BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c37039_g1_i1 len=185 path=[163:0-184]

Length=185
                                                                      Score     E

ref|XP_006446213.1|  hypothetical protein CICLE_v10014020mg           57.4    1e-07   
gb|KDO50419.1|  hypothetical protein CISIN_1g000462mg                 57.4    2e-07   
ref|XP_006470705.1|  PREDICTED: uncharacterized protein LOC102628496  57.0    2e-07   
ref|XP_006446212.1|  hypothetical protein CICLE_v10014020mg           57.0    2e-07   
gb|EPS62589.1|  hypothetical protein M569_12201                       53.9    2e-07   
gb|KDO50418.1|  hypothetical protein CISIN_1g000462mg                 56.6    2e-07   
ref|XP_011080378.1|  PREDICTED: uncharacterized protein LOC105163648  56.6    3e-07   
emb|CDP08501.1|  unnamed protein product                              56.2    4e-07   
ref|XP_010313253.1|  PREDICTED: uncharacterized protein LOC101256352  55.8    5e-07   
gb|KDP22133.1|  hypothetical protein JCGZ_25964                       55.8    5e-07   
ref|XP_006362316.1|  PREDICTED: uncharacterized protein LOC102579382  55.8    5e-07   
ref|XP_008450383.1|  PREDICTED: uncharacterized protein LOC103492...  55.8    5e-07   
ref|XP_008450382.1|  PREDICTED: uncharacterized protein LOC103492...  55.8    5e-07   
ref|XP_008450381.1|  PREDICTED: uncharacterized protein LOC103492...  55.5    6e-07   
ref|XP_008450379.1|  PREDICTED: uncharacterized protein LOC103492...  55.5    6e-07   
ref|XP_006399757.1|  hypothetical protein EUTSA_v10012427mg           55.5    6e-07   
gb|KGN66513.1|  hypothetical protein Csa_1G616310                     55.5    6e-07   
ref|XP_009800307.1|  PREDICTED: uncharacterized protein LOC104246234  54.7    1e-06   
emb|CDX85688.1|  BnaA02g01250D                                        54.7    1e-06   
ref|XP_009125862.1|  PREDICTED: uncharacterized protein LOC103850826  54.7    1e-06   
ref|XP_010536112.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.7    1e-06   
ref|XP_008348660.1|  PREDICTED: uncharacterized protein LOC103411819  53.9    2e-06   
ref|XP_009338542.1|  PREDICTED: uncharacterized protein LOC103930870  53.9    2e-06   
ref|XP_009356074.1|  PREDICTED: uncharacterized protein LOC103946970  53.9    2e-06   
ref|XP_002513535.1|  hypothetical protein RCOM_1578820                53.9    2e-06   Ricinus communis
ref|XP_009612146.1|  PREDICTED: uncharacterized protein LOC104105523  53.9    2e-06   
ref|XP_010105404.1|  Nucleosome-remodeling factor subunit BPTF        53.9    2e-06   
emb|CDX97192.1|  BnaC09g44330D                                        53.5    3e-06   
ref|XP_009337035.1|  PREDICTED: uncharacterized protein LOC103929546  53.5    3e-06   
ref|XP_008358163.1|  PREDICTED: uncharacterized protein LOC103421895  53.1    3e-06   
emb|CDX91163.1|  BnaC02g04340D                                        52.8    5e-06   
ref|NP_568273.2|  PHD-finger and DNA binding domain-containing pr...  52.8    5e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAC42901.1|  putative protein                                     52.8    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871525.1|  hypothetical protein ARALYDRAFT_488087           52.4    6e-06   
ref|XP_010651487.1|  PREDICTED: uncharacterized protein LOC100260...  52.4    6e-06   
gb|KFK25512.1|  hypothetical protein AALP_AA8G124500                  52.4    6e-06   
ref|XP_010419828.1|  PREDICTED: uncharacterized protein LOC104705...  52.4    7e-06   
emb|CAN78969.1|  hypothetical protein VITISV_022739                   52.4    7e-06   Vitis vinifera
ref|XP_010453309.1|  PREDICTED: uncharacterized protein LOC104735...  52.4    7e-06   
emb|CDX69681.1|  BnaA10g20300D                                        52.4    8e-06   
ref|XP_009122878.1|  PREDICTED: uncharacterized protein LOC103847538  52.0    8e-06   
ref|XP_010651486.1|  PREDICTED: uncharacterized protein LOC100260...  52.0    9e-06   
emb|CBI24209.3|  unnamed protein product                              52.0    9e-06   
ref|XP_008227215.1|  PREDICTED: uncharacterized protein LOC103326752  52.0    9e-06   
gb|EYU46216.1|  hypothetical protein MIMGU_mgv1a023243mg              52.0    9e-06   
ref|XP_008363221.1|  PREDICTED: uncharacterized protein LOC103426921  52.0    1e-05   
ref|XP_004505800.1|  PREDICTED: uncharacterized protein LOC101501088  51.6    1e-05   
ref|XP_007131566.1|  hypothetical protein PHAVU_011G023900g           51.6    1e-05   
ref|XP_007131565.1|  hypothetical protein PHAVU_011G023900g           51.6    1e-05   
ref|XP_007214563.1|  hypothetical protein PRUPE_ppa000168mg           51.6    1e-05   
ref|XP_004291756.1|  PREDICTED: uncharacterized protein LOC101311539  51.6    1e-05   
gb|AGM37970.1|  chromodomain helicase DNA binding protein             50.1    2e-05   
ref|XP_010520637.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.2    2e-05   
ref|XP_010453315.1|  PREDICTED: uncharacterized protein LOC104735...  50.8    2e-05   
ref|XP_010453313.1|  PREDICTED: uncharacterized protein LOC104735...  50.8    2e-05   
ref|XP_010491999.1|  PREDICTED: uncharacterized protein LOC104769480  49.7    5e-05   
ref|XP_002299794.2|  hypothetical protein POPTR_0001s26130g           49.7    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_007015165.1|  DNA binding,zinc ion binding,DNA binding, pu...  49.7    7e-05   
ref|XP_006286884.1|  hypothetical protein CARUB_v10000028mg           49.7    7e-05   
ref|XP_007015162.1|  DNA binding,zinc ion binding,DNA binding, pu...  49.7    7e-05   
ref|XP_007015166.1|  DNA binding,zinc ion binding,DNA binding, pu...  49.3    7e-05   
ref|XP_007015161.1|  DNA binding,zinc ion binding,DNA binding, pu...  49.3    7e-05   
ref|XP_007015163.1|  DNA binding,zinc ion binding,DNA binding, pu...  49.3    8e-05   
ref|XP_011032081.1|  PREDICTED: uncharacterized protein LOC105131...  49.3    9e-05   
ref|XP_011032082.1|  PREDICTED: uncharacterized protein LOC105131...  48.9    9e-05   
ref|XP_003540620.1|  PREDICTED: uncharacterized protein LOC100791832  48.9    1e-04   
gb|KHN05492.1|  Nucleosome-remodeling factor subunit BPTF             48.9    1e-04   
ref|XP_003538947.1|  PREDICTED: uncharacterized protein LOC100800...  48.5    1e-04   
ref|XP_006590775.1|  PREDICTED: uncharacterized protein LOC100800...  48.5    1e-04   
gb|KHN09249.1|  Nucleosome-remodeling factor subunit NURF301          48.5    1e-04   
ref|XP_011045384.1|  PREDICTED: uncharacterized protein LOC105140...  48.5    1e-04   
ref|XP_011045385.1|  PREDICTED: uncharacterized protein LOC105140...  48.5    1e-04   
ref|XP_009131280.1|  PREDICTED: uncharacterized protein LOC103855975  47.8    3e-04   
ref|XP_010239521.1|  PREDICTED: uncharacterized protein LOC100838217  47.0    5e-04   
ref|XP_002313363.2|  hypothetical protein POPTR_0009s05370g           46.6    6e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006347254.1|  PREDICTED: uncharacterized protein LOC102582627  46.6    7e-04   



>ref|XP_006446213.1| hypothetical protein CICLE_v10014020mg [Citrus clementina]
 gb|ESR59453.1| hypothetical protein CICLE_v10014020mg [Citrus clementina]
Length=1579

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++KC++P +LFDSVHVS+L++LRKH
Sbjct  441  ELEDFVAALKCSSPNLLFDSVHVSILRILRKH  472



>gb|KDO50419.1| hypothetical protein CISIN_1g000462mg [Citrus sinensis]
Length=1306

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++KC++P +LFDSVHVS+L++LRKH
Sbjct  162  ELEDFVAALKCSSPNLLFDSVHVSILRILRKH  193



>ref|XP_006470705.1| PREDICTED: uncharacterized protein LOC102628496 [Citrus sinensis]
Length=1761

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++KC++P +LFDSVHVS+L++LRKH
Sbjct  441  ELEDFVAALKCSSPNLLFDSVHVSILRILRKH  472



>ref|XP_006446212.1| hypothetical protein CICLE_v10014020mg [Citrus clementina]
 gb|ESR59452.1| hypothetical protein CICLE_v10014020mg [Citrus clementina]
Length=1761

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++KC++P +LFDSVHVS+L++LRKH
Sbjct  441  ELEDFVAALKCSSPNLLFDSVHVSILRILRKH  472



>gb|EPS62589.1| hypothetical protein M569_12201, partial [Genlisea aurea]
Length=180

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            E+EDFVAS KCN  T+LFDS+HVSLL+ LRKH
Sbjct  124  EMEDFVASAKCNDSTLLFDSIHVSLLRTLRKH  155



>gb|KDO50418.1| hypothetical protein CISIN_1g000462mg [Citrus sinensis]
Length=1482

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++KC++P +LFDSVHVS+L++LRKH
Sbjct  162  ELEDFVAALKCSSPNLLFDSVHVSILRILRKH  193



>ref|XP_011080378.1| PREDICTED: uncharacterized protein LOC105163648 [Sesamum indicum]
Length=1804

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFVAS+KCN  T+LFDS+HVSLL+ LRKH
Sbjct  467  ELDDFVASVKCNDSTLLFDSIHVSLLRTLRKH  498



>emb|CDP08501.1| unnamed protein product [Coffea canephora]
Length=1765

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDF+A + CN+P+VLFDS+HVSLL  LRKH
Sbjct  440  ELEDFLACLSCNSPSVLFDSIHVSLLHTLRKH  471



>ref|XP_010313253.1| PREDICTED: uncharacterized protein LOC101256352 [Solanum lycopersicum]
Length=1712

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA IK N PT+LFDS+H SLLQ+LRKH
Sbjct  432  ELEDFVACIKANAPTLLFDSIHFSLLQILRKH  463



>gb|KDP22133.1| hypothetical protein JCGZ_25964 [Jatropha curcas]
Length=1949

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELE+FVA++KCN+P+ LFD +HVS+LQ LRKH
Sbjct  586  ELEEFVAALKCNSPSALFDCIHVSVLQTLRKH  617



>ref|XP_006362316.1| PREDICTED: uncharacterized protein LOC102579382 [Solanum tuberosum]
Length=1718

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA IK N PT+LFDS+H SLLQ+LRKH
Sbjct  429  ELEDFVACIKANAPTLLFDSIHFSLLQILRKH  460



>ref|XP_008450383.1| PREDICTED: uncharacterized protein LOC103492005 isoform X4 [Cucumis 
melo]
Length=1665

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFVA++KC +PT+LFD++H+S+LQ LRKH
Sbjct  518  ELDDFVAALKCKSPTILFDNIHLSVLQTLRKH  549



>ref|XP_008450382.1| PREDICTED: uncharacterized protein LOC103492005 isoform X3 [Cucumis 
melo]
Length=1668

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFVA++KC +PT+LFD++H+S+LQ LRKH
Sbjct  518  ELDDFVAALKCKSPTILFDNIHLSVLQTLRKH  549



>ref|XP_008450381.1| PREDICTED: uncharacterized protein LOC103492005 isoform X2 [Cucumis 
melo]
Length=1676

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFVA++KC +PT+LFD++H+S+LQ LRKH
Sbjct  518  ELDDFVAALKCKSPTILFDNIHLSVLQTLRKH  549



>ref|XP_008450379.1| PREDICTED: uncharacterized protein LOC103492005 isoform X1 [Cucumis 
melo]
Length=1683

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFVA++KC +PT+LFD++H+S+LQ LRKH
Sbjct  518  ELDDFVAALKCKSPTILFDNIHLSVLQTLRKH  549



>ref|XP_006399757.1| hypothetical protein EUTSA_v10012427mg [Eutrema salsugineum]
 gb|ESQ41210.1| hypothetical protein EUTSA_v10012427mg [Eutrema salsugineum]
Length=1599

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFV +++C +P++LFDS+HVS+LQ+LRKH
Sbjct  450  ELEDFVEAMRCTSPSLLFDSIHVSVLQILRKH  481



>gb|KGN66513.1| hypothetical protein Csa_1G616310 [Cucumis sativus]
Length=1262

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFVA++KC +PT+LFD++H+S+LQ LRKH
Sbjct  518  ELDDFVAALKCKSPTILFDNIHLSVLQTLRKH  549



>ref|XP_009800307.1| PREDICTED: uncharacterized protein LOC104246234 [Nicotiana sylvestris]
Length=1742

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA +K + PT+LFDS+H SLLQ+LRKH
Sbjct  420  ELEDFVACVKADAPTLLFDSIHFSLLQILRKH  451



>emb|CDX85688.1| BnaA02g01250D [Brassica napus]
Length=1537

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFV +++C +P++LFDS+HVS+LQ+LRKH
Sbjct  373  ELEDFVEALRCMSPSLLFDSIHVSVLQILRKH  404



>ref|XP_009125862.1| PREDICTED: uncharacterized protein LOC103850826 [Brassica rapa]
Length=1537

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFV +++C +P++LFDS+HVS+LQ+LRKH
Sbjct  373  ELEDFVEALRCMSPSLLFDSIHVSVLQILRKH  404



>ref|XP_010536112.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104811188 
[Tarenaya hassleriana]
Length=1597

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFV +++C +P++LFDS+HVS+LQ+LRKH
Sbjct  437  ELEDFVEALRCVSPSLLFDSIHVSVLQILRKH  468



>ref|XP_008348660.1| PREDICTED: uncharacterized protein LOC103411819 [Malus domestica]
Length=956

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            +LEDFVA++ C TP++LFD VHVS+LQ LRKH
Sbjct  497  KLEDFVAALTCKTPSLLFDHVHVSILQTLRKH  528



>ref|XP_009338542.1| PREDICTED: uncharacterized protein LOC103930870 [Pyrus x bretschneideri]
Length=1665

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            +LEDFVA++ C TP++LFD VHVS+LQ LRKH
Sbjct  491  KLEDFVAALTCKTPSLLFDHVHVSILQTLRKH  522



>ref|XP_009356074.1| PREDICTED: uncharacterized protein LOC103946970 [Pyrus x bretschneideri]
Length=1665

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            +LEDFVA++ C TP++LFD VHVS+LQ LRKH
Sbjct  491  KLEDFVAALTCKTPSLLFDHVHVSILQTLRKH  522



>ref|XP_002513535.1| hypothetical protein RCOM_1578820 [Ricinus communis]
 gb|EEF48938.1| hypothetical protein RCOM_1578820 [Ricinus communis]
Length=1915

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            +LE+FVA++KCNTP+ LFD +HVS+LQ L+KH
Sbjct  561  DLEEFVAALKCNTPSSLFDCIHVSILQTLKKH  592



>ref|XP_009612146.1| PREDICTED: uncharacterized protein LOC104105523 [Nicotiana tomentosiformis]
Length=1744

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA IK + PT+LFDS+H SLLQ+LRKH
Sbjct  421  ELEDFVACIKADAPTLLFDSIHFSLLQILRKH  452



>ref|XP_010105404.1| Nucleosome-remodeling factor subunit BPTF [Morus notabilis]
 gb|EXC04604.1| Nucleosome-remodeling factor subunit BPTF [Morus notabilis]
Length=1761

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELE+FVA++KC +PT LFD+VH+S+L+ LRKH
Sbjct  488  ELEEFVAAVKCKSPTSLFDNVHISILRTLRKH  519



>emb|CDX97192.1| BnaC09g44330D [Brassica napus]
Length=1740

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRK  124
            EL+DFV +++C +P++LFDS+HVSLLQMLRK
Sbjct  410  ELKDFVEALRCTSPSLLFDSIHVSLLQMLRK  440


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRK  124
            EL+DFV +++C +P++LFDS+HVSLLQMLRK
Sbjct  648  ELKDFVEALRCTSPSLLFDSIHVSLLQMLRK  678



>ref|XP_009337035.1| PREDICTED: uncharacterized protein LOC103929546 [Pyrus x bretschneideri]
 ref|XP_009337036.1| PREDICTED: uncharacterized protein LOC103929546 [Pyrus x bretschneideri]
Length=1657

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++ C +P+ LFD VHVS+LQ LRKH
Sbjct  499  ELEDFVAALTCKSPSSLFDHVHVSILQTLRKH  530



>ref|XP_008358163.1| PREDICTED: uncharacterized protein LOC103421895 [Malus domestica]
Length=1671

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            +LEDFVA++ C TP+ LFD VHVS+LQ LRKH
Sbjct  497  KLEDFVAALTCKTPSXLFDHVHVSILQTLRKH  528



>emb|CDX91163.1| BnaC02g04340D [Brassica napus]
Length=1533

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELE+FV +++C +P++LFDS+HVS+LQ+LRKH
Sbjct  372  ELEEFVEALRCMSPSLLFDSIHVSVLQILRKH  403



>ref|NP_568273.2| PHD-finger and DNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AED91805.1| PHD-finger and DNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=1602

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFV +++C +P++LFDS+HVS+LQ+LRKH
Sbjct  438  ELKDFVEALRCMSPSLLFDSIHVSVLQILRKH  469



>emb|CAC42901.1| putative protein [Arabidopsis thaliana]
Length=1595

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFV +++C +P++LFDS+HVS+LQ+LRKH
Sbjct  438  ELKDFVEALRCMSPSLLFDSIHVSVLQILRKH  469



>ref|XP_002871525.1| hypothetical protein ARALYDRAFT_488087 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47784.1| hypothetical protein ARALYDRAFT_488087 [Arabidopsis lyrata subsp. 
lyrata]
Length=1581

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFV +++C +P++LFDS+HVS+LQ+LRKH
Sbjct  435  ELKDFVEALRCMSPSLLFDSIHVSVLQILRKH  466



>ref|XP_010651487.1| PREDICTED: uncharacterized protein LOC100260139 isoform X2 [Vitis 
vinifera]
Length=1470

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFV +++CN    LFDSVHVSLLQ LRKH
Sbjct  423  ELEDFVEALRCNFSNPLFDSVHVSLLQTLRKH  454



>gb|KFK25512.1| hypothetical protein AALP_AA8G124500 [Arabis alpina]
Length=1584

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFV +++C +P++LFDS+HVS+LQ+LRKH
Sbjct  429  ELKDFVEAMRCMSPSLLFDSIHVSVLQILRKH  460



>ref|XP_010419828.1| PREDICTED: uncharacterized protein LOC104705512 isoform X1 [Camelina 
sativa]
 ref|XP_010419829.1| PREDICTED: uncharacterized protein LOC104705512 isoform X2 [Camelina 
sativa]
 ref|XP_010419830.1| PREDICTED: uncharacterized protein LOC104705512 isoform X3 [Camelina 
sativa]
 ref|XP_010419831.1| PREDICTED: uncharacterized protein LOC104705512 isoform X4 [Camelina 
sativa]
Length=1605

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFV +++C +P++LFDS+HV++LQ+LRKH
Sbjct  434  ELKDFVEALRCTSPSLLFDSIHVAVLQILRKH  465



>emb|CAN78969.1| hypothetical protein VITISV_022739 [Vitis vinifera]
Length=1318

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFV +++CN    LFDSVHVSLLQ LRKH
Sbjct  407  ELEDFVEALRCNFSNPLFDSVHVSLLQTLRKH  438



>ref|XP_010453309.1| PREDICTED: uncharacterized protein LOC104735257 isoform X1 [Camelina 
sativa]
 ref|XP_010453311.1| PREDICTED: uncharacterized protein LOC104735257 isoform X2 [Camelina 
sativa]
 ref|XP_010453312.1| PREDICTED: uncharacterized protein LOC104735257 isoform X3 [Camelina 
sativa]
Length=1606

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFV +++C +P++LFDS+HV++LQ+LRKH
Sbjct  433  ELKDFVEALRCTSPSLLFDSIHVAVLQILRKH  464



>emb|CDX69681.1| BnaA10g20300D [Brassica napus]
Length=1730

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRK  124
            EL+DFV +++C +P++LFDS+HVSLLQ+LRK
Sbjct  719  ELKDFVEALRCTSPSLLFDSIHVSLLQILRK  749



>ref|XP_009122878.1| PREDICTED: uncharacterized protein LOC103847538 [Brassica rapa]
Length=1748

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRK  124
            EL+DFV +++C +P++LFDS+HVSLLQ+LRK
Sbjct  737  ELKDFVEALRCTSPSLLFDSIHVSLLQILRK  767



>ref|XP_010651486.1| PREDICTED: uncharacterized protein LOC100260139 isoform X1 [Vitis 
vinifera]
Length=1884

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFV +++CN    LFDSVHVSLLQ LRKH
Sbjct  423  ELEDFVEALRCNFSNPLFDSVHVSLLQTLRKH  454



>emb|CBI24209.3| unnamed protein product [Vitis vinifera]
Length=1805

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFV +++CN    LFDSVHVSLLQ LRKH
Sbjct  409  ELEDFVEALRCNFSNPLFDSVHVSLLQTLRKH  440



>ref|XP_008227215.1| PREDICTED: uncharacterized protein LOC103326752 [Prunus mume]
 ref|XP_008227216.1| PREDICTED: uncharacterized protein LOC103326752 [Prunus mume]
Length=1678

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            +LEDFVA++KC +P+ LFD VH+S+LQ LRKH
Sbjct  504  KLEDFVAALKCKSPSSLFDYVHLSILQTLRKH  535



>gb|EYU46216.1| hypothetical protein MIMGU_mgv1a023243mg, partial [Erythranthe 
guttata]
Length=1772

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFVAS+KCN  T LFD +HVSLL+ LRKH
Sbjct  474  ELDDFVASVKCNDSTTLFDYIHVSLLRPLRKH  505



>ref|XP_008363221.1| PREDICTED: uncharacterized protein LOC103426921 [Malus domestica]
 ref|XP_008363228.1| PREDICTED: uncharacterized protein LOC103426921 [Malus domestica]
Length=1657

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            +LEDFVA++ C +P+ LFD VHVS+LQ LRKH
Sbjct  499  KLEDFVAALTCKSPSSLFDHVHVSILQTLRKH  530



>ref|XP_004505800.1| PREDICTED: uncharacterized protein LOC101501088, partial [Cicer 
arietinum]
Length=1746

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELED VA++K  TP  LFDS+HVS+LQ LRKH
Sbjct  569  ELEDLVAALKSETPNALFDSIHVSILQTLRKH  600



>ref|XP_007131566.1| hypothetical protein PHAVU_011G023900g [Phaseolus vulgaris]
 gb|ESW03560.1| hypothetical protein PHAVU_011G023900g [Phaseolus vulgaris]
Length=1758

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELED VA++K   P++LFDS+HVS+LQ LRKH
Sbjct  534  ELEDLVAALKSEIPSILFDSIHVSILQTLRKH  565



>ref|XP_007131565.1| hypothetical protein PHAVU_011G023900g [Phaseolus vulgaris]
 gb|ESW03559.1| hypothetical protein PHAVU_011G023900g [Phaseolus vulgaris]
Length=1761

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELED VA++K   P++LFDS+HVS+LQ LRKH
Sbjct  534  ELEDLVAALKSEIPSILFDSIHVSILQTLRKH  565



>ref|XP_007214563.1| hypothetical protein PRUPE_ppa000168mg [Prunus persica]
 gb|EMJ15762.1| hypothetical protein PRUPE_ppa000168mg [Prunus persica]
Length=1545

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            +LEDFVA++KC +P+ LFD VH+S+LQ LRKH
Sbjct  381  KLEDFVAALKCKSPSSLFDYVHLSILQTLRKH  412



>ref|XP_004291756.1| PREDICTED: uncharacterized protein LOC101311539 [Fragaria vesca 
subsp. vesca]
Length=1773

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            +LEDFVA+++C +P+ L DSVHVS+LQ LRKH
Sbjct  569  KLEDFVAALQCKSPSSLIDSVHVSILQTLRKH  600



>gb|AGM37970.1| chromodomain helicase DNA binding protein, partial [Caragana 
korshinskii]
Length=260

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELED VA++K   P+VLFDS+HVS+LQ LRKH
Sbjct  48   ELEDLVAAVKSKIPSVLFDSIHVSILQTLRKH  79



>ref|XP_010520637.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104799696, 
partial [Tarenaya hassleriana]
Length=1605

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  35   LEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            LEDFV ++ C +P++LFDS+HVS+LQ+LRKH
Sbjct  452  LEDFVEALNCLSPSLLFDSIHVSVLQILRKH  482



>ref|XP_010453315.1| PREDICTED: uncharacterized protein LOC104735257 isoform X6 [Camelina 
sativa]
 ref|XP_010453316.1| PREDICTED: uncharacterized protein LOC104735257 isoform X7 [Camelina 
sativa]
Length=1345

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFV +++C +P++LFDS+HV++LQ+LRKH
Sbjct  433  ELKDFVEALRCTSPSLLFDSIHVAVLQILRKH  464



>ref|XP_010453313.1| PREDICTED: uncharacterized protein LOC104735257 isoform X4 [Camelina 
sativa]
 ref|XP_010453314.1| PREDICTED: uncharacterized protein LOC104735257 isoform X5 [Camelina 
sativa]
Length=1346

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFV +++C +P++LFDS+HV++LQ+LRKH
Sbjct  433  ELKDFVEALRCTSPSLLFDSIHVAVLQILRKH  464



>ref|XP_010491999.1| PREDICTED: uncharacterized protein LOC104769480 [Camelina sativa]
Length=1601

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFV +++C +P++LFDS+HV++LQ+LRK+
Sbjct  430  ELKDFVEALRCTSPSLLFDSIHVAVLQILRKY  461



>ref|XP_002299794.2| hypothetical protein POPTR_0001s26130g, partial [Populus trichocarpa]
 gb|EEE84599.2| hypothetical protein POPTR_0001s26130g, partial [Populus trichocarpa]
Length=1815

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  35   LEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            LE+FVA++K N+P+ LFD +HVS+LQ LRKH
Sbjct  555  LEEFVAAVKGNSPSSLFDCIHVSILQTLRKH  585



>ref|XP_007015165.1| DNA binding,zinc ion binding,DNA binding, putative isoform 5, 
partial [Theobroma cacao]
 gb|EOY32784.1| DNA binding,zinc ion binding,DNA binding, putative isoform 5, 
partial [Theobroma cacao]
Length=1357

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++KC + + L D +HVS+LQ LRKH
Sbjct  473  ELEDFVAALKCQSASSLIDCIHVSILQTLRKH  504



>ref|XP_006286884.1| hypothetical protein CARUB_v10000028mg [Capsella rubella]
 gb|EOA19782.1| hypothetical protein CARUB_v10000028mg [Capsella rubella]
Length=1611

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            EL+DFV +++C +P++LFDS+HV++LQ+LRKH
Sbjct  445  ELKDFVEALRCVSPSLLFDSIHVAVLQILRKH  476



>ref|XP_007015162.1| DNA binding,zinc ion binding,DNA binding, putative isoform 2 
[Theobroma cacao]
 gb|EOY32781.1| DNA binding,zinc ion binding,DNA binding, putative isoform 2 
[Theobroma cacao]
Length=1647

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++KC + + L D +HVS+LQ LRKH
Sbjct  473  ELEDFVAALKCQSASSLIDCIHVSILQTLRKH  504



>ref|XP_007015166.1| DNA binding,zinc ion binding,DNA binding, putative isoform 6, 
partial [Theobroma cacao]
 gb|EOY32785.1| DNA binding,zinc ion binding,DNA binding, putative isoform 6, 
partial [Theobroma cacao]
Length=1345

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++KC + + L D +HVS+LQ LRKH
Sbjct  473  ELEDFVAALKCQSASSLIDCIHVSILQTLRKH  504



>ref|XP_007015161.1| DNA binding,zinc ion binding,DNA binding, putative isoform 1 
[Theobroma cacao]
 gb|EOY32780.1| DNA binding,zinc ion binding,DNA binding, putative isoform 1 
[Theobroma cacao]
Length=1931

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++KC + + L D +HVS+LQ LRKH
Sbjct  473  ELEDFVAALKCQSASSLIDCIHVSILQTLRKH  504



>ref|XP_007015163.1| DNA binding,zinc ion binding,DNA binding, putative isoform 3 
[Theobroma cacao]
 ref|XP_007015164.1| DNA binding,zinc ion binding,DNA binding, putative isoform 3 
[Theobroma cacao]
 gb|EOY32782.1| DNA binding,zinc ion binding,DNA binding, putative isoform 3 
[Theobroma cacao]
 gb|EOY32783.1| DNA binding,zinc ion binding,DNA binding, putative isoform 3 
[Theobroma cacao]
Length=1859

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELEDFVA++KC + + L D +HVS+LQ LRKH
Sbjct  473  ELEDFVAALKCQSASSLIDCIHVSILQTLRKH  504



>ref|XP_011032081.1| PREDICTED: uncharacterized protein LOC105131023 isoform X1 [Populus 
euphratica]
Length=1932

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  35   LEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            LE+FVA++K N+P+ LFDS+HVS+L+ LRKH
Sbjct  584  LEEFVAALKGNSPSSLFDSIHVSILETLRKH  614



>ref|XP_011032082.1| PREDICTED: uncharacterized protein LOC105131023 isoform X2 [Populus 
euphratica]
Length=1894

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  35   LEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            LE+FVA++K N+P+ LFDS+HVS+L+ LRKH
Sbjct  546  LEEFVAALKGNSPSSLFDSIHVSILETLRKH  576



>ref|XP_003540620.1| PREDICTED: uncharacterized protein LOC100791832 [Glycine max]
Length=1702

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELED VA++K   P++LFDS+HVS+LQ LRK+
Sbjct  506  ELEDLVAALKSEIPSILFDSIHVSILQTLRKN  537



>gb|KHN05492.1| Nucleosome-remodeling factor subunit BPTF [Glycine soja]
Length=1722

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELED VA++K   P++LFDS+HVS+LQ LRK+
Sbjct  506  ELEDLVAALKSEIPSILFDSIHVSILQTLRKN  537



>ref|XP_003538947.1| PREDICTED: uncharacterized protein LOC100800973 isoform X1 [Glycine 
max]
Length=1735

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELED VA++K   P++LFDS+HVS+LQ LRK+
Sbjct  508  ELEDLVAALKSEIPSILFDSIHVSILQTLRKN  539



>ref|XP_006590775.1| PREDICTED: uncharacterized protein LOC100800973 isoform X2 [Glycine 
max]
Length=1738

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELED VA++K   P++LFDS+HVS+LQ LRK+
Sbjct  508  ELEDLVAALKSEIPSILFDSIHVSILQTLRKN  539



>gb|KHN09249.1| Nucleosome-remodeling factor subunit NURF301 [Glycine soja]
Length=1755

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            ELED VA++K   P++LFDS+HVS+LQ LRK+
Sbjct  508  ELEDLVAALKSEIPSILFDSIHVSILQTLRKN  539



>ref|XP_011045384.1| PREDICTED: uncharacterized protein LOC105140303 isoform X1 [Populus 
euphratica]
Length=1820

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  35   LEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            LE+FVA++K N+P+ LFD +HVS+LQ LRKH
Sbjct  551  LEEFVAAVKGNSPSSLFDWIHVSILQTLRKH  581



>ref|XP_011045385.1| PREDICTED: uncharacterized protein LOC105140303 isoform X2 [Populus 
euphratica]
Length=1719

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  35   LEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            LE+FVA++K N+P+ LFD +HVS+LQ LRKH
Sbjct  450  LEEFVAAVKGNSPSSLFDWIHVSILQTLRKH  480



>ref|XP_009131280.1| PREDICTED: uncharacterized protein LOC103855975 [Brassica rapa]
Length=1534

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  32   ELEDFVASIKCNTPTVLFDSVHVSLLQMLRK  124
            EL+DFV +++C +P++L DS+HVS+LQ+LRK
Sbjct  387  ELKDFVEALRCMSPSLLLDSIHVSVLQLLRK  417



>ref|XP_010239521.1| PREDICTED: uncharacterized protein LOC100838217 [Brachypodium 
distachyon]
Length=1786

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  35   LEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            L+DFVASIKC   + + D+VHVSLL+ LR+H
Sbjct  240  LDDFVASIKCTVQSTMLDAVHVSLLRALRRH  270



>ref|XP_002313363.2| hypothetical protein POPTR_0009s05370g [Populus trichocarpa]
 gb|EEE87318.2| hypothetical protein POPTR_0009s05370g [Populus trichocarpa]
Length=1934

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  35   LEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            LE+FVA++K N+P+ LFD +HVS+L++LRKH
Sbjct  584  LEEFVAALKGNSPSSLFDFIHVSILEILRKH  614



>ref|XP_006347254.1| PREDICTED: uncharacterized protein LOC102582627 [Solanum tuberosum]
Length=1569

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  35   LEDFVASIKCNTPTVLFDSVHVSLLQMLRKH  127
            LEDFV ++ C+ P  LFDSVHV+L+  LR+H
Sbjct  225  LEDFVGALNCSAPNTLFDSVHVALMCALRRH  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506872938168