC+DPHLPPCAAFVEIMA VFS
Sbjct  241  LEISQPGLEPNQG--LTWQMTKRRGNSEVHKETEEKPGWCTDPHLPPCAAFVEIMATVFS  298



>ref|XP_008230511.1| PREDICTED: uncharacterized protein LOC103329778 [Prunus mume]
 ref|XP_008230512.1| PREDICTED: uncharacterized protein LOC103329778 [Prunus mume]
Length=403

 Score =   389 bits (999),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 224/294 (76%), Gaps = 26/294 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSSNLT  347
             N +  NE ++LVV V +G++ G F+G SFP +YL K+N+ +SL  ++D     D  +  
Sbjct  8    GNIRNPNEKMRLVVTVFVGIVLGFFLGVSFPTVYLTKMNLPSSLFPSIDLSYIEDKYSGF  67

Query  348  EDQTVMDP-------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
              Q +++                     KIWVP+NPRGAE LPP II  ESDFYLRRLWG
Sbjct  68   STQALLNAWSSLKGNTDNSARYVSNEEAKIWVPTNPRGAESLPPGIIASESDFYLRRLWG  127

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
             PS+DL +KPKYL+T TVGY QK+N+DA VKKFS NFTILLFHYDG+T+EWDEFEWSKRA
Sbjct  128  LPSEDLIIKPKYLVTFTVGYAQKNNVDAAVKKFSKNFTILLFHYDGRTSEWDEFEWSKRA  187

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHF+AE+YIKLV+K+GLEISQP
Sbjct  188  IHVSIQKQTKWWYAKRFLHPDIVAPYDYIFVWDEDLGVEHFNAEKYIKLVRKYGLEISQP  247

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE   G  LTW+MT+R+ +SEVH  T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  248  GLEPNNG--LTWQMTKRRGDSEVHMLTEEKPGWCNDPHLPPCAAFVEIMAPVFS  299



>ref|XP_002529935.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32443.1| conserved hypothetical protein [Ricinus communis]
Length=368

 Score =   387 bits (995),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 176/267 (66%), Positives = 221/267 (83%), Gaps = 4/267 (1%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDP  371
            ++ N++ +L+V   +GV+FG F+G SFP++ L K+++ +  +++ D SS  T+     + 
Sbjct  11   RKTNDSARLIVTTILGVVFGFFVGISFPSVSLTKIHIPSGFISSTDMSS--TDQNIRGNA  68

Query  372  TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNID  551
             KI+ P NPRGAE LPP I+V ESDFYLRRLWGEPS+DL  KPKYL+T TVGY Q++NI+
Sbjct  69   PKIYAPRNPRGAELLPPGIVVSESDFYLRRLWGEPSEDLKKKPKYLVTFTVGYDQRNNIN  128

Query  552  AVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYE  731
            A +KKFSD+FTILLFHYDG+ +EWD+FEWS+ AIHVS  +QTKWWYAKRFLHPDIVA+YE
Sbjct  129  AAIKKFSDDFTILLFHYDGRVSEWDQFEWSRTAIHVSVRRQTKWWYAKRFLHPDIVAAYE  188

Query  732  YIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKET  911
            YIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTW+MT+R+ + EVHK+T
Sbjct  189  YIFIWDEDLGVEHFNADKYIELVKKHGLEISQPGLEPNNG--LTWQMTKRRGDKEVHKDT  246

Query  912  DEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            +EK GWCSDP LPPCAAFVEIMAPVFS
Sbjct  247  EEKPGWCSDPRLPPCAAFVEIMAPVFS  273



>ref|XP_006417735.1| hypothetical protein EUTSA_v10007913mg [Eutrema salsugineum]
 ref|XP_006417736.1| hypothetical protein EUTSA_v10007913mg [Eutrema salsugineum]
 gb|ESQ36088.1| hypothetical protein EUTSA_v10007913mg [Eutrema salsugineum]
 gb|ESQ36089.1| hypothetical protein EUTSA_v10007913mg [Eutrema salsugineum]
Length=382

 Score =   388 bits (996),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 181/276 (66%), Positives = 220/276 (80%), Gaps = 11/276 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------DSSNL  344
            +R NE  KL++   +G++FG FIG + P++   K+N+ + L++++D              
Sbjct  11   RRTNENAKLIITTIVGMVFGFFIGITLPSVSFIKINLPSGLISSLDVAMSDRKLFSGGRS  70

Query  345  TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
             ED    +  KI+VP+NP GAE LPP IIV E+DFYLRRLWGEPS+DL  KPKYL+T TV
Sbjct  71   PEDFGSRESPKIYVPTNPHGAELLPPGIIVAETDFYLRRLWGEPSEDLKKKPKYLVTFTV  130

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G++QK+NI+A VKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+SA KQTKWWYAKRFL
Sbjct  131  GFEQKNNINAAVKKFSEDFQILLFHYDGRTTEWDQFEWSKNAIHISARKQTKWWYAKRFL  190

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPDIV++YEYIFIWDEDLGVEHF+AE YI+LVKKHGLEISQPGLE   G  LTWEMT+R+
Sbjct  191  HPDIVSAYEYIFIWDEDLGVEHFNAERYIELVKKHGLEISQPGLEPNNG--LTWEMTKRR  248

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + +VHKET EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  GDRDVHKETQEKPGWCSDPHLPPCAAFVEIMAPVFS  284



>ref|XP_008463954.1| PREDICTED: uncharacterized protein LOC103501955 [Cucumis melo]
Length=392

 Score =   388 bits (997),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 179/283 (63%), Positives = 226/283 (80%), Gaps = 12/283 (4%)
 Frame = +3

Query  174  GHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN----  341
             H    ++ N+  ++++   +GV+FG F+G SFP + L K+N+  SL++++D +++    
Sbjct  4    AHRGGTRKANDGARIILTTLVGVVFGFFLGASFPTVSLTKINLPPSLISSIDVATDVQKP  63

Query  342  ----LTEDQTVMDPT--KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPK  503
                +TE  +   P   KI+VP+NPRGAE LPP I+   SDFYLRRLWGEPS+DL  KPK
Sbjct  64   PRTRITETHSHGSPKTPKIYVPTNPRGAESLPPGIVASGSDFYLRRLWGEPSEDLNKKPK  123

Query  504  YLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKW  683
            YL+T TVG+ Q++NIDA VKKFSD+FTILLFHYDG+TTEWD++EWSK AIH+S  KQTKW
Sbjct  124  YLVTFTVGFDQRENIDAAVKKFSDDFTILLFHYDGRTTEWDQYEWSKNAIHISVKKQTKW  183

Query  684  WYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLT  863
            WYAKRFLHPD+VA+YEYIFIWDEDLGV+HF+AE+YI+LVKKHGLEISQPGLE   G  LT
Sbjct  184  WYAKRFLHPDVVAAYEYIFIWDEDLGVQHFNAEKYIELVKKHGLEISQPGLEPNNG--LT  241

Query  864  WEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            W+MT+R+ + EVHK+T+EK GWCSDP LPPCAAFVEIMAPVFS
Sbjct  242  WQMTKRRGDREVHKDTEEKPGWCSDPRLPPCAAFVEIMAPVFS  284



>ref|XP_008225886.1| PREDICTED: uncharacterized protein LOC103325487 isoform X1 [Prunus 
mume]
Length=388

 Score =   388 bits (996),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/289 (64%), Positives = 219/289 (76%), Gaps = 14/289 (5%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M N      GK+ N++ +L+   T+G +FG FIG S PA+ L K+   +S++ ++D    
Sbjct  1    MVNVHRSGVGKKSNDSARLIFTTTLGAVFGFFIGVSLPAVSLTKIRFPSSIITSLDVAFT  60

Query  330  --------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
                     S+   ED+      KI+VP+NPRGAE LPP IIVP+SD YLRRLWGEPS D
Sbjct  61   ELRRPNPPPSNRSLEDEGSEGVPKIYVPTNPRGAETLPPGIIVPQSDLYLRRLWGEPSAD  120

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            L   PKYL++ TVG  QK NIDA VKKFS+NF ILLFHYDG+T+EWDEFEWSKRAIHVS 
Sbjct  121  LKTIPKYLVSFTVGINQKKNIDAAVKKFSENFAILLFHYDGRTSEWDEFEWSKRAIHVSV  180

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             +Q KWWYAKRFLHPDIVA+YEYIFIWDEDLG+EHFD E+YI+LVKK+GLEISQPGLE  
Sbjct  181  KRQAKWWYAKRFLHPDIVAAYEYIFIWDEDLGLEHFDGEKYIQLVKKYGLEISQPGLEPN  240

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             G  LTWEMT+R+ + E HK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  241  NG--LTWEMTKRRGDREAHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  287



>gb|KDP46396.1| hypothetical protein JCGZ_10236 [Jatropha curcas]
Length=402

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 227/291 (78%), Gaps = 25/291 (9%)
 Frame = +3

Query  189  GKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSSNLTED  353
             ++  ET++L +    G+ FG F+G SFP L L+K+N+ +SL +++D     D  +    
Sbjct  10   ARKPGETMRLFLTTFAGITFGFFLGISFPTLSLSKMNLPSSLFSSIDLTYIEDKYSGLST  69

Query  354  QTVMDP------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPS  479
            +T+ +                   T IWVP+NPRGAERLPPDI+ PESDFYLRRLWG P 
Sbjct  70   RTLFNAWSSLKGSKGDSLPHKYNDTNIWVPTNPRGAERLPPDIVAPESDFYLRRLWGLPE  129

Query  480  QDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHV  659
            +DL++KP+YL+T TVG  QKDNIDA V++FS+NFTI+LFHYDG+TTEWDEFEWSK+A+HV
Sbjct  130  EDLSIKPRYLVTFTVGADQKDNIDAAVRRFSENFTIVLFHYDGRTTEWDEFEWSKQAVHV  189

Query  660  SAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLE  839
            SAHKQTKWWYAKRFLHPDIVA YEYIF+WDEDLG+EHFDAEEY+KLV+KHGLEISQPGL+
Sbjct  190  SAHKQTKWWYAKRFLHPDIVAPYEYIFMWDEDLGLEHFDAEEYLKLVRKHGLEISQPGLD  249

Query  840  RKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
              +G   TW MT+++ +SEVHK+T+EK GWC+DPHLPPCAAFVEIMA VFS
Sbjct  250  PDRGT--TWAMTKKRDDSEVHKDTEEKPGWCTDPHLPPCAAFVEIMATVFS  298



>ref|XP_008225894.1| PREDICTED: uncharacterized protein LOC103325487 isoform X2 [Prunus 
mume]
Length=384

 Score =   387 bits (995),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/289 (64%), Positives = 219/289 (76%), Gaps = 14/289 (5%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M N      GK+ N++ +L+   T+G +FG FIG S PA+ L K+   +S++ ++D    
Sbjct  1    MVNVHRSGVGKKSNDSARLIFTTTLGAVFGFFIGVSLPAVSLTKIRFPSSIITSLDVAFT  60

Query  330  --------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
                     S+   ED+      KI+VP+NPRGAE LPP IIVP+SD YLRRLWGEPS D
Sbjct  61   ELRRPNPPPSNRSLEDEGSEGVPKIYVPTNPRGAETLPPGIIVPQSDLYLRRLWGEPSAD  120

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            L   PKYL++ TVG  QK NIDA VKKFS+NF ILLFHYDG+T+EWDEFEWSKRAIHVS 
Sbjct  121  LKTIPKYLVSFTVGINQKKNIDAAVKKFSENFAILLFHYDGRTSEWDEFEWSKRAIHVSV  180

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             +Q KWWYAKRFLHPDIVA+YEYIFIWDEDLG+EHFD E+YI+LVKK+GLEISQPGLE  
Sbjct  181  KRQAKWWYAKRFLHPDIVAAYEYIFIWDEDLGLEHFDGEKYIQLVKKYGLEISQPGLEPN  240

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             G  LTWEMT+R+ + E HK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  241  NG--LTWEMTKRRGDREAHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  287



>emb|CDX93598.1| BnaA06g04500D [Brassica napus]
Length=386

 Score =   387 bits (995),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/277 (65%), Positives = 220/277 (79%), Gaps = 3/277 (1%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M  F      +R NE  KL++   + ++FG FIG + P++   K+N+ +  ++++D   +
Sbjct  1    MGIFHRSGAPRRTNENAKLIITTIVAMVFGFFIGITLPSVSFTKINLPSGFISSLDGGRS  60

Query  342  LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLT  521
              ED       KI+VP+NP GAE LPP IIV ESDFYLRRLWGEPS+DL  KPKYL+T T
Sbjct  61   -PEDFGSRQFPKIYVPTNPHGAELLPPGIIVAESDFYLRRLWGEPSEDLKKKPKYLVTFT  119

Query  522  VGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRF  701
            VG++Q++NI+A VKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+SA KQTKWWYAKRF
Sbjct  120  VGFEQRNNINAAVKKFSEDFQILLFHYDGRTTEWDQFEWSKNAIHISAKKQTKWWYAKRF  179

Query  702  LHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRR  881
            LHPD+V++YEYIFIWDEDLGVEHF+AE YI+LVKKHGLEISQPGLE   G  LTWEMT+R
Sbjct  180  LHPDVVSAYEYIFIWDEDLGVEHFNAERYIELVKKHGLEISQPGLEPNNG--LTWEMTKR  237

Query  882  KANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            + + +VHKET EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  238  RGDRDVHKETQEKPGWCSDPHLPPCAAFVEIMAPVFS  274



>gb|EYU18817.1| hypothetical protein MIMGU_mgv1a008100mg [Erythranthe guttata]
Length=385

 Score =   387 bits (994),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/281 (65%), Positives = 226/281 (80%), Gaps = 17/281 (6%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------DSS  338
            KR N+  +L++   +GV+FG FIG SFP++ L+K+N+ +SL++++D           D S
Sbjct  11   KRSNDGARLIITTIMGVVFGYFIGVSFPSVSLSKINLPSSLISSLDMAFNEDHQNSGDRS  70

Query  339  ---NLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
               NL    T + P KI+VP+NPRGA+ LPP I+V E+DFY+RRLWGEPS+DL  KPKYL
Sbjct  71   FPENLGSGSTPLTP-KIYVPTNPRGAQSLPPGIVVSETDFYMRRLWGEPSEDLKRKPKYL  129

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG  QK+ I+A VKKFS++F I+LFHYDGQTTEWD+FEWS+RAIHVS  KQTKWWY
Sbjct  130  VTFTVGLNQKNIINAAVKKFSEDFQIMLFHYDGQTTEWDQFEWSQRAIHVSVRKQTKWWY  189

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPD+VA+YEYIFIWDEDLGVEHF+A+ Y+ LVKKHGLEISQPGLE   G  LTW+
Sbjct  190  AKRFLHPDVVAAYEYIFIWDEDLGVEHFNADRYMDLVKKHGLEISQPGLEPNNG--LTWQ  247

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  MTKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  288



>ref|XP_009770312.1| PREDICTED: uncharacterized protein LOC104221038 [Nicotiana sylvestris]
Length=389

 Score =   387 bits (994),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/281 (65%), Positives = 224/281 (80%), Gaps = 17/281 (6%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------  335
            KR N++ +LV+   +G++FG FIG SFP++ L K+ + +S+++++D +            
Sbjct  13   KRSNDSARLVITTVMGMVFGYFIGISFPSVSLTKITLPSSIISSLDVAFNDDHQRHSERS  72

Query  336  --SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
               NL      + P KI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+DL  KPKYL
Sbjct  73   FPENLGSGNIPLTP-KIYVPTNPRGAESLPPGIVVSESDFYLRRLWGEPSEDLRKKPKYL  131

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG  QK+NIDA VKKFS++F ILLFHYDG+T+EWD+FEWSKRA+HVS  KQTKWWY
Sbjct  132  VTFTVGLDQKNNIDAAVKKFSEDFQILLFHYDGRTSEWDQFEWSKRAVHVSVRKQTKWWY  191

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPD+VA+Y+YIFIWDEDLGVEHF+AE+YI+LVKKHGLEISQPGLE   G  LTW+
Sbjct  192  AKRFLHPDVVAAYDYIFIWDEDLGVEHFNAEKYIQLVKKHGLEISQPGLEPNNG--LTWQ  249

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + EVHK T+EK GWCSDP LPPCAAFVEIMAPVFS
Sbjct  250  MTKRRGDREVHKNTEEKPGWCSDPRLPPCAAFVEIMAPVFS  290



>ref|XP_007031618.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007031619.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007031623.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY02544.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY02545.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY02549.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=404

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/291 (64%), Positives = 222/291 (76%), Gaps = 26/291 (9%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------  329
            ++ NET++L++    G+IFG F+G SFP + L K+N  +SL  ++D              
Sbjct  7    RKTNETMRLLITTFAGIIFGFFLGVSFPTISLTKMNFPSSLFPSIDITYIEDKYSGLSTE  66

Query  330  ---DSSNLTEDQTVM-------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPS  479
               D+ N  +   VM       + TKIW+P+NPRGAERLPPDII  ESD Y RRLWG+PS
Sbjct  67   ALLDAFNTFKANKVMSVPSSKDNETKIWIPTNPRGAERLPPDIIESESDLYPRRLWGQPS  126

Query  480  QDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHV  659
            +DLT+KPKYL+T TVG  QK NIDA VKKFS+NFTI+LFHYDGQ + WDEFEWSKRAIHV
Sbjct  127  EDLTIKPKYLVTFTVGISQKYNIDAAVKKFSENFTIMLFHYDGQASAWDEFEWSKRAIHV  186

Query  660  SAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLE  839
            S  KQTKWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHFDAEEYIKLV+KHGLEISQPGLE
Sbjct  187  SVRKQTKWWYAKRFLHPDIVAPYDYIFMWDEDLGVEHFDAEEYIKLVRKHGLEISQPGLE  246

Query  840  RKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
               G  LTW MTR++ ++EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  247  PNSG--LTWAMTRKRDDTEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  295



>ref|XP_007031621.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY02547.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=405

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/291 (64%), Positives = 222/291 (76%), Gaps = 26/291 (9%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------  329
            ++ NET++L++    G+IFG F+G SFP + L K+N  +SL  ++D              
Sbjct  7    RKTNETMRLLITTFAGIIFGFFLGVSFPTISLTKMNFPSSLFPSIDITYIEDKYSGLSTE  66

Query  330  ---DSSNLTEDQTVM-------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPS  479
               D+ N  +   VM       + TKIW+P+NPRGAERLPPDII  ESD Y RRLWG+PS
Sbjct  67   ALLDAFNTFKANKVMSVPSSKDNETKIWIPTNPRGAERLPPDIIESESDLYPRRLWGQPS  126

Query  480  QDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHV  659
            +DLT+KPKYL+T TVG  QK NIDA VKKFS+NFTI+LFHYDGQ + WDEFEWSKRAIHV
Sbjct  127  EDLTIKPKYLVTFTVGISQKYNIDAAVKKFSENFTIMLFHYDGQASAWDEFEWSKRAIHV  186

Query  660  SAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLE  839
            S  KQTKWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHFDAEEYIKLV+KHGLEISQPGLE
Sbjct  187  SVRKQTKWWYAKRFLHPDIVAPYDYIFMWDEDLGVEHFDAEEYIKLVRKHGLEISQPGLE  246

Query  840  RKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
               G  LTW MTR++ ++EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  247  PNSG--LTWAMTRKRDDTEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  295



>ref|XP_007207337.1| hypothetical protein PRUPE_ppa008013mg [Prunus persica]
 gb|EMJ08536.1| hypothetical protein PRUPE_ppa008013mg [Prunus persica]
Length=349

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/279 (65%), Positives = 217/279 (78%), Gaps = 13/279 (5%)
 Frame = +3

Query  189  GKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS-----------  335
            GK+ N++ +L+   T+G +FG FIG S PA+ L K+   +S++ ++D +           
Sbjct  10   GKKSNDSARLIFTTTLGAVFGFFIGVSLPAVSLTKIRFPSSIITSLDVAFTELRRPNPPP  69

Query  336  SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLT  515
            +   ED+      KI+VP+NPRGAE LPP IIVP+SD YLRRLWGEPS DL   PKYL++
Sbjct  70   NRSLEDEGSEGVPKIYVPTNPRGAETLPPGIIVPQSDLYLRRLWGEPSADLKTTPKYLVS  129

Query  516  LTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAK  695
             TVG  QK NIDA VKKFS+NF ILLFHYDG+T+EWDEFEWSKRAIHVS  +Q KWWYAK
Sbjct  130  FTVGINQKKNIDAAVKKFSENFAILLFHYDGRTSEWDEFEWSKRAIHVSVKRQAKWWYAK  189

Query  696  RFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMT  875
            RFLHPDIVA+YEYIFIWDEDLGVEHFD E+YI+LVKK+GLEISQPGLE   G  LTWEMT
Sbjct  190  RFLHPDIVAAYEYIFIWDEDLGVEHFDGEKYIQLVKKYGLEISQPGLEPNNG--LTWEMT  247

Query  876  RRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            +R+ + E HK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  KRRGDREAHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  286



>ref|XP_009148057.1| PREDICTED: uncharacterized protein LOC103871548 [Brassica rapa]
 ref|XP_009148058.1| PREDICTED: uncharacterized protein LOC103871548 [Brassica rapa]
Length=372

 Score =   386 bits (992),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/277 (65%), Positives = 220/277 (79%), Gaps = 3/277 (1%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M  F      +R NE  KL++   + ++FG FIG + P++   K+N+ +  ++++D   +
Sbjct  1    MGIFHRSGAPRRTNENAKLIITTIVAMVFGFFIGITLPSVSFTKINLPSGFISSLDGGRS  60

Query  342  LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLT  521
              ED       KI+VP+NP GAE LPP IIV ESDFYLRRLWGEPS+DL  KPKYL+T T
Sbjct  61   -PEDFGSRHFPKIYVPTNPHGAELLPPGIIVAESDFYLRRLWGEPSEDLKKKPKYLVTFT  119

Query  522  VGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRF  701
            VG++Q++NI+A VKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+SA KQTKWWYAKRF
Sbjct  120  VGFEQRNNINAAVKKFSEDFQILLFHYDGRTTEWDQFEWSKNAIHISAKKQTKWWYAKRF  179

Query  702  LHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRR  881
            LHPD+V++YEYIFIWDEDLGVEHF+AE YI+LVKKHGLEISQPGLE   G  LTWEMT+R
Sbjct  180  LHPDVVSAYEYIFIWDEDLGVEHFNAERYIELVKKHGLEISQPGLEPNNG--LTWEMTKR  237

Query  882  KANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            + + +VHKET EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  238  RGDRDVHKETQEKPGWCSDPHLPPCAAFVEIMAPVFS  274



>ref|NP_001054429.1| Os05g0108100 [Oryza sativa Japonica Group]
 gb|AAK73132.1|AC079022_5 putative protein [Oryza sativa]
 gb|AAU44134.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16343.1| Os05g0108100 [Oryza sativa Japonica Group]
 gb|EEC78374.1| hypothetical protein OsI_18144 [Oryza sativa Indica Group]
 gb|EEE62051.1| hypothetical protein OsJ_16835 [Oryza sativa Japonica Group]
Length=401

 Score =   387 bits (994),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 226/284 (80%), Gaps = 22/284 (8%)
 Frame = +3

Query  201  NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVM-----  365
            NE++++V+   IGV+ G FIG SFP++ + KL+  +S V+ ++D ++    Q ++     
Sbjct  16   NESMRIVMVTIIGVLLGFFIGISFPSVSITKLHFPSSFVSYIEDRNSGLTTQALLNHAWT  75

Query  366  ----------DPT-----KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKP  500
                      +P+     KI+VP+NP+GAERL P I+VPE+DF+LRRLWGEPS+DL  KP
Sbjct  76   SARNARENSSEPSSNTTLKIYVPTNPKGAERLAPAIVVPETDFHLRRLWGEPSEDLPFKP  135

Query  501  KYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTK  680
            KYL+T TVGY QK+NI+  VKKFSDNF ILLFHYDG+ +EWDEFEWSKRAIH+SA KQTK
Sbjct  136  KYLVTFTVGYAQKENINRAVKKFSDNFAILLFHYDGRVSEWDEFEWSKRAIHISARKQTK  195

Query  681  WWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWL  860
            WWYAKRFLHPDIVA+YEYIFIWDEDLGVEHF+AEEYIKLVKK+ LEISQPGLE  +G  L
Sbjct  196  WWYAKRFLHPDIVAAYEYIFIWDEDLGVEHFNAEEYIKLVKKYHLEISQPGLEPDRG--L  253

Query  861  TWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            TW+MT+R+ + EVHK T+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  254  TWQMTKRRGDREVHKVTEERPGWCSDPHLPPCAAFVEIMAPVFS  297



>ref|XP_007215510.1| hypothetical protein PRUPE_ppa006988mg [Prunus persica]
 gb|EMJ16709.1| hypothetical protein PRUPE_ppa006988mg [Prunus persica]
Length=387

 Score =   387 bits (993),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/285 (65%), Positives = 220/285 (77%), Gaps = 26/285 (9%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSSNLTEDQTVMDP-  371
            ++LVV V +G++ G F+G SFP LYL K+N+ +SL  ++D     D  +    Q +++  
Sbjct  1    MRLVVTVFVGIVLGFFLGVSFPTLYLTKMNLPSSLFPSIDLSYIEDKYSGFSTQALLNAW  60

Query  372  ------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                               KIWVP+NPRGAE LPP II  ESDFYLRRLWG PS+DL +K
Sbjct  61   SSLKGNTDNSARYVSNEEAKIWVPTNPRGAESLPPGIIASESDFYLRRLWGLPSEDLIIK  120

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            PKYL+T TVGY QK+N+DA VKKFS NFTILLFHYDG+T+EWDEFEWSKRAIHVS  KQT
Sbjct  121  PKYLVTFTVGYAQKNNVDAAVKKFSKNFTILLFHYDGRTSEWDEFEWSKRAIHVSIQKQT  180

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHF+AEEYIKLV+K+GLEISQPGLE   G  
Sbjct  181  KWWYAKRFLHPDIVAPYDYIFVWDEDLGVEHFNAEEYIKLVRKYGLEISQPGLEPNNG--  238

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ +SEVH  T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  239  LTWQMTKRRGDSEVHMLTEEKPGWCNDPHLPPCAAFVEIMAPVFS  283



>gb|KHN44372.1| hypothetical protein glysoja_014413 [Glycine soja]
Length=383

 Score =   386 bits (992),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 217/281 (77%), Gaps = 22/281 (8%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------------  329
            ++  V   I ++ G FIG S P L + KLN+ + L+ ++D                    
Sbjct  1    MRFFVTTFISIVLGFFIGVSVPTLSITKLNLPSGLLPSIDLSYIEDRYTGRQAWSFMNNG  60

Query  330  DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
            +  + ++ Q   D +KIWVPSNPRGAERLPP I+  ESD+YLRRLWG+PS+DLT +P YL
Sbjct  61   NKRSSSQVQLSNDTSKIWVPSNPRGAERLPPGIVEAESDYYLRRLWGKPSEDLTSRPNYL  120

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVGY QK+NIDA VKKFS NFTILLFHYDG+TTEWDEFEWSK+AIHVS HKQTKWWY
Sbjct  121  VTFTVGYDQKNNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQAIHVSVHKQTKWWY  180

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPDIVA Y+Y FIWDEDLGVEHF+AEEYIKLV+KHGLEISQPGLE  +G  LTW+
Sbjct  181  AKRFLHPDIVAPYDYTFIWDEDLGVEHFNAEEYIKLVRKHGLEISQPGLEPNRG--LTWQ  238

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  239  MTKRRGDQEVHKVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  279



>ref|XP_009589970.1| PREDICTED: uncharacterized protein LOC104087260 [Nicotiana tomentosiformis]
Length=389

 Score =   386 bits (992),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 181/281 (64%), Positives = 224/281 (80%), Gaps = 17/281 (6%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------  335
            KR N++ +L++   +G++FG FIG SFP++ L K+ + +S+++++D +            
Sbjct  13   KRSNDSARLIITTVMGMVFGYFIGISFPSVSLTKITLPSSIISSLDVAFNDDHQRHSGRS  72

Query  336  --SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
               NL      + P KI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+DL  KPKYL
Sbjct  73   FPENLGSGNIPLTP-KIYVPTNPRGAESLPPGIVVSESDFYLRRLWGEPSEDLRKKPKYL  131

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG  QK+NIDA VKKFS++F ILLFHYDG+T+EWD+FEWSKRA+HVS  KQTKWWY
Sbjct  132  VTFTVGLDQKNNIDAAVKKFSEDFQILLFHYDGRTSEWDQFEWSKRAVHVSIRKQTKWWY  191

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPD+VA+Y+YIFIWDEDLGVEHF+AE+YI+LVKKHGLEISQPGLE   G  LTW+
Sbjct  192  AKRFLHPDVVAAYDYIFIWDEDLGVEHFNAEKYIQLVKKHGLEISQPGLEPNNG--LTWQ  249

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + EVHK T+EK GWCSDP LPPCAAFVEIMAPVFS
Sbjct  250  MTKRRGDKEVHKNTEEKPGWCSDPRLPPCAAFVEIMAPVFS  290



>ref|XP_009402707.1| PREDICTED: uncharacterized protein LOC103986416 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402708.1| PREDICTED: uncharacterized protein LOC103986416 [Musa acuminata 
subsp. malaccensis]
Length=402

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/300 (62%), Positives = 230/300 (77%), Gaps = 22/300 (7%)
 Frame = +3

Query  153  VCTMKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDD  332
            +  +   G     ++ NE+++L++   IGV FG  IG SFP + + KL+  +S+++ +++
Sbjct  1    MAKLGTVGRSGFLRKPNESLRLIITTVIGVAFGYLIGISFPTVNIIKLHFPSSILSYIEE  60

Query  333  SSNLTEDQTVMDP--------------------TKIWVPSNPRGAERLPPDIIVPESDFY  452
             ++ T  Q++++                      KI+VP+NPRGAERLPPDI+V ESDFY
Sbjct  61   RNSGTTTQSLLNHPWASSSNQNRNNSTSSSTNLLKIYVPTNPRGAERLPPDIVVSESDFY  120

Query  453  LRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEF  632
            LRRLWG P +DL  K KYL+T TVGY+QK NIDAVVKKFS++FTILLFHYDG+T+EWDEF
Sbjct  121  LRRLWGNPDEDLATKQKYLVTFTVGYEQKRNIDAVVKKFSEDFTILLFHYDGRTSEWDEF  180

Query  633  EWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHG  812
            EWSK+AIHVS  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLGVEHFDAE+YIKLVKK+G
Sbjct  181  EWSKQAIHVSVRKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGVEHFDAEKYIKLVKKYG  240

Query  813  LEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LEISQPGLE   G  LTW+MT+R+ + EVHKET+E+ GWC+D HLPPCAAFVEIMAPVFS
Sbjct  241  LEISQPGLEPNNG--LTWQMTKRRGDREVHKETEERPGWCADAHLPPCAAFVEIMAPVFS  298



>gb|EYU44800.1| hypothetical protein MIMGU_mgv1a007501mg [Erythranthe guttata]
 gb|EYU44801.1| hypothetical protein MIMGU_mgv1a007501mg [Erythranthe guttata]
Length=405

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 224/288 (78%), Gaps = 23/288 (8%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------SNLTED  353
            +R NET++L+V   +GVIFG F+G SFPAL L K+N+++++  ++D S      S L+  
Sbjct  16   RRTNETMRLLVTTIVGVIFGFFLGVSFPALSLTKVNISSNIFPSIDLSYIEDKYSGLSTQ  75

Query  354  QTV---------------MDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL  488
              +                + TKIWVP+NPRGAERLPP +IV ESD Y RRLWG P +DL
Sbjct  76   ALLNVWSSLKGRRGFSRKFNNTKIWVPTNPRGAERLPPGVIVAESDLYTRRLWGLPGEDL  135

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
             +KP+YL T TVGY+Q+ NIDA VKK S+NFTILLFHYDG+ +EWDEFEWSKR+IHVS  
Sbjct  136  IVKPRYLFTFTVGYEQRYNIDAAVKKLSENFTILLFHYDGRASEWDEFEWSKRSIHVSVR  195

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDIVA ++Y+FIWDEDLGVE+FDAEEYIKLV+KHGL+ISQPGL    
Sbjct  196  KQTKWWYAKRFLHPDIVAPFDYVFIWDEDLGVENFDAEEYIKLVRKHGLDISQPGLSLDS  255

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            G  +TW+MTRR+  SEVHK+T+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  256  G--MTWQMTRRQEESEVHKDTEERPGWCTDPHLPPCAAFVEIMAPVFS  301



>ref|XP_004971004.1| PREDICTED: uncharacterized protein LOC101768420 isoform X7 [Setaria 
italica]
Length=365

 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 178/293 (61%), Positives = 225/293 (77%), Gaps = 21/293 (7%)
 Frame = +3

Query  171  FGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTE  350
             G  S+  R NE+++++ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++   
Sbjct  44   LGRSSSVPRSNESMRIIFSAVVGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGIT  103

Query  351  DQTVMDPT-------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
             QT+++                     KI+VP+NP+GAERLPP I+  E+D YLRRLWGE
Sbjct  104  TQTLLNHAWTSAASHKNNSVSNPDEIPKIYVPTNPKGAERLPPGIVASETDLYLRRLWGE  163

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            PS+DLT +P+YL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+TTEW+EFEWSKRAI
Sbjct  164  PSEDLTSQPRYLVTFTVGYSQKANIDAAVKKFSENFTIMLFHYDGRTTEWNEFEWSKRAI  223

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVS  KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE YIKLV+KHGLEISQPG
Sbjct  224  HVSVRKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEAYIKLVRKHGLEISQPG  283

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE  KG  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  284  LEPDKG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  334



>ref|XP_010458024.1| PREDICTED: uncharacterized protein LOC104739386 isoform X1 [Camelina 
sativa]
 ref|XP_010458025.1| PREDICTED: uncharacterized protein LOC104739386 isoform X1 [Camelina 
sativa]
Length=381

 Score =   385 bits (990),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/281 (65%), Positives = 221/281 (79%), Gaps = 11/281 (4%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS-------  335
            H S   R+NE  KL++   +G++FG FIG + P+    K+++ + LV++ D S       
Sbjct  5    HRSGAPRRNENAKLIITTILGMVFGFFIGITLPSGSFKKISLPSGLVSSFDVSMSDGKLF  64

Query  336  --SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
                  ED       KI+VP+NP GAE LPP IIV E+DFYLRRLWGEPS+DL  KPKYL
Sbjct  65   SGGRSPEDFGSRQFPKIYVPTNPHGAELLPPGIIVAETDFYLRRLWGEPSEDLKKKPKYL  124

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG++Q++NI+A VKKFS++F ILLFHYDG+TTEWD+FEWSK+AIH+SA KQTKWWY
Sbjct  125  VTFTVGFEQRNNINAAVKKFSEDFQILLFHYDGRTTEWDQFEWSKKAIHISAKKQTKWWY  184

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPD+V++YEYIFIWDEDLGVEHF+AE YI+LVKKHGLEISQPGLE   G  LTWE
Sbjct  185  AKRFLHPDVVSAYEYIFIWDEDLGVEHFNAERYIELVKKHGLEISQPGLEPNNG--LTWE  242

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + +VHKET EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  243  MTKRRGDRDVHKETKEKPGWCSDPHLPPCAAFVEIMAPVFS  283



>ref|XP_006653957.1| PREDICTED: uncharacterized protein LOC102713904 [Oryza brachyantha]
Length=401

 Score =   386 bits (992),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 226/284 (80%), Gaps = 22/284 (8%)
 Frame = +3

Query  201  NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVM-----  365
            NE++++V+   IGV+FG FIG SFP++ + KL+  +S V+ ++D ++    Q ++     
Sbjct  16   NESMRIVMVTIIGVLFGFFIGISFPSVSITKLHFPSSFVSYIEDRNSGLTTQALLNHAWT  75

Query  366  ----------DPT-----KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKP  500
                      +P+     KI+VP+NP+GAERL P I+VPESDF+LRRLWGEPS+DL  KP
Sbjct  76   SARNARENSSEPSSSTTFKIYVPTNPKGAERLAPGIVVPESDFHLRRLWGEPSEDLPFKP  135

Query  501  KYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTK  680
            KYL+T TVGY QK+NI+  VKKFSDNF ILLFHYD + +EWDEFEWSKRAIH+SA KQTK
Sbjct  136  KYLVTFTVGYAQKENINKAVKKFSDNFAILLFHYDDRVSEWDEFEWSKRAIHISARKQTK  195

Query  681  WWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWL  860
            WWYAKRFLHPDIVA+YEYIFIWDEDLGVEHF+AEEYIKLVKK+ L+ISQPGLE  +G  L
Sbjct  196  WWYAKRFLHPDIVAAYEYIFIWDEDLGVEHFNAEEYIKLVKKYRLDISQPGLEPDRG--L  253

Query  861  TWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            TW+MT+R+ + EVHK T+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  254  TWQMTKRRGDREVHKVTEERPGWCSDPHLPPCAAFVEIMAPVFS  297



>ref|XP_007031622.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY02548.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=433

 Score =   387 bits (995),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 187/291 (64%), Positives = 222/291 (76%), Gaps = 26/291 (9%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------  329
            ++ NET++L++    G+IFG F+G SFP + L K+N  +SL  ++D              
Sbjct  7    RKTNETMRLLITTFAGIIFGFFLGVSFPTISLTKMNFPSSLFPSIDITYIEDKYSGLSTE  66

Query  330  ---DSSNLTEDQTVM-------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPS  479
               D+ N  +   VM       + TKIW+P+NPRGAERLPPDII  ESD Y RRLWG+PS
Sbjct  67   ALLDAFNTFKANKVMSVPSSKDNETKIWIPTNPRGAERLPPDIIESESDLYPRRLWGQPS  126

Query  480  QDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHV  659
            +DLT+KPKYL+T TVG  QK NIDA VKKFS+NFTI+LFHYDGQ + WDEFEWSKRAIHV
Sbjct  127  EDLTIKPKYLVTFTVGISQKYNIDAAVKKFSENFTIMLFHYDGQASAWDEFEWSKRAIHV  186

Query  660  SAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLE  839
            S  KQTKWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHFDAEEYIKLV+KHGLEISQPGLE
Sbjct  187  SVRKQTKWWYAKRFLHPDIVAPYDYIFMWDEDLGVEHFDAEEYIKLVRKHGLEISQPGLE  246

Query  840  RKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
               G  LTW MTR++ ++EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  247  PNSG--LTWAMTRKRDDTEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  295



>ref|XP_004145746.1| PREDICTED: uncharacterized protein LOC101216740 [Cucumis sativus]
 ref|XP_004169195.1| PREDICTED: uncharacterized LOC101216740 [Cucumis sativus]
 gb|KGN46844.1| hypothetical protein Csa_6G141410 [Cucumis sativus]
Length=393

 Score =   386 bits (991),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 178/283 (63%), Positives = 223/283 (79%), Gaps = 12/283 (4%)
 Frame = +3

Query  174  GHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------  335
             H    ++ N+  ++++   +GV+FG F+G SFP + L K+N+ +S+++++D +      
Sbjct  4    AHRGGTRKANDGARIILTTLVGVVFGFFLGASFPTVSLTKINLPSSIISSLDVAMDVQKS  63

Query  336  --SNLTEDQTVMDPT--KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPK  503
              + +TE      P   KI+VP+NPRGAE LPP I+   SDFYLRRLWGEPS+DL  KPK
Sbjct  64   PRTRITETHNQGSPKIPKIYVPTNPRGAESLPPGIVASGSDFYLRRLWGEPSEDLNKKPK  123

Query  504  YLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKW  683
            YL+T TVG+ Q+ NIDA VKKFSD+FTILLFHYDG+ TEWD++EWSK AIH+S  KQTKW
Sbjct  124  YLVTFTVGFDQRKNIDAAVKKFSDDFTILLFHYDGRITEWDQYEWSKNAIHISVKKQTKW  183

Query  684  WYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLT  863
            WYAKRFLHPD+VA+YEYIFIWDEDLGVEHF+AE+YI+LVKKHGLEISQPGLE   G  LT
Sbjct  184  WYAKRFLHPDVVAAYEYIFIWDEDLGVEHFNAEKYIELVKKHGLEISQPGLEPNNG--LT  241

Query  864  WEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            W+MT+R+ + EVHK+T+EK GWCSDP LPPCAAFVEIMAPVFS
Sbjct  242  WQMTKRRGDREVHKDTEEKAGWCSDPRLPPCAAFVEIMAPVFS  284



>ref|XP_009367055.1| PREDICTED: uncharacterized protein LOC103956753 isoform X1 [Pyrus 
x bretschneideri]
Length=388

 Score =   385 bits (990),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 223/285 (78%), Gaps = 15/285 (5%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------  329
            H S  K+ N++ +L+    +GVIFG FIG S P + L+K+ + +SL+ ++D         
Sbjct  5    HRSGVKKSNDSARLIFTTILGVIFGFFIGVSLPMVSLSKIRLPSSLITSLDVAFTQLRRP  64

Query  330  ----DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                 S+   ED+      KI+VP+NP GAE LPP IIVP+SD Y+RRLWGEPS+DL + 
Sbjct  65   STPPPSNKSLEDEGSEGVPKIYVPTNPHGAETLPPGIIVPQSDLYIRRLWGEPSEDLKVT  124

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            PKYL++ TVG  QK NIDA VKKFS+NFTILLFHYDG+T+EW+EFEWSKRAIHVS  +Q 
Sbjct  125  PKYLVSFTVGINQKMNIDAAVKKFSENFTILLFHYDGRTSEWEEFEWSKRAIHVSVKRQA  184

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPD+VA+YEYIFIWDEDLGVEHF+AE+YI+LVKK+GLEISQPGLE   G  
Sbjct  185  KWWYAKRFLHPDVVAAYEYIFIWDEDLGVEHFNAEKYIQLVKKYGLEISQPGLEPNDG--  242

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTWEMT+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  243  LTWEMTKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  287



>ref|XP_009367056.1| PREDICTED: uncharacterized protein LOC103956753 isoform X2 [Pyrus 
x bretschneideri]
Length=384

 Score =   385 bits (990),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 223/285 (78%), Gaps = 15/285 (5%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------  329
            H S  K+ N++ +L+    +GVIFG FIG S P + L+K+ + +SL+ ++D         
Sbjct  5    HRSGVKKSNDSARLIFTTILGVIFGFFIGVSLPMVSLSKIRLPSSLITSLDVAFTQLRRP  64

Query  330  ----DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                 S+   ED+      KI+VP+NP GAE LPP IIVP+SD Y+RRLWGEPS+DL + 
Sbjct  65   STPPPSNKSLEDEGSEGVPKIYVPTNPHGAETLPPGIIVPQSDLYIRRLWGEPSEDLKVT  124

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            PKYL++ TVG  QK NIDA VKKFS+NFTILLFHYDG+T+EW+EFEWSKRAIHVS  +Q 
Sbjct  125  PKYLVSFTVGINQKMNIDAAVKKFSENFTILLFHYDGRTSEWEEFEWSKRAIHVSVKRQA  184

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPD+VA+YEYIFIWDEDLGVEHF+AE+YI+LVKK+GLEISQPGLE   G  
Sbjct  185  KWWYAKRFLHPDVVAAYEYIFIWDEDLGVEHFNAEKYIQLVKKYGLEISQPGLEPNDG--  242

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTWEMT+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  243  LTWEMTKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  287



>ref|XP_010100413.1| hypothetical protein L484_027724 [Morus notabilis]
 gb|EXB82547.1| hypothetical protein L484_027724 [Morus notabilis]
Length=375

 Score =   385 bits (988),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 187/285 (66%), Positives = 218/285 (76%), Gaps = 26/285 (9%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNL---------------  344
            ++L+V   +GV+ G FIG SFP L L KLN+T+SL+    D + +               
Sbjct  1    MRLIVTTFLGVVLGFFIGVSFPTLSLTKLNITSSLLLPPTDLTYIEDKKSSFSTPIDAWS  60

Query  345  ---------TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                      +DQ + D +KIW  SNP+GAERLPP I+   SDFY RRLWG+PS+DLT  
Sbjct  61   SKSSNPSSSNQDQHLNDTSKIWATSNPKGAERLPPGIVEAMSDFYPRRLWGKPSEDLTST  120

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            PKYL+T TVGY Q++NIDA VKKFS+NFTILLFHYD +TTEWDEFEWSKRAIHVS  KQT
Sbjct  121  PKYLVTFTVGYDQRNNIDACVKKFSENFTILLFHYDDRTTEWDEFEWSKRAIHVSVRKQT  180

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLV+KHGLEISQPGLE  KG  
Sbjct  181  KWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVRKHGLEISQPGLEPNKG--  238

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHKET E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  239  LTWQMTKRRGDREVHKETKERPGWCTDPHLPPCAAFVEIMAPVFS  283



>ref|XP_010253712.1| PREDICTED: uncharacterized protein LOC104594877 isoform X1 [Nelumbo 
nucifera]
Length=382

 Score =   385 bits (988),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/278 (65%), Positives = 223/278 (80%), Gaps = 14/278 (5%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------DSS  338
            K+ N++ +L+    +G +FG F+G SFP+  + KLN+ + L++++D             S
Sbjct  11   KKSNDSARLITITVMGAVFGFFVGVSFPSDLVTKLNLHSGLLSSIDVALINERSGRFSRS  70

Query  339  NLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTL  518
            +L       D  KI+VP+NPRGAE LPP I+VPE+DFYLRRLWG+P++DL  KPKYL+T 
Sbjct  71   DLGGTNH-SDTPKIYVPTNPRGAELLPPGIVVPETDFYLRRLWGDPNEDLKTKPKYLVTF  129

Query  519  TVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKR  698
            TVG+ Q++NIDA VKKFS++FTILLFHYDG+T+EWD+FEWSKRAIH+SA KQTKWWYAKR
Sbjct  130  TVGFDQRNNIDAAVKKFSEDFTILLFHYDGRTSEWDQFEWSKRAIHISARKQTKWWYAKR  189

Query  699  FLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTR  878
            FLHPD+VA+Y+YIFIWDEDLGVEHF+AE+YI LVKKHGLEISQPGLE   G  LTW+MT+
Sbjct  190  FLHPDVVAAYDYIFIWDEDLGVEHFNAEKYINLVKKHGLEISQPGLEPNNG--LTWQMTK  247

Query  879  RKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            R+ +SEVH ET EK GWCS PHLPPCAAFVEIMAPVFS
Sbjct  248  RRGDSEVHMETTEKPGWCSYPHLPPCAAFVEIMAPVFS  285



>ref|XP_011089275.1| PREDICTED: uncharacterized protein LOC105170284 [Sesamum indicum]
 ref|XP_011089276.1| PREDICTED: uncharacterized protein LOC105170284 [Sesamum indicum]
Length=383

 Score =   385 bits (988),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/280 (64%), Positives = 227/280 (81%), Gaps = 16/280 (6%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------  335
            K+ N+  +L++   +G++FG FIG SFP++ L+K+N+ +SL++++D +            
Sbjct  11   KKSNDGARLLITTIMGMVFGYFIGVSFPSVSLDKINLPSSLISSLDMAFNDDRRAVSRSF  70

Query  336  -SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLL  512
              NL    T + P KI+VP+NPRGAE LPP I+V ESDF+LRRLWG+P +DL   PKYL+
Sbjct  71   PENLGSSSTPLTP-KIYVPTNPRGAESLPPGIVVSESDFFLRRLWGDPREDLRRTPKYLV  129

Query  513  TLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYA  692
            T TVG +QK+NI+A VKKFS++F I+LFHYDG+T+EWD+FEWS+RAIHVSA KQTKWWYA
Sbjct  130  TFTVGLEQKNNINAAVKKFSEDFQIMLFHYDGRTSEWDQFEWSQRAIHVSARKQTKWWYA  189

Query  693  KRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEM  872
            KRFLHPD+VA+Y+YIFIWDEDLGVEHF+AE YI+LVKKHGLEISQPGLE   G  LTW+M
Sbjct  190  KRFLHPDVVAAYDYIFIWDEDLGVEHFNAERYIELVKKHGLEISQPGLEPNNG--LTWQM  247

Query  873  TRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            T+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  TKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  287



>emb|CDX95100.1| BnaC05g05710D [Brassica napus]
Length=437

 Score =   387 bits (993),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/267 (67%), Positives = 218/267 (82%), Gaps = 3/267 (1%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDP  371
            +R NE  KLV+   + ++FG FIG + P++   K+N+ +  ++++D   +  ED      
Sbjct  11   RRTNENAKLVITTIVAMVFGFFIGITLPSVSFTKINLPSGFISSLDGGRS-PEDFGSRHF  69

Query  372  TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNID  551
             KI+VP+NP GAE LPP I+V ESDFYLRRLWGEPS+DL  KPKYL+T TVG++Q++NI+
Sbjct  70   PKIYVPTNPHGAELLPPGIVVAESDFYLRRLWGEPSEDLKKKPKYLVTFTVGFEQRNNIN  129

Query  552  AVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYE  731
            A VKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+SA KQTKWWYAKRFLHPD+V++YE
Sbjct  130  AAVKKFSEDFQILLFHYDGRTTEWDQFEWSKNAIHISAKKQTKWWYAKRFLHPDVVSAYE  189

Query  732  YIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKET  911
            YIFIWDEDLGVEHF+AE YI+LVKKHGLEISQPGLE   G  LTWEMT+R+ + +VHKET
Sbjct  190  YIFIWDEDLGVEHFNAERYIELVKKHGLEISQPGLEPNNG--LTWEMTKRRGDRDVHKET  247

Query  912  DEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  QEKPGWCSDPHLPPCAAFVEIMAPVFS  274



>ref|XP_002323994.1| hypothetical protein POPTR_0017s10560g [Populus trichocarpa]
 ref|XP_006373275.1| hypothetical protein POPTR_0017s10560g [Populus trichocarpa]
 ref|XP_006373276.1| hypothetical protein POPTR_0017s10560g [Populus trichocarpa]
 gb|EEF04127.1| hypothetical protein POPTR_0017s10560g [Populus trichocarpa]
 gb|ERP51072.1| hypothetical protein POPTR_0017s10560g [Populus trichocarpa]
 gb|ERP51073.1| hypothetical protein POPTR_0017s10560g [Populus trichocarpa]
Length=403

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/291 (63%), Positives = 224/291 (77%), Gaps = 26/291 (9%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSSNLTEDQ  356
            K+ +E ++L +   IG+IFG F+G SFP L L+K+N+ +SL  ++D     D  +    Q
Sbjct  11   KKPSEMMRLFMTTFIGIIFGFFLGISFPTLSLSKMNLPSSLFPSIDLTYIEDKYSGLSKQ  70

Query  357  TVMDP-------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPS  479
             + +                    T+IWVP+NPRGAERLPP I+  ESDFYLRRLWG PS
Sbjct  71   ALFNAWSSLKGNKEASPLLPRYNETEIWVPTNPRGAERLPPGIVASESDFYLRRLWGLPS  130

Query  480  QDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHV  659
            +DLT++P+YL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+TTEWDEFEWSKR +H+
Sbjct  131  EDLTIQPRYLVTFTVGYDQKKNIDAAVKKFSENFTIVLFHYDGRTTEWDEFEWSKRTVHI  190

Query  660  SAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLE  839
            SAHKQTKWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHFDAE+YIKLV+KHGLEISQPGL+
Sbjct  191  SAHKQTKWWYAKRFLHPDIVAPYDYIFLWDEDLGVEHFDAEKYIKLVRKHGLEISQPGLD  250

Query  840  RKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
              +G   TW MT+R+   EVHK+T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  251  PDRGT--TWAMTKRRDGIEVHKDTEERPGWCTDPHLPPCAAFVEIMATVFS  299



>ref|XP_007016775.1| T6D22.12 isoform 4 [Theobroma cacao]
 gb|EOY34394.1| T6D22.12 isoform 4 [Theobroma cacao]
Length=303

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 220/275 (80%), Gaps = 10/275 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTEDQ-  356
            K+ N++ ++++   +GV+FG FIG SFP   LNK+++ +SL++++D    D ++   D+ 
Sbjct  11   KKTNDSARIIIITILGVVFGFFIGVSFPYASLNKIHLPSSLISSLDVALPDDNDFPRDRS  70

Query  357  ---TVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVG  527
               T  +  KI+VP+NPRGAE LPP I+V ESD YLRRLWGEP +DL  KPKYL+T TVG
Sbjct  71   PETTGGNVPKIYVPTNPRGAELLPPGIVVAESDLYLRRLWGEPGEDLKKKPKYLVTFTVG  130

Query  528  YKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLH  707
              Q++NIDA VKKFS++F ILLFHYDG TTEWD+FEWSK AIHVS  KQTKWWYAKRFLH
Sbjct  131  IAQRNNIDACVKKFSEDFQILLFHYDGHTTEWDQFEWSKNAIHVSVRKQTKWWYAKRFLH  190

Query  708  PDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKA  887
            PDIVASYEYIFIWDEDLGVEHF+ E YI+LVKKHGLEISQPGLE   G  LTW+MT+R+ 
Sbjct  191  PDIVASYEYIFIWDEDLGVEHFNGERYIELVKKHGLEISQPGLEPNNG--LTWQMTKRRG  248

Query  888  NSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            + EVHK T+EK GWCSD HLPPCAAFVEIMAPVFS
Sbjct  249  DREVHKITEEKPGWCSDSHLPPCAAFVEIMAPVFS  283



>ref|XP_008359345.1| PREDICTED: uncharacterized protein LOC103423052 isoform X1 [Malus 
domestica]
Length=388

 Score =   384 bits (987),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/285 (64%), Positives = 222/285 (78%), Gaps = 15/285 (5%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------  329
            H S  K+ N + +L+    +GV+FG FIG S P + L+K+ + +SL+ ++D         
Sbjct  5    HRSGVKKSNXSARLIFTTILGVVFGFFIGVSLPMVSLSKIRLPSSLITSLDVAFTQLRRP  64

Query  330  ----DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                 S+   ED+      KI+VP+NPRGAE LPP IIVP+SD Y+RRLWGEPS+DL + 
Sbjct  65   SNPPPSNKSLEDEGSEGVPKIYVPTNPRGAETLPPXIIVPQSDLYIRRLWGEPSEDLKVT  124

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            PKYL++ TVG  QK NIDA +KKFS+NFTILLFHYDG+T+EW+EFEWSKRAIHVS  +Q 
Sbjct  125  PKYLVSFTVGINQKMNIDAAIKKFSENFTILLFHYDGRTSEWEEFEWSKRAIHVSVKRQA  184

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPD+VA+YEYIFIWDEDLGVEHF+AE+YI+ VKK+GLEISQPGLE   G  
Sbjct  185  KWWYAKRFLHPDVVAAYEYIFIWDEDLGVEHFNAEKYIQXVKKYGLEISQPGLEPNDG--  242

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTWEMT+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  243  LTWEMTKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  287



>ref|XP_010542587.1| PREDICTED: uncharacterized protein LOC104815743 [Tarenaya hassleriana]
Length=381

 Score =   384 bits (986),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/276 (65%), Positives = 220/276 (80%), Gaps = 11/276 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------DSSNL  344
            +R NE+ KL++   +G++ G FIG +FP++   K+N+ + L++++D              
Sbjct  11   RRTNESAKLIITTILGMVVGFFIGITFPSVSFIKINLPSGLISSLDVAMSNGRLFSGGKS  70

Query  345  TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
             ED    +  KI+VPSNPRGAE LPP I+  E+DFYLRRLWGEPS+DL  KPKYL+T TV
Sbjct  71   PEDFGSREFPKIYVPSNPRGAELLPPGIVEAETDFYLRRLWGEPSEDLKKKPKYLVTFTV  130

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G++Q++NIDA VKKFSD+F ILLFHYDG+TTEWD F+WSK AIH+S  +QTKWWYAKRFL
Sbjct  131  GFEQRNNIDAAVKKFSDDFQILLFHYDGRTTEWDHFDWSKNAIHISVRRQTKWWYAKRFL  190

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPDIV++YE+IFIWDEDLGVEHF+AE+YI+LVKKHGLEISQPGLE   G  LTWEMT+R+
Sbjct  191  HPDIVSAYEFIFIWDEDLGVEHFNAEKYIELVKKHGLEISQPGLEPNNG--LTWEMTKRR  248

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + EVHKET EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  GDREVHKETQEKPGWCSDPHLPPCAAFVEIMAPVFS  284



>ref|XP_010475592.1| PREDICTED: uncharacterized protein LOC104754984 [Camelina sativa]
Length=381

 Score =   384 bits (986),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/281 (64%), Positives = 219/281 (78%), Gaps = 11/281 (4%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------  329
            H S   R+NE  KL++   +G++FG FIG + P+    K+++ + L+++ D         
Sbjct  5    HRSGAPRRNENAKLIITTILGMVFGFFIGITLPSGSFRKISLPSGLMSSFDVAMSDGKLF  64

Query  330  DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
                  ED       KI+VP+NP GAE LPP IIV E+DFYLRRLWGEPS+DL  KPKYL
Sbjct  65   SGGRSPEDFGSRQFPKIYVPTNPHGAELLPPGIIVAETDFYLRRLWGEPSEDLKKKPKYL  124

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG++Q++NI+A VKKFS++F ILLFHYDG+TTEWD+FEWSK+AIH+SA KQTKWWY
Sbjct  125  VTFTVGFEQRNNINAAVKKFSEDFQILLFHYDGRTTEWDQFEWSKKAIHISAKKQTKWWY  184

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPD+V++YEYIFIWDEDLGVEHF+AE YI LVKKHGLEISQPGLE   G  LTWE
Sbjct  185  AKRFLHPDVVSAYEYIFIWDEDLGVEHFNAERYIALVKKHGLEISQPGLEPNNG--LTWE  242

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + +VHKET EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  243  MTKRRGDQDVHKETKEKPGWCSDPHLPPCAAFVEIMAPVFS  283



>gb|KDP44036.1| hypothetical protein JCGZ_05503 [Jatropha curcas]
Length=375

 Score =   384 bits (985),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 181/278 (65%), Positives = 221/278 (79%), Gaps = 5/278 (2%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M +     + ++ NE+ +LVV   +G +FG  +G SFP + L K+++ + LV+  D    
Sbjct  5    MGSILRSGHSRKTNESTRLVVTAILGAVFGFVVGISFPPVSLTKIHMPSGLVSTFD--LP  62

Query  342  LTEDQTVMDPT-KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTL  518
             T++     P  +I+VP NPRGAE LPP I+VPESDFYLRRLWGEPS+DL  KPKYL+T 
Sbjct  63   FTDESRSSKPIPRIYVPKNPRGAESLPPGIVVPESDFYLRRLWGEPSEDLKKKPKYLVTF  122

Query  519  TVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKR  698
            TVGY Q++NI+A V+KFSD+FTI+LFHYDG+T+EWDEFEWSK AIHVS  +QTKWWYAKR
Sbjct  123  TVGYDQRENINAAVQKFSDDFTIMLFHYDGRTSEWDEFEWSKSAIHVSVRRQTKWWYAKR  182

Query  699  FLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTR  878
            FLHPDIVA+YEYIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTW+MT+
Sbjct  183  FLHPDIVAAYEYIFIWDEDLGVEHFNADKYIELVKKHGLEISQPGLEPNNG--LTWQMTK  240

Query  879  RKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            R  +SEVHK T EK GWCSDP LPPC+AFVEIMAPVFS
Sbjct  241  RIGDSEVHKITQEKAGWCSDPLLPPCSAFVEIMAPVFS  278



>ref|XP_002314280.2| hypothetical protein POPTR_0009s01620g [Populus trichocarpa]
 gb|EEE88235.2| hypothetical protein POPTR_0009s01620g [Populus trichocarpa]
Length=382

 Score =   384 bits (986),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 177/277 (64%), Positives = 220/277 (79%), Gaps = 12/277 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----------DSSN  341
            ++ N++ +L++   +GV FG F+G SFPA+   K+++ +S   ++D           S +
Sbjct  11   RKTNDSARLIIVTIVGVAFGFFVGISFPAVTFTKIHIHSSFTLSLDISIVNQNEFRRSKS  70

Query  342  LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLT  521
            L    +  + T I+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+D+  KPKYLLT T
Sbjct  71   LETLGSGSNVTNIYVPTNPRGAELLPPGIVVAESDFYLRRLWGEPSEDMLKKPKYLLTFT  130

Query  522  VGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRF  701
            VGY Q++NI+A VKKFSD+F ILLFHYDG+T+EWD+FEWSK AIHVS  +QTKWWYAKRF
Sbjct  131  VGYDQRNNINAAVKKFSDDFQILLFHYDGRTSEWDQFEWSKSAIHVSVMRQTKWWYAKRF  190

Query  702  LHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRR  881
            LHPDIV +YEYIFIWDEDLGVEHF+ E+YI+L+KKHGLEISQPGLE   G  LTW+MT+R
Sbjct  191  LHPDIVGAYEYIFIWDEDLGVEHFNGEKYIQLIKKHGLEISQPGLEPNNG--LTWQMTKR  248

Query  882  KANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            + + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  RGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  285



>ref|XP_008359351.1| PREDICTED: uncharacterized protein LOC103423052 isoform X2 [Malus 
domestica]
Length=384

 Score =   384 bits (986),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 181/285 (64%), Positives = 222/285 (78%), Gaps = 15/285 (5%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------  329
            H S  K+ N + +L+    +GV+FG FIG S P + L+K+ + +SL+ ++D         
Sbjct  5    HRSGVKKSNXSARLIFTTILGVVFGFFIGVSLPMVSLSKIRLPSSLITSLDVAFTQLRRP  64

Query  330  ----DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                 S+   ED+      KI+VP+NPRGAE LPP IIVP+SD Y+RRLWGEPS+DL + 
Sbjct  65   SNPPPSNKSLEDEGSEGVPKIYVPTNPRGAETLPPXIIVPQSDLYIRRLWGEPSEDLKVT  124

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            PKYL++ TVG  QK NIDA +KKFS+NFTILLFHYDG+T+EW+EFEWSKRAIHVS  +Q 
Sbjct  125  PKYLVSFTVGINQKMNIDAAIKKFSENFTILLFHYDGRTSEWEEFEWSKRAIHVSVKRQA  184

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPD+VA+YEYIFIWDEDLGVEHF+AE+YI+ VKK+GLEISQPGLE   G  
Sbjct  185  KWWYAKRFLHPDVVAAYEYIFIWDEDLGVEHFNAEKYIQXVKKYGLEISQPGLEPNDG--  242

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTWEMT+R+ + EVHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  243  LTWEMTKRRGDREVHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  287



>ref|XP_004971002.1| PREDICTED: uncharacterized protein LOC101768420 isoform X5 [Setaria 
italica]
 ref|XP_004971003.1| PREDICTED: uncharacterized protein LOC101768420 isoform X6 [Setaria 
italica]
Length=401

 Score =   384 bits (986),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 178/293 (61%), Positives = 225/293 (77%), Gaps = 21/293 (7%)
 Frame = +3

Query  171  FGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTE  350
             G  S+  R NE+++++ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++   
Sbjct  7    LGRSSSVPRSNESMRIIFSAVVGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGIT  66

Query  351  DQTVMDPT-------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
             QT+++                     KI+VP+NP+GAERLPP I+  E+D YLRRLWGE
Sbjct  67   TQTLLNHAWTSAASHKNNSVSNPDEIPKIYVPTNPKGAERLPPGIVASETDLYLRRLWGE  126

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            PS+DLT +P+YL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+TTEW+EFEWSKRAI
Sbjct  127  PSEDLTSQPRYLVTFTVGYSQKANIDAAVKKFSENFTIMLFHYDGRTTEWNEFEWSKRAI  186

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVS  KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE YIKLV+KHGLEISQPG
Sbjct  187  HVSVRKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEAYIKLVRKHGLEISQPG  246

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE  KG  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  247  LEPDKG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  297



>ref|XP_011101801.1| PREDICTED: uncharacterized protein LOC105179859 isoform X2 [Sesamum 
indicum]
 ref|XP_011101802.1| PREDICTED: uncharacterized protein LOC105179859 isoform X2 [Sesamum 
indicum]
Length=382

 Score =   383 bits (984),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 179/280 (64%), Positives = 223/280 (80%), Gaps = 21/280 (8%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSSNLTEDQTVMD--  368
            ++L++   +G+IFG  +G SFP L L+K+NV++++ +++D     D  +    Q +++  
Sbjct  1    MRLIITTFVGIIFGFLLGVSFPKLSLSKVNVSSNIFSSIDLTYVEDKHSGLSTQALLNIW  60

Query  369  ------------PTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLL  512
                         T+IWVP+NPRGAERLPP IIVPE+DFY RRLWG P +DL +KP+YL 
Sbjct  61   SHLRGRRARKSNDTEIWVPTNPRGAERLPPGIIVPETDFYTRRLWGLPGEDLIIKPRYLF  120

Query  513  TLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYA  692
            T TVGY+QK+NIDA VKK ++NFTILLFHYDG+T+EWDEFEWSKRAIHVS  KQTKWWYA
Sbjct  121  TFTVGYEQKNNIDAAVKKLTENFTILLFHYDGRTSEWDEFEWSKRAIHVSVRKQTKWWYA  180

Query  693  KRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEM  872
            KRFLHPDIVA Y+YIFIWDEDLGVE+FD EEYIKLVKKHGLEISQPGL    G  +TW+M
Sbjct  181  KRFLHPDIVAPYDYIFIWDEDLGVENFDPEEYIKLVKKHGLEISQPGLSPDSG--MTWQM  238

Query  873  TRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            T+R+ ++EVHK+T+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  239  TKRREDTEVHKDTEERPGWCTDPHLPPCAAFVEIMAPVFS  278



>ref|XP_011044400.1| PREDICTED: uncharacterized protein LOC105139600 isoform X2 [Populus 
euphratica]
Length=364

 Score =   382 bits (982),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 179/267 (67%), Positives = 215/267 (81%), Gaps = 10/267 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDP  371
            ++ N++V+L++   +GV FG F+G SFPA+   K        N    S +L    +  + 
Sbjct  11   RKTNDSVRLIIVTIVGVAFGFFVGISFPAVTYTK--------NEFRRSKSLETLGSGSNV  62

Query  372  TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNID  551
            TKI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+D+  KPKYLLT TVGY Q++NI+
Sbjct  63   TKIYVPTNPRGAELLPPGIVVAESDFYLRRLWGEPSEDMLKKPKYLLTFTVGYDQRNNIN  122

Query  552  AVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYE  731
            A VKKFSD+F ILLFHYDG+T+EWD+FEWSK AIHVS  +QTKWWYAKRFLHPDIV +YE
Sbjct  123  AAVKKFSDDFQILLFHYDGRTSEWDQFEWSKSAIHVSVVRQTKWWYAKRFLHPDIVGAYE  182

Query  732  YIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKET  911
            YIFIWDEDLGVEHF+ E+YI+LVKKHGLEISQPGLE   G  LTW+MT+R+ + EVHK+T
Sbjct  183  YIFIWDEDLGVEHFNGEKYIQLVKKHGLEISQPGLEPNNG--LTWQMTKRRGDREVHKDT  240

Query  912  DEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            +EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  241  EEKPGWCSDPHLPPCAAFVEIMAPVFS  267



>ref|XP_008379197.1| PREDICTED: uncharacterized protein LOC103442207 [Malus domestica]
Length=402

 Score =   384 bits (985),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 188/293 (64%), Positives = 222/293 (76%), Gaps = 25/293 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS---------  335
             N +  NET++L V + +GV+ G F+G SF  + L K+N+ ++L  ++D S         
Sbjct  8    GNLRNPNETMRLAVTIFVGVVVGFFLGVSFSTISLTKMNLPSTLFPSIDLSCIEEKYSGF  67

Query  336  ---------SNLTEDQT-----VMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
                     S+L  ++      V   TKIWVP+NPRGAE L P II  ESDFYL RLWG 
Sbjct  68   STQAMLSAWSSLKGNEQRTEKYVSQDTKIWVPTNPRGAESLAPGIIASESDFYLHRLWGL  127

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            PS+DL +KPKYL+T TVG  QK N+DA VKKFS+NFTILLFHYDG T+EWDEFEWSKRAI
Sbjct  128  PSEDLLVKPKYLVTFTVGCAQKKNVDAAVKKFSENFTILLFHYDGLTSEWDEFEWSKRAI  187

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            H+S  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLG+EHFDAE+YIKLVKKHGLEISQPG
Sbjct  188  HMSIQKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGLEHFDAEKYIKLVKKHGLEISQPG  247

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            L+ K G  LTW+MTRR+ NSEVH +T+E+ GWCSDPHLPPCA+FVEIMAPVFS
Sbjct  248  LDPKSG--LTWQMTRRRENSEVHMQTEERPGWCSDPHLPPCASFVEIMAPVFS  298



>ref|XP_011044399.1| PREDICTED: uncharacterized protein LOC105139600 isoform X1 [Populus 
euphratica]
Length=368

 Score =   382 bits (982),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 182/272 (67%), Positives = 217/272 (80%), Gaps = 11/272 (4%)
 Frame = +3

Query  180  CSNGKRQ-NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQ  356
            CS   R+ N++V+L++   +GV FG F+G SFPA+   K        N    S +L    
Sbjct  10   CSGVYRKTNDSVRLIIVTIVGVAFGFFVGISFPAVTYTK--------NEFRRSKSLETLG  61

Query  357  TVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQ  536
            +  + TKI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+D+  KPKYLLT TVGY Q
Sbjct  62   SGSNVTKIYVPTNPRGAELLPPGIVVAESDFYLRRLWGEPSEDMLKKPKYLLTFTVGYDQ  121

Query  537  KDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDI  716
            ++NI+A VKKFSD+F ILLFHYDG+T+EWD+FEWSK AIHVS  +QTKWWYAKRFLHPDI
Sbjct  122  RNNINAAVKKFSDDFQILLFHYDGRTSEWDQFEWSKSAIHVSVVRQTKWWYAKRFLHPDI  181

Query  717  VASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSE  896
            V +YEYIFIWDEDLGVEHF+ E+YI+LVKKHGLEISQPGLE   G  LTW+MT+R+ + E
Sbjct  182  VGAYEYIFIWDEDLGVEHFNGEKYIQLVKKHGLEISQPGLEPNNG--LTWQMTKRRGDRE  239

Query  897  VHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            VHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  240  VHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  271



>ref|XP_010043761.1| PREDICTED: uncharacterized protein LOC104432886 [Eucalyptus grandis]
 gb|KCW85754.1| hypothetical protein EUGRSUZ_B02511 [Eucalyptus grandis]
Length=377

 Score =   382 bits (982),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 174/272 (64%), Positives = 225/272 (83%), Gaps = 7/272 (3%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTEDQT  359
            K+ N+  ++++A  +GV+FG FIG SFP++ L K+N  +S+++++D    +S ++++   
Sbjct  11   KKSNDRARIIIATILGVLFGFFIGISFPSVSLTKINFHSSIISSLDLISDESRSISKSSD  70

Query  360  VMDPT-KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQ  536
             +    KI+VP+NPRGAE LPP+IIV E+DFYLRRLWGEP++DL  KPKYL+T TVG+ Q
Sbjct  71   NLGSIPKIYVPTNPRGAESLPPNIIVSETDFYLRRLWGEPNEDLKKKPKYLVTFTVGFDQ  130

Query  537  KDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDI  716
            + NI+A ++KFS+ F ILLFHYDG+ +EWD+FEWSK AIH+S  KQTKWWYAKRFLHPD+
Sbjct  131  RRNIEASIRKFSEEFQILLFHYDGRVSEWDQFEWSKDAIHISVKKQTKWWYAKRFLHPDV  190

Query  717  VASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSE  896
            VA+YEYIFIWDEDLGVEHF+ E+YI+LVKKHGLEISQPGLE   G  LTW+MT+R+ + E
Sbjct  191  VAAYEYIFIWDEDLGVEHFNGEKYIQLVKKHGLEISQPGLEPNNG--LTWQMTKRRGDRE  248

Query  897  VHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            VHK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  VHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  280



>ref|XP_006604007.1| PREDICTED: uncharacterized protein LOC100776711 isoform X1 [Glycine 
max]
Length=403

 Score =   384 bits (985),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 227/294 (77%), Gaps = 26/294 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS---------  335
             N KRQNE ++L +A  +GV+FG  +G SFP L L ++N+ +SL+ ++D +         
Sbjct  8    GNIKRQNEAMRLTLATFVGVVFGFSLGVSFPTLALTRMNLPSSLLPSIDLTYVDDNYSKI  67

Query  336  ---------SNLTEDQTV------MDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
                     ++   D+++      ++ TKIWVP+NPRGAERLPP I+  ESDFYL RLWG
Sbjct  68   STKSLWDAWASFRRDRSMYKKVHKLNDTKIWVPTNPRGAERLPPKIVKSESDFYLHRLWG  127

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
             P QDL++KPKYL+T TVG  QKDNIDA VKKFS+NFTI+LFHYDG+ ++W++FEWSKRA
Sbjct  128  MPYQDLSIKPKYLVTFTVGSDQKDNIDAAVKKFSENFTIVLFHYDGRASDWEKFEWSKRA  187

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IH+SA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFDAEEY+K+V+KHGLEISQP
Sbjct  188  IHISARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDAEEYLKMVRKHGLEISQP  247

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            G++       TW+MTR++ + EVHK+ +E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  GIDPSSS--FTWQMTRKRDSGEVHKKAEERSGWCSDPHLPPCAAFVEIMAPVFS  299



>emb|CBI34843.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   383 bits (983),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 187/286 (65%), Positives = 224/286 (78%), Gaps = 27/286 (9%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASL-----VNNVDDSSNLTEDQTVMD--  368
            ++L+V   IGV+ G F+G SFP L L K+++ +SL     +N ++D  +    Q +++  
Sbjct  1    MRLIVTAFIGVVVGFFLGVSFPTLSLTKMSLPSSLFPSIDLNYLEDKYSGLSTQALLNVW  60

Query  369  -----------------PTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                              TKIWVP+NPRGAERLPP IIV ESDFYLRRLWG PS+DLT+K
Sbjct  61   SSLKRNRGTASHFYKFNETKIWVPTNPRGAERLPPGIIVSESDFYLRRLWGLPSEDLTIK  120

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            P+YL+T TVG  QK+NIDA VKKFS++FTILLFHYDG+ +EWDEFEWSKRAIHVS  KQT
Sbjct  121  PRYLVTFTVGIAQKNNIDAAVKKFSESFTILLFHYDGRVSEWDEFEWSKRAIHVSVQKQT  180

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLE-RKKGV  854
            KWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHFDAEEYIKLV+KHGLEISQPGL+ + KG 
Sbjct  181  KWWYAKRFLHPDIVAPYDYIFMWDEDLGVEHFDAEEYIKLVRKHGLEISQPGLDPQSKG-  239

Query  855  WLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             LTW+MT+++ NSEVHKET E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  240  -LTWQMTKKRDNSEVHKETQERPGWCTDPHLPPCAAFVEIMATVFS  284



>dbj|BAJ92182.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93237.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   384 bits (985),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 178/284 (63%), Positives = 225/284 (79%), Gaps = 22/284 (8%)
 Frame = +3

Query  201  NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDPT--  374
            NET+++V+   IGV+ G FIG SFP++ + KL+  +S V+ +++ ++    Q +++    
Sbjct  16   NETMRIVMVTVIGVVLGFFIGISFPSVSITKLHFPSSFVSYIEERNSGLSTQALLNHAWD  75

Query  375  ------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKP  500
                              KI+VP+NP+GAERL P I+VP++DF+LRRLWG+PS+DL  KP
Sbjct  76   SVRNARENTSEPNTNTTLKIYVPTNPKGAERLAPGIVVPDTDFHLRRLWGDPSEDLPFKP  135

Query  501  KYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTK  680
            KYL+T TVGY QK+NI+  VKKFSDNF ILLFHYDG+ TEWDEFEWSKRAIHVS  KQTK
Sbjct  136  KYLVTFTVGYAQKENINRAVKKFSDNFAILLFHYDGRVTEWDEFEWSKRAIHVSVSKQTK  195

Query  681  WWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWL  860
            WWYAKRFLHPDIVA+YEYIFIWDEDLGV+HF+AEEY+KLVKK+GL+ISQPGLE  +G  L
Sbjct  196  WWYAKRFLHPDIVAAYEYIFIWDEDLGVDHFNAEEYLKLVKKNGLDISQPGLEPDRG--L  253

Query  861  TWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            TW+MT+R+ + EVHKET+E+ GWC++PHLPPCAAFVEIMAPVFS
Sbjct  254  TWQMTKRRGDREVHKETEERPGWCANPHLPPCAAFVEIMAPVFS  297



>ref|XP_004970998.1| PREDICTED: uncharacterized protein LOC101768420 isoform X1 [Setaria 
italica]
 ref|XP_004970999.1| PREDICTED: uncharacterized protein LOC101768420 isoform X2 [Setaria 
italica]
 ref|XP_004971000.1| PREDICTED: uncharacterized protein LOC101768420 isoform X3 [Setaria 
italica]
Length=438

 Score =   385 bits (988),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 178/293 (61%), Positives = 225/293 (77%), Gaps = 21/293 (7%)
 Frame = +3

Query  171  FGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTE  350
             G  S+  R NE+++++ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++   
Sbjct  44   LGRSSSVPRSNESMRIIFSAVVGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGIT  103

Query  351  DQTVMDPT-------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
             QT+++                     KI+VP+NP+GAERLPP I+  E+D YLRRLWGE
Sbjct  104  TQTLLNHAWTSAASHKNNSVSNPDEIPKIYVPTNPKGAERLPPGIVASETDLYLRRLWGE  163

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            PS+DLT +P+YL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+TTEW+EFEWSKRAI
Sbjct  164  PSEDLTSQPRYLVTFTVGYSQKANIDAAVKKFSENFTIMLFHYDGRTTEWNEFEWSKRAI  223

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVS  KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE YIKLV+KHGLEISQPG
Sbjct  224  HVSVRKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEAYIKLVRKHGLEISQPG  283

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE  KG  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  284  LEPDKG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  334



>emb|CDM85600.1| unnamed protein product [Triticum aestivum]
Length=401

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/290 (63%), Positives = 224/290 (77%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S+  R NE ++LV +  IG++ G   G SFP + + KL+  +S+V+ ++D ++    QT+
Sbjct  10   SSMPRSNEGMRLVFSAVIGIMLGYLFGISFPTVNITKLHFPSSIVSYIEDRNSGITTQTL  69

Query  363  MDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+V SNP+GAERLPP I+V E+D YLRRLWGEPS+
Sbjct  70   LNHAWTSANSHKKNNSDSKSDEIPKIYVTSNPKGAERLPPGIVVSETDLYLRRLWGEPSE  129

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT++PKYL+T TVG  QK NIDA VKKFS+NFTI+LFHYDG+TTEWDEFEWSKRAIHVS
Sbjct  130  DLTIQPKYLVTFTVGIAQKANIDAAVKKFSENFTIMLFHYDGRTTEWDEFEWSKRAIHVS  189

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGV+HF+AEEYIKLV+KHGLEISQPGLE 
Sbjct  190  VSKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVQHFNAEEYIKLVRKHGLEISQPGLEP  249

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +G  LTW+MT+R+ + EVHK T+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  250  DRG--LTWQMTKRRGDREVHKVTEERPGWCSDPHLPPCAAFVEIMATVFS  297



>ref|XP_006846795.1| hypothetical protein AMTR_s00148p00059020 [Amborella trichopoda]
 gb|ERN08376.1| hypothetical protein AMTR_s00148p00059020 [Amborella trichopoda]
Length=397

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/285 (64%), Positives = 222/285 (78%), Gaps = 20/285 (7%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------  329
            ++ N+  + ++   +GV+FG  +G SFPA+ + KLN+ +SL   +D              
Sbjct  2    RKSNDPGRPILTTVLGVVFGFLVGISFPAISITKLNLPSSLRPAIDFAFEGKSSVIYSRA  61

Query  330  ----DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                   N   D  V +  +I+V +NPRGAE LPP IIV ESDFYLRRLWGEP++DL ++
Sbjct  62   SQTNSHKNKDIDTRVPNQPRIFVATNPRGAETLPPGIIVAESDFYLRRLWGEPNEDLKIR  121

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            PKYL+T TVG+ Q++NI+A +KKFSD+F ILLFHYDG+TT+WD+FEWSK AIHVS  KQT
Sbjct  122  PKYLVTFTVGFDQRNNINAAIKKFSDDFQILLFHYDGRTTDWDQFEWSKHAIHVSVRKQT  181

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA+YEYIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE  KG  
Sbjct  182  KWWYAKRFLHPDIVAAYEYIFIWDEDLGVEHFNADKYIQLVKKHGLEISQPGLEPDKG--  239

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ NSEVHKET+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  240  LTWQMTKRRGNSEVHKETEEKPGWCSDPHLPPCAAFVEIMAPVFS  284



>gb|KHG06071.1| Trimethylguanosine synthase [Gossypium arboreum]
Length=381

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/276 (65%), Positives = 220/276 (80%), Gaps = 11/276 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDP  371
            K+ N+  +LV+A  +G++ G FIG SFP++   K+++ ++L ++ D S    +D  V  P
Sbjct  11   KKTNDKARLVIATILGIVIGFFIGVSFPSVSFYKIHLPSNLRSSFDASIANDQDFMVRSP  70

Query  372  TK---------IWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
             +         I+VP+NPRGAE LPP I+VPESD YLRRLWGEPS+DL  KPKYL+T TV
Sbjct  71   ERTADNLPKVPIYVPTNPRGAELLPPGIVVPESDLYLRRLWGEPSEDLKKKPKYLVTFTV  130

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G+ Q++NID  VKKFS++F ILLFHYDG+TTEWD+FEWSK AIHVS  KQTKWWYAKRFL
Sbjct  131  GFDQRNNIDKCVKKFSEDFQILLFHYDGRTTEWDQFEWSKNAIHVSVKKQTKWWYAKRFL  190

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPD+V++YEYIFIWDEDLGVEHF+AE YI+LVKKHGLEISQPGLE   G  LTW+MT+R+
Sbjct  191  HPDVVSAYEYIFIWDEDLGVEHFNAERYIELVKKHGLEISQPGLEPNNG--LTWQMTKRR  248

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  GDREVHKFTEEKPGWCSDPHLPPCAAFVEIMAPVFS  284



>ref|XP_007016774.1| T6D22.12 isoform 3 [Theobroma cacao]
 gb|EOY34393.1| T6D22.12 isoform 3 [Theobroma cacao]
Length=381

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 220/275 (80%), Gaps = 10/275 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTEDQ-  356
            K+ N++ ++++   +GV+FG FIG SFP   LNK+++ +SL++++D    D ++   D+ 
Sbjct  11   KKTNDSARIIIITILGVVFGFFIGVSFPYASLNKIHLPSSLISSLDVALPDDNDFPRDRS  70

Query  357  ---TVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVG  527
               T  +  KI+VP+NPRGAE LPP I+V ESD YLRRLWGEP +DL  KPKYL+T TVG
Sbjct  71   PETTGGNVPKIYVPTNPRGAELLPPGIVVAESDLYLRRLWGEPGEDLKKKPKYLVTFTVG  130

Query  528  YKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLH  707
              Q++NIDA VKKFS++F ILLFHYDG TTEWD+FEWSK AIHVS  KQTKWWYAKRFLH
Sbjct  131  IAQRNNIDACVKKFSEDFQILLFHYDGHTTEWDQFEWSKNAIHVSVRKQTKWWYAKRFLH  190

Query  708  PDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKA  887
            PDIVASYEYIFIWDEDLGVEHF+ E YI+LVKKHGLEISQPGLE   G  LTW+MT+R+ 
Sbjct  191  PDIVASYEYIFIWDEDLGVEHFNGERYIELVKKHGLEISQPGLEPNNG--LTWQMTKRRG  248

Query  888  NSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            + EVHK T+EK GWCSD HLPPCAAFVEIMAPVFS
Sbjct  249  DREVHKITEEKPGWCSDSHLPPCAAFVEIMAPVFS  283



>ref|XP_007016772.1| T6D22.12 isoform 1 [Theobroma cacao]
 ref|XP_007016773.1| T6D22.12 isoform 1 [Theobroma cacao]
 gb|EOY34391.1| T6D22.12 isoform 1 [Theobroma cacao]
 gb|EOY34392.1| T6D22.12 isoform 1 [Theobroma cacao]
Length=380

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 220/275 (80%), Gaps = 10/275 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTEDQ-  356
            K+ N++ ++++   +GV+FG FIG SFP   LNK+++ +SL++++D    D ++   D+ 
Sbjct  11   KKTNDSARIIIITILGVVFGFFIGVSFPYASLNKIHLPSSLISSLDVALPDDNDFPRDRS  70

Query  357  ---TVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVG  527
               T  +  KI+VP+NPRGAE LPP I+V ESD YLRRLWGEP +DL  KPKYL+T TVG
Sbjct  71   PETTGGNVPKIYVPTNPRGAELLPPGIVVAESDLYLRRLWGEPGEDLKKKPKYLVTFTVG  130

Query  528  YKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLH  707
              Q++NIDA VKKFS++F ILLFHYDG TTEWD+FEWSK AIHVS  KQTKWWYAKRFLH
Sbjct  131  IAQRNNIDACVKKFSEDFQILLFHYDGHTTEWDQFEWSKNAIHVSVRKQTKWWYAKRFLH  190

Query  708  PDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKA  887
            PDIVASYEYIFIWDEDLGVEHF+ E YI+LVKKHGLEISQPGLE   G  LTW+MT+R+ 
Sbjct  191  PDIVASYEYIFIWDEDLGVEHFNGERYIELVKKHGLEISQPGLEPNNG--LTWQMTKRRG  248

Query  888  NSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            + EVHK T+EK GWCSD HLPPCAAFVEIMAPVFS
Sbjct  249  DREVHKITEEKPGWCSDSHLPPCAAFVEIMAPVFS  283



>ref|XP_009379954.1| PREDICTED: uncharacterized protein LOC103968450 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=383

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 220/285 (77%), Gaps = 12/285 (4%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLT  347
            N GH    +  N+ +++++ + +GV+ G FIG SFP   + KL++  S+   ++D ++  
Sbjct  6    NMGHSGFLRYPNDCMRIIINIFVGVVIGFFIGVSFPTANMPKLHLAGSITTCIEDKNSAF  65

Query  348  EDQTVM----------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
              Q ++          D +KI+VP NPRGAERLPP+IIV +SD Y RRLWG PS+D  ++
Sbjct  66   ATQALLNHTWPSIHYNDTSKIYVPKNPRGAERLPPNIIVSKSDLYPRRLWGNPSEDFQIQ  125

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
             KYL+T TVGY QK+NIDA VKKFS+NFTI+LFHYDG+T+EWDEFEWSKRAIHVSA KQT
Sbjct  126  QKYLVTFTVGYDQKNNIDAAVKKFSENFTIMLFHYDGRTSEWDEFEWSKRAIHVSARKQT  185

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWW+AKRFLHPDIV SYE+IFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGL+  K   
Sbjct  186  KWWFAKRFLHPDIVDSYEFIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLQPSKD--  243

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW MT R+  SEVHKET EK G CSDPHLPPCAAFVEIMA VFS
Sbjct  244  LTWLMTMRREGSEVHKETKEKHGRCSDPHLPPCAAFVEIMATVFS  288



>ref|XP_004504126.1| PREDICTED: uncharacterized protein LOC101498964 [Cicer arietinum]
Length=394

 Score =   382 bits (980),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 231/289 (80%), Gaps = 22/289 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASL-----VNNVDDSSNLT  347
            +  ++ +E+++L++   +G+IFG FIG S+P L   KLN+++SL     V++++D    T
Sbjct  5    TRSRKPSESMRLILTTFVGIIFGFFIGISYPTL-TTKLNISSSLLPSIDVSSIEDEYAST  63

Query  348  EDQTVM--------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
              ++ M              D  KIWVPS+PRGAERLPP II  ESDFYLRRLWGEPS+D
Sbjct  64   NARSFMKNNGSSSSKHLLLNDTLKIWVPSSPRGAERLPPAIIEAESDFYLRRLWGEPSED  123

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            LT KPKYL+T TVGY QK+NIDA VKKFS NFTILLFHYDG+TTEWDEFEWSK+AIHVSA
Sbjct  124  LTSKPKYLVTFTVGYDQKNNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQAIHVSA  183

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEY+KLV+KHGLEISQPGLE  
Sbjct  184  RKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYLKLVRKHGLEISQPGLEPN  243

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             G  LTW+MT+R+ + EVHKET+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  244  NG--LTWQMTKRRGDREVHKETEEKPGWCSDPHLPPCAAFVEIMAPVFS  290



>ref|XP_011014025.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014026.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014027.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014028.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014029.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014030.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014031.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
Length=399

 Score =   382 bits (980),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 223/291 (77%), Gaps = 26/291 (9%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----DSSNLTEDQ  356
            K+ +E ++L +   IG+IFG F+G SFP L L+K+N+ +SL  ++D     D  +    Q
Sbjct  11   KKPSEMMRLFMTTFIGIIFGFFLGISFPTLSLSKMNLPSSLFPSIDLTYIEDKYSGLSKQ  70

Query  357  TVMDP-------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPS  479
             + +                    T+IWVP+NPRGAERLPP I+  ESDFYLRRLWG PS
Sbjct  71   ALFNAWASLKGNKEASPLLPRYNKTEIWVPTNPRGAERLPPGIVASESDFYLRRLWGLPS  130

Query  480  QDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHV  659
            +DLT++P+YL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+TTEWDEFEWSKR +H+
Sbjct  131  EDLTIEPRYLVTFTVGYDQKKNIDAAVKKFSENFTIVLFHYDGRTTEWDEFEWSKRTVHI  190

Query  660  SAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLE  839
            SA KQTKWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHFDAE+YIKLV+KHGLEISQPGL+
Sbjct  191  SARKQTKWWYAKRFLHPDIVAPYDYIFLWDEDLGVEHFDAEKYIKLVRKHGLEISQPGLD  250

Query  840  RKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
              +G   TW MT+R+   EVHK+T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  251  PDRGT--TWAMTKRRDGIEVHKDTEERPGWCTDPHLPPCAAFVEIMATVFS  299



>ref|XP_009620378.1| PREDICTED: uncharacterized protein LOC104112222 [Nicotiana tomentosiformis]
Length=394

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 189/281 (67%), Positives = 220/281 (78%), Gaps = 16/281 (6%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLV----------NNVDD  332
            SN     ET++L+V++  GVIFGLFIG SFPA  L KLN+T S+           NN+D 
Sbjct  5    SNCLNPAETMRLIVSICCGVIFGLFIGISFPAGSLTKLNITTSMFVSNFPIARDRNNIDS  64

Query  333  SSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLT-MKPKYL  509
            S    ++Q   D  KIWV SNPRGAERLPP+II  ESD+Y RRLWG+P++DL   KPKYL
Sbjct  65   S---IKNQNGTDKVKIWVESNPRGAERLPPEIIASESDYYTRRLWGKPNEDLPPSKPKYL  121

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG  QK N+DA VKKFSD+ TILLFHYDG+TTEWDEFEWSKRAIHVSA KQTKWWY
Sbjct  122  VTFTVGINQKYNVDANVKKFSDDSTILLFHYDGKTTEWDEFEWSKRAIHVSARKQTKWWY  181

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPDIVA Y+YIFIWDEDLGVEHFDA+EYI+LVKKHGLEISQPGL+ KKG   TW+
Sbjct  182  AKRFLHPDIVAPYDYIFIWDEDLGVEHFDAKEYIRLVKKHGLEISQPGLDPKKGT--TWQ  239

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + E+H   +EK G C D HLPPC+AF+EIMAPVFS
Sbjct  240  MTKRRGDGEIHMIAEEKPGVCPDSHLPPCSAFIEIMAPVFS  280



>ref|XP_010232719.1| PREDICTED: uncharacterized protein LOC100831721 isoform X1 [Brachypodium 
distachyon]
Length=402

 Score =   381 bits (979),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 224/294 (76%), Gaps = 22/294 (7%)
 Frame = +3

Query  171  FGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTE  350
             G  S+  R NE ++L+ +  IGV+ G   G SFP + + KL+  +S+V+ ++D ++   
Sbjct  7    LGRSSSMPRSNEGMRLIFSAVIGVMLGYLFGISFPTVNITKLHFPSSIVSYIEDRNSGIT  66

Query  351  DQTVMDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
             QT+++                      KI+V SNP+GAERLPP I+V E+D Y RRLWG
Sbjct  67   TQTLLNHAWTSANSHKKNNSDSKSDEIPKIYVTSNPKGAERLPPGIVVSETDLYPRRLWG  126

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
            EPS+DLT++P+YL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+TTEWDEFEWSKRA
Sbjct  127  EPSEDLTIQPRYLVTFTVGYAQKANIDAAVKKFSENFTIMLFHYDGRTTEWDEFEWSKRA  186

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGV+HF+AE YI+LVKKHGLEISQP
Sbjct  187  IHVSVSKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVQHFNAEAYIELVKKHGLEISQP  246

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE  +G  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  247  GLEPDRG--LTWQMTKRRGDREVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  298



>ref|XP_009779721.1| PREDICTED: uncharacterized protein LOC104228871 [Nicotiana sylvestris]
Length=394

 Score =   381 bits (978),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 188/281 (67%), Positives = 220/281 (78%), Gaps = 16/281 (6%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLV----------NNVDD  332
            SN     ET++L+V++  GVIFGLFIG SFP   L KLN+T S+           NN+D 
Sbjct  5    SNCLNPAETMRLIVSICCGVIFGLFIGISFPTSSLTKLNITTSMFVSNFPIARDRNNIDS  64

Query  333  SSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLT-MKPKYL  509
            S    ++Q      KIWV SNPRGAERLPP+II  ESD+Y RRLWG+P++DL   KPKYL
Sbjct  65   S---IKNQNGTHQVKIWVESNPRGAERLPPEIIASESDYYTRRLWGKPNEDLPPSKPKYL  121

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG  QK N+DA VKKFSD+FTILLFHYDG+TTEWDEFEWSKRAIHVSA KQTKWWY
Sbjct  122  VTFTVGINQKYNVDANVKKFSDDFTILLFHYDGKTTEWDEFEWSKRAIHVSARKQTKWWY  181

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPDIVA Y+YIFIWDEDLGVEHFDA+EYI+LVKKHGLEISQPGL+ KKG   TW+
Sbjct  182  AKRFLHPDIVAPYDYIFIWDEDLGVEHFDAKEYIRLVKKHGLEISQPGLDPKKGT--TWQ  239

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+++ E+H   +EK G C D HLPPC+AF+EIMAPVFS
Sbjct  240  MTKRRSDGEIHMIAEEKPGVCPDSHLPPCSAFIEIMAPVFS  280



>ref|XP_004231837.1| PREDICTED: uncharacterized protein LOC101259691 [Solanum lycopersicum]
Length=399

 Score =   381 bits (978),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 183/290 (63%), Positives = 224/290 (77%), Gaps = 23/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTE  350
            SN +R+NE ++L V   IGV+FG F+G +FP + L+KL +  +L+ ++D    + S L+ 
Sbjct  9    SNSRRRNEKMRLFVTTFIGVVFGFFLGVTFPTISLSKLPLPTNLIPSIDLPDMEKSGLST  68

Query  351  DQTVMD----------------PTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
             Q +++                  KIWVPSNPRGAERLPP I+  ESD Y RRLWG PS+
Sbjct  69   -QALLNVLNSLKDRVGSSHKNKAAKIWVPSNPRGAERLPPGIVASESDLYTRRLWGLPSE  127

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DL +KP+YL+T TVG KQK NIDA VKKFS+NFTI+LFHYDG+TTEWD+ EWS RAIHVS
Sbjct  128  DLIIKPRYLVTFTVGLKQKSNIDAAVKKFSENFTIMLFHYDGRTTEWDDLEWSARAIHVS  187

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+E+F+AEEYIKLV KHGL+ISQPGLE 
Sbjct  188  TPKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLENFNAEEYIKLVTKHGLDISQPGLEP  247

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
              G  LTW+MT+ + ++EVHKET+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  248  NSG--LTWQMTKGRNDTEVHKETEERPGWCADPHLPPCAAFVEIMAPVFS  295



>ref|XP_004971001.1| PREDICTED: uncharacterized protein LOC101768420 isoform X4 [Setaria 
italica]
Length=437

 Score =   382 bits (981),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 177/289 (61%), Positives = 224/289 (78%), Gaps = 21/289 (7%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S+  R NE+++++ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++    QT+
Sbjct  47   SSVPRSNESMRIIFSAVVGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITTQTL  106

Query  363  MDPT-------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
            ++                     KI+VP+NP+GAERLPP I+  E+D YLRRLWGEPS+D
Sbjct  107  LNHAWTSAASHKNNSVSNPDEIPKIYVPTNPKGAERLPPGIVASETDLYLRRLWGEPSED  166

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            LT +P+YL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+TTEW+EFEWSKRAIHVS 
Sbjct  167  LTSQPRYLVTFTVGYSQKANIDAAVKKFSENFTIMLFHYDGRTTEWNEFEWSKRAIHVSV  226

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE YIKLV+KHGLEISQPGLE  
Sbjct  227  RKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEAYIKLVRKHGLEISQPGLEPD  286

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            KG  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  287  KG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  333



>ref|NP_001045532.1| Os01g0971200 [Oryza sativa Japonica Group]
 dbj|BAD87361.1| lysine ketoglutarate reductase trans-splicing related 1-like 
[Oryza sativa Japonica Group]
 dbj|BAF07446.1| Os01g0971200 [Oryza sativa Japonica Group]
 gb|EAZ14986.1| hypothetical protein OsJ_04921 [Oryza sativa Japonica Group]
 dbj|BAG95217.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/290 (62%), Positives = 222/290 (77%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S  ++ NE+++L+V   IGV+ G FIG SFPA+ + KL+  +S+V+ ++D ++    Q +
Sbjct  10   SAPRKPNESMRLLVVTVIGVMLGFFIGISFPAVSITKLHFPSSIVSYIEDKNSALTAQAI  69

Query  363  MD--------------------PTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+VP+NPRGAE L P I+VPESDF+ RRLWG P +
Sbjct  70   LNHAWTAARNAKGNDTESSSDTAMKIYVPTNPRGAESLAPGIVVPESDFHPRRLWGNPDE  129

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DL  KPKYL+T TVG  QK+NI+  VKKFSDNF ILLFHYDG+ +EWDEFEWSKRAIHVS
Sbjct  130  DLPFKPKYLVTFTVGISQKENINRAVKKFSDNFAILLFHYDGRVSEWDEFEWSKRAIHVS  189

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              +Q KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHF+AEEYIKLVKK+ LEISQPGLE 
Sbjct  190  VRRQAKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFNAEEYIKLVKKYQLEISQPGLEP  249

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +G  LTW+MT+R+ + +VHKET+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  250  DRG--LTWQMTKRRGDHQVHKETEERPGWCTDPHLPPCAAFVEIMAPVFS  297



>ref|XP_007031620.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY02546.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=410

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 222/297 (75%), Gaps = 32/297 (11%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------  329
            ++ NET++L++    G+IFG F+G SFP + L K+N  +SL  ++D              
Sbjct  7    RKTNETMRLLITTFAGIIFGFFLGVSFPTISLTKMNFPSSLFPSIDITYIEDKYSGLSTE  66

Query  330  ---DSSNLTEDQTVM-------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPS  479
               D+ N  +   VM       + TKIW+P+NPRGAERLPPDII  ESD Y RRLWG+PS
Sbjct  67   ALLDAFNTFKANKVMSVPSSKDNETKIWIPTNPRGAERLPPDIIESESDLYPRRLWGQPS  126

Query  480  Q------DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWS  641
            +      DLT+KPKYL+T TVG  QK NIDA VKKFS+NFTI+LFHYDGQ + WDEFEWS
Sbjct  127  EVCIFYTDLTIKPKYLVTFTVGISQKYNIDAAVKKFSENFTIMLFHYDGQASAWDEFEWS  186

Query  642  KRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEI  821
            KRAIHVS  KQTKWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHFDAEEYIKLV+KHGLEI
Sbjct  187  KRAIHVSVRKQTKWWYAKRFLHPDIVAPYDYIFMWDEDLGVEHFDAEEYIKLVRKHGLEI  246

Query  822  SQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            SQPGLE   G  LTW MTR++ ++EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  247  SQPGLEPNSG--LTWAMTRKRDDTEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  301



>ref|XP_007031624.1| Uncharacterized protein isoform 7 [Theobroma cacao]
 gb|EOY02550.1| Uncharacterized protein isoform 7 [Theobroma cacao]
Length=392

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 217/285 (76%), Gaps = 26/285 (9%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----------------DSS  338
            ++L++    G+IFG F+G SFP + L K+N  +SL  ++D                 D+ 
Sbjct  1    MRLLITTFAGIIFGFFLGVSFPTISLTKMNFPSSLFPSIDITYIEDKYSGLSTEALLDAF  60

Query  339  NLTEDQTVM-------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
            N  +   VM       + TKIW+P+NPRGAERLPPDII  ESD Y RRLWG+PS+DLT+K
Sbjct  61   NTFKANKVMSVPSSKDNETKIWIPTNPRGAERLPPDIIESESDLYPRRLWGQPSEDLTIK  120

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            PKYL+T TVG  QK NIDA VKKFS+NFTI+LFHYDGQ + WDEFEWSKRAIHVS  KQT
Sbjct  121  PKYLVTFTVGISQKYNIDAAVKKFSENFTIMLFHYDGQASAWDEFEWSKRAIHVSVRKQT  180

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIF+WDEDLGVEHFDAEEYIKLV+KHGLEISQPGLE   G  
Sbjct  181  KWWYAKRFLHPDIVAPYDYIFMWDEDLGVEHFDAEEYIKLVRKHGLEISQPGLEPNSG--  238

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW MTR++ ++EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  239  LTWAMTRKRDDTEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  283



>ref|XP_009127584.1| PREDICTED: uncharacterized protein LOC103852432 [Brassica rapa]
Length=404

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 186/285 (65%), Positives = 215/285 (75%), Gaps = 24/285 (8%)
 Frame = +3

Query  204  ETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-------DSSNLTEDQTV  362
            + +K++ A   GV FG  IG SFP+L + K+N+    + + D        S+  T D   
Sbjct  15   DGMKIIAAAFFGVTFGFLIGISFPSLSITKVNLPTKFLASNDLSYIEEKGSAIATPDSHK  74

Query  363  ---------------MDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                           +D ++IWVPSNPRGAERLPP I+  ESDFYLRRLWG P +DLT +
Sbjct  75   SWSSSKSNDTSSSAPIDKSQIWVPSNPRGAERLPPGIVAAESDFYLRRLWGLPHEDLTRQ  134

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            P+YL+T TVG KQK NIDA VKKFS+NFTILLFHYDG+ TEWDEFEWSK AIH+S  KQT
Sbjct  135  PRYLVTFTVGIKQKQNIDACVKKFSENFTILLFHYDGRVTEWDEFEWSKTAIHISVRKQT  194

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLVKKHGLEISQPGLE  KG  
Sbjct  195  KWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEEYIKLVKKHGLEISQPGLEPNKG--  252

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  253  LTWQMTKRRGDLEVHKITEEKPGWCSDPHLPPCAAFVEIMAPVFS  297



>ref|XP_006338630.1| PREDICTED: uncharacterized protein LOC102584113 [Solanum tuberosum]
Length=399

 Score =   380 bits (975),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 223/289 (77%), Gaps = 21/289 (7%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTE  350
            SN +R+NE ++L V   IGV+FG F+G +FP + L+KL +  +L+ ++D    + S L+ 
Sbjct  9    SNSRRRNEKMRLFVTTFIGVVFGFFLGVTFPTISLSKLPLPTNLIPSIDLPDMEKSGLST  68

Query  351  DQ--TVMDP-------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
                 V++               KIWVPSNPRGAERLPP I+  ESD Y RRLWG PS+D
Sbjct  69   QALLNVLNSLKDRVGSLHKNKIPKIWVPSNPRGAERLPPGIVASESDLYTRRLWGLPSED  128

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            L +KP+YL+T TVG KQK NIDA VKKFS+NFTI+LFHYDG+TTEWD+ EWS RAIHVS 
Sbjct  129  LIIKPRYLVTFTVGLKQKSNIDAAVKKFSENFTIMLFHYDGRTTEWDDLEWSSRAIHVST  188

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+E+F+AEEYIKLV KHGL+ISQPGLE  
Sbjct  189  PKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLENFNAEEYIKLVMKHGLDISQPGLEPN  248

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             G  LTW+MT+ + ++EVHKET+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  249  SG--LTWQMTKGRNDTEVHKETEERPGWCADPHLPPCAAFVEIMAPVFS  295



>ref|XP_010320939.1| PREDICTED: uncharacterized protein LOC101244185 isoform X2 [Solanum 
lycopersicum]
Length=376

 Score =   379 bits (973),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 225/274 (82%), Gaps = 15/274 (5%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNN---VDDSSNLTEDQTVMDPT--  374
            ++L+++V  G+IFGL IG SFP+  L KLN+T+S+++N     D +N+  D+   DP+  
Sbjct  1    MRLMLSVCCGIIFGLIIGISFPSSSLTKLNITSSIISNFPIARDRNNVVSDEKPADPSIK  60

Query  375  --------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGY  530
                    KIWVPSNPRGAERLPP I+  ESD+Y RRLWG+PS+DL  KPKYL+T TVG 
Sbjct  61   TQNATDQLKIWVPSNPRGAERLPPGIVASESDYYPRRLWGKPSEDLQSKPKYLVTFTVGI  120

Query  531  KQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHP  710
            KQK NIDA VKKFSD+FTILLFHYDG+TTEWDEFEWSK+AIHVS  KQTKWWYAKRFLHP
Sbjct  121  KQKRNIDAAVKKFSDDFTILLFHYDGKTTEWDEFEWSKKAIHVSVRKQTKWWYAKRFLHP  180

Query  711  DIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKAN  890
            DIVA Y+YIFIWDEDLGVEHFDA+EYIKLVKKHGLEISQPGL+ ++G   TW+MT+R+ +
Sbjct  181  DIVAPYDYIFIWDEDLGVEHFDAKEYIKLVKKHGLEISQPGLDPRRGT--TWQMTKRRGD  238

Query  891  SEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             EVH +T+EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  239  REVHMKTEEKPGWCADPHLPPCAAFVEIMAPVFS  272



>ref|XP_004299222.1| PREDICTED: uncharacterized protein LOC101313310 [Fragaria vesca 
subsp. vesca]
Length=397

 Score =   379 bits (974),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 187/286 (65%), Positives = 220/286 (77%), Gaps = 21/286 (7%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYL-------------------NKLNVTASL  314
            ++ NET++L+V   +GV+FG  IG SFP L L                   N  +  +  
Sbjct  11   RKPNETMRLIVTTFVGVVFGFLIGVSFPTLSLTKLNLSSSLLPSVDLSYNDNGKSSVSDF  70

Query  315  VNNVDDSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTM  494
             + V  +S+ ++ Q V D +KIWVP+NPRGAE LPP I+  ESDFYLRRLWG+PS+DLT 
Sbjct  71   YSYVKKNSSSSQSQRVNDTSKIWVPTNPRGAEMLPPGIVEAESDFYLRRLWGKPSEDLTT  130

Query  495  KPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQ  674
            KP+YL+T TVG  QK NIDA VKKFS++FTILLFHYDG TTEWD+ EWSKRAIHVS  KQ
Sbjct  131  KPRYLVTFTVGINQKKNIDAAVKKFSEDFTILLFHYDGITTEWDDLEWSKRAIHVSVRKQ  190

Query  675  TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGV  854
            TKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLV+KHGLEISQPGLE  KG 
Sbjct  191  TKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVRKHGLEISQPGLEPNKG-  249

Query  855  WLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             LTW+MT+R+ + EVHK+T EK GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  250  -LTWQMTKRRGDREVHKQTQEKPGWCTDPHLPPCAAFVEIMAPVFS  294



>ref|XP_008225901.1| PREDICTED: uncharacterized protein LOC103325487 isoform X3 [Prunus 
mume]
Length=379

 Score =   379 bits (972),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/276 (65%), Positives = 213/276 (77%), Gaps = 14/276 (5%)
 Frame = +3

Query  201  NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD------------DSSNL  344
            + + +L+   T+G +FG FIG S PA+ L K+   +S++ ++D             S+  
Sbjct  5    HRSARLIFTTTLGAVFGFFIGVSLPAVSLTKIRFPSSIITSLDVAFTELRRPNPPPSNRS  64

Query  345  TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
             ED+      KI+VP+NPRGAE LPP IIVP+SD YLRRLWGEPS DL   PKYL++ TV
Sbjct  65   LEDEGSEGVPKIYVPTNPRGAETLPPGIIVPQSDLYLRRLWGEPSADLKTIPKYLVSFTV  124

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G  QK NIDA VKKFS+NF ILLFHYDG+T+EWDEFEWSKRAIHVS  +Q KWWYAKRFL
Sbjct  125  GINQKKNIDAAVKKFSENFAILLFHYDGRTSEWDEFEWSKRAIHVSVKRQAKWWYAKRFL  184

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPDIVA+YEYIFIWDEDLG+EHFD E+YI+LVKK+GLEISQPGLE   G  LTWEMT+R+
Sbjct  185  HPDIVAAYEYIFIWDEDLGLEHFDGEKYIQLVKKYGLEISQPGLEPNNG--LTWEMTKRR  242

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + E HK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  243  GDREAHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  278



>ref|XP_009617942.1| PREDICTED: uncharacterized protein LOC104110199 isoform X1 [Nicotiana 
tomentosiformis]
Length=401

 Score =   379 bits (974),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/288 (62%), Positives = 220/288 (76%), Gaps = 23/288 (8%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTEDQT  359
            +R+NET++L V   IGV+FG F+G +FP + L KL +  +L  ++D    D  +    Q 
Sbjct  12   RRRNETMRLFVTTFIGVVFGFFLGVTFPTISLTKLPLPTNLFQSIDLTIEDKYSGLSTQA  71

Query  360  VM-----------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL  488
            ++                 DP +IWVPSNPRGA+RLPP I+  ESD Y RRLWG PS+DL
Sbjct  72   LLNVLNSLKGRGGSSHKNNDPKQIWVPSNPRGAKRLPPGIVASESDLYTRRLWGLPSEDL  131

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
             +KP+YL+T TVG KQK NIDA VKKFS+NFTI+LFHYDGQT+EWD+ EWSKRAIHVS  
Sbjct  132  IIKPRYLVTFTVGLKQKSNIDAAVKKFSENFTIMLFHYDGQTSEWDDLEWSKRAIHVSTP  191

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+E+F+AEEYIKLV KHGL+ISQPGL    
Sbjct  192  KQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLENFNAEEYIKLVAKHGLDISQPGLAPNS  251

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            G  LTW+MT+ + ++E+HKET+E+ GWC+DPHLPPCAAF+EIMAPVFS
Sbjct  252  G--LTWQMTKGRNDTEIHKETEERPGWCADPHLPPCAAFIEIMAPVFS  297



>ref|XP_006645331.1| PREDICTED: uncharacterized protein LOC102709326 [Oryza brachyantha]
Length=402

 Score =   379 bits (973),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/290 (61%), Positives = 221/290 (76%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S  ++ NE+++L+V   IGV+ G FIG SFP + + KL+  +S+V+ ++D ++    Q +
Sbjct  10   SATRKPNESMRLLVVTIIGVVLGFFIGISFPTVSITKLHFPSSIVSYIEDKNSALTAQAI  69

Query  363  MD--------------------PTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+VP+NPRGAERL P I+VPESDF+ RRLWG P +
Sbjct  70   LNHAWTTARNTKGNDTESSSDTAMKIYVPTNPRGAERLAPGIVVPESDFHPRRLWGNPDE  129

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DL  KPKYL+T TVG  QK+NI+  VKKFSDNF ILLFHYDG+ +EWDEFEWSKRAIH+S
Sbjct  130  DLPFKPKYLVTFTVGISQKENINRAVKKFSDNFAILLFHYDGRVSEWDEFEWSKRAIHIS  189

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              +Q KWWYAKRFLHPDIVA YEYIFIWDEDLGVEHF+AEEY+KLVKKH LEISQPGLE 
Sbjct  190  VRRQAKWWYAKRFLHPDIVAPYEYIFIWDEDLGVEHFNAEEYMKLVKKHQLEISQPGLEP  249

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +G  LTW+MT+R+ + +VHK+T+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  250  DRG--LTWQMTKRRGDRQVHKDTEERPGWCNDPHLPPCAAFVEIMAPVFS  297



>ref|XP_009379952.1| PREDICTED: uncharacterized protein LOC103968450 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009379953.1| PREDICTED: uncharacterized protein LOC103968450 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=393

 Score =   378 bits (971),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 220/295 (75%), Gaps = 22/295 (7%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLT  347
            N GH    +  N+ +++++ + +GV+ G FIG SFP   + KL++  S+   ++D ++  
Sbjct  6    NMGHSGFLRYPNDCMRIIINIFVGVVIGFFIGVSFPTANMPKLHLAGSITTCIEDKNSAF  65

Query  348  EDQTVM--------------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLW  467
              Q ++                    D +KI+VP NPRGAERLPP+IIV +SD Y RRLW
Sbjct  66   ATQALLNHTWPSIHSHNGNNSTVHYNDTSKIYVPKNPRGAERLPPNIIVSKSDLYPRRLW  125

Query  468  GEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKR  647
            G PS+D  ++ KYL+T TVGY QK+NIDA VKKFS+NFTI+LFHYDG+T+EWDEFEWSKR
Sbjct  126  GNPSEDFQIQQKYLVTFTVGYDQKNNIDAAVKKFSENFTIMLFHYDGRTSEWDEFEWSKR  185

Query  648  AIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ  827
            AIHVSA KQTKWW+AKRFLHPDIV SYE+IFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ
Sbjct  186  AIHVSARKQTKWWFAKRFLHPDIVDSYEFIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ  245

Query  828  PGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            PGL+  K   LTW MT R+  SEVHKET EK G CSDPHLPPCAAFVEIMA VFS
Sbjct  246  PGLQPSKD--LTWLMTMRREGSEVHKETKEKHGRCSDPHLPPCAAFVEIMATVFS  298



>ref|XP_003564891.1| PREDICTED: uncharacterized protein LOC100831721 isoform X2 [Brachypodium 
distachyon]
Length=401

 Score =   378 bits (971),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 179/290 (62%), Positives = 223/290 (77%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S+  R NE ++L+ +  IGV+ G   G SFP + + KL+  +S+V+ ++D ++    QT+
Sbjct  10   SSMPRSNEGMRLIFSAVIGVMLGYLFGISFPTVNITKLHFPSSIVSYIEDRNSGITTQTL  69

Query  363  MDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+V SNP+GAERLPP I+V E+D Y RRLWGEPS+
Sbjct  70   LNHAWTSANSHKKNNSDSKSDEIPKIYVTSNPKGAERLPPGIVVSETDLYPRRLWGEPSE  129

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT++P+YL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+TTEWDEFEWSKRAIHVS
Sbjct  130  DLTIQPRYLVTFTVGYAQKANIDAAVKKFSENFTIMLFHYDGRTTEWDEFEWSKRAIHVS  189

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGV+HF+AE YI+LVKKHGLEISQPGLE 
Sbjct  190  VSKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVQHFNAEAYIELVKKHGLEISQPGLEP  249

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +G  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  250  DRG--LTWQMTKRRGDREVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  297



>gb|KHG01210.1| hypothetical protein F383_22893 [Gossypium arboreum]
Length=400

 Score =   378 bits (971),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 184/294 (63%), Positives = 217/294 (74%), Gaps = 25/294 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS---------  335
             N  + +E  +L +    GV  G  IG SFP L L K+N  +SL  ++D +         
Sbjct  8    GNVIKPSEMTRLTITTFAGVFLGFLIGVSFPTLSLTKINFPSSLFLSIDLTYIEDKHSGL  67

Query  336  ---------SNLTEDQTVM------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
                     S+L +D+ VM      + TKIW+P+NPRGAERLPP II  ESDFYL RLWG
Sbjct  68   STRKLFSALSSLKDDKVVMVASNKSEKTKIWIPTNPRGAERLPPGIITSESDFYLHRLWG  127

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
            +PS+DLT+KPKYL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG TTEWDEFEWSKRA
Sbjct  128  QPSEDLTIKPKYLVTFTVGYNQKSNIDAAVKKFSENFTIMLFHYDGLTTEWDEFEWSKRA  187

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHPDI   Y+YIFIWDEDLGVE+FDAEEYIKLV++HGLEISQP
Sbjct  188  IHVSVQKQTKWWYAKRFLHPDIAVPYDYIFIWDEDLGVENFDAEEYIKLVRRHGLEISQP  247

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GL+      LTW MTR++ N+EVH +T+E+ GWCSD HLPPCA+FVEIMA VFS
Sbjct  248  GLDANSAS-LTWAMTRKRDNTEVHMDTEERPGWCSDQHLPPCASFVEIMATVFS  300



>emb|CDP16614.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/288 (63%), Positives = 223/288 (77%), Gaps = 26/288 (9%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------  335
            +R NET++L+V   +G++FG F+G SFP +    +N+ +SL  ++D +            
Sbjct  16   RRPNETMRLLVTTFVGIVFGFFLGVSFPTI---SMNIASSLFPSIDLTYIEDKYSGISTQ  72

Query  336  ------SNLTEDQTVM---DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL  488
                  S+L  ++  M   + TKIW P+NPRGAERLPP II  ESD YLRRLWG PS+DL
Sbjct  73   ALLNVWSSLKGNRANMHKLNGTKIWSPTNPRGAERLPPGIIASESDLYLRRLWGLPSEDL  132

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
             ++P+YL+T TVGY+Q+ NIDA  KK S+NFTILLFHYDG+T+EWDEFEWSKRAIHVS  
Sbjct  133  IIRPRYLVTFTVGYEQRKNIDAAAKKLSENFTILLFHYDGRTSEWDEFEWSKRAIHVSVR  192

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDI+A Y+YIFIWDEDLGVE+FD EEYIKLVKKHGL+ISQPGL    
Sbjct  193  KQTKWWYAKRFLHPDIIAPYDYIFIWDEDLGVENFDFEEYIKLVKKHGLDISQPGLAPNS  252

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            G  LTW+MT+++ ++EVHKET+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  253  G--LTWQMTKKRDDTEVHKETEERPGWCTDPHLPPCAAFVEIMAPVFS  298



>ref|XP_010528214.1| PREDICTED: uncharacterized protein LOC104805362 isoform X2 [Tarenaya 
hassleriana]
Length=378

 Score =   377 bits (968),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/297 (61%), Positives = 223/297 (75%), Gaps = 35/297 (12%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------  329
            +R N+ ++L++   +GVI G  +G SFP L L K+N+ ++L   +D              
Sbjct  2    RRTNQMMRLLITAFVGVIVGFLMGISFPTLSLTKMNLPSTLFPAIDLSYIEDKYSGFSKQ  61

Query  330  ----------DSSNLTEDQTVMDPT------KIWVPSNPRGAERLPPDIIVPESDFYLRR  461
                      DS+++ E   + DP+      KIW P+NPRGAERLPP I+ PESD YLRR
Sbjct  62   GLFGAWSSIKDSTSMRE---IPDPSYDLNDEKIWDPTNPRGAERLPPAIVTPESDLYLRR  118

Query  462  LWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWS  641
            LWG+P +DLT+K KYL+T TVGY Q+ NIDA VKKFS+NFTI+LFHYDG+ +EW+EFEWS
Sbjct  119  LWGDPREDLTIKQKYLVTFTVGYDQRKNIDAAVKKFSENFTIMLFHYDGRVSEWEEFEWS  178

Query  642  KRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEI  821
            KRAIHVS  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLGVEHFD+EEY+ +VKKHGLEI
Sbjct  179  KRAIHVSVRKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGVEHFDSEEYLAVVKKHGLEI  238

Query  822  SQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            SQPGL+  +G  LTWEMT+++ ++EVHK  DEK GWC+DP+LPPCAAFVEIMAPVFS
Sbjct  239  SQPGLQPYEG--LTWEMTKKRDDTEVHKHADEKNGWCTDPNLPPCAAFVEIMAPVFS  293



>ref|XP_004241278.1| PREDICTED: uncharacterized protein LOC101263523 [Solanum lycopersicum]
Length=387

 Score =   377 bits (969),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/278 (64%), Positives = 227/278 (82%), Gaps = 13/278 (5%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQ-----  356
            KR N++V+L++   +G++FG FIG SFP++ L K+++ +S+++++D + N    +     
Sbjct  13   KRSNDSVRLIITTIMGMVFGYFIGISFPSVSLTKMSLPSSILSSLDVAFNDGHQRLSGRS  72

Query  357  ------TVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTL  518
                  +V    KI+VP+NPRGAE LPP I+VPESDFYLRRLWG+PS+DL  KPKYL+T 
Sbjct  73   FPENLGSVPLTPKIYVPTNPRGAESLPPGIVVPESDFYLRRLWGDPSEDLRNKPKYLVTF  132

Query  519  TVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKR  698
            TVG  QK+NIDA VKKFS++F ILLFHYDG+T+EWD+FEWSKRA+H+S  KQTKWWYAKR
Sbjct  133  TVGLDQKNNIDACVKKFSEDFQILLFHYDGRTSEWDQFEWSKRAVHISIRKQTKWWYAKR  192

Query  699  FLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTR  878
            FLHPD+VA+Y+Y+FIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTW+MT+
Sbjct  193  FLHPDVVAAYDYVFIWDEDLGVEHFNADKYIQLVKKHGLEISQPGLEPNNG--LTWQMTK  250

Query  879  RKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            R+ + EVHK T+EK GWCSDP LPPCAAFVEIMAPVFS
Sbjct  251  RRGDREVHKSTEEKPGWCSDPRLPPCAAFVEIMAPVFS  288



>ref|XP_009797241.1| PREDICTED: uncharacterized protein LOC104243699 isoform X1 [Nicotiana 
sylvestris]
Length=400

 Score =   378 bits (970),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/288 (63%), Positives = 220/288 (76%), Gaps = 24/288 (8%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTEDQT  359
            +R+NET++L V   IGV+FG F+G +FP + L KL +  +L  ++D    D  +    Q 
Sbjct  12   RRRNETMRLFVTTFIGVVFGFFLGVTFPTISLTKLPLPTNLFQSIDLTIEDKYSGLSTQA  71

Query  360  VM-----------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL  488
            ++                 DP KIWVPSNPRGAERLPP I+  ESD Y RRLWG PS+DL
Sbjct  72   LLNVLNSLKGRGGSSHKNNDP-KIWVPSNPRGAERLPPGIVASESDLYTRRLWGLPSEDL  130

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
             +KP+YL+T TVG KQK NIDA VKKFS+NFTI+LFHYDGQT+EWD+ EWSKRAIHVS  
Sbjct  131  IIKPRYLVTFTVGLKQKSNIDAAVKKFSENFTIMLFHYDGQTSEWDDLEWSKRAIHVSTP  190

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+E+F+AEEYIKLV KHGL+ISQPGL    
Sbjct  191  KQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLENFNAEEYIKLVAKHGLDISQPGLAPNS  250

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            G  LTW+MT+ + ++E+HKET+E+ GWC+DPHLPPCAAF+EIMAPVFS
Sbjct  251  G--LTWQMTKGRNDTEIHKETEERPGWCADPHLPPCAAFIEIMAPVFS  296



>ref|XP_010912960.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105038769 
[Elaeis guineensis]
Length=403

 Score =   378 bits (970),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 188/300 (63%), Positives = 219/300 (73%), Gaps = 23/300 (8%)
 Frame = +3

Query  138  SSGNRVCTMKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLV  317
            S G R C+          +++NET+ L++  TIGV  G  IG SFP L   KL   +S +
Sbjct  6    SIGRRACS-------GLVRKKNETMSLIITTTIGVAVGFLIGISFPTLNPTKLRFPSSNI  58

Query  318  NNVDDSS---------------NLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFY  452
            + ++D +               N    +   D  KI+VP+ PRG ERLPP IIV ESDFY
Sbjct  59   SCIEDRNTGLMLLNHALTSRNHNGNNSKDFNDTLKIYVPTKPRGVERLPPGIIVSESDFY  118

Query  453  LRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEF  632
            LRRLWG P +DLT+K KYL+  TVGY QK  IDA VKKFS+NFTILLFHYDG T+EWDEF
Sbjct  119  LRRLWGNPDEDLTIKQKYLVAFTVGYDQKKMIDAAVKKFSENFTILLFHYDGXTSEWDEF  178

Query  633  EWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHG  812
            EWSKRAIHVSA KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLVKKHG
Sbjct  179  EWSKRAIHVSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFNAEEYIKLVKKHG  238

Query  813  LEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LEISQPGL +  G ++TW+M RR+ +SEVHKET+E+ G C DP LPPCAAFVEIMAPVFS
Sbjct  239  LEISQPGLLQNTG-FITWQMARRREDSEVHKETEERPGQCPDPRLPPCAAFVEIMAPVFS  297



>ref|XP_002456820.1| hypothetical protein SORBIDRAFT_03g043390 [Sorghum bicolor]
 gb|EES01940.1| hypothetical protein SORBIDRAFT_03g043390 [Sorghum bicolor]
Length=401

 Score =   378 bits (970),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/290 (61%), Positives = 221/290 (76%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S+ ++ NE ++++ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++    QT+
Sbjct  10   SSAQKSNEGMRIIFSAVVGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITTQTL  69

Query  363  MDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+VP+NP+GAERLPP I+V E+D YLRRLWGEPS+
Sbjct  70   LNHAWTSAATHKKNNSASNSDEIPKIYVPTNPKGAERLPPGIVVSETDLYLRRLWGEPSE  129

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT KP+YL+T TVGY QK NIDA V+KFS+NFTI+LFHYD + TEWDEFEWSKRAIHVS
Sbjct  130  DLTSKPRYLVTFTVGYAQKANIDAAVRKFSENFTIMLFHYDDRITEWDEFEWSKRAIHVS  189

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE YI LV+KHGLEISQPGLE 
Sbjct  190  VRKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEAYIGLVRKHGLEISQPGLEP  249

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             KG  LTW+MT+R  + EVHK T+E+ GWCSDPHLPPCAAFVEIMA VFS
Sbjct  250  DKG--LTWQMTKRIGDQEVHKVTEERPGWCSDPHLPPCAAFVEIMATVFS  297



>ref|XP_006391211.1| hypothetical protein EUTSA_v10018653mg [Eutrema salsugineum]
 gb|ESQ28497.1| hypothetical protein EUTSA_v10018653mg [Eutrema salsugineum]
Length=401

 Score =   377 bits (969),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 215/296 (73%), Gaps = 24/296 (8%)
 Frame = +3

Query  171  FGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTE  350
             G  S  ++  + +K++     GV FG  +G SFP+L + K+++    + + D S    +
Sbjct  1    MGIFSRSRKSKDGMKIIATAFFGVTFGFLVGISFPSLSITKVSLPTKFLLSTDLSYIEEK  60

Query  351  DQTVMDP----------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRL  464
               +  P                      +KIWVPSNPRGAERLPP I+  ESDFYLRRL
Sbjct  61   GSAISTPESHKAWSSSKSNDSSSSDPIDKSKIWVPSNPRGAERLPPGIVAAESDFYLRRL  120

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSK  644
            WG P +DLT +P+YL+T TVG  QK+NIDA VKKFS NFTILLFHYDG+ TEWDEFEWSK
Sbjct  121  WGLPHEDLTSQPRYLVTFTVGINQKENIDACVKKFSGNFTILLFHYDGRVTEWDEFEWSK  180

Query  645  RAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEIS  824
             AIH+S  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLVKKHGLEIS
Sbjct  181  NAIHISVRKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEEYIKLVKKHGLEIS  240

Query  825  QPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            QPGLE  KG  LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  241  QPGLEPNKG--LTWQMTKRRGDLEVHKITEEKPGWCSDPHLPPCAAFVEIMAPVFS  294



>ref|XP_010528212.1| PREDICTED: uncharacterized protein LOC104805362 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010528213.1| PREDICTED: uncharacterized protein LOC104805362 isoform X1 [Tarenaya 
hassleriana]
Length=391

 Score =   377 bits (968),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/297 (61%), Positives = 223/297 (75%), Gaps = 35/297 (12%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------  329
            +R N+ ++L++   +GVI G  +G SFP L L K+N+ ++L   +D              
Sbjct  2    RRTNQMMRLLITAFVGVIVGFLMGISFPTLSLTKMNLPSTLFPAIDLSYIEDKYSGFSKQ  61

Query  330  ----------DSSNLTEDQTVMDPT------KIWVPSNPRGAERLPPDIIVPESDFYLRR  461
                      DS+++ E   + DP+      KIW P+NPRGAERLPP I+ PESD YLRR
Sbjct  62   GLFGAWSSIKDSTSMRE---IPDPSYDLNDEKIWDPTNPRGAERLPPAIVTPESDLYLRR  118

Query  462  LWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWS  641
            LWG+P +DLT+K KYL+T TVGY Q+ NIDA VKKFS+NFTI+LFHYDG+ +EW+EFEWS
Sbjct  119  LWGDPREDLTIKQKYLVTFTVGYDQRKNIDAAVKKFSENFTIMLFHYDGRVSEWEEFEWS  178

Query  642  KRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEI  821
            KRAIHVS  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLGVEHFD+EEY+ +VKKHGLEI
Sbjct  179  KRAIHVSVRKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGVEHFDSEEYLAVVKKHGLEI  238

Query  822  SQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            SQPGL+  +G  LTWEMT+++ ++EVHK  DEK GWC+DP+LPPCAAFVEIMAPVFS
Sbjct  239  SQPGLQPYEG--LTWEMTKKRDDTEVHKHADEKNGWCTDPNLPPCAAFVEIMAPVFS  293



>ref|XP_010044565.1| PREDICTED: uncharacterized protein LOC104433498 [Eucalyptus grandis]
 gb|KCW86652.1| hypothetical protein EUGRSUZ_B03278 [Eucalyptus grandis]
Length=401

 Score =   377 bits (968),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 221/299 (74%), Gaps = 24/299 (8%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----  329
            M N    +  K+ N+T++L++    G++FG FIG SFP L L K N+  SL    D    
Sbjct  1    MGNPMRSAGCKKSNDTMRLIITTFFGIVFGFFIGVSFPTLSLIKFNLPTSLQTAHDVMYS  60

Query  330  ------------------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYL  455
                                 N + DQ     +KIW PSNPRGAERLPP I+  ESDFYL
Sbjct  61   EDPKTGLSTQTILNLSGEKGYNSSSDQAQNGTSKIWAPSNPRGAERLPPGIVTAESDFYL  120

Query  456  RRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFE  635
            RRLWG+PS+DLT KP+YL+T TVGY Q+ NIDA VKKFS NFTILLFHYDG TTEWDE+E
Sbjct  121  RRLWGKPSEDLTTKPRYLVTFTVGYNQQKNIDAAVKKFSGNFTILLFHYDGITTEWDEYE  180

Query  636  WSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGL  815
            WSKRAIHVS  KQTKWWYAKRFLHPDIVASY+YIFIWDEDLGVEHFDAEEYIKL++KHGL
Sbjct  181  WSKRAIHVSVRKQTKWWYAKRFLHPDIVASYDYIFIWDEDLGVEHFDAEEYIKLMRKHGL  240

Query  816  EISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            EISQPGLE  +G  LTW+MT+R+ + EVHKET+EK GWC+ P LPPCAAFVEIMAPVFS
Sbjct  241  EISQPGLEPNRG--LTWQMTKRRGDGEVHKETEEKPGWCTSPSLPPCAAFVEIMAPVFS  297



>ref|XP_008676605.1| PREDICTED: uncharacterized protein LOC100193875 isoform X1 [Zea 
mays]
Length=403

 Score =   377 bits (967),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 224/295 (76%), Gaps = 22/295 (7%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLT  347
            + G  S+  R NE ++L+ +  IG++ G   G SFP + + KL+  +S+++ ++D ++  
Sbjct  7    SIGRSSSMPRSNEGLRLIFSAVIGIMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGI  66

Query  348  EDQTVMDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLW  467
              QT+++                      KI+VP+NP+GAERLPP I+V E+D Y RRLW
Sbjct  67   TTQTLLNHAWASANNRKKNSSESNTDEIPKIYVPTNPKGAERLPPGIVVSETDLYPRRLW  126

Query  468  GEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKR  647
            G+PS+DLT +P+YL+T TVG  QK NIDA VKKFSD FTI+LFHYDG+TTEWDEFEWSKR
Sbjct  127  GDPSEDLTSEPRYLVTFTVGIGQKANIDAAVKKFSDKFTIMLFHYDGRTTEWDEFEWSKR  186

Query  648  AIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ  827
            AIHVS  KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGLEISQ
Sbjct  187  AIHVSVRKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEKYIELVRKHGLEISQ  246

Query  828  PGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            PGL+  KG  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  247  PGLQPDKG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  299



>ref|XP_004952281.1| PREDICTED: uncharacterized protein LOC101755578 isoform X1 [Setaria 
italica]
 ref|XP_004952282.1| PREDICTED: uncharacterized protein LOC101755578 isoform X2 [Setaria 
italica]
Length=403

 Score =   377 bits (967),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 223/295 (76%), Gaps = 22/295 (7%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLT  347
              G  S+  R NE ++L+ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++  
Sbjct  7    GIGRSSSMPRSNEGMRLIFSAVVGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGI  66

Query  348  EDQTVMDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLW  467
              QT+++                      KI+VP+NP+GAERLPP I+V ESD Y RRLW
Sbjct  67   TTQTLLNHAWASANNRKKNNSDSNSDEIPKIYVPTNPKGAERLPPGIVVSESDLYPRRLW  126

Query  468  GEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKR  647
            G+PS+DLT +P+YL+T TVG  QK NIDA VKKFSD FTI+LFHYDG+TTEWDEFEWSKR
Sbjct  127  GDPSEDLTSEPRYLVTFTVGIGQKANIDAAVKKFSDKFTIMLFHYDGRTTEWDEFEWSKR  186

Query  648  AIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ  827
            AIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGLEISQ
Sbjct  187  AIHVSVMKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEKYIELVRKHGLEISQ  246

Query  828  PGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            PGL+  +G  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  247  PGLQPDRG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  299



>gb|EPS63684.1| hypothetical protein M569_11100, partial [Genlisea aurea]
Length=350

 Score =   374 bits (961),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/281 (64%), Positives = 223/281 (79%), Gaps = 17/281 (6%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------------  335
            K+ N+ V+L+ A  +G++FG FIG SFP +YL+K+ + +SL+++ D +            
Sbjct  5    KKSNDRVRLIAATIMGIVFGYFIGISFPTVYLSKITLPSSLISSFDVTFNDESSSGSHSF  64

Query  336  -SNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLL  512
              N+    T + P KI+VPSNPRGAE LPP I+V ESDFYLRRLWGEP++DL  KPKYL+
Sbjct  65   SENIESGSTPLTP-KIYVPSNPRGAETLPPGIVVSESDFYLRRLWGEPNEDLKKKPKYLV  123

Query  513  TLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYA  692
            T TVG +QK N++  VKKFS++F I+LFHYDG+T+EWDEFEWS+ AIHVS  KQTKWWYA
Sbjct  124  TFTVGVEQKANVNLAVKKFSEDFQIILFHYDGRTSEWDEFEWSQNAIHVSVKKQTKWWYA  183

Query  693  KRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEM  872
            KRFLHPDIVA+Y+YIFIWDEDLGVEHF+A++YI L+KK+GLEISQPGLE   G  LTW+M
Sbjct  184  KRFLHPDIVAAYDYIFIWDEDLGVEHFNADKYIDLIKKYGLEISQPGLEPNNG--LTWQM  241

Query  873  TRRKANSEVHK-ETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            T+R  + EVHK ET+EK GWCSDPHLPPCAAFVEIMAPV+S
Sbjct  242  TKRLGDREVHKLETEEKPGWCSDPHLPPCAAFVEIMAPVYS  282



>ref|XP_010253713.1| PREDICTED: uncharacterized protein LOC104594877 isoform X2 [Nelumbo 
nucifera]
Length=358

 Score =   375 bits (962),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/263 (67%), Positives = 214/263 (81%), Gaps = 12/263 (5%)
 Frame = +3

Query  234  IGVIFGLFIGFSFPALYLNKLNVTASLVNNVDD----------SSNLTEDQTVMDPTKIW  383
            +G +FG F+G SFP+  + KLN+ + L++++D           S +        D  KI+
Sbjct  1    MGAVFGFFVGVSFPSDLVTKLNLHSGLLSSIDVALINERSGRFSRSDLGGTNHSDTPKIY  60

Query  384  VPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVK  563
            VP+NPRGAE LPP I+VPE+DFYLRRLWG+P++DL  KPKYL+T TVG+ Q++NIDA VK
Sbjct  61   VPTNPRGAELLPPGIVVPETDFYLRRLWGDPNEDLKTKPKYLVTFTVGFDQRNNIDAAVK  120

Query  564  KFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFI  743
            KFS++FTILLFHYDG+T+EWD+FEWSKRAIH+SA KQTKWWYAKRFLHPD+VA+Y+YIFI
Sbjct  121  KFSEDFTILLFHYDGRTSEWDQFEWSKRAIHISARKQTKWWYAKRFLHPDVVAAYDYIFI  180

Query  744  WDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQ  923
            WDEDLGVEHF+AE+YI LVKKHGLEISQPGLE   G  LTW+MT+R+ +SEVH ET EK 
Sbjct  181  WDEDLGVEHFNAEKYINLVKKHGLEISQPGLEPNNG--LTWQMTKRRGDSEVHMETTEKP  238

Query  924  GWCSDPHLPPCAAFVEIMAPVFS  992
            GWCS PHLPPCAAFVEIMAPVFS
Sbjct  239  GWCSYPHLPPCAAFVEIMAPVFS  261



>ref|XP_009617943.1| PREDICTED: uncharacterized protein LOC104110199 isoform X2 [Nicotiana 
tomentosiformis]
Length=400

 Score =   376 bits (966),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 180/288 (63%), Positives = 220/288 (76%), Gaps = 24/288 (8%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTEDQT  359
            +R+NET++L V   IGV+FG F+G +FP + L KL +  +L  ++D    D  +    Q 
Sbjct  12   RRRNETMRLFVTTFIGVVFGFFLGVTFPTISLTKLPLPTNLFQSIDLTIEDKYSGLSTQA  71

Query  360  VM-----------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL  488
            ++                 DP KIWVPSNPRGA+RLPP I+  ESD Y RRLWG PS+DL
Sbjct  72   LLNVLNSLKGRGGSSHKNNDP-KIWVPSNPRGAKRLPPGIVASESDLYTRRLWGLPSEDL  130

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
             +KP+YL+T TVG KQK NIDA VKKFS+NFTI+LFHYDGQT+EWD+ EWSKRAIHVS  
Sbjct  131  IIKPRYLVTFTVGLKQKSNIDAAVKKFSENFTIMLFHYDGQTSEWDDLEWSKRAIHVSTP  190

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+E+F+AEEYIKLV KHGL+ISQPGL    
Sbjct  191  KQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLENFNAEEYIKLVAKHGLDISQPGLAPNS  250

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            G  LTW+MT+ + ++E+HKET+E+ GWC+DPHLPPCAAF+EIMAPVFS
Sbjct  251  G--LTWQMTKGRNDTEIHKETEERPGWCADPHLPPCAAFIEIMAPVFS  296



>gb|AFW75010.1| hypothetical protein ZEAMMB73_885657 [Zea mays]
Length=394

 Score =   376 bits (965),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/284 (63%), Positives = 219/284 (77%), Gaps = 22/284 (8%)
 Frame = +3

Query  201  NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVM-----  365
            N +++LV+   IG + G FIG SFP++ + KL+   S ++ ++D       Q ++     
Sbjct  16   NGSMRLVMVTVIGAVLGFFIGISFPSVSITKLHFPDSFISYIEDKDAGLTTQAILNHAWT  75

Query  366  ----------DPT-----KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKP  500
                      +PT     KI+VP+NP+GAE L P I+V ESDF+LRRLWG+PS+DL  KP
Sbjct  76   SARNARGNGTEPTSNSTLKIYVPTNPKGAEGLAPGIVVSESDFHLRRLWGDPSEDLPFKP  135

Query  501  KYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTK  680
            KYL+T TVG +QK NI+  VKKFSDNF ILLFHYDG+ +EWDEFEWS+RAIH+S  KQTK
Sbjct  136  KYLVTFTVGVEQKANINRAVKKFSDNFAILLFHYDGRVSEWDEFEWSQRAIHISVRKQTK  195

Query  681  WWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWL  860
            WWYAKRFLHPDIVA+YEYIFIWDEDLGVEHF+AEEYIKLVKKH L+ISQPGLE  +G  L
Sbjct  196  WWYAKRFLHPDIVAAYEYIFIWDEDLGVEHFNAEEYIKLVKKHNLDISQPGLEPDRG--L  253

Query  861  TWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            TW+MT+R+ +SEVHK+T+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  254  TWQMTKRRGDSEVHKDTEERPGWCSDPHLPPCAAFVEIMAPVFS  297



>ref|XP_009148552.1| PREDICTED: uncharacterized protein LOC103871966 [Brassica rapa]
 ref|XP_009148553.1| PREDICTED: uncharacterized protein LOC103871966 [Brassica rapa]
Length=403

 Score =   376 bits (965),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 227/295 (77%), Gaps = 22/295 (7%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----D  332
            N   CSNGK+ N+ +KL++A  IGV+ G F+G SFP L L K+N  ++++ +VD     D
Sbjct  7    NSNRCSNGKKLNDGMKLIIATFIGVVIGFFLGISFPTLSLTKINFPSTILPSVDIAYVED  66

Query  333  SSNLTEDQTVM------DPT--------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
             +  T  +T++       P+        KIWVPSNPRGAE L P I+ PESD+YLRRLWG
Sbjct  67   ETPETSSETLLHTWSSRTPSHRANASHWKIWVPSNPRGAEMLTPGIVAPESDYYLRRLWG  126

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDN-FTILLFHYDGQTTEWDEFEWSKR  647
             P +D+ +KPKYL+  TVG+ Q+ N+DA VKKFS++ FT++LFHYDG+TTEWD++EWSKR
Sbjct  127  LPEEDIPVKPKYLIAFTVGFNQRVNVDACVKKFSEDLFTLVLFHYDGRTTEWDQYEWSKR  186

Query  648  AIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQ  827
            AIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+EHF+AEEYI+L+KKHGLEISQ
Sbjct  187  AIHVSVPKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLEHFNAEEYIRLIKKHGLEISQ  246

Query  828  PGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            PG+E +K +  TWE+T+RK   EVHK+  EK G C+DPHLPPCAAF+EIMAPVFS
Sbjct  247  PGVESEKKI--TWEITKRKTKGEVHKDAKEKPGRCNDPHLPPCAAFIEIMAPVFS  299



>ref|XP_007150189.1| hypothetical protein PHAVU_005G134100g [Phaseolus vulgaris]
 ref|XP_007150190.1| hypothetical protein PHAVU_005G134100g [Phaseolus vulgaris]
 gb|ESW22183.1| hypothetical protein PHAVU_005G134100g [Phaseolus vulgaris]
 gb|ESW22184.1| hypothetical protein PHAVU_005G134100g [Phaseolus vulgaris]
Length=397

 Score =   376 bits (965),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 185/296 (63%), Positives = 225/296 (76%), Gaps = 28/296 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNN-------------  323
            S  KR N++ +++V   +G+ FG FIG S  +++L K+++ +S V N             
Sbjct  4    STFKRANDSTRILVTAIMGIAFGFFIGISISSVHLRKISLLSSPVGNSFDVPVAESEIDR  63

Query  324  ----------VDDSSNLTEDQTVMDPTK---IWVPSNPRGAERLPPDIIVPESDFYLRRL  464
                      V DSS+ T++  V+   K   I+V SNPRGAE LPP I+V ESDFYLRRL
Sbjct  64   FSAEVERSPAVIDSSSGTKNLEVLGSIKLPKIFVASNPRGAESLPPGIVVSESDFYLRRL  123

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSK  644
            WGEPS+DL  KPKYL+T TVG +Q+ NI+A VKKFSD+F ILLFHYDG+T+EWD+FEWSK
Sbjct  124  WGEPSEDLKKKPKYLVTFTVGLEQRHNINAAVKKFSDDFAILLFHYDGRTSEWDQFEWSK  183

Query  645  RAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEIS  824
            +AIHVSA KQTKWWYAKRFLHPDIV++YEYIFIWDEDLGVEHF+A++YI LVKK+GLEIS
Sbjct  184  KAIHVSARKQTKWWYAKRFLHPDIVSAYEYIFIWDEDLGVEHFNADKYIHLVKKYGLEIS  243

Query  825  QPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            QPGLE  KG  LTWEMT+R+ + EVH  T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  244  QPGLEPNKG--LTWEMTKRRGDKEVHMVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  297



>ref|XP_010531572.1| PREDICTED: uncharacterized protein LOC104807825 isoform X3 [Tarenaya 
hassleriana]
Length=393

 Score =   375 bits (964),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 217/301 (72%), Gaps = 26/301 (9%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M  F      +R  E +KLV    +G+ FG F+G SFP L + K+++  +L+   D SS 
Sbjct  1    MGIFSRSLISRRSTEGMKLVATAFLGIAFGFFVGISFPTLSITKVSLPTNLLYFADLSSV  60

Query  342  LTEDQTV------------------------MDPTKIWVPSNPRGAERLPPDIIVPESDF  449
                 +V                        +D ++IWVPSNPRGAERLPP I+  ESDF
Sbjct  61   EERGSSVPTPADHKAWSSLKGNDSRSSAPDSIDKSQIWVPSNPRGAERLPPGIVAAESDF  120

Query  450  YLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDE  629
            YLRRLWG P +DLT KP+YL+T TVGY Q++NIDA VKKFSDNFTI+LFHYDG+TTEWDE
Sbjct  121  YLRRLWGLPEEDLTSKPRYLVTFTVGYDQRNNIDACVKKFSDNFTIVLFHYDGRTTEWDE  180

Query  630  FEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKH  809
            FEWSKRAIH+S  KQTKWWY KRFLHPDI+A+Y+YIF+WDEDLGVEHF+ EEYIKLVKKH
Sbjct  181  FEWSKRAIHISVRKQTKWWYVKRFLHPDIIAAYDYIFVWDEDLGVEHFNGEEYIKLVKKH  240

Query  810  GLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVF  989
            GLEISQPGLE  +G  LTW MT+R  + EVHK T+EK   CSDP LPPCAAFVEIMAPVF
Sbjct  241  GLEISQPGLEPNRG--LTWPMTKRIEDLEVHKTTEEKPELCSDPLLPPCAAFVEIMAPVF  298

Query  990  S  992
            S
Sbjct  299  S  299



>ref|XP_006357566.1| PREDICTED: uncharacterized protein LOC102597248 [Solanum tuberosum]
Length=380

 Score =   375 bits (963),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/273 (65%), Positives = 222/273 (81%), Gaps = 8/273 (3%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNV---DDSSNLTEDQTV  362
            +R N++ +LV+   IG++ G FIG S P + L K+++ ++LV+++   DD    + ++  
Sbjct  11   RRTNDSSRLVITSIIGMVLGYFIGISSPYVSLTKISLPSNLVSSLAFGDDHRRPSIERFF  70

Query  363  ---MDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYK  533
               +   +I+VP+NPRGAE LPP I+VPESDFYLRRLWGEPS+DL  KPKYL+T TVG  
Sbjct  71   PEHLVTPQIYVPTNPRGAESLPPRIVVPESDFYLRRLWGEPSKDLIKKPKYLVTFTVGLN  130

Query  534  QKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPD  713
            QKDNIDA  KKFS++F ILLFHYDG+T+EWDEFEWSKRA+H+S  KQTKWWYAKRFLHPD
Sbjct  131  QKDNIDAAAKKFSEDFQILLFHYDGRTSEWDEFEWSKRAVHISVRKQTKWWYAKRFLHPD  190

Query  714  IVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANS  893
            +VA+Y+YIFIWDEDLGVE+F+AE+YI+LVK+HGLEISQPGLE   G  LTW+MT+R+ + 
Sbjct  191  VVAAYDYIFIWDEDLGVENFNAEKYIRLVKRHGLEISQPGLEPNSG--LTWQMTKRRDDR  248

Query  894  EVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            EVHK TDEK GWCS+P LPPCAAFVEIMAPVFS
Sbjct  249  EVHKNTDEKPGWCSNPRLPPCAAFVEIMAPVFS  281



>ref|XP_010415381.1| PREDICTED: uncharacterized protein LOC104701401 [Camelina sativa]
Length=404

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/299 (61%), Positives = 215/299 (72%), Gaps = 24/299 (8%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M  F   S  ++ N+ +K++     GV FG  IG SFP+L + K+++  + + + D S  
Sbjct  1    MGIFSRSSISRKSNDGMKIIATAFFGVTFGFLIGISFPSLSITKVSLPTNFLPSNDLSYV  60

Query  342  LTEDQTVMDPTK----------------------IWVPSNPRGAERLPPDIIVPESDFYL  455
              +  T+  P                        IWVPSNPRGAE LPP +I  ESDFYL
Sbjct  61   EEKGSTIATPESHKAWSSSKDNDSSSSSPIDKSKIWVPSNPRGAEMLPPGMIAAESDFYL  120

Query  456  RRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFE  635
            RRLWG P +DLT +P+YL T TVG  QK NIDA VKKFS+NFTI+LFHYDGQ TEWDEFE
Sbjct  121  RRLWGLPQEDLTSEPRYLATFTVGINQKANIDACVKKFSENFTIVLFHYDGQVTEWDEFE  180

Query  636  WSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGL  815
            WSK AIH+S  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIK+VKKHGL
Sbjct  181  WSKTAIHISVRKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEEYIKMVKKHGL  240

Query  816  EISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            EISQPGLE  +G  LTW+MT+R+ + EVHK T+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  241  EISQPGLEPNQG--LTWQMTKRRGDMEVHKITEERPGWCSDPHLPPCAAFVEIMAPVFS  297



>ref|XP_010555939.1| PREDICTED: uncharacterized protein LOC104825316 isoform X2 [Tarenaya 
hassleriana]
Length=391

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 221/294 (75%), Gaps = 29/294 (10%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------  329
            +R N  ++L++   +GVI G  +G S+P L L K+N+ ++L    D              
Sbjct  2    RRTNLMMRLLITAVVGVIVGFLMGISYPTLSLTKMNLPSTLFPAFDLSYIEGKYSDFSKQ  61

Query  330  ---DSSNLTEDQTVM----DP------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
               D+    +D T M    DP      TKIWVP+NPRGAERLPP I+ PESDFYLRRLWG
Sbjct  62   PLLDAWYSVKDSTSMKEIPDPSYDWNATKIWVPTNPRGAERLPPAIVTPESDFYLRRLWG  121

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
             PS+DLT+K KYL+T TVGY Q+ NIDA VKKFS++FTI+LFHYDG  +EW+EFEWSKRA
Sbjct  122  NPSEDLTIKQKYLVTFTVGYDQRKNIDAAVKKFSEDFTIMLFHYDGGASEWEEFEWSKRA  181

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            +HVS  KQTKWWYAKRFLHPD+VA YEYIFIWDEDLGVEHFD+E+Y+ +VKKHGLEISQP
Sbjct  182  VHVSVRKQTKWWYAKRFLHPDVVAPYEYIFIWDEDLGVEHFDSEKYLAVVKKHGLEISQP  241

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GL+  +G  LTWEMT+++ ++EVHK+ DE+ GWC+DP LPPCAAFVEIMAPVFS
Sbjct  242  GLQPYEG--LTWEMTKKRDDTEVHKKADERNGWCTDPKLPPCAAFVEIMAPVFS  293



>ref|XP_008446150.1| PREDICTED: uncharacterized protein LOC103488962 [Cucumis melo]
 ref|XP_008446151.1| PREDICTED: uncharacterized protein LOC103488962 [Cucumis melo]
 ref|XP_008446153.1| PREDICTED: uncharacterized protein LOC103488962 [Cucumis melo]
 ref|XP_008446154.1| PREDICTED: uncharacterized protein LOC103488962 [Cucumis melo]
 ref|XP_008446155.1| PREDICTED: uncharacterized protein LOC103488962 [Cucumis melo]
Length=403

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 217/296 (73%), Gaps = 26/296 (9%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDD--------  332
              S  ++ N++++L++   +GV  G  IG SFP L L KL + + L+  +D         
Sbjct  6    RSSVNRKPNDSMRLIIITFMGVFLGFLIGISFPTLSLTKLGIPSGLIPKIDQMYNTDIKA  65

Query  333  ----------------SSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRL  464
                            S +    Q     ++IWVPSNPRGAERL P I+  ESDFYL RL
Sbjct  66   GSSTQTSQNFPSTRTGSGDKNSSQNRNGTSEIWVPSNPRGAERLAPGIVAAESDFYLHRL  125

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSK  644
            WG P++DL  KP YL+T TVGYKQ++NID  VKKFS+NFTILLFHYDG+TTEWDEFEWSK
Sbjct  126  WGNPNEDLNTKPNYLVTFTVGYKQRENIDRAVKKFSENFTILLFHYDGRTTEWDEFEWSK  185

Query  645  RAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEIS  824
            RAIHVSA KQ+KWWYAKRFLHPDIVA Y+YIF+WDEDLGVE+FDAEEYIKLV+KHGLEIS
Sbjct  186  RAIHVSARKQSKWWYAKRFLHPDIVAPYDYIFMWDEDLGVENFDAEEYIKLVRKHGLEIS  245

Query  825  QPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            QPGLE  +G  LTW+MT+++   EVHK+T E+ GWC++P+LPPCAAFVEIMAPVFS
Sbjct  246  QPGLEPTRG--LTWQMTKKRDGLEVHKDTVERAGWCTEPNLPPCAAFVEIMAPVFS  299



>ref|XP_010531554.1| PREDICTED: uncharacterized protein LOC104807825 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010531562.1| PREDICTED: uncharacterized protein LOC104807825 isoform X1 [Tarenaya 
hassleriana]
Length=405

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 217/301 (72%), Gaps = 26/301 (9%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M  F      +R  E +KLV    +G+ FG F+G SFP L + K+++  +L+   D SS 
Sbjct  1    MGIFSRSLISRRSTEGMKLVATAFLGIAFGFFVGISFPTLSITKVSLPTNLLYFADLSSV  60

Query  342  LTEDQTV------------------------MDPTKIWVPSNPRGAERLPPDIIVPESDF  449
                 +V                        +D ++IWVPSNPRGAERLPP I+  ESDF
Sbjct  61   EERGSSVPTPADHKAWSSLKGNDSRSSAPDSIDKSQIWVPSNPRGAERLPPGIVAAESDF  120

Query  450  YLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDE  629
            YLRRLWG P +DLT KP+YL+T TVGY Q++NIDA VKKFSDNFTI+LFHYDG+TTEWDE
Sbjct  121  YLRRLWGLPEEDLTSKPRYLVTFTVGYDQRNNIDACVKKFSDNFTIVLFHYDGRTTEWDE  180

Query  630  FEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKH  809
            FEWSKRAIH+S  KQTKWWY KRFLHPDI+A+Y+YIF+WDEDLGVEHF+ EEYIKLVKKH
Sbjct  181  FEWSKRAIHISVRKQTKWWYVKRFLHPDIIAAYDYIFVWDEDLGVEHFNGEEYIKLVKKH  240

Query  810  GLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVF  989
            GLEISQPGLE  +G  LTW MT+R  + EVHK T+EK   CSDP LPPCAAFVEIMAPVF
Sbjct  241  GLEISQPGLEPNRG--LTWPMTKRIEDLEVHKTTEEKPELCSDPLLPPCAAFVEIMAPVF  298

Query  990  S  992
            S
Sbjct  299  S  299



>ref|XP_010089968.1| hypothetical protein L484_008046 [Morus notabilis]
 gb|EXB38682.1| hypothetical protein L484_008046 [Morus notabilis]
Length=432

 Score =   376 bits (966),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/297 (61%), Positives = 222/297 (75%), Gaps = 31/297 (10%)
 Frame = +3

Query  189  GKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------DSSN  341
            GK+ ++  +LV+   +GV+FG F+G SFP++ L K+N+ +SL++++D          +S 
Sbjct  49   GKKSSDGARLVITTILGVVFGFFVGMSFPSVSLTKINLPSSLISSLDVAITDIHKTTTSK  108

Query  342  LTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLT  521
              ED    +  KI+VP+NPRGAE LPP I+V ESD YLRRLWGEPS+DL  KPKYL+T T
Sbjct  109  SVEDHGPSNVPKIYVPTNPRGAELLPPGIVVSESDLYLRRLWGEPSEDLKKKPKYLVTFT  168

Query  522  VGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRF  701
            VG  QK+NIDA VKKFS++F I+LFHYDG+ +EWD+FEWSK AIHVS  KQTKWWYAKRF
Sbjct  169  VGLDQKNNIDASVKKFSEDFMIMLFHYDGRVSEWDQFEWSKNAIHVSVKKQTKWWYAKRF  228

Query  702  LHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRR  881
            LHPDIVASYEYIFIWDEDLGVEHF+  +YI+LVKKHGLEISQPGLE   G  LTW+MT+R
Sbjct  229  LHPDIVASYEYIFIWDEDLGVEHFNGNKYIELVKKHGLEISQPGLEPNNG--LTWQMTKR  286

Query  882  KANSEVHKETDEKQGWCSDPHLPPCAA--------------------FVEIMAPVFS  992
            + + EVHK+T+EK GWCSDPHLPPCAA                    FVEIMAPVFS
Sbjct  287  RGDREVHKDTEEKPGWCSDPHLPPCAAYPNFLSFSFSLCMLLTRTTRFVEIMAPVFS  343



>ref|XP_010531567.1| PREDICTED: uncharacterized protein LOC104807825 isoform X2 [Tarenaya 
hassleriana]
Length=404

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 217/301 (72%), Gaps = 26/301 (9%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M  F      +R  E +KLV    +G+ FG F+G SFP L + K+++  +L+   D SS 
Sbjct  1    MGIFSRSLISRRSTEGMKLVATAFLGIAFGFFVGISFPTLSITKVSLPTNLLYFADLSSV  60

Query  342  LTEDQTV------------------------MDPTKIWVPSNPRGAERLPPDIIVPESDF  449
                 +V                        +D ++IWVPSNPRGAERLPP I+  ESDF
Sbjct  61   EERGSSVPTPADHKAWSSLKGNDSRSSAPDSIDKSQIWVPSNPRGAERLPPGIVAAESDF  120

Query  450  YLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDE  629
            YLRRLWG P +DLT KP+YL+T TVGY Q++NIDA VKKFSDNFTI+LFHYDG+TTEWDE
Sbjct  121  YLRRLWGLPEEDLTSKPRYLVTFTVGYDQRNNIDACVKKFSDNFTIVLFHYDGRTTEWDE  180

Query  630  FEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKH  809
            FEWSKRAIH+S  KQTKWWY KRFLHPDI+A+Y+YIF+WDEDLGVEHF+ EEYIKLVKKH
Sbjct  181  FEWSKRAIHISVRKQTKWWYVKRFLHPDIIAAYDYIFVWDEDLGVEHFNGEEYIKLVKKH  240

Query  810  GLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVF  989
            GLEISQPGLE  +G  LTW MT+R  + EVHK T+EK   CSDP LPPCAAFVEIMAPVF
Sbjct  241  GLEISQPGLEPNRG--LTWPMTKRIEDLEVHKTTEEKPELCSDPLLPPCAAFVEIMAPVF  298

Query  990  S  992
            S
Sbjct  299  S  299



>ref|NP_001141005.1| lysine ketoglutarate reductase trans-splicing 1 [Zea mays]
 gb|ACF85151.1| unknown [Zea mays]
 gb|ACG34813.1| lysine ketoglutarate reductase trans-splicing related 1 [Zea 
mays]
 gb|AFW75009.1| lysine ketoglutarate reductase trans-splicing 1 [Zea mays]
Length=401

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/284 (63%), Positives = 219/284 (77%), Gaps = 22/284 (8%)
 Frame = +3

Query  201  NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVM-----  365
            N +++LV+   IG + G FIG SFP++ + KL+   S ++ ++D       Q ++     
Sbjct  16   NGSMRLVMVTVIGAVLGFFIGISFPSVSITKLHFPDSFISYIEDKDAGLTTQAILNHAWT  75

Query  366  ----------DPT-----KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKP  500
                      +PT     KI+VP+NP+GAE L P I+V ESDF+LRRLWG+PS+DL  KP
Sbjct  76   SARNARGNGTEPTSNSTLKIYVPTNPKGAEGLAPGIVVSESDFHLRRLWGDPSEDLPFKP  135

Query  501  KYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTK  680
            KYL+T TVG +QK NI+  VKKFSDNF ILLFHYDG+ +EWDEFEWS+RAIH+S  KQTK
Sbjct  136  KYLVTFTVGVEQKANINRAVKKFSDNFAILLFHYDGRVSEWDEFEWSQRAIHISVRKQTK  195

Query  681  WWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWL  860
            WWYAKRFLHPDIVA+YEYIFIWDEDLGVEHF+AEEYIKLVKKH L+ISQPGLE  +G  L
Sbjct  196  WWYAKRFLHPDIVAAYEYIFIWDEDLGVEHFNAEEYIKLVKKHNLDISQPGLEPDRG--L  253

Query  861  TWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            TW+MT+R+ +SEVHK+T+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  254  TWQMTKRRGDSEVHKDTEERPGWCSDPHLPPCAAFVEIMAPVFS  297



>ref|XP_002892430.1| hypothetical protein ARALYDRAFT_888027 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68689.1| hypothetical protein ARALYDRAFT_888027 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/276 (63%), Positives = 215/276 (78%), Gaps = 11/276 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------DSSNL  344
            +R NE  KL++   +G++FG F+G + P     K+++ + L++++D              
Sbjct  11   RRTNENAKLIITTIVGMVFGFFVGITLPLGAFRKISLPSGLISSLDVAMSDGKLFSGGRS  70

Query  345  TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
             ED       KI+VP+NP GAE LPP IIV E+DFYLRRLWGEPS+DL  KPKYL+T TV
Sbjct  71   PEDFGSRKSPKIYVPTNPHGAELLPPGIIVAETDFYLRRLWGEPSEDLKKKPKYLVTFTV  130

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G +Q++NI+A V KFS++F ILLFHYDG+TTEWD+FEWSK AIH+SA KQTKWWYAKRFL
Sbjct  131  GLEQRNNINAAVLKFSEDFQILLFHYDGRTTEWDQFEWSKNAIHISAKKQTKWWYAKRFL  190

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPD+V++YEYIFIWDEDLGV+HF+A+ YI+LVKKHGLEISQPGLE   G  LTWEMT+R+
Sbjct  191  HPDVVSAYEYIFIWDEDLGVKHFNADRYIELVKKHGLEISQPGLEPNNG--LTWEMTKRR  248

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + +VHKET EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  GDRDVHKETKEKPGWCSDPHLPPCAAFVEIMAPVFS  284



>ref|XP_003543467.1| PREDICTED: uncharacterized protein LOC100806338 [Glycine max]
Length=397

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 223/298 (75%), Gaps = 28/298 (9%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDD--------  332
            H ++ KR N++ ++++   +G+ FG F+G S  +++L K+++ +S V N  D        
Sbjct  2    HRNSLKRSNDSTRIIITAIMGIAFGFFVGISISSVHLTKISLLSSPVGNSFDVPVADSEI  61

Query  333  ---SSNLTEDQTVMDPT---------------KIWVPSNPRGAERLPPDIIVPESDFYLR  458
               S  +     V+D +               KI+V SNPRGAE LPP I+V ESDFYLR
Sbjct  62   DRFSDEVKRSSAVIDESSGTKNLETLGSIRLPKIFVASNPRGAESLPPGIVVSESDFYLR  121

Query  459  RLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEW  638
            RLWGEPS+DL  KPKYL+T TVGY+Q+ NI+A VKKFSD+F ILLFHYDG+T+EWD+FEW
Sbjct  122  RLWGEPSEDLKKKPKYLVTFTVGYEQRHNINAAVKKFSDDFAILLFHYDGRTSEWDQFEW  181

Query  639  SKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLE  818
            S+ AIHVSA KQTKWWYAKRFLHPDIV++YEYIFIWDEDLGVEHF+A++YI LVKK+GLE
Sbjct  182  SRSAIHVSARKQTKWWYAKRFLHPDIVSAYEYIFIWDEDLGVEHFNADKYIHLVKKYGLE  241

Query  819  ISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            ISQPGLE   G  LTWEMT+R+ + EVH  T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  242  ISQPGLEPNNG--LTWEMTKRRGDKEVHMVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  297



>gb|EEC72009.1| hypothetical protein OsI_04874 [Oryza sativa Indica Group]
Length=395

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/297 (60%), Positives = 219/297 (74%), Gaps = 22/297 (7%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M   G  S   R NE ++L+ +  IGV+ G   G SFP + + KL+   S+++ ++D  +
Sbjct  1    MSKLGRSSGLPRSNEGMRLLFSAVIGVMLGYLFGISFPTVNVTKLHFPFSIISYIEDKDS  60

Query  342  LTEDQTVMDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRR  461
                QT+++                      KI+VP+NP+GAE L P I+VPE+D YLRR
Sbjct  61   GITTQTLLNHAWTSANSKKRNNSESNSDEIPKIYVPTNPKGAEGLAPGIVVPETDLYLRR  120

Query  462  LWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWS  641
            LWGEPS+DLT +P+YL+T TVGY QK NIDA VKKFS+NFTI+LFHYDG+T +WDEFEWS
Sbjct  121  LWGEPSEDLTSQPRYLITFTVGYSQKANIDAAVKKFSENFTIMLFHYDGRTNDWDEFEWS  180

Query  642  KRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEI  821
            KRAIHVS  +QTKWWYAKRFLHPDIVA Y+YIFIWDEDL V+HF+AE YIKLV+KHGLEI
Sbjct  181  KRAIHVSVRRQTKWWYAKRFLHPDIVAPYDYIFIWDEDLSVQHFNAEAYIKLVRKHGLEI  240

Query  822  SQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            SQPGLE  KG  LTW+MT+R  + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  241  SQPGLEPDKG--LTWQMTKRLGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  295



>ref|XP_010233400.1| PREDICTED: uncharacterized protein LOC100822631 [Brachypodium 
distachyon]
Length=357

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/284 (62%), Positives = 219/284 (77%), Gaps = 22/284 (8%)
 Frame = +3

Query  201  NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDPT--  374
            NE++++V+   IGV+ G FIG SFP++ + KL+  +S V+  ++S      Q ++D    
Sbjct  16   NESMRIVMVTVIGVVLGFFIGISFPSVSITKLHFPSSFVSYTEESHPEITTQDLLDHAWT  75

Query  375  ------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKP  500
                              KI+VP+NP+GAERL P I+VP+SD +L RLWG PS+DL  KP
Sbjct  76   SARNETDNSSESNSNDTLKIYVPTNPKGAERLAPGIVVPDSDLHLHRLWGNPSEDLPFKP  135

Query  501  KYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTK  680
            KYL+T TVGY QK+NI+  V+KFSDNF ILLFHYDG+ +EW+EFEWSKRAIH+S  KQTK
Sbjct  136  KYLVTFTVGYAQKENINRAVQKFSDNFAILLFHYDGRVSEWNEFEWSKRAIHISVSKQTK  195

Query  681  WWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWL  860
            WWYAKRFLHPDIVA+YEYIFIWDEDLGV++FDAEEYIKLVKK+GL+ISQPGLE  +G  L
Sbjct  196  WWYAKRFLHPDIVAAYEYIFIWDEDLGVDNFDAEEYIKLVKKYGLDISQPGLEPDRG--L  253

Query  861  TWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            TW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  254  TWQMTKRRGDREVHKNTEERPGWCADPHLPPCAAFVEIMAPVFS  297



>ref|XP_004135276.1| PREDICTED: uncharacterized protein LOC101222926 [Cucumis sativus]
 ref|XP_004166255.1| PREDICTED: uncharacterized LOC101222926 [Cucumis sativus]
 gb|KGN51746.1| hypothetical protein Csa_5G598050 [Cucumis sativus]
Length=403

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 219/294 (74%), Gaps = 26/294 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNL-----T  347
            S  ++ N++++L++   +GV  G  IG SFP L L KL + + L+  +D+  N      +
Sbjct  8    SVNRKPNDSMRLIIITFMGVFLGFLIGISFPTLSLTKLGIPSGLIPKIDEMYNTDIKAGS  67

Query  348  EDQTVMD-------------------PTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
              QT  +                    ++IWVPSNPRGAERL P I+  ESDFYL RLWG
Sbjct  68   STQTSQNFPSTTTGSGDKNNSHNRNGTSEIWVPSNPRGAERLAPGIVAAESDFYLHRLWG  127

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
             P +DL  KP YL+T TVGYKQK+NID  VKKFS+NFTILLFHYDG+TTEWDEFEWSKRA
Sbjct  128  NPHEDLNTKPNYLVTFTVGYKQKENIDKAVKKFSENFTILLFHYDGRTTEWDEFEWSKRA  187

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVSA KQ+KWWYAKRFLHPDIVA Y+YIF+WDEDLGVE+FDAEEYIKLV+KHGLEISQP
Sbjct  188  IHVSARKQSKWWYAKRFLHPDIVAPYDYIFMWDEDLGVENFDAEEYIKLVRKHGLEISQP  247

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE  +G  LTW+MT+++   EVHK+T E+ GWC++P+LPPCAAFVEIMAPVFS
Sbjct  248  GLEPTRG--LTWQMTKKRDGLEVHKDTAERPGWCTEPNLPPCAAFVEIMAPVFS  299



>ref|XP_010470715.1| PREDICTED: uncharacterized protein LOC104750595 [Camelina sativa]
 ref|XP_010470716.1| PREDICTED: uncharacterized protein LOC104750595 [Camelina sativa]
 ref|XP_010470717.1| PREDICTED: uncharacterized protein LOC104750595 [Camelina sativa]
Length=404

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/299 (61%), Positives = 215/299 (72%), Gaps = 24/299 (8%)
 Frame = +3

Query  162  MKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSN  341
            M  F   S  ++ N+ +K++     GV FG  IG SFP+L + K+++  + + + D S  
Sbjct  1    MGIFSRSSISRKSNDGMKIIATAFFGVTFGFLIGISFPSLSITKVSLPTNFLPSNDLSYV  60

Query  342  LTEDQTVMDPTK----------------------IWVPSNPRGAERLPPDIIVPESDFYL  455
              +  T+  P                        IWVPSNPRGAE LPP +I  ESDFYL
Sbjct  61   EEKGSTIATPESHKAWSSSKDNDSSSSSPIDKSKIWVPSNPRGAEMLPPGMIAAESDFYL  120

Query  456  RRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFE  635
            RRLWG P +DLT +P+YL T TVG  QK NIDA VKKFS+NFTI+LFHYDGQ +EWDEFE
Sbjct  121  RRLWGLPQEDLTSEPRYLATFTVGINQKANIDACVKKFSENFTIVLFHYDGQVSEWDEFE  180

Query  636  WSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGL  815
            WSK AIH+S  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIK+VKKHGL
Sbjct  181  WSKTAIHISVRKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEEYIKMVKKHGL  240

Query  816  EISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            EISQPGLE  +G  LTW+MT+R+ + EVHK T+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  241  EISQPGLEPNQG--LTWQMTKRRGDMEVHKITEERPGWCSDPHLPPCAAFVEIMAPVFS  297



>gb|AAM20490.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72175.1| unknown protein [Arabidopsis thaliana]
Length=341

 Score =   372 bits (955),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/270 (64%), Positives = 219/270 (81%), Gaps = 6/270 (2%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---DSSNLTEDQTV  362
            +R NE  K+++   +G++FG FIG + P+L   K+N+ + L++++D         ED   
Sbjct  11   RRTNENAKVIITTILGIVFGTFIGITLPSLSF-KINLPSRLISSLDVAISGDKSPEDFGS  69

Query  363  MDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKD  542
                +I+VP+NPRGAE LPP I+V ++DFYLRRLWGEP++DL  KPKYL+T TVG++Q++
Sbjct  70   RKFPEIYVPTNPRGAELLPPGIVVAKTDFYLRRLWGEPNEDLKKKPKYLVTFTVGFEQRN  129

Query  543  NIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVA  722
            +I+ VVKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+S  KQTKWWYAKRFLHPD+V+
Sbjct  130  HINGVVKKFSEDFQILLFHYDGRTTEWDQFEWSKSAIHISTRKQTKWWYAKRFLHPDVVS  189

Query  723  SYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVH  902
            +YEYIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTWEMT+R+ + EVH
Sbjct  190  AYEYIFIWDEDLGVEHFNADKYIELVKKHGLEISQPGLEPNNG--LTWEMTKRRGDREVH  247

Query  903  KETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            K+T EK GWC DPHLPPCAAFVEIMAPVFS
Sbjct  248  KDTKEKPGWCKDPHLPPCAAFVEIMAPVFS  277



>ref|XP_009111574.1| PREDICTED: uncharacterized protein LOC103836996 [Brassica rapa]
 ref|XP_009111575.1| PREDICTED: uncharacterized protein LOC103836996 [Brassica rapa]
 emb|CDY20045.1| BnaA09g02060D [Brassica napus]
Length=399

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 225/294 (77%), Gaps = 29/294 (10%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------SNLTED  353
            +R ++ +KL+VA   GVI G  +G +FP L L K+N+ ++L  ++D +      S+L+  
Sbjct  2    RRPSQMMKLLVASFFGVIVGFLMGITFPTLTLTKMNLPSTLFPSIDLAYIEDKYSDLSRK  61

Query  354  Q---------------TVMDP------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
            +                + DP      TKIWVPSNPRGAERLPPDI+ PESD YLRRLWG
Sbjct  62   RLFSSWSSTKSSKPKNDIPDPPYTYNDTKIWVPSNPRGAERLPPDIVTPESDLYLRRLWG  121

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
            +P++DL  K +YL+T TVGY Q+ NIDA +KKFSDNFTI+LFHYDG+ +EW+EFEWSKRA
Sbjct  122  DPNEDLKTKQRYLVTFTVGYGQRKNIDAALKKFSDNFTIMLFHYDGRASEWEEFEWSKRA  181

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFD+E+Y+ +VKKHGLEISQP
Sbjct  182  IHVSIRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDSEKYLAVVKKHGLEISQP  241

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE  +G  LTWEMT+++ ++EVHK  +E+ GWCSDP+LPPCAAFVEIMAPVFS
Sbjct  242  GLEPYEG--LTWEMTKKRDDTEVHKHAEERNGWCSDPNLPPCAAFVEIMAPVFS  293



>ref|XP_004952283.1| PREDICTED: uncharacterized protein LOC101755578 isoform X3 [Setaria 
italica]
Length=402

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/290 (61%), Positives = 222/290 (77%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S+  R NE ++L+ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++    QT+
Sbjct  11   SSMPRSNEGMRLIFSAVVGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITTQTL  70

Query  363  MDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+VP+NP+GAERLPP I+V ESD Y RRLWG+PS+
Sbjct  71   LNHAWASANNRKKNNSDSNSDEIPKIYVPTNPKGAERLPPGIVVSESDLYPRRLWGDPSE  130

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT +P+YL+T TVG  QK NIDA VKKFSD FTI+LFHYDG+TTEWDEFEWSKRAIHVS
Sbjct  131  DLTSEPRYLVTFTVGIGQKANIDAAVKKFSDKFTIMLFHYDGRTTEWDEFEWSKRAIHVS  190

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGLEISQPGL+ 
Sbjct  191  VMKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEKYIELVRKHGLEISQPGLQP  250

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +G  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  251  DRG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  298



>gb|AFW62453.1| hypothetical protein ZEAMMB73_667064 [Zea mays]
Length=402

 Score =   374 bits (960),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 222/290 (77%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S+  R NE ++L+ +  IG++ G   G SFP + + KL+  +S+++ ++D ++    QT+
Sbjct  11   SSMPRSNEGLRLIFSAVIGIMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITTQTL  70

Query  363  MDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+VP+NP+GAERLPP I+V E+D Y RRLWG+PS+
Sbjct  71   LNHAWASANNRKKNSSESNTDEIPKIYVPTNPKGAERLPPGIVVSETDLYPRRLWGDPSE  130

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT +P+YL+T TVG  QK NIDA VKKFSD FTI+LFHYDG+TTEWDEFEWSKRAIHVS
Sbjct  131  DLTSEPRYLVTFTVGIGQKANIDAAVKKFSDKFTIMLFHYDGRTTEWDEFEWSKRAIHVS  190

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGLEISQPGL+ 
Sbjct  191  VRKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEKYIELVRKHGLEISQPGLQP  250

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             KG  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  251  DKG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  298



>gb|KHN21509.1| hypothetical protein glysoja_021089 [Glycine soja]
Length=406

 Score =   374 bits (960),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 222/296 (75%), Gaps = 28/296 (9%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDD----------  332
            S+ KR N++ ++++   +G+ FG F+G S  +++L K+++ +S V N  D          
Sbjct  13   SSLKRSNDSTRIIITAIMGIAFGFFVGISISSVHLTKISLLSSPVGNSFDVPVADSEIDR  72

Query  333  -SSNLTEDQTVMDPT---------------KIWVPSNPRGAERLPPDIIVPESDFYLRRL  464
             S  +     V+D +               KI+V SNPRGAE LPP I+V ESDFYLRRL
Sbjct  73   FSDEVKRSSAVIDESSGTKNLETLGSIRLPKIFVASNPRGAESLPPGIVVSESDFYLRRL  132

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSK  644
            WGEPS+DL  KPKYL+T TVGY+Q+ NI+A VKKFSD+F ILLFHYDG+T+EWD+FEWS+
Sbjct  133  WGEPSEDLKKKPKYLVTFTVGYEQRHNINAAVKKFSDDFAILLFHYDGRTSEWDQFEWSR  192

Query  645  RAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEIS  824
             AIHVSA KQTKWWYAKRFLHPDIV++YEYIFIWDEDLGVEHF+A++YI LVKK+GLEIS
Sbjct  193  SAIHVSARKQTKWWYAKRFLHPDIVSAYEYIFIWDEDLGVEHFNADKYIHLVKKYGLEIS  252

Query  825  QPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            QPGLE   G  LTWEMT+R+ + EVH  T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  253  QPGLEPNNG--LTWEMTKRRGDKEVHMVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  306



>emb|CDP07097.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   373 bits (958),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/274 (64%), Positives = 218/274 (80%), Gaps = 10/274 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVN----NVDDSS---NLTE  350
            K+ ++  +LV+   +G++FG FIG SFP + L K+N     +N    ++D  S    +  
Sbjct  11   KKSSDGARLVITTIMGIVFGYFIGVSFPFVSLAKINFFEGAMNRDRHSLDTRSFPETVGS  70

Query  351  DQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGY  530
              T + P KI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+DL  KPKYL+T TVG 
Sbjct  71   GSTPLAP-KIYVPTNPRGAESLPPGIVVSESDFYLRRLWGEPSEDLKRKPKYLVTFTVGL  129

Query  531  KQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHP  710
             Q++NIDA VKKFS++F I+LFHYDG+T+EWD+FEWSK AIHVS  +QTKWWYAKRFL P
Sbjct  130  DQRNNIDAAVKKFSEDFQIMLFHYDGRTSEWDQFEWSKHAIHVSVRRQTKWWYAKRFLQP  189

Query  711  DIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKAN  890
            D++A+Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGLEISQPGLE   G  LTW+MT+R+ +
Sbjct  190  DVIAAYDYIFIWDEDLGVEHFNAEKYIQLVRKHGLEISQPGLEPNNG--LTWQMTKRRGD  247

Query  891  SEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  248  REVHKVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  281



>emb|CDY00154.1| BnaC09g01470D [Brassica napus]
Length=399

 Score =   374 bits (959),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 224/294 (76%), Gaps = 29/294 (10%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------SNLTED  353
            +R ++ +KL+VA   GVI G  +G +FP L L K+N+ ++L  ++D +      S+L+  
Sbjct  2    RRPSQMMKLLVASFFGVIVGFLMGITFPTLTLTKMNLPSTLFPSIDLAYIEDKYSDLSRK  61

Query  354  ---------------QTVMDP------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
                             + DP      TKIWVPSNPRGAERLPPDI+ PESD YLRRLWG
Sbjct  62   TLFSSWSSTKSSKPKNDIPDPPYTYNDTKIWVPSNPRGAERLPPDIVTPESDLYLRRLWG  121

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
            +P++DL  K +YL+T TVGY Q+ NIDA +KKFSDNFTI+LFHYDG+ +EW+EFEWSKRA
Sbjct  122  DPNEDLKTKQRYLVTFTVGYGQRKNIDAALKKFSDNFTIMLFHYDGRASEWEEFEWSKRA  181

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHFD+E+Y+ +VKKHGLEISQP
Sbjct  182  IHVSIRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDSEKYLAVVKKHGLEISQP  241

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE  +G  LTWEMT+++ ++EVHK  +E+ GWCSDP+LPPCAAFVEIMAPVFS
Sbjct  242  GLEPYEG--LTWEMTKKRDDTEVHKHAEERNGWCSDPNLPPCAAFVEIMAPVFS  293



>ref|XP_006391212.1| hypothetical protein EUTSA_v10018653mg [Eutrema salsugineum]
 gb|ESQ28498.1| hypothetical protein EUTSA_v10018653mg [Eutrema salsugineum]
Length=404

 Score =   374 bits (960),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 181/285 (64%), Positives = 211/285 (74%), Gaps = 24/285 (8%)
 Frame = +3

Query  204  ETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDP----  371
            + +K++     GV FG  +G SFP+L + K+++    + + D S    +   +  P    
Sbjct  15   DGMKIIATAFFGVTFGFLVGISFPSLSITKVSLPTKFLLSTDLSYIEEKGSAISTPESHK  74

Query  372  ------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                              +KIWVPSNPRGAERLPP I+  ESDFYLRRLWG P +DLT +
Sbjct  75   AWSSSKSNDSSSSDPIDKSKIWVPSNPRGAERLPPGIVAAESDFYLRRLWGLPHEDLTSQ  134

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            P+YL+T TVG  QK+NIDA VKKFS NFTILLFHYDG+ TEWDEFEWSK AIH+S  KQT
Sbjct  135  PRYLVTFTVGINQKENIDACVKKFSGNFTILLFHYDGRVTEWDEFEWSKNAIHISVRKQT  194

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLVKKHGLEISQPGLE  KG  
Sbjct  195  KWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEEYIKLVKKHGLEISQPGLEPNKG--  252

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  253  LTWQMTKRRGDLEVHKITEEKPGWCSDPHLPPCAAFVEIMAPVFS  297



>gb|AFW62455.1| hypothetical protein ZEAMMB73_667064 [Zea mays]
Length=401

 Score =   374 bits (959),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 174/286 (61%), Positives = 220/286 (77%), Gaps = 22/286 (8%)
 Frame = +3

Query  195  RQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDPT  374
            R NE ++L+ +  IG++ G   G SFP + + KL+  +S+++ ++D ++    QT+++  
Sbjct  14   RSNEGLRLIFSAVIGIMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITTQTLLNHA  73

Query  375  --------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTM  494
                                KI+VP+NP+GAERLPP I+V E+D Y RRLWG+PS+DLT 
Sbjct  74   WASANNRKKNSSESNTDEIPKIYVPTNPKGAERLPPGIVVSETDLYPRRLWGDPSEDLTS  133

Query  495  KPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQ  674
            +P+YL+T TVG  QK NIDA VKKFSD FTI+LFHYDG+TTEWDEFEWSKRAIHVS  KQ
Sbjct  134  EPRYLVTFTVGIGQKANIDAAVKKFSDKFTIMLFHYDGRTTEWDEFEWSKRAIHVSVRKQ  193

Query  675  TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGV  854
            TKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGLEISQPGL+  KG 
Sbjct  194  TKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEKYIELVRKHGLEISQPGLQPDKG-  252

Query  855  WLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  253  -LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  297



>ref|XP_006365731.1| PREDICTED: uncharacterized protein LOC102598936 [Solanum tuberosum]
Length=387

 Score =   373 bits (958),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/278 (64%), Positives = 224/278 (81%), Gaps = 13/278 (5%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQ-----  356
            KR N++V+L++   +G++FG FIG SFP++ L K++  +S+++++D + N    +     
Sbjct  13   KRSNDSVRLIITTIMGMVFGYFIGISFPSVSLAKISFPSSIISSLDVAFNDDHQRLSGRS  72

Query  357  ------TVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTL  518
                  ++    KI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+DL  KPKYL+T 
Sbjct  73   FPENLGSIPLTPKIYVPTNPRGAESLPPGIVVAESDFYLRRLWGEPSEDLRNKPKYLVTF  132

Query  519  TVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKR  698
            TVG  QK+NIDA VKKFS++F ILLFHYDG+T+EWD+FEWSKRA+H+S  KQTKWWYAKR
Sbjct  133  TVGLDQKNNIDACVKKFSEDFQILLFHYDGRTSEWDQFEWSKRAVHISIRKQTKWWYAKR  192

Query  699  FLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTR  878
            FLHPD+VA+Y+YIFIWDEDLGVEHF+AE+YI+LVKKHGLEISQPGLE   G  LTW+MT+
Sbjct  193  FLHPDVVAAYDYIFIWDEDLGVEHFNAEKYIQLVKKHGLEISQPGLEPNNG--LTWQMTK  250

Query  879  RKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            R+ + EVHK T+EK GWCSD  LPPCAAFVEIMAPVFS
Sbjct  251  RRGDREVHKSTEEKPGWCSDQRLPPCAAFVEIMAPVFS  288



>emb|CDY12672.1| BnaA02g13400D [Brassica napus]
Length=457

 Score =   375 bits (964),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 184/291 (63%), Positives = 211/291 (73%), Gaps = 30/291 (10%)
 Frame = +3

Query  204  ETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDPT---  374
            + +K++ A   GV FG  IG SFP+L + K+N+    + + D S    +   +  P    
Sbjct  62   DGMKIIAAAFFGVTFGFLIGISFPSLSITKVNLPTKFLASNDLSYIEEKGSAIATPDSHK  121

Query  375  -------------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPS  479
                                      IWVPSNPRGAERLPP I+  ESDFYLRRLWG P 
Sbjct  122  SWSSSKSNDTSSSAPIDKSQACFFYTIWVPSNPRGAERLPPGIVAAESDFYLRRLWGLPH  181

Query  480  QDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHV  659
            +DLT +P+YL+T TVG KQK NIDA VKKFS+NFTILLFHYDG+ TEWDEFEWSK AIH+
Sbjct  182  EDLTRQPRYLVTFTVGIKQKQNIDACVKKFSENFTILLFHYDGRVTEWDEFEWSKTAIHI  241

Query  660  SAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLE  839
            S  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLVKKHGLEISQPGLE
Sbjct  242  SVRKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEEYIKLVKKHGLEISQPGLE  301

Query  840  RKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
              KG  LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  302  PNKG--LTWQMTKRRGDLEVHKITEEKPGWCSDPHLPPCAAFVEIMAPVFS  350



>gb|AFW62454.1| hypothetical protein ZEAMMB73_667064 [Zea mays]
Length=406

 Score =   374 bits (959),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 222/290 (77%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S+  R NE ++L+ +  IG++ G   G SFP + + KL+  +S+++ ++D ++    QT+
Sbjct  11   SSMPRSNEGLRLIFSAVIGIMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITTQTL  70

Query  363  MDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+VP+NP+GAERLPP I+V E+D Y RRLWG+PS+
Sbjct  71   LNHAWASANNRKKNSSESNTDEIPKIYVPTNPKGAERLPPGIVVSETDLYPRRLWGDPSE  130

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT +P+YL+T TVG  QK NIDA VKKFSD FTI+LFHYDG+TTEWDEFEWSKRAIHVS
Sbjct  131  DLTSEPRYLVTFTVGIGQKANIDAAVKKFSDKFTIMLFHYDGRTTEWDEFEWSKRAIHVS  190

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGLEISQPGL+ 
Sbjct  191  VRKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEKYIELVRKHGLEISQPGLQP  250

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             KG  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  251  DKG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  298



>ref|XP_011089930.1| PREDICTED: uncharacterized protein LOC105170731 [Sesamum indicum]
 ref|XP_011089931.1| PREDICTED: uncharacterized protein LOC105170731 [Sesamum indicum]
Length=382

 Score =   372 bits (956),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/279 (65%), Positives = 224/279 (80%), Gaps = 14/279 (5%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNV-----DDSSNLT---  347
            K+ N+ V+++V   +G++ G F+G SFP++ L+K+N+ +SL+ +      DD   LT   
Sbjct  12   KKSNDIVRIIVTTIMGMLLGYFMGVSFPSVSLSKINLPSSLMPSANVAFSDDLPTLTRTY  71

Query  348  -EDQTVMD--PT-KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLT  515
             ED+ + D  PT KI++P+NPRGAE LPP IIV ESDFYLRRLWG PS+DL  KPKYL+T
Sbjct  72   PEDRVLNDTPPTPKIYLPTNPRGAESLPPGIIVSESDFYLRRLWGNPSEDLRKKPKYLVT  131

Query  516  LTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAK  695
             TVG  QK++IDA VKKFS++F ILLFHYDG+T+EW++ EWS+RAIH+SA KQTKWWYAK
Sbjct  132  FTVGINQKNHIDAAVKKFSEDFQILLFHYDGRTSEWEQLEWSRRAIHISARKQTKWWYAK  191

Query  696  RFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMT  875
            RFLHPD+V  Y+YIFIWDEDLGVEHFDAE+YI+LVKKHGLEISQP LE   G  LTW MT
Sbjct  192  RFLHPDVVVPYDYIFIWDEDLGVEHFDAEKYIELVKKHGLEISQPALEPNSG--LTWLMT  249

Query  876  RRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            ++K N EVHK+T+E+ GWCSDP+LPPCA FVEIMAPVFS
Sbjct  250  KKKDNREVHKDTEERPGWCSDPYLPPCAGFVEIMAPVFS  288



>ref|XP_009771349.1| PREDICTED: uncharacterized protein LOC104221902 [Nicotiana sylvestris]
 ref|XP_009771350.1| PREDICTED: uncharacterized protein LOC104221902 [Nicotiana sylvestris]
 ref|XP_009771351.1| PREDICTED: uncharacterized protein LOC104221902 [Nicotiana sylvestris]
Length=403

 Score =   373 bits (958),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 218/291 (75%), Gaps = 23/291 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------SNL  344
            SN +R+NE ++L+V    GV+ G+F+G SFP L   KLN+ +SL   +D S      S L
Sbjct  11   SNTRRRNEMMRLLVTTFAGVVLGIFLGVSFPTLSFTKLNLPSSLFGLIDLSFIEDKYSGL  70

Query  345  TEDQTV---------------MDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPS  479
            +    +                + TKIWVPSNPRGAERL P II  ESD Y RRLWG P 
Sbjct  71   STQDLLNVLSSLRSHRGNSHKHNDTKIWVPSNPRGAERLSPGIIASESDLYPRRLWGLPR  130

Query  480  QDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHV  659
            +DL +KP+YL++  VGYKQK+NIDA VKKFS+NFT +LFHYDG+T+EWD+ EWSKRAIHV
Sbjct  131  EDLIIKPRYLVSFAVGYKQKNNIDAAVKKFSENFTFMLFHYDGRTSEWDDLEWSKRAIHV  190

Query  660  SAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLE  839
            S  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+E+FDAEEYIKLV+KHGL+ISQPG+ 
Sbjct  191  STRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLENFDAEEYIKLVQKHGLDISQPGV-  249

Query  840  RKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
                + L W M +R+ ++EVHKET+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  250  -ASNIELAWRMAKRRNDTEVHKETEERPGWCTDPHLPPCAAFVEIMAPVFS  299



>gb|KGN51347.1| hypothetical protein Csa_5G522930 [Cucumis sativus]
Length=1084

 Score =   392 bits (1008),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 194/321 (60%), Positives = 242/321 (75%), Gaps = 30/321 (9%)
 Frame = +3

Query  99   GNYLRDAGKLLYLSSGNRVCTMKNFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPA  278
            G  +R    +L ++  N  C   +FG   N ++ NE ++++V   +G +FG F+G SFP 
Sbjct  681  GVDIRSKLGVLEVAKFNTGC--HSFG---NMRKPNEIMRILVTTFVGGVFGFFLGVSFPT  735

Query  279  LYLNKLNVTASLVNNVDDS------SNLTED-----------------QTVMDPTKIWVP  389
            L L++LN  +SL+ ++D +      S L+ +                 Q  ++ TKIWVP
Sbjct  736  LSLSQLNFPSSLIPSIDLTYIEDKYSGLSTEAFLNAWSSLKGNRGISSQFSLNETKIWVP  795

Query  390  SNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKF  569
            +NPRGAERLPP I+ PESDF LRRLWG PS+DL +KPKYL+T TVG+ QK NIDA VKKF
Sbjct  796  TNPRGAERLPPGIVEPESDFNLRRLWGMPSEDLAIKPKYLVTFTVGFDQKKNIDAAVKKF  855

Query  570  SDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWD  749
            S+NFTILLFHYDG+ +EW++ EWSKRAIHVS +KQTKWWYAKRFLHPDIVASY+YIF+WD
Sbjct  856  SENFTILLFHYDGRASEWEDLEWSKRAIHVSVYKQTKWWYAKRFLHPDIVASYDYIFVWD  915

Query  750  EDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGW  929
            EDLGVEHF+AEEYIKLV+KHGLEISQPGLE  +G  LTW+MT+R+ +SEVHKET+EK GW
Sbjct  916  EDLGVEHFNAEEYIKLVRKHGLEISQPGLEPNQG--LTWQMTKRRGDSEVHKETEEKPGW  973

Query  930  CSDPHLPPCAAFVEIMAPVFS  992
            C+DPHLPPCAAFVEIMA VFS
Sbjct  974  CTDPHLPPCAAFVEIMATVFS  994



>ref|NP_850118.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850119.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001154537.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAD94744.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08103.1| uncharacterized protein AT2G28310 [Arabidopsis thaliana]
 gb|AEC08104.1| uncharacterized protein AT2G28310 [Arabidopsis thaliana]
 gb|AEC08105.1| uncharacterized protein AT2G28310 [Arabidopsis thaliana]
Length=374

 Score =   372 bits (955),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 172/270 (64%), Positives = 219/270 (81%), Gaps = 6/270 (2%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---DSSNLTEDQTV  362
            +R NE  K+++   +G++FG FIG + P+L   K+N+ + L++++D         ED   
Sbjct  11   RRTNENAKVIITTILGIVFGTFIGITLPSLSF-KINLPSRLISSLDVAISGDKSPEDFGS  69

Query  363  MDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQKD  542
                +I+VP+NPRGAE LPP I+V ++DFYLRRLWGEP++DL  KPKYL+T TVG++Q++
Sbjct  70   RKFPEIYVPTNPRGAELLPPGIVVAKTDFYLRRLWGEPNEDLKKKPKYLVTFTVGFEQRN  129

Query  543  NIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIVA  722
            +I+ VVKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+S  KQTKWWYAKRFLHPD+V+
Sbjct  130  HINGVVKKFSEDFQILLFHYDGRTTEWDQFEWSKSAIHISTRKQTKWWYAKRFLHPDVVS  189

Query  723  SYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEVH  902
            +YEYIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTWEMT+R+ + EVH
Sbjct  190  AYEYIFIWDEDLGVEHFNADKYIELVKKHGLEISQPGLEPNNG--LTWEMTKRRGDREVH  247

Query  903  KETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            K+T EK GWC DPHLPPCAAFVEIMAPVFS
Sbjct  248  KDTKEKPGWCKDPHLPPCAAFVEIMAPVFS  277



>ref|XP_010511750.1| PREDICTED: uncharacterized protein LOC104787807 [Camelina sativa]
 ref|XP_010511751.1| PREDICTED: uncharacterized protein LOC104787807 [Camelina sativa]
Length=404

 Score =   373 bits (958),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/292 (62%), Positives = 212/292 (73%), Gaps = 24/292 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S  ++ N+ +K++     GV FG  IG SFP+L + K+++  + + + D S    +  T+
Sbjct  10   STSRKSNDGMKIIATAFFGVTFGFLIGISFPSLSITKVSLPTNFLPSNDLSYIEEKGSTI  69

Query  363  MDPTK----------------------IWVPSNPRGAERLPPDIIVPESDFYLRRLWGEP  476
              P                        IWVPSNPRGAE LPP +I  ESDFYLRRLWG P
Sbjct  70   ATPESHKAWSSSKDNDSSSSSPIDKSKIWVPSNPRGAEMLPPGMIAAESDFYLRRLWGLP  129

Query  477  SQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIH  656
             +DLT +P+YL T TVG  QK NIDA VKKFS NFTI+LFHYDGQ TEWDEFEWSK AIH
Sbjct  130  QEDLTSEPRYLATFTVGINQKANIDACVKKFSGNFTIVLFHYDGQVTEWDEFEWSKTAIH  189

Query  657  VSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGL  836
            +S  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIK+VKKHGLEISQPGL
Sbjct  190  ISVRKQTKWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEEYIKMVKKHGLEISQPGL  249

Query  837  ERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            E  +G  LTW+MT+R+ + EVHK T+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  250  EPNQG--LTWQMTKRRGDMEVHKITEERPGWCSDPHLPPCAAFVEIMAPVFS  299



>emb|CDX98020.1| BnaA06g07710D [Brassica napus]
Length=405

 Score =   373 bits (958),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 226/297 (76%), Gaps = 24/297 (8%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----D  332
            N   CSNGK+ N+ +KL++A  IGV+ G F+G SFP L L K+N  ++++ +VD     D
Sbjct  7    NSNRCSNGKKLNDGMKLIIATFIGVVIGFFLGISFPTLSLTKINFPSTILPSVDIAYVED  66

Query  333  SSNLTEDQTVM------DPTK----------IWVPSNPRGAERLPPDIIVPESDFYLRRL  464
             +  T  +T++       P+           IWVPSNPRGAE L P I+ PESD+YLRRL
Sbjct  67   ETPETSSETLLHTWSSRTPSHRANASHWKAIIWVPSNPRGAEMLTPGIVAPESDYYLRRL  126

Query  465  WGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDN-FTILLFHYDGQTTEWDEFEWS  641
            WG P +D+ +KPKYL+  TVG+ Q+ N+DA VKKFS++ FT++LFHYDG+TTEWD++EWS
Sbjct  127  WGLPEEDIPVKPKYLIAFTVGFNQRVNVDACVKKFSEDLFTLVLFHYDGRTTEWDQYEWS  186

Query  642  KRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEI  821
            KRAIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+EHF+AEEYI+L+KKHGLEI
Sbjct  187  KRAIHVSVPKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLEHFNAEEYIRLIKKHGLEI  246

Query  822  SQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            SQPG+E +K +  TWE+T+RK   EVHK+  EK G C+DPHLPPCAAF+EIMAPVFS
Sbjct  247  SQPGVESEKKI--TWEITKRKTKGEVHKDAKEKPGRCNDPHLPPCAAFIEIMAPVFS  301



>ref|XP_009804490.1| PREDICTED: uncharacterized protein LOC104249712 isoform X3 [Nicotiana 
sylvestris]
Length=382

 Score =   372 bits (954),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/276 (64%), Positives = 219/276 (79%), Gaps = 12/276 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------DSSNL  344
            +R N+  +LV+   +G++FG FIG S P + L K+ + +SL++++D          S   
Sbjct  11   RRSNDRGRLVITTIMGMVFGYFIGISSPYVSLTKITLPSSLMSSLDVAFGDDHRRPSIER  70

Query  345  TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
               + +++P KI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+DLT KPKYL+T TV
Sbjct  71   FFPENLVNP-KIYVPTNPRGAESLPPRIVVSESDFYLRRLWGEPSKDLTNKPKYLVTFTV  129

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G  Q +NIDA V KFSD+F ILLFHYD +T+EWD+FEWSKRAIH+S  KQTKWWYAKRFL
Sbjct  130  GLSQMNNIDAAVTKFSDDFQILLFHYDDRTSEWDQFEWSKRAIHISVRKQTKWWYAKRFL  189

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPD+VA+Y+YIFIWDEDLGVEHF+AE+YI+LVKKHGLEISQP LE   G  LTW+MT+R+
Sbjct  190  HPDVVAAYDYIFIWDEDLGVEHFNAEKYIRLVKKHGLEISQPALEPNSG--LTWQMTKRR  247

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + EVHK TDEK GWCS+P LPPCAAFVEIMAPVFS
Sbjct  248  DDREVHKSTDEKPGWCSNPRLPPCAAFVEIMAPVFS  283



>ref|XP_009105088.1| PREDICTED: uncharacterized protein LOC103831005 [Brassica rapa]
 ref|XP_009105089.1| PREDICTED: uncharacterized protein LOC103831005 [Brassica rapa]
 ref|XP_009105090.1| PREDICTED: uncharacterized protein LOC103831005 [Brassica rapa]
 ref|XP_009105091.1| PREDICTED: uncharacterized protein LOC103831005 [Brassica rapa]
Length=404

 Score =   372 bits (956),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/285 (63%), Positives = 213/285 (75%), Gaps = 24/285 (8%)
 Frame = +3

Query  204  ETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDP----  371
            + +K++     GV+FG  IG SFP+L + K+++  + + +   S    +  T+  P    
Sbjct  15   DGMKIIATAFFGVMFGFLIGISFPSLSITKVSLPTNFLPSNGISYIEEKGSTIATPDSHK  74

Query  372  ------------------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                              +KIWVPSNPRGAERLPP +I  ESDFYLRRLWG P +DLT +
Sbjct  75   SWSSSKSNDSSSSGPVDKSKIWVPSNPRGAERLPPGMIAAESDFYLRRLWGLPHEDLTSQ  134

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            P+YL+T TVG  QK+NIDA VKKFS+NFTI+LFHYDG+ TEWDEFEWSK AIH+S  KQT
Sbjct  135  PRYLVTFTVGINQKENIDACVKKFSENFTIVLFHYDGRVTEWDEFEWSKTAIHISVRKQT  194

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIKLVKKHGLEISQPGLE  KG  
Sbjct  195  KWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEEYIKLVKKHGLEISQPGLEPNKG--  252

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHK T+EK GWCSDPHLPPCA FVEIMAPVFS
Sbjct  253  LTWQMTKRRGDLEVHKITEEKPGWCSDPHLPPCAGFVEIMAPVFS  297



>ref|NP_001132425.1| uncharacterized protein LOC100193875 [Zea mays]
 gb|ACF81258.1| unknown [Zea mays]
Length=402

 Score =   372 bits (956),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/290 (60%), Positives = 221/290 (76%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S+  R NE ++L+ +  IG++ G   G SFP + + KL+  +S+++ ++D ++    QT+
Sbjct  11   SSMPRSNEGLRLIFSAVIGIMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITTQTL  70

Query  363  MDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+VP+NP+GAERLPP I+V E+D Y RRLWG+PS+
Sbjct  71   LNHAWASANNRKKNSSESNTDEIPKIYVPTNPKGAERLPPGIVVSETDLYPRRLWGDPSE  130

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT +P+Y +T TVG  QK NIDA VKKFSD FTI+LFHYDG+TTEWDEFEWSKRAIHVS
Sbjct  131  DLTSEPRYFVTFTVGIGQKANIDAAVKKFSDKFTIMLFHYDGRTTEWDEFEWSKRAIHVS  190

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGLEISQPGL+ 
Sbjct  191  VRKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEKYIELVRKHGLEISQPGLQP  250

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             KG  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  251  DKG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  298



>emb|CDY70480.1| BnaAnng33820D [Brassica napus]
 emb|CDX71363.1| BnaC04g15980D [Brassica napus]
Length=383

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/278 (62%), Positives = 222/278 (80%), Gaps = 14/278 (5%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---DSSNLTEDQTV  362
            +R NE  K+++   +G++FG FIG S P+L   K+N+ ++L++++D       L   +  
Sbjct  12   RRTNENAKVIITTILGIVFGTFIGISLPSLSF-KINLPSALISSLDVALSDGKLLSARDD  70

Query  363  MDPT--------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTL  518
              P         +I+VP+NPRGAE LPP I+V ++D YLRRLWGEP++DL  KPKYL+T 
Sbjct  71   KSPEHFGSRKFPQIYVPTNPRGAELLPPGIVVAKTDLYLRRLWGEPNEDLKKKPKYLVTF  130

Query  519  TVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKR  698
            TVG++Q+++I++VVKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+S  KQTKWWYAKR
Sbjct  131  TVGFEQRNHINSVVKKFSEDFQILLFHYDGRTTEWDQFEWSKSAIHISTRKQTKWWYAKR  190

Query  699  FLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTR  878
            FLHPD+V++YEYIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTWEMT+
Sbjct  191  FLHPDVVSAYEYIFIWDEDLGVEHFNADKYIQLVKKHGLEISQPGLEPNNG--LTWEMTK  248

Query  879  RKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            R+ + EVHK+T EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  RRGDREVHKDTKEKAGWCSDPHLPPCAAFVEIMAPVFS  286



>ref|XP_010556214.1| PREDICTED: uncharacterized protein LOC104825558 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556215.1| PREDICTED: uncharacterized protein LOC104825558 isoform X1 [Tarenaya 
hassleriana]
Length=401

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/289 (64%), Positives = 218/289 (75%), Gaps = 30/289 (10%)
 Frame = +3

Query  204  ETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD------------------  329
            + +KLV     G+ FG F+G SFP L + K++V  S + + D                  
Sbjct  15   DGMKLVATAFFGIAFGFFVGISFPTLSITKVSVPTSFLRSADLSYIEEKGSSIATPADHK  74

Query  330  --------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
                    DS +   D   +D ++IWVPSNPRGAERLPP I+  ESDFYLRRLWG P +D
Sbjct  75   AWSSSKGNDSRSSASDS--VDKSQIWVPSNPRGAERLPPGIVAAESDFYLRRLWGLPHED  132

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            LT KP+YL+T TVGY Q++NIDA +KKFSDNFTI+LFHYDG+TTEWDEFEWSKRAIH+S 
Sbjct  133  LTSKPRYLVTFTVGYDQRNNIDACIKKFSDNFTIVLFHYDGRTTEWDEFEWSKRAIHISV  192

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPDI+A+Y+YIF+WDEDLGVEHF+AEEYIK VKKHGLEISQPGLE  
Sbjct  193  RKQTKWWYAKRFLHPDIIAAYDYIFVWDEDLGVEHFNAEEYIKTVKKHGLEISQPGLEPN  252

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            KG  LTW+MT+R+ + E+HK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  253  KG--LTWQMTKRRGDLEMHKITEEKPGWCSDPHLPPCAAFVEIMAPVFS  299



>ref|XP_009617945.1| PREDICTED: uncharacterized protein LOC104110200 [Nicotiana tomentosiformis]
 ref|XP_009617946.1| PREDICTED: uncharacterized protein LOC104110200 [Nicotiana tomentosiformis]
 ref|XP_009617947.1| PREDICTED: uncharacterized protein LOC104110200 [Nicotiana tomentosiformis]
Length=395

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/293 (60%), Positives = 218/293 (74%), Gaps = 23/293 (8%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDS------S  338
            H SN +R+NE ++L+V    GV+ G+F+G SFP L   KLN+ ++L   +D S      S
Sbjct  9    HSSNTRRRNEMMRLLVTTFAGVVLGIFLGVSFPTLSFTKLNLPSNLFGLIDLSFIEGKHS  68

Query  339  NLTEDQTV---------------MDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
             L+    +                + TKIWVPSNPRGAERLPP I   ESD Y RRLWG 
Sbjct  69   GLSTQDLLNAWSSLRSHRGNSHKHNDTKIWVPSNPRGAERLPPGITASESDLYPRRLWGL  128

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            P +DL +KP+YL++  VGY+QK+NID  VKKFS+NFT +LFHYDG+T+EWD+ EWSKRAI
Sbjct  129  PREDLIIKPRYLVSFAVGYEQKNNIDVAVKKFSENFTFILFHYDGRTSEWDDLEWSKRAI  188

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+E+FDAEEYIKLV+KHGL+ISQPG
Sbjct  189  HVSTRKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLENFDAEEYIKLVQKHGLDISQPG  248

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            +     + L W M +R+ ++EVHKET+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  249  V--ASNIELAWRMAKRRNDTEVHKETEERPGWCTDPHLPPCAAFVEIMAPVFS  299



>ref|XP_010682266.1| PREDICTED: uncharacterized protein LOC104897137 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682267.1| PREDICTED: uncharacterized protein LOC104897137 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=399

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/288 (63%), Positives = 223/288 (77%), Gaps = 11/288 (4%)
 Frame = +3

Query  156  CTMKNFGHCSNGKRQ-NETVKLVVAVTIGVIFGLFIGFSFPALYLNKLN----VTASLVN  320
            C+  N   CS   R+ +++++L++   IG+I G  +G     L ++KLN    +  + + 
Sbjct  16   CSHLNLIGCSMVSRKPSDSLRLILTTAIGIILGFIVGVYISLLSVSKLNPVNYIPVAFLP  75

Query  321  NVDD--SSNLTEDQTVMDPTK--IWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL  488
              D      + ++Q + D TK  ++V SNP+GAERLPP I+  +SD YLRRLWG PS+DL
Sbjct  76   ATDQQLGDGVRQNQVLNDTTKMPLFVQSNPKGAERLPPGIVAAQSDLYLRRLWGLPSEDL  135

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
            T  PKYL+T TVG   K+NIDA VKKFSDNFTILLFHYDG+T+EWD+FEWSKRAIHVSA 
Sbjct  136  TKTPKYLVTFTVGLDMKENIDAAVKKFSDNFTILLFHYDGKTSEWDQFEWSKRAIHVSAR  195

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDIVA+Y+YIFIWDEDLGVEHFD+E+YI+LVKKHGLEISQPG++ K 
Sbjct  196  KQTKWWYAKRFLHPDIVAAYDYIFIWDEDLGVEHFDSEKYIELVKKHGLEISQPGVDPKT  255

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +  TW+MTR++ NSEVHKET+EK GWC DPHLPPCAAFVEIMAPVFS
Sbjct  256  TI--TWQMTRKRDNSEVHKETEEKPGWCKDPHLPPCAAFVEIMAPVFS  301



>ref|NP_001149970.1| lysine ketoglutarate reductase trans-splicing related 1 [Zea 
mays]
 ref|XP_008681447.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG37370.1| lysine ketoglutarate reductase trans-splicing related 1 [Zea 
mays]
 gb|ACN26060.1| unknown [Zea mays]
 gb|ACN27550.1| unknown [Zea mays]
 gb|ACN28090.1| unknown [Zea mays]
 gb|AFW70890.1| lysine ketoglutarate reductase trans-splicing 1 isoform 1 [Zea 
mays]
 gb|AFW70891.1| lysine ketoglutarate reductase trans-splicing 1 isoform 2 [Zea 
mays]
Length=401

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/293 (59%), Positives = 223/293 (76%), Gaps = 22/293 (8%)
 Frame = +3

Query  174  GHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTED  353
            G   +  R NE ++L+ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++    
Sbjct  7    GSGRSMPRSNEGMRLIFSAVVGVMLGYLFGISFPTVNITKLHFPSSIISYIEDRNSGITT  66

Query  354  QTVMDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
            QT+++                      +I+VP+NP+GAERLPP I+V E+D Y RRLWG+
Sbjct  67   QTLLNHAWASANNHKKNSSESNTDEIPEIYVPTNPKGAERLPPGIVVSETDLYPRRLWGD  126

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            PS+DLT +P+YL+T TVG  QK NIDA V+KFSD FTI+LFHYDG+TTEWDEFEWSKRAI
Sbjct  127  PSEDLTSEPRYLVTFTVGIGQKANIDAAVRKFSDKFTIMLFHYDGRTTEWDEFEWSKRAI  186

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVSA KQTKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGLEISQPG
Sbjct  187  HVSARKQTKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEKYIELVRKHGLEISQPG  246

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            L+  +G  LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  247  LQPDRG--LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  297



>emb|CDY30497.1| BnaA04g16360D [Brassica napus]
Length=382

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/276 (63%), Positives = 222/276 (80%), Gaps = 12/276 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTEDQT  359
            +R NE  K V+   +G++FG FIG + P+L L K+N  ++L++++D    D   L+  ++
Sbjct  12   RRTNENAKAVITTILGIVFGTFIGITLPSLSL-KINFPSALISSLDVALSDGHLLSTHKS  70

Query  360  VMDPT-----KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
              D       +I+VP+NPRGAE LPP I+V ++D YLRRLWGEP++DL  KPKYL+T TV
Sbjct  71   PQDFGSRKFPEIYVPTNPRGAELLPPGIVVAKTDLYLRRLWGEPNEDLKKKPKYLVTFTV  130

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G+ Q+++I+ VVKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+S  KQTKWWYAKRFL
Sbjct  131  GFDQRNHINTVVKKFSEDFQILLFHYDGRTTEWDQFEWSKTAIHISTRKQTKWWYAKRFL  190

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPD+V++YEYIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTWEMT+R+
Sbjct  191  HPDVVSAYEYIFIWDEDLGVEHFNADKYIELVKKHGLEISQPGLEPNNG--LTWEMTKRR  248

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + EVHK+T EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  GDREVHKDTKEKAGWCSDPHLPPCAAFVEIMAPVFS  284



>ref|XP_009140891.1| PREDICTED: uncharacterized protein LOC103864879 [Brassica rapa]
 ref|XP_009140892.1| PREDICTED: uncharacterized protein LOC103864879 [Brassica rapa]
Length=382

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/276 (63%), Positives = 222/276 (80%), Gaps = 12/276 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTEDQT  359
            +R NE  K V+   +G++FG FIG + P+L L K+N  ++L++++D    D   L+  ++
Sbjct  12   RRTNENAKAVITTILGIVFGTFIGITLPSLSL-KINFPSALISSLDVALSDGHLLSTHKS  70

Query  360  VMDPT-----KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
              D       +I+VP+NPRGAE LPP I+V ++D YLRRLWGEP++DL  KPKYL+T TV
Sbjct  71   PQDFGSRKFPEIYVPTNPRGAELLPPGIVVAKTDLYLRRLWGEPNEDLKKKPKYLVTFTV  130

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G+ Q+++I+ VVKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+S  KQTKWWYAKRFL
Sbjct  131  GFDQRNHINTVVKKFSEDFQILLFHYDGRTTEWDQFEWSKTAIHISTRKQTKWWYAKRFL  190

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPD+V++YEYIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTWEMT+R+
Sbjct  191  HPDVVSAYEYIFIWDEDLGVEHFNADKYIELVKKHGLEISQPGLEPNNG--LTWEMTKRR  248

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + EVHK+T EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  GDREVHKDTKEKAGWCSDPHLPPCAAFVEIMAPVFS  284



>ref|XP_009804484.1| PREDICTED: uncharacterized protein LOC104249712 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009804485.1| PREDICTED: uncharacterized protein LOC104249712 isoform X1 [Nicotiana 
sylvestris]
Length=433

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/276 (64%), Positives = 219/276 (79%), Gaps = 12/276 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------DSSNL  344
            +R N+  +LV+   +G++FG FIG S P + L K+ + +SL++++D          S   
Sbjct  11   RRSNDRGRLVITTIMGMVFGYFIGISSPYVSLTKITLPSSLMSSLDVAFGDDHRRPSIER  70

Query  345  TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
               + +++P KI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+DLT KPKYL+T TV
Sbjct  71   FFPENLVNP-KIYVPTNPRGAESLPPRIVVSESDFYLRRLWGEPSKDLTNKPKYLVTFTV  129

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G  Q +NIDA V KFSD+F ILLFHYD +T+EWD+FEWSKRAIH+S  KQTKWWYAKRFL
Sbjct  130  GLSQMNNIDAAVTKFSDDFQILLFHYDDRTSEWDQFEWSKRAIHISVRKQTKWWYAKRFL  189

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPD+VA+Y+YIFIWDEDLGVEHF+AE+YI+LVKKHGLEISQP LE   G  LTW+MT+R+
Sbjct  190  HPDVVAAYDYIFIWDEDLGVEHFNAEKYIRLVKKHGLEISQPALEPNSG--LTWQMTKRR  247

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + EVHK TDEK GWCS+P LPPCAAFVEIMAPVFS
Sbjct  248  DDREVHKSTDEKPGWCSNPRLPPCAAFVEIMAPVFS  283



>ref|XP_010556216.1| PREDICTED: uncharacterized protein LOC104825558 isoform X2 [Tarenaya 
hassleriana]
Length=400

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/289 (64%), Positives = 218/289 (75%), Gaps = 30/289 (10%)
 Frame = +3

Query  204  ETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD------------------  329
            + +KLV     G+ FG F+G SFP L + K++V  S + + D                  
Sbjct  15   DGMKLVATAFFGIAFGFFVGISFPTLSITKVSVPTSFLRSADLSYIEEKGSSIATPADHK  74

Query  330  --------DSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQD  485
                    DS +   D   +D ++IWVPSNPRGAERLPP I+  ESDFYLRRLWG P +D
Sbjct  75   AWSSSKGNDSRSSASDS--VDKSQIWVPSNPRGAERLPPGIVAAESDFYLRRLWGLPHED  132

Query  486  LTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSA  665
            LT KP+YL+T TVGY Q++NIDA +KKFSDNFTI+LFHYDG+TTEWDEFEWSKRAIH+S 
Sbjct  133  LTSKPRYLVTFTVGYDQRNNIDACIKKFSDNFTIVLFHYDGRTTEWDEFEWSKRAIHISV  192

Query  666  HKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERK  845
             KQTKWWYAKRFLHPDI+A+Y+YIF+WDEDLGVEHF+AEEYIK VKKHGLEISQPGLE  
Sbjct  193  RKQTKWWYAKRFLHPDIIAAYDYIFVWDEDLGVEHFNAEEYIKTVKKHGLEISQPGLEPN  252

Query  846  KGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            KG  LTW+MT+R+ + E+HK T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  253  KG--LTWQMTKRRGDLEMHKITEEKPGWCSDPHLPPCAAFVEIMAPVFS  299



>ref|XP_002875389.1| hypothetical protein ARALYDRAFT_904991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51648.1| hypothetical protein ARALYDRAFT_904991 [Arabidopsis lyrata subsp. 
lyrata]
Length=392

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/288 (61%), Positives = 219/288 (76%), Gaps = 29/288 (10%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------------  329
            ++L++    GVI G  +G +FP L L K+N+ ++L  ++D                    
Sbjct  2    MRLLLTSFFGVIVGFLMGITFPTLTLTKMNLPSTLFPSIDLAYIEDKYSDISRQRLFGSW  61

Query  330  -DSSNLTEDQTVMDP------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL  488
              +  L     + DP      TKIWVP+NPRGAERLPPDI+ PESDFYLRRLWG+P++DL
Sbjct  62   SSTKGLKLKNDIPDPPYNYSDTKIWVPTNPRGAERLPPDIVTPESDFYLRRLWGDPNEDL  121

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
            T+K +YL+T TVGY Q+ NID V+KKFSDNF+I+LFHYDG+ +EW+EFEWSKRAIHVS  
Sbjct  122  TIKQRYLVTFTVGYDQRKNIDTVLKKFSDNFSIMLFHYDGRASEWEEFEWSKRAIHVSIR  181

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDIVA YEYIFIWDEDLGVEHFD+E+Y+ +VKKHGLEISQPGLE  +
Sbjct  182  KQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGVEHFDSEKYLAVVKKHGLEISQPGLEPYE  241

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            G  LTWEMT+++ ++EVHK  +E+ GWC+DP+LPPCAAFVEIMAPVFS
Sbjct  242  G--LTWEMTKKRDDTEVHKHAEERNGWCTDPNLPPCAAFVEIMAPVFS  287



>ref|XP_009103671.1| PREDICTED: uncharacterized protein LOC103829726 [Brassica rapa]
Length=383

 Score =   371 bits (952),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/278 (62%), Positives = 221/278 (79%), Gaps = 14/278 (5%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---DSSNLTEDQTV  362
            +R NE  K+++   +G++FG FIG S P+L   K+N+ ++L++++D       L   +  
Sbjct  12   RRTNENAKVIITTILGIVFGTFIGISLPSLSF-KINLPSALISSLDVALSDGKLLSARDD  70

Query  363  MDPT--------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTL  518
              P         +I+VP+NPRGAE LPP I+V ++D YLRRLWGEP++DL  KPKYL+T 
Sbjct  71   KSPEHFGSRKFPQIYVPTNPRGAELLPPGIVVAKTDLYLRRLWGEPNEDLKKKPKYLVTF  130

Query  519  TVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKR  698
            TVG++Q+++I+ VVKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+S  KQTKWWYAKR
Sbjct  131  TVGFEQRNHINTVVKKFSEDFQILLFHYDGRTTEWDQFEWSKSAIHISTRKQTKWWYAKR  190

Query  699  FLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTR  878
            FLHPD+V++YEYIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTWEMT+
Sbjct  191  FLHPDVVSAYEYIFIWDEDLGVEHFNADKYIQLVKKHGLEISQPGLEPNNG--LTWEMTK  248

Query  879  RKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            R+ + EVHK+T EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  RRGDREVHKDTKEKAGWCSDPHLPPCAAFVEIMAPVFS  286



>ref|XP_006303581.1| hypothetical protein CARUB_v10011103mg [Capsella rubella]
 gb|EOA36479.1| hypothetical protein CARUB_v10011103mg [Capsella rubella]
Length=401

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/297 (59%), Positives = 222/297 (75%), Gaps = 24/297 (8%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----D  332
            N   CSNGK+ N+ ++L++A  +G++ G F+G SFP L L K+N  + ++ +VD     D
Sbjct  7    NSSRCSNGKKTNDGMRLIIATFVGIVIGFFVGISFPTLSLTKINFPSGILPSVDIAYVED  66

Query  333  SSNLTEDQTVM------DPT-----------KIWVPSNPRGAERLPPDIIVPESDFYLRR  461
             +  T  +T++       P            KIWVPSNPRGAE L P I+  ESD+Y+RR
Sbjct  67   ETPETSSETLLHTWSSRSPLHGANSSDAPQWKIWVPSNPRGAEMLTPGIVASESDYYIRR  126

Query  462  LWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWS  641
            LWG P +D+ +KPKYL+  TVG+ QK N+DA VKKFS++FTI+LFHYDG+TTEWDEFEWS
Sbjct  127  LWGLPEEDVPVKPKYLIAFTVGFGQKLNVDACVKKFSEDFTIVLFHYDGRTTEWDEFEWS  186

Query  642  KRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEI  821
            KRAIHVS  KQTKWWYAKRFLHPDIVA Y+Y+FIWDEDLG+E+FD +EYI+L+KKHGLEI
Sbjct  187  KRAIHVSVPKQTKWWYAKRFLHPDIVAPYDYVFIWDEDLGLENFDVQEYIRLIKKHGLEI  246

Query  822  SQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            SQP +E KK +  TWE+T+RK   EVHK+  EK G C+DPHLPPCAAF+EIMAPVFS
Sbjct  247  SQPAVESKKKI--TWEITKRKTKGEVHKDAKEKPGRCNDPHLPPCAAFIEIMAPVFS  301



>emb|CDM80653.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/293 (61%), Positives = 218/293 (74%), Gaps = 22/293 (8%)
 Frame = +3

Query  174  GHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTED  353
            G   + K+ NE+++LVV   IGV+FG FIG SFP + + KL+  +S+V+ ++D ++    
Sbjct  8    GRSVHSKKPNESMRLVVVTIIGVVFGFFIGISFPTVSITKLHFPSSIVSYIEDKNSGLSA  67

Query  354  QTVMD--------------------PTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
            Q +++                      KI+VP+NPRGAE L P II  ESDF   RLWG+
Sbjct  68   QAILNHAWISARNARGNTSESSSNTTMKIYVPTNPRGAEMLAPGIIASESDFNAHRLWGD  127

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            P++DL  KPKYL+T TVG  QKDNI+  V+KFSD+F ILLFHYDG  TEW+EFEWSKRAI
Sbjct  128  PAEDLPFKPKYLVTFTVGIAQKDNINRAVQKFSDDFAILLFHYDGHVTEWEEFEWSKRAI  187

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVS  KQ KWWYAKRFLHPDIVA YEYIFIWDEDLGV+HF+ EEYIKLVKK+ LEISQPG
Sbjct  188  HVSVLKQAKWWYAKRFLHPDIVAPYEYIFIWDEDLGVDHFNGEEYIKLVKKYQLEISQPG  247

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE  KG  LTW+MT+R+ + EVHK+T+E+ GWC+DPHLPPCAAFVEIMAPVFS
Sbjct  248  LEPDKG--LTWQMTKRRGDREVHKDTEERPGWCTDPHLPPCAAFVEIMAPVFS  298



>ref|NP_172760.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031034.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL59933.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20256.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28958.1| uncharacterized protein AT1G13000 [Arabidopsis thaliana]
 gb|AEE28959.1| uncharacterized protein AT1G13000 [Arabidopsis thaliana]
Length=401

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/297 (60%), Positives = 220/297 (74%), Gaps = 24/297 (8%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----D  332
            N   CSNGK+ N+ ++L++A  +G++ G F+G SFP L L KLN  + ++ +VD     D
Sbjct  7    NSNRCSNGKKPNDGMRLIIATFVGIVVGFFLGISFPTLSLTKLNFPSGILPSVDITYVED  66

Query  333  SSNLTEDQTVMDPT-----------------KIWVPSNPRGAERLPPDIIVPESDFYLRR  461
             +  T  +T++                    KIWVPSNPRGAE L P II PESD+YLRR
Sbjct  67   ETPETSSETLLHTWSSRGPLHGANSSDAPHWKIWVPSNPRGAEMLTPGIIAPESDYYLRR  126

Query  462  LWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWS  641
            LWG P +D+ +KPKYL+  TVG+ QK N+DA VKKFS +FTI+LFHYDG+TTEW+E EWS
Sbjct  127  LWGLPEEDVPVKPKYLIAFTVGFGQKVNVDACVKKFSKDFTIVLFHYDGRTTEWEELEWS  186

Query  642  KRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEI  821
            KRAIHVS  KQTKWWYAKRFLHPDIVA Y+Y+FIWDEDLG+E+FD EEYI+L+KKHGLEI
Sbjct  187  KRAIHVSVPKQTKWWYAKRFLHPDIVAPYDYVFIWDEDLGLENFDVEEYIRLIKKHGLEI  246

Query  822  SQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            SQP +E KK +  TWE+T+RK   EVHK+  EK G C+DPHLPPCAAF+EIMAPVFS
Sbjct  247  SQPAVESKKKI--TWEITKRKTKGEVHKDAKEKPGRCNDPHLPPCAAFIEIMAPVFS  301



>ref|XP_010264658.1| PREDICTED: uncharacterized protein LOC104602608 [Nelumbo nucifera]
 ref|XP_010264659.1| PREDICTED: uncharacterized protein LOC104602608 [Nelumbo nucifera]
 ref|XP_010264660.1| PREDICTED: uncharacterized protein LOC104602608 [Nelumbo nucifera]
Length=383

 Score =   371 bits (952),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 179/280 (64%), Positives = 230/280 (82%), Gaps = 15/280 (5%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD------------DS  335
            K+ N++ +L++A  +GV+FG F+G SFP++ ++KLN+ +  ++++D              
Sbjct  11   KKSNDSARLIIATVMGVVFGFFVGVSFPSISVSKLNLHSGFLSSIDVAVLDENRSGRFSR  70

Query  336  SNLTEDQTV-MDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLL  512
             +L+++     D  KI+VP+NPRGAE LPP I+VPE+DFYLRRLWG+P++DL  KPKYL+
Sbjct  71   PDLSKNNASDSDIPKIYVPTNPRGAESLPPGIVVPETDFYLRRLWGDPNEDLKTKPKYLV  130

Query  513  TLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYA  692
            T TVG+ Q++NID  VKKFS++FTILLFHYDG+T+EWD+FEWSKRAIHVS  KQTKWWYA
Sbjct  131  TFTVGFDQRNNIDTAVKKFSEDFTILLFHYDGRTSEWDQFEWSKRAIHVSVRKQTKWWYA  190

Query  693  KRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEM  872
            KRFLHPD+VA+Y+YIFIWDEDLGVEHF+AE++++LVKKHGLEISQPGLE   G  LTW+M
Sbjct  191  KRFLHPDVVAAYDYIFIWDEDLGVEHFNAEKFLELVKKHGLEISQPGLEPNNG--LTWQM  248

Query  873  TRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            T+R+ +SEVHKET EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  249  TKRRGDSEVHKETTEKPGWCSDPHLPPCAAFVEIMAPVFS  288



>ref|XP_003539418.1| PREDICTED: uncharacterized protein LOC100785818 [Glycine max]
Length=391

 Score =   371 bits (953),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/293 (61%), Positives = 222/293 (76%), Gaps = 24/293 (8%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNK---------------------  293
            H ++ KR N++ ++++   +G+ FG FIG S  +++L K                     
Sbjct  2    HRNSLKRSNDSTRIIITAIMGIAFGFFIGISISSVHLTKPVGNSFDVPVAESEIDRFSAE  61

Query  294  LNVTASLVNNVDDSSNLTEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGE  473
            +N + ++++    + NL    ++  P KI+V SNPRGAE LPP I+V ESDFYLRRLWGE
Sbjct  62   VNRSPAVIDESSGTKNLETLGSIRLP-KIFVASNPRGAESLPPGIVVSESDFYLRRLWGE  120

Query  474  PSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAI  653
            PS+DL  KPKYL+T TVGY+Q+ NI+A VKKFSD+F ILLFHYDG+T+EWD+FEWS+ AI
Sbjct  121  PSEDLKKKPKYLVTFTVGYEQRHNINATVKKFSDDFAILLFHYDGRTSEWDQFEWSRNAI  180

Query  654  HVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPG  833
            HVSA KQTKWWYAKRFLHPDIV++YEYIFIWDEDLGVEHF+A++YI LVKK+GLEISQPG
Sbjct  181  HVSARKQTKWWYAKRFLHPDIVSAYEYIFIWDEDLGVEHFNADKYIHLVKKYGLEISQPG  240

Query  834  LERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LE   G  LTWEMT+R+ + EVH  T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  241  LEPNNG--LTWEMTKRRGDKEVHMVTEEKPGWCSDPHLPPCAAFVEIMAPVFS  291



>ref|NP_189383.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001078217.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL91201.1| unknown protein [Arabidopsis thaliana]
 gb|AAO00919.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77324.1| uncharacterized protein AT3G27470 [Arabidopsis thaliana]
 gb|AEE77325.1| uncharacterized protein AT3G27470 [Arabidopsis thaliana]
Length=398

 Score =   371 bits (953),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 222/294 (76%), Gaps = 29/294 (10%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------  329
            +R ++ ++L++    GVI G  +G +FP L L K+N+ ++L  ++D              
Sbjct  2    RRPSQMMRLLLTSFFGVIVGFLMGITFPTLTLTKMNLPSTLFPSIDLAYIEDKYSDISRQ  61

Query  330  -------DSSNLTEDQTVMDP------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
                    +  L     + DP      TKIWV +NPRGAERLPPDI+ PESDFYLRRLWG
Sbjct  62   RLFGSWSSTKGLKLKNDIPDPPYNYNDTKIWVSTNPRGAERLPPDIVTPESDFYLRRLWG  121

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
            +P++DLT+K +YL+T TVGY Q+ NID V+KKFSDNF+I+LFHYDG+ +EW+EFEWSKRA
Sbjct  122  DPNEDLTVKQRYLVTFTVGYDQRKNIDTVLKKFSDNFSIMLFHYDGRASEWEEFEWSKRA  181

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLGVEHFD+E+Y+ +VKKHGLEISQP
Sbjct  182  IHVSIRKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGVEHFDSEKYLAVVKKHGLEISQP  241

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE  +G  LTWEMT+++ ++EVHK  +E+ GWC+DP+LPPCAAFVEIMAPVFS
Sbjct  242  GLEPYEG--LTWEMTKKRDDTEVHKHAEERNGWCTDPNLPPCAAFVEIMAPVFS  293



>ref|XP_006409854.1| hypothetical protein EUTSA_v10016806mg [Eutrema salsugineum]
 gb|ESQ51307.1| hypothetical protein EUTSA_v10016806mg [Eutrema salsugineum]
Length=379

 Score =   371 bits (952),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/281 (62%), Positives = 225/281 (80%), Gaps = 12/281 (4%)
 Frame = +3

Query  177  HCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNL  344
            H S   R+NE  K+++   +G++FG FIG + P+    K+N+ + L+++ D    D   L
Sbjct  5    HRSGAPRRNENAKVIITTILGIVFGAFIGITLPSGSF-KINLPSGLMSSFDVALSDGKLL  63

Query  345  TEDQTVMDPT-----KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYL  509
            + +++  D       +I+VP+NPRGAE LPP I+V ++DFYLRRLWGEP++DL  KP+YL
Sbjct  64   SGEKSPEDFGSRKFPEIYVPTNPRGAELLPPGIVVAKTDFYLRRLWGEPNEDLKKKPRYL  123

Query  510  LTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWY  689
            +T TVG++Q+++I+ VVKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+S  KQTKWWY
Sbjct  124  VTFTVGFEQRNHINTVVKKFSEDFQILLFHYDGRTTEWDQFEWSKSAIHISIRKQTKWWY  183

Query  690  AKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWE  869
            AKRFLHPD+V++YEYIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTWE
Sbjct  184  AKRFLHPDVVSAYEYIFIWDEDLGVEHFNADKYIQLVKKHGLEISQPGLEPNNG--LTWE  241

Query  870  MTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            MT+R+ + EVHK+T EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  242  MTKRRGDREVHKDTKEKPGWCSDPHLPPCAAFVEIMAPVFS  282



>ref|XP_009804486.1| PREDICTED: uncharacterized protein LOC104249712 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009804487.1| PREDICTED: uncharacterized protein LOC104249712 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009804489.1| PREDICTED: uncharacterized protein LOC104249712 isoform X2 [Nicotiana 
sylvestris]
Length=400

 Score =   371 bits (953),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 178/276 (64%), Positives = 219/276 (79%), Gaps = 12/276 (4%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD---------DSSNL  344
            +R N+  +LV+   +G++FG FIG S P + L K+ + +SL++++D          S   
Sbjct  11   RRSNDRGRLVITTIMGMVFGYFIGISSPYVSLTKITLPSSLMSSLDVAFGDDHRRPSIER  70

Query  345  TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
               + +++P KI+VP+NPRGAE LPP I+V ESDFYLRRLWGEPS+DLT KPKYL+T TV
Sbjct  71   FFPENLVNP-KIYVPTNPRGAESLPPRIVVSESDFYLRRLWGEPSKDLTNKPKYLVTFTV  129

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G  Q +NIDA V KFSD+F ILLFHYD +T+EWD+FEWSKRAIH+S  KQTKWWYAKRFL
Sbjct  130  GLSQMNNIDAAVTKFSDDFQILLFHYDDRTSEWDQFEWSKRAIHISVRKQTKWWYAKRFL  189

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPD+VA+Y+YIFIWDEDLGVEHF+AE+YI+LVKKHGLEISQP LE   G  LTW+MT+R+
Sbjct  190  HPDVVAAYDYIFIWDEDLGVEHFNAEKYIRLVKKHGLEISQPALEPNSG--LTWQMTKRR  247

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + EVHK TDEK GWCS+P LPPCAAFVEIMAPVFS
Sbjct  248  DDREVHKSTDEKPGWCSNPRLPPCAAFVEIMAPVFS  283



>ref|XP_002880936.1| hypothetical protein ARALYDRAFT_481676 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57195.1| hypothetical protein ARALYDRAFT_481676 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score =   370 bits (951),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/277 (63%), Positives = 222/277 (80%), Gaps = 13/277 (5%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLT----  347
            +R NE  K+++   +G++FG FIG + P+L   K+N+ + L++++D    D   L+    
Sbjct  11   RRTNENAKVIITTILGIVFGTFIGITLPSLSF-KINLPSRLISSLDVAISDGKLLSGGDK  69

Query  348  --EDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLT  521
              ED       +I+VP+NPRGAE LPP I+V ++DFYLRRLWGEP++DL  KPKYL+T T
Sbjct  70   SPEDFGSRKFPEIYVPTNPRGAELLPPGIVVAKTDFYLRRLWGEPNEDLKKKPKYLVTFT  129

Query  522  VGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRF  701
            VG++Q+++I+ VVKKFS++F ILLFHYDG+TTEWD+FEWSK AIH+S  KQTKWWYAKRF
Sbjct  130  VGFEQRNHINGVVKKFSEDFQILLFHYDGRTTEWDQFEWSKSAIHISTRKQTKWWYAKRF  189

Query  702  LHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRR  881
            LHPD+V++YEYIFIWDEDLGVEHF+A++YI+LVKKHGLEISQPGLE   G  LTWEMT+R
Sbjct  190  LHPDVVSAYEYIFIWDEDLGVEHFNADKYIELVKKHGLEISQPGLEPNNG--LTWEMTKR  247

Query  882  KANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            + + EVHK+T EK GWC DPHLPPCAAFVEIMAPVFS
Sbjct  248  RGDREVHKDTKEKPGWCKDPHLPPCAAFVEIMAPVFS  284



>ref|XP_002892723.1| hypothetical protein ARALYDRAFT_888652 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68982.1| hypothetical protein ARALYDRAFT_888652 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   371 bits (953),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 178/297 (60%), Positives = 222/297 (75%), Gaps = 24/297 (8%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----D  332
            N   CSNGK+ N+ ++L++A  +G++ G F+G SFP L L KLN  + ++ +VD     D
Sbjct  7    NSNRCSNGKKPNDGMRLIIATFVGIVIGFFLGISFPTLSLTKLNFPSGILPSVDIAYVED  66

Query  333  SSNLTEDQTVM------DPT-----------KIWVPSNPRGAERLPPDIIVPESDFYLRR  461
             +  T  +T++       P            KIWVPSNPRGAE L P II  ESD+Y+RR
Sbjct  67   ETPETSSETLLHTWSSRSPLHRANSSDAPHWKIWVPSNPRGAEMLTPGIIASESDYYIRR  126

Query  462  LWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWS  641
            LWG P +D+ +KPKYL+  TVG+ QK N+DA VKKFS++FTI+LFHYDG+TTEWDEFEWS
Sbjct  127  LWGLPEEDVPVKPKYLIAFTVGFGQKVNVDACVKKFSEDFTIVLFHYDGRTTEWDEFEWS  186

Query  642  KRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEI  821
            KRAIHVS  KQTKWWYAKRFLHPDIVA Y+Y+FIWDEDLG+E+FD EEYI+L+KKHGLEI
Sbjct  187  KRAIHVSVPKQTKWWYAKRFLHPDIVAPYDYVFIWDEDLGLENFDVEEYIRLIKKHGLEI  246

Query  822  SQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            SQP +E K  +  TWE+T+RK   EVHK++ EK G C+DPHLPPCAAF+EIMAPVFS
Sbjct  247  SQPAVESKTKI--TWEITKRKTKGEVHKDSKEKPGRCNDPHLPPCAAFIEIMAPVFS  301



>gb|ABR16453.1| unknown [Picea sitchensis]
Length=396

 Score =   371 bits (952),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 174/292 (60%), Positives = 221/292 (76%), Gaps = 28/292 (10%)
 Frame = +3

Query  195  RQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNV-----TASLVNNVDDSSNL-----  344
            + NET++L++    G++FG FIG S P++ L+K+N      T  L  + D +S L     
Sbjct  12   KPNETLRLILTAVFGIVFGFFIGASLPSIGLSKINFPSLLSTIELPFHEDRNSGLATQVM  71

Query  345  ----------------TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEP  476
                            T D    + +KI+VP+NPRGAE LPP I+V E+D YLRRLWG+P
Sbjct  72   LNYAWASKSGTKFNSSTSDSRAKNSSKIYVPTNPRGAETLPPGIVVSETDLYLRRLWGKP  131

Query  477  SQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIH  656
            S+D+  K KYL+T TVG++Q++ +++ V KFS NFTILLFHYDG+T+EWD+FEWSKRAIH
Sbjct  132  SEDIVFKQKYLVTFTVGFQQREMVNSAVSKFSKNFTILLFHYDGRTSEWDQFEWSKRAIH  191

Query  657  VSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGL  836
            +SA KQTKWW+AKRFLHPD+VA ++YIFIWDEDLGVEHFDAE+Y+ LV+KHGLEISQPGL
Sbjct  192  ISAKKQTKWWFAKRFLHPDVVAPFDYIFIWDEDLGVEHFDAEKYLGLVRKHGLEISQPGL  251

Query  837  ERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            E  +G  LTW+MT+R+ +SEVHKET E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  252  EPNRG--LTWQMTKRRGDSEVHKETQERPGWCSDPHLPPCAAFVEIMAPVFS  301



>ref|XP_006417167.1| hypothetical protein EUTSA_v10007793mg [Eutrema salsugineum]
 gb|ESQ35520.1| hypothetical protein EUTSA_v10007793mg [Eutrema salsugineum]
Length=406

 Score =   371 bits (953),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 181/298 (61%), Positives = 221/298 (74%), Gaps = 25/298 (8%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----D  332
            N   CSNGK+ N+ +KL++A  +G+I G F+G SFP L L K+N  +S++ +VD     D
Sbjct  7    NTNRCSNGKKLNDGMKLLIATFVGIILGFFLGISFPTLSLTKMNFPSSILPSVDIAYVED  66

Query  333  SSNLTEDQTVMDPT-----------------KIWVPSNPRGAERLPPDIIVPESDFYLRR  461
             +  T  +T+++                   KIWVPSNPRGAE L P II  ESD+YLRR
Sbjct  67   ETPETSSETLLNTWSSRSPLHGANSSDAPHWKIWVPSNPRGAEMLTPGIIAAESDYYLRR  126

Query  462  LWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSD-NFTILLFHYDGQTTEWDEFEW  638
            LWG P +DL +KPKYL+  TVG  QK N+DA VKKFS+ NF+I+LFHYDG+TTEWDE+EW
Sbjct  127  LWGLPEEDLPVKPKYLIAFTVGLGQKVNVDACVKKFSEENFSIVLFHYDGRTTEWDEYEW  186

Query  639  SKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLE  818
            SKRAIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+E+F  EEYI+L+KKHGLE
Sbjct  187  SKRAIHVSVPKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLENFSVEEYIRLIKKHGLE  246

Query  819  ISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            ISQP +E KK +  TWE+T+R+   EVHKE  EK G C+DPHLPPCAAF+EIMAPVFS
Sbjct  247  ISQPAVESKKKI--TWEITKRRTKGEVHKEAKEKPGRCNDPHLPPCAAFIEIMAPVFS  302



>ref|XP_010502749.1| PREDICTED: uncharacterized protein LOC104779987 [Camelina sativa]
Length=398

 Score =   370 bits (951),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 220/294 (75%), Gaps = 29/294 (10%)
 Frame = +3

Query  192  KRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD--------------  329
            +R +  ++L++    GVI G  +G +FP L L K+N+ ++L  ++D              
Sbjct  2    RRPSHMMRLLLTSLFGVIVGFLLGITFPTLTLTKMNLPSTLFPSIDLAYIEDKYSDISRQ  61

Query  330  -------DSSNLTEDQTVMDP------TKIWVPSNPRGAERLPPDIIVPESDFYLRRLWG  470
                    +  L   + + DP      TKIWVP+NPRGAERLPPDI+ PESD YLRRLWG
Sbjct  62   RLFGSWSSTKGLQLKKDIPDPPFNYNDTKIWVPTNPRGAERLPPDIVTPESDLYLRRLWG  121

Query  471  EPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRA  650
            +PS+DLT K +YL+T TVGY Q+ NID V+KKFSDNF+I+LFHYDG+ +EW+ F+WSKRA
Sbjct  122  DPSEDLTTKQRYLVTFTVGYDQRKNIDTVLKKFSDNFSIMLFHYDGRASEWEVFDWSKRA  181

Query  651  IHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQP  830
            IHVS  KQTKWWYAKRFLHPDIVA YEYIFIWDEDLGVEHFD+E+Y+ +VKKHGLEISQP
Sbjct  182  IHVSIRKQTKWWYAKRFLHPDIVAPYEYIFIWDEDLGVEHFDSEKYLAVVKKHGLEISQP  241

Query  831  GLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            GLE  +G  LTWEMT+++ ++EVHK  +E+ GWCSDP+LPPCAAFVEIMAPVFS
Sbjct  242  GLEPYEG--LTWEMTKKRDDTEVHKHAEERNGWCSDPNLPPCAAFVEIMAPVFS  293



>gb|KHN35448.1| hypothetical protein glysoja_047673 [Glycine soja]
Length=374

 Score =   370 bits (949),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 176/272 (65%), Positives = 209/272 (77%), Gaps = 31/272 (11%)
 Frame = +3

Query  180  CS-NGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQ  356
            CS N KRQNE ++L +A  +GV+FG  +G SFP L L                       
Sbjct  29   CSGNIKRQNEAMRLTLATFVGVVFGFSLGVSFPTLAL-----------------------  65

Query  357  TVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQ  536
                 T+IWVP+NPRGAERLPP I+  ESDFYL RLWG P QDL++KPKYL+T TVG  Q
Sbjct  66   -----TRIWVPTNPRGAERLPPKIVKSESDFYLHRLWGMPYQDLSIKPKYLVTFTVGSDQ  120

Query  537  KDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDI  716
            KDNIDA VKKFS+NFTI+LFHYDG+ ++W++FEWSKRAIH+SA KQTKWWYAKRFLHPDI
Sbjct  121  KDNIDAAVKKFSENFTIVLFHYDGRASDWEKFEWSKRAIHISARKQTKWWYAKRFLHPDI  180

Query  717  VASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSE  896
            VA Y+YIFIWDEDLGVEHFDAEEY+K+V+KHGLEISQPG++       TW+MTR++ + E
Sbjct  181  VAPYDYIFIWDEDLGVEHFDAEEYLKMVRKHGLEISQPGIDPSSS--FTWQMTRKRDSGE  238

Query  897  VHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            VHK+ +E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  239  VHKKAEERSGWCSDPHLPPCAAFVEIMAPVFS  270



>ref|XP_002887149.1| hypothetical protein ARALYDRAFT_894542 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63408.1| hypothetical protein ARALYDRAFT_894542 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/285 (62%), Positives = 212/285 (74%), Gaps = 24/285 (8%)
 Frame = +3

Query  204  ETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV-------  362
            + +K++     GV FG  IG SFP+L + K+++  + + + D SS   +   +       
Sbjct  15   DGMKIIATAFFGVTFGFLIGISFPSLSITKVSLPTNFLPSNDLSSIEEKGSKIATPESHK  74

Query  363  ---------------MDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMK  497
                           +D +KIWVPSNPRGAE LPP ++  ESDFYLRRLWG P +DLT +
Sbjct  75   AWSSSKGNDSSSSVPIDKSKIWVPSNPRGAEMLPPGMVAAESDFYLRRLWGLPQEDLTSE  134

Query  498  PKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQT  677
            P+YL T TVG  QK NIDA VKKFS+NFTI+LFHYDGQ TEWDEFEWSK AIH+S  KQT
Sbjct  135  PRYLATFTVGINQKANIDACVKKFSENFTIVLFHYDGQVTEWDEFEWSKTAIHISVRKQT  194

Query  678  KWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVW  857
            KWWYAKRFLHPDIVA Y+YIFIWDEDLGVEHF+AEEYIK+VKKHGLEISQPGLE  +G  
Sbjct  195  KWWYAKRFLHPDIVARYDYIFIWDEDLGVEHFNAEEYIKMVKKHGLEISQPGLEPNQG--  252

Query  858  LTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            LTW+MT+R+ + EVHK T+E+ GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  253  LTWQMTKRRGDMEVHKITEERPGWCSDPHLPPCAAFVEIMAPVFS  297



>ref|XP_006645202.1| PREDICTED: uncharacterized protein LOC102718787 [Oryza brachyantha]
Length=400

 Score =   370 bits (950),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 220/290 (76%), Gaps = 22/290 (8%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTV  362
            S   R NE ++L+ +  IGV+ G   G SFP +Y+ KL+  +S+++ ++D ++    QT+
Sbjct  10   SGVPRSNEGMRLIFSAVIGVMLGYLFGISFPTVYITKLHFPSSIISYIEDRNSGITTQTL  69

Query  363  MDPT--------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQ  482
            ++                      KI+VP+NP+GAE L P I+VPE+D YLRRLWGEPS+
Sbjct  70   LNHAWTFANSKKRNSSESNSDEIPKIYVPTNPKGAESLAPGIVVPETDLYLRRLWGEPSE  129

Query  483  DLTMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVS  662
            DLT +P+YL+T TVGY QK NIDA VKKFS+NFTI+LFHYD +TTEWDEFEWSK+AIHVS
Sbjct  130  DLTSQPRYLVTFTVGYPQKANIDAAVKKFSENFTIMLFHYDDRTTEWDEFEWSKKAIHVS  189

Query  663  AHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLER  842
              KQTKWW+AKRFLHPDIVA Y+YIFIWDEDL V+HF+AE YI+LV+KHGLEISQPGLE 
Sbjct  190  VRKQTKWWFAKRFLHPDIVARYDYIFIWDEDLDVQHFNAEAYIELVRKHGLEISQPGLEP  249

Query  843  KKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             KG  LTW+MT+R  + EVHK T+E+ GWC+DP+LPPCAAFVEIMA VFS
Sbjct  250  DKG--LTWQMTKRLGDQEVHKVTEERPGWCTDPYLPPCAAFVEIMATVFS  297



>ref|XP_009617944.1| PREDICTED: uncharacterized protein LOC104110199 isoform X3 [Nicotiana 
tomentosiformis]
Length=384

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/282 (62%), Positives = 214/282 (76%), Gaps = 23/282 (8%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD----DSSNLTEDQTVM----  365
            ++L V   IGV+FG F+G +FP + L KL +  +L  ++D    D  +    Q ++    
Sbjct  1    MRLFVTTFIGVVFGFFLGVTFPTISLTKLPLPTNLFQSIDLTIEDKYSGLSTQALLNVLN  60

Query  366  -------------DPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKY  506
                         DP +IWVPSNPRGA+RLPP I+  ESD Y RRLWG PS+DL +KP+Y
Sbjct  61   SLKGRGGSSHKNNDPKQIWVPSNPRGAKRLPPGIVASESDLYTRRLWGLPSEDLIIKPRY  120

Query  507  LLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWW  686
            L+T TVG KQK NIDA VKKFS+NFTI+LFHYDGQT+EWD+ EWSKRAIHVS  KQTKWW
Sbjct  121  LVTFTVGLKQKSNIDAAVKKFSENFTIMLFHYDGQTSEWDDLEWSKRAIHVSTPKQTKWW  180

Query  687  YAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTW  866
            YAKRFLHPDIVA Y+YIFIWDEDLG+E+F+AEEYIKLV KHGL+ISQPGL    G  LTW
Sbjct  181  YAKRFLHPDIVAPYDYIFIWDEDLGLENFNAEEYIKLVAKHGLDISQPGLAPNSG--LTW  238

Query  867  EMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            +MT+ + ++E+HKET+E+ GWC+DPHLPPCAAF+EIMAPVFS
Sbjct  239  QMTKGRNDTEIHKETEERPGWCADPHLPPCAAFIEIMAPVFS  280



>ref|XP_010494848.1| PREDICTED: uncharacterized protein LOC104771923 [Camelina sativa]
 ref|XP_010494855.1| PREDICTED: uncharacterized protein LOC104771923 [Camelina sativa]
 ref|XP_010494862.1| PREDICTED: uncharacterized protein LOC104771923 [Camelina sativa]
 ref|XP_010494864.1| PREDICTED: uncharacterized protein LOC104771923 [Camelina sativa]
Length=402

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 222/298 (74%), Gaps = 25/298 (8%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVD-----D  332
            N   CSNGK+ N+ ++L++A  +G++ G F+G SFP L L KLN  +S++ +VD     D
Sbjct  7    NSSRCSNGKKTNDGMRLIIATFVGIVIGFFVGISFPTLSLTKLNFPSSILPSVDIAYVED  66

Query  333  SSNLTEDQTVM------DPT-----------KIWVPSNPRGAERLPPDIIVPESDFYLRR  461
             +  T  +T++       P            KIWVPSNPRGAE L P II  ESD+YLRR
Sbjct  67   ETPETSSETLLHTWSSRSPLHGDNSSDAPQWKIWVPSNPRGAEMLTPGIIASESDYYLRR  126

Query  462  LWGEPSQDLTMKPKYLLTLTVGYKQKDNIDAVVKKFSD-NFTILLFHYDGQTTEWDEFEW  638
            LWG P +D+ +KPKYL+  TVG+ QK N+DA VKKFS+ +FTI+LFHYDG+TTEWDEFEW
Sbjct  127  LWGLPEEDVPVKPKYLIAFTVGFGQKVNVDACVKKFSEEDFTIVLFHYDGRTTEWDEFEW  186

Query  639  SKRAIHVSAHKQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLE  818
            S RAIHVS  KQTKWWYAKRFLHPDIVA Y+YIFIWDEDLG+E+FD +EYI+L+KKHGLE
Sbjct  187  STRAIHVSVPKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGLENFDVQEYIRLIKKHGLE  246

Query  819  ISQPGLERKKGVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            ISQP +E KK +  TWE+T+RK   EVHK+  EK G C+DPHLPPCAAF+EIMAPVFS
Sbjct  247  ISQPAVESKKKI--TWEITKRKTKGEVHKDAKEKPGRCNDPHLPPCAAFIEIMAPVFS  302



>ref|XP_008807810.1| PREDICTED: uncharacterized protein LOC103720060 [Phoenix dactylifera]
Length=375

 Score =   369 bits (946),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 216/271 (80%), Gaps = 12/271 (4%)
 Frame = +3

Query  210  VKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLV------NNVDDSSNLTEDQT----  359
            ++L++   +G++ G +IG SFP +   K   T+  +      N+ + ++N  +D +    
Sbjct  1    MRLIITSVVGIVIGYWIGTSFPPVIKPKHFFTSGTISYGGDQNSWNSANNQNKDNSSSNS  60

Query  360  VMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTVGYKQK  539
             +D  KI+VP+NPRGAE LP  II  ESDFYLRRLWG P +DL ++ KYL+T TVGY+QK
Sbjct  61   TVDIYKIYVPTNPRGAESLPKGIIASESDFYLRRLWGNPDEDLVIRQKYLVTFTVGYEQK  120

Query  540  DNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFLHPDIV  719
            DNIDA +KKFS+NFTILLFHYDG+T+EWDEFEWSKRAIHVSA KQ KWWYAKRFLHPDIV
Sbjct  121  DNIDAAIKKFSENFTILLFHYDGRTSEWDEFEWSKRAIHVSARKQAKWWYAKRFLHPDIV  180

Query  720  ASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRKANSEV  899
            A YEYIFIWDEDLG+EHFDAEEYIKLVKKHGLEISQPGLE  +G  LTW+MT+++ + EV
Sbjct  181  APYEYIFIWDEDLGLEHFDAEEYIKLVKKHGLEISQPGLEPDRG--LTWKMTKKRDDHEV  238

Query  900  HKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
            HKET+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  239  HKETEEQPGWCTDPHLPPCAAFVEIMATVFS  269



>ref|NP_001046611.1| Os02g0297600 [Oryza sativa Japonica Group]
 dbj|BAD21688.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08525.1| Os02g0297600 [Oryza sativa Japonica Group]
 dbj|BAG95108.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/286 (60%), Positives = 220/286 (77%), Gaps = 22/286 (8%)
 Frame = +3

Query  195  RQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDPT  374
            R NE ++L+ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++    QT+++  
Sbjct  14   RSNEGMRLIFSAVVGVMLGYLFGVSFPTVNITKLHFPSSIISYIEDRNSGITTQTLLNHA  73

Query  375  --------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTM  494
                                KI+VP+NP+GAERLPP I+V E+D + RRLWG+PS+DL+ 
Sbjct  74   WASANRHNKNNSDSTSEEVPKIYVPTNPKGAERLPPGIVVSETDLFPRRLWGDPSEDLSS  133

Query  495  KPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQ  674
            +P+YL+T TVG  QK NIDA VKKFSD FTI+LFHYDG+TTEWDEFEWSKRAIHVS  KQ
Sbjct  134  EPRYLVTFTVGITQKANIDAAVKKFSDKFTIMLFHYDGRTTEWDEFEWSKRAIHVSVRKQ  193

Query  675  TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGV  854
            TKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGL+ISQPGL+  KG 
Sbjct  194  TKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEKYIELVRKHGLDISQPGLQPDKG-  252

Query  855  WLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  253  -LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  297



>ref|NP_566793.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001030771.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH20167.1| AT3G26440 [Arabidopsis thaliana]
 gb|AEE77157.1| uncharacterized protein AT3G26440 [Arabidopsis thaliana]
 gb|AEE77158.1| uncharacterized protein AT3G26440 [Arabidopsis thaliana]
Length=396

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 215/288 (75%), Gaps = 15/288 (5%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLV---------N  320
            N   CSN K+ N+ + LV+++  G++ G  +G SFP L L K+N  +S++         N
Sbjct  7    NSMRCSNSKKPNDGMMLVISIFAGIVIGFLLGISFPTLSLTKMNFPSSILPSVATVYIEN  66

Query  321  NVDDSSNLTEDQTVMDPT---KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL-  488
               + S+ T  Q   D +   KIWVPSNPRGAE LPP  +  ESDFYLRRLWG P  DL 
Sbjct  67   EKPEKSSKTSSQNESDASHHHKIWVPSNPRGAEMLPPSFVAAESDFYLRRLWGLPKDDLP  126

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
             +KPKYL+  TV Y+Q+ NIDA VKKFSDNFTI+LFHYDG+T+E+DEFEWSKRAIHVS  
Sbjct  127  VVKPKYLVAFTVSYEQRKNIDACVKKFSDNFTIVLFHYDGKTSEYDEFEWSKRAIHVSVP  186

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDI+A YEYIFIWDEDLGVE+FDAEEYIK+V KHGLEISQP +E +K
Sbjct  187  KQTKWWYAKRFLHPDIIAPYEYIFIWDEDLGVENFDAEEYIKIVNKHGLEISQPAVESRK  246

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +  TW++T+R    EVHKE +EK G C+DPHLPPCA F+EIMAPVFS
Sbjct  247  SI--TWKITKRIPGIEVHKEVEEKPGRCNDPHLPPCAGFIEIMAPVFS  292



>gb|AAL27511.1|AF439843_1 AT3g26440/F20C19_16 [Arabidopsis thaliana]
 gb|AAN18270.1| At3g26440/F20C19_16 [Arabidopsis thaliana]
Length=396

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 215/288 (75%), Gaps = 15/288 (5%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLV---------N  320
            N   CSN K+ N+ + LV+++  G++ G  +G SFP L L K+N  +S++         N
Sbjct  7    NSMRCSNSKKPNDGMMLVISIFAGIVIGFLLGISFPTLSLTKMNFPSSILPSVATVYIEN  66

Query  321  NVDDSSNLTEDQTVMDPT---KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL-  488
               + S+ T  Q   D +   KIWVPSNPRGAE LPP  +  ESDFYLRRLWG P  DL 
Sbjct  67   EKPEKSSKTSSQNESDASHHHKIWVPSNPRGAEMLPPSFVAAESDFYLRRLWGLPKDDLP  126

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
             +KPKYL+  TV Y+Q+ NIDA VKKFSDNFTI+LFHYDG+T+E+DEFEWSKRAIHVS  
Sbjct  127  VVKPKYLVAFTVSYEQRKNIDACVKKFSDNFTIVLFHYDGKTSEYDEFEWSKRAIHVSVP  186

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDI+A YEYIFIWDEDLGVE+FDAEEYIK+V KHGLEISQP +E +K
Sbjct  187  KQTKWWYAKRFLHPDIIAPYEYIFIWDEDLGVENFDAEEYIKIVNKHGLEISQPAVESRK  246

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +  TW++T+R    EVHKE +EK G C+DPHLPPCA F+EIMAPVFS
Sbjct  247  SI--TWKITKRIPGIEVHKEVEEKPGRCNDPHLPPCAGFIEIMAPVFS  292



>ref|XP_004291706.1| PREDICTED: uncharacterized protein LOC101295012 [Fragaria vesca 
subsp. vesca]
Length=381

 Score =   369 bits (946),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 172/276 (62%), Positives = 215/276 (78%), Gaps = 8/276 (3%)
 Frame = +3

Query  183  SNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTAS------LVNNVDDSSNL  344
            S  K+ N++ + +   T+GV+FG  IG S    +L K+  +         +    +++  
Sbjct  7    SGVKKSNDSARAIFYTTVGVLFGFAIGVSLQNAFLGKIRFSLPSFDVHFAMRRTTNTNKS  66

Query  345  TEDQTVMDPTKIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTMKPKYLLTLTV  524
             ED+      KI+VP+NP GAE LPP I+VP++D Y+RRLWGEPS+DL MKPKYL+T TV
Sbjct  67   LEDEGSEGVPKIYVPTNPAGAETLPPGIVVPQTDLYMRRLWGEPSEDLKMKPKYLVTFTV  126

Query  525  GYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQTKWWYAKRFL  704
            G  QK NIDA VKKFS++FTILLFHYDG+T+EWDEFEWSK+AIHVSA +Q KWWYAKRFL
Sbjct  127  GINQKKNIDAAVKKFSEDFTILLFHYDGRTSEWDEFEWSKKAIHVSAKRQAKWWYAKRFL  186

Query  705  HPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGVWLTWEMTRRK  884
            HPD+V++YEYIFIWDEDLGVE+F+A++YI+LVKK+GLEISQPGLE   G  LTWEMT+R+
Sbjct  187  HPDVVSAYEYIFIWDEDLGVENFNADKYIELVKKYGLEISQPGLEPNNG--LTWEMTKRR  244

Query  885  ANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             + E HK+T+EK GWCSDPHLPPCAAFVEIMAPVFS
Sbjct  245  GDREAHKDTEEKPGWCSDPHLPPCAAFVEIMAPVFS  280



>ref|XP_006647190.1| PREDICTED: uncharacterized protein LOC102709338 [Oryza brachyantha]
Length=401

 Score =   369 bits (947),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/286 (60%), Positives = 217/286 (76%), Gaps = 22/286 (8%)
 Frame = +3

Query  195  RQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDPT  374
            R NE ++L+ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++    QT+++  
Sbjct  14   RSNEGMRLIFSAVVGVMLGYLFGVSFPTVNITKLHFPSSIISYIEDRNSGITTQTLLNHA  73

Query  375  --------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTM  494
                                KI+VP+NP+GAERLPP I+V E+D Y RRLWG+PS+DL  
Sbjct  74   WASANRHKKNNSDSSAEKIPKIYVPTNPKGAERLPPGIVVSETDLYPRRLWGDPSEDLNS  133

Query  495  KPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQ  674
            +P+YL+T TVG  QK NIDA VKKFSD FTI+LFHYDG+TTEWDEFEWSKRAIH+S  KQ
Sbjct  134  EPRYLVTFTVGISQKANIDAAVKKFSDKFTIMLFHYDGRTTEWDEFEWSKRAIHISVRKQ  193

Query  675  TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGV  854
            TKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE YI LV+KHGL+ISQPGL+  KG 
Sbjct  194  TKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEAYIGLVRKHGLDISQPGLQPDKG-  252

Query  855  WLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  253  -LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  297



>gb|EEC72958.1| hypothetical protein OsI_06843 [Oryza sativa Indica Group]
Length=401

 Score =   369 bits (947),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/286 (60%), Positives = 220/286 (77%), Gaps = 22/286 (8%)
 Frame = +3

Query  195  RQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLVNNVDDSSNLTEDQTVMDPT  374
            R NE ++L+ +  +GV+ G   G SFP + + KL+  +S+++ ++D ++    QT+++  
Sbjct  14   RSNEGMRLIFSAVVGVMLGYLFGVSFPTVNITKLHFPSSIISYIEDRNSGITTQTLLNHA  73

Query  375  --------------------KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDLTM  494
                                KI+VP+NP+GAERLPP I+V E+D + RRLWG+PS+DL+ 
Sbjct  74   WASANRHNKNNSDSTSEEVPKIYVPTNPKGAERLPPGIVVSETDLFPRRLWGDPSEDLSS  133

Query  495  KPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAHKQ  674
            +P+YL+T TVG  QK NIDA VKKFSD FTI+LFHYDG+TTEWDEFEWSKRAIHVS  KQ
Sbjct  134  EPRYLVTFTVGITQKVNIDAAVKKFSDKFTIMLFHYDGRTTEWDEFEWSKRAIHVSVRKQ  193

Query  675  TKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKKGV  854
            TKWWYAKRFLHPD+VA Y+YIFIWDEDLGVEHF+AE+YI+LV+KHGL+ISQPGL+  KG 
Sbjct  194  TKWWYAKRFLHPDVVARYDYIFIWDEDLGVEHFNAEKYIELVRKHGLDISQPGLQPDKG-  252

Query  855  WLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             LTW+MT+R+ + EVHK T+E+ GWC+DPHLPPCAAFVEIMA VFS
Sbjct  253  -LTWQMTKRRGDQEVHKVTEERPGWCTDPHLPPCAAFVEIMATVFS  297



>ref|NP_001078211.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH56924.1| AT3G26440 [Arabidopsis thaliana]
 gb|AEE77159.1| uncharacterized protein AT3G26440 [Arabidopsis thaliana]
Length=373

 Score =   368 bits (944),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 215/288 (75%), Gaps = 15/288 (5%)
 Frame = +3

Query  168  NFGHCSNGKRQNETVKLVVAVTIGVIFGLFIGFSFPALYLNKLNVTASLV---------N  320
            N   CSN K+ N+ + LV+++  G++ G  +G SFP L L K+N  +S++         N
Sbjct  7    NSMRCSNSKKPNDGMMLVISIFAGIVIGFLLGISFPTLSLTKMNFPSSILPSVATVYIEN  66

Query  321  NVDDSSNLTEDQTVMDPT---KIWVPSNPRGAERLPPDIIVPESDFYLRRLWGEPSQDL-  488
               + S+ T  Q   D +   KIWVPSNPRGAE LPP  +  ESDFYLRRLWG P  DL 
Sbjct  67   EKPEKSSKTSSQNESDASHHHKIWVPSNPRGAEMLPPSFVAAESDFYLRRLWGLPKDDLP  126

Query  489  TMKPKYLLTLTVGYKQKDNIDAVVKKFSDNFTILLFHYDGQTTEWDEFEWSKRAIHVSAH  668
             +KPKYL+  TV Y+Q+ NIDA VKKFSDNFTI+LFHYDG+T+E+DEFEWSKRAIHVS  
Sbjct  127  VVKPKYLVAFTVSYEQRKNIDACVKKFSDNFTIVLFHYDGKTSEYDEFEWSKRAIHVSVP  186

Query  669  KQTKWWYAKRFLHPDIVASYEYIFIWDEDLGVEHFDAEEYIKLVKKHGLEISQPGLERKK  848
            KQTKWWYAKRFLHPDI+A YEYIFIWDEDLGVE+FDAEEYIK+V KHGLEISQP +E +K
Sbjct  187  KQTKWWYAKRFLHPDIIAPYEYIFIWDEDLGVENFDAEEYIKIVNKHGLEISQPAVESRK  246

Query  849  GVWLTWEMTRRKANSEVHKETDEKQGWCSDPHLPPCAAFVEIMAPVFS  992
             +  TW++T+R    EVHKE +EK G C+DPHLPPCA F+EIMAPVFS
Sbjct  247  SI--TWKITKRIPGIEVHKEVEEKPGRCNDPHLPPCAGFIEIMAPVFS  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2193756387154