BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c37037_g1_i1 len=216 path=[1:0-215]

Length=216
                                                                      Score     E

ref|XP_010257844.1|  PREDICTED: putative germin-like protein 2-1        101   3e-24   
ref|NP_001268128.1|  germin-like protein 5                            99.4    1e-23   
gb|KDP23769.1|  hypothetical protein JCGZ_23602                       98.2    3e-23   
gb|KCW61445.1|  hypothetical protein EUGRSUZ_H04176                   97.1    9e-23   
ref|XP_010659615.1|  PREDICTED: germin-like protein subfamily 1 m...  97.1    1e-22   
gb|EYU40209.1|  hypothetical protein MIMGU_mgv1a013129mg              96.3    2e-22   
gb|EYU40211.1|  hypothetical protein MIMGU_mgv1a013108mg              95.9    3e-22   
gb|EYU20546.1|  hypothetical protein MIMGU_mgv1a013111mg              95.9    3e-22   
ref|XP_006371118.1|  hypothetical protein POPTR_0019s042602g          92.8    3e-22   
emb|CBI36786.3|  unnamed protein product                              94.4    6e-22   
gb|EYU20539.1|  hypothetical protein MIMGU_mgv1a013072mg              94.7    9e-22   
gb|EYU20535.1|  hypothetical protein MIMGU_mgv1a013054mg              94.4    1e-21   
emb|CDP10695.1|  unnamed protein product                              94.4    1e-21   
gb|EYU20540.1|  hypothetical protein MIMGU_mgv1a013117mg              94.4    1e-21   
ref|XP_010027140.1|  PREDICTED: uncharacterized protein LOC104417587  97.1    1e-21   
ref|XP_010528770.1|  PREDICTED: germin-like protein subfamily 1 m...  94.4    1e-21   
emb|CBI36783.3|  unnamed protein product                              94.7    2e-21   
gb|KDP23767.1|  hypothetical protein JCGZ_23600                       92.8    2e-21   
gb|KDP23763.1|  hypothetical protein JCGZ_23596                       92.8    2e-21   
gb|KDP23759.1|  hypothetical protein JCGZ_23592                       92.8    2e-21   
ref|XP_011002009.1|  PREDICTED: germin-like protein subfamily 1 m...  93.6    2e-21   
emb|CBI36811.3|  unnamed protein product                              93.2    2e-21   
ref|XP_010024920.1|  PREDICTED: germin-like protein subfamily 1 m...  93.2    3e-21   
ref|NP_001267943.1|  germin-like protein 4 precursor                  92.8    4e-21   
emb|CBI36816.3|  unnamed protein product                              92.8    4e-21   
ref|XP_002284320.1|  PREDICTED: germin-like protein subfamily 1 m...  92.8    4e-21   Vitis vinifera
ref|XP_002284661.2|  PREDICTED: uncharacterized protein LOC100240807  94.7    5e-21   Vitis vinifera
emb|CBI36815.3|  unnamed protein product                              92.4    5e-21   
emb|CBI36812.3|  unnamed protein product                              94.4    6e-21   
ref|XP_007030270.1|  Germin-like protein subfamily 1 member 18        93.2    6e-21   
ref|XP_011002008.1|  PREDICTED: germin-like protein subfamily 1 m...  92.0    6e-21   
gb|ABR68690.1|  oxalate oxidase                                       90.5    8e-21   Theobroma cacao [chocolate]
emb|CAN80134.1|  hypothetical protein VITISV_012033                   91.7    9e-21   Vitis vinifera
emb|CDP10701.1|  unnamed protein product                              92.0    9e-21   
ref|XP_010024918.1|  PREDICTED: germin-like protein subfamily 1 m...  91.7    1e-20   
ref|XP_010024919.1|  PREDICTED: germin-like protein subfamily 1 m...  91.7    1e-20   
gb|KCW61456.1|  hypothetical protein EUGRSUZ_H04192                   91.7    1e-20   
emb|CDP10694.1|  unnamed protein product                              91.3    2e-20   
ref|XP_002325797.2|  hypothetical protein POPTR_0019s04340g           91.3    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006358463.1|  PREDICTED: germin-like protein subfamily 1 m...  91.3    2e-20   
ref|XP_002280481.2|  PREDICTED: uncharacterized protein LOC100252737  94.4    2e-20   Vitis vinifera
ref|XP_002325370.2|  hypothetical protein POPTR_0019s04270g           90.9    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_007200157.1|  hypothetical protein PRUPE_ppa016753mg           90.9    2e-20   
ref|XP_010683101.1|  PREDICTED: germin-like protein subfamily 1 m...  90.9    2e-20   
ref|XP_007201862.1|  hypothetical protein PRUPE_ppa020162mg           90.9    2e-20   
ref|XP_007030273.1|  RmlC-like cupins superfamily protein             90.9    2e-20   
ref|XP_004230403.1|  PREDICTED: putative germin-like protein 2-1      90.9    2e-20   
ref|XP_006371120.1|  hypothetical protein POPTR_0019s04280g           90.9    2e-20   
ref|XP_011012323.1|  PREDICTED: germin-like protein subfamily 1 m...  92.0    2e-20   
gb|EYU28622.1|  hypothetical protein MIMGU_mgv1a018753mg              90.9    2e-20   
ref|XP_006349264.1|  PREDICTED: germin-like protein subfamily 1 m...  90.5    3e-20   
ref|XP_006443311.1|  hypothetical protein CICLE_v10022142mg           90.5    3e-20   
ref|XP_006349268.1|  PREDICTED: germin-like protein subfamily 1 m...  90.5    3e-20   
gb|EYU38444.1|  hypothetical protein MIMGU_mgv1a013102mg              90.5    3e-20   
ref|XP_002284343.2|  PREDICTED: uncharacterized protein LOC100256308  92.8    3e-20   Vitis vinifera
ref|XP_010659856.1|  PREDICTED: germin-like protein subfamily 1 m...  90.1    3e-20   
emb|CDP10698.1|  unnamed protein product                              90.1    4e-20   
ref|XP_010024921.1|  PREDICTED: germin-like protein subfamily 1 m...  90.1    4e-20   
gb|EYU20549.1|  hypothetical protein MIMGU_mgv1a020596mg              90.1    4e-20   
ref|XP_010251871.1|  PREDICTED: putative germin-like protein 2-1      89.7    5e-20   
ref|XP_007200176.1|  hypothetical protein PRUPE_ppa016529mg           89.7    5e-20   
ref|XP_010251869.1|  PREDICTED: putative germin-like protein 2-1 ...  89.7    5e-20   
ref|XP_011099651.1|  PREDICTED: germin-like protein subfamily 1 m...  89.7    5e-20   
ref|XP_010251872.1|  PREDICTED: putative germin-like protein 2-1      89.7    5e-20   
ref|XP_006358459.1|  PREDICTED: germin-like protein subfamily 1 m...  89.7    5e-20   
ref|XP_006442438.1|  hypothetical protein CICLE_v10024000mg           89.4    6e-20   
ref|XP_006349261.1|  PREDICTED: putative germin-like protein 2-1-...  89.7    6e-20   
ref|XP_002531992.1|  Rhicadhesin receptor precursor, putative         89.4    7e-20   Ricinus communis
ref|XP_010027143.1|  PREDICTED: uncharacterized protein LOC104417591  91.7    7e-20   
emb|CAN73847.1|  hypothetical protein VITISV_021638                   89.4    7e-20   Vitis vinifera
ref|XP_006371122.1|  Germin-like protein subfamily 1 member 6 pre...  89.4    7e-20   
ref|XP_006442440.1|  hypothetical protein CICLE_v10023726mg           89.4    8e-20   
ref|XP_007030281.1|  RmlC-like cupins superfamily protein isoform 2   89.4    8e-20   
ref|XP_007030280.1|  RmlC-like cupins superfamily protein isoform 1   89.4    8e-20   
ref|XP_007199217.1|  hypothetical protein PRUPE_ppa021882mg           89.4    8e-20   
ref|XP_006443312.1|  hypothetical protein CICLE_v10022118mg           89.0    9e-20   
ref|NP_001237300.1|  uncharacterized protein LOC100527781 precursor   89.0    1e-19   
ref|XP_006282503.1|  hypothetical protein CARUB_v10006909mg           89.0    1e-19   
gb|KDO42113.1|  hypothetical protein CISIN_1g027369mg                 89.0    1e-19   
gb|EYU40208.1|  hypothetical protein MIMGU_mgv1a020439mg              89.0    1e-19   
ref|XP_004230405.1|  PREDICTED: germin-like protein subfamily 1 m...  89.0    1e-19   
ref|XP_010435818.1|  PREDICTED: germin-like protein subfamily 1 m...  89.0    1e-19   
emb|CDY11695.1|  BnaC06g13030D                                        89.0    1e-19   
emb|CDY69099.1|  BnaA07g37570D                                        89.0    1e-19   
emb|CAN80133.1|  hypothetical protein VITISV_012032                   89.0    1e-19   Vitis vinifera
ref|XP_006442444.1|  hypothetical protein CICLE_v10023384mg           89.0    1e-19   
emb|CBI39477.3|  unnamed protein product                              89.0    1e-19   
ref|XP_006442442.1|  hypothetical protein CICLE_v10022152mg           88.6    1e-19   
ref|XP_006442447.1|  hypothetical protein CICLE_v10024005mg           88.6    1e-19   
ref|XP_010251870.1|  PREDICTED: putative germin-like protein 2-1 ...  89.0    1e-19   
ref|XP_006477875.1|  PREDICTED: germin-like protein subfamily 1 m...  88.6    1e-19   
emb|CBI36810.3|  unnamed protein product                              89.4    1e-19   
ref|XP_006442436.1|  hypothetical protein CICLE_v10024280mg           88.6    1e-19   
ref|XP_009612543.1|  PREDICTED: germin-like protein subfamily 1 m...  88.6    1e-19   
ref|XP_006477879.1|  PREDICTED: germin-like protein subfamily 1 m...  88.6    1e-19   
ref|XP_006477883.1|  PREDICTED: germin-like protein subfamily 1 m...  88.6    1e-19   
ref|XP_006477877.1|  PREDICTED: germin-like protein subfamily 1 m...  88.6    1e-19   
emb|CDY15957.1|  BnaA04g11540D                                        88.2    2e-19   
ref|XP_002868738.1|  hypothetical protein ARALYDRAFT_494073           88.2    2e-19   
ref|XP_009129904.1|  PREDICTED: germin-like protein subfamily 1 m...  88.2    2e-19   
emb|CDX99669.1|  BnaC04g34260D                                        88.2    2e-19   
ref|XP_006358462.1|  PREDICTED: germin-like protein subfamily 1 m...  88.2    2e-19   
ref|XP_010042132.1|  PREDICTED: germin-like protein subfamily 1 m...  88.2    2e-19   
ref|XP_009784933.1|  PREDICTED: germin-like protein subfamily 1 m...  88.2    2e-19   
ref|XP_009627660.1|  PREDICTED: germin-like protein subfamily 1 m...  88.2    2e-19   
ref|XP_003590904.1|  Germin-like protein subfamily 1 member           88.2    2e-19   
ref|XP_010052624.1|  PREDICTED: germin-like protein subfamily 1 m...  88.2    2e-19   
ref|XP_007200183.1|  hypothetical protein PRUPE_ppa016284mg           88.2    2e-19   
ref|XP_010048221.1|  PREDICTED: germin-like protein subfamily 1 m...  88.2    2e-19   
ref|XP_007030289.1|  RmlC-like cupins superfamily protein             87.8    2e-19   
ref|XP_009795503.1|  PREDICTED: germin-like protein subfamily 1 m...  87.8    2e-19   
ref|XP_002868743.1|  predicted protein                                87.8    3e-19   
ref|XP_010450837.1|  PREDICTED: germin-like protein subfamily 1 m...  87.8    3e-19   
emb|CBI36789.3|  unnamed protein product                              85.9    3e-19   
emb|CBI36814.3|  unnamed protein product                              87.8    3e-19   
emb|CBI36785.3|  unnamed protein product                              87.0    3e-19   
ref|XP_006358464.1|  PREDICTED: germin-like protein subfamily 1 m...  87.8    3e-19   
ref|XP_010251867.1|  PREDICTED: putative germin-like protein 2-1      87.4    3e-19   
ref|NP_198732.2|  germin-like protein subfamily 1 member 18           87.4    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868798.1|  predicted protein                                87.4    4e-19   
ref|XP_009125150.1|  PREDICTED: germin-like protein subfamily 1 m...  87.0    5e-19   
ref|XP_011034445.1|  PREDICTED: germin-like protein subfamily 1 m...  87.0    5e-19   
gb|KCW61441.1|  hypothetical protein EUGRSUZ_H04171                   87.0    5e-19   
ref|XP_011038440.1|  PREDICTED: germin-like protein subfamily 1 m...  87.0    5e-19   
ref|XP_007030284.1|  RmlC-like cupins superfamily protein             87.0    5e-19   
ref|XP_002284682.1|  PREDICTED: germin-like protein subfamily 1 m...  87.0    5e-19   Vitis vinifera
emb|CBI36782.3|  unnamed protein product                              87.0    5e-19   
gb|EYU20542.1|  hypothetical protein MIMGU_mgv1a020630mg              87.0    5e-19   
gb|EYU20548.1|  hypothetical protein MIMGU_mgv1a013109mg              87.0    6e-19   
emb|CDP10693.1|  unnamed protein product                              87.0    6e-19   
ref|NP_198735.1|  germin-like protein 2a                              87.0    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010672478.1|  PREDICTED: germin-like protein subfamily 1 m...  87.0    6e-19   
emb|CDP22064.1|  unnamed protein product                              87.0    6e-19   
ref|NP_198729.1|  germin-like protein subfamily 1 member 16           86.7    6e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CBI36778.3|  unnamed protein product                              90.5    7e-19   
ref|XP_008443754.1|  PREDICTED: germin-like protein subfamily 1 m...  86.7    7e-19   
emb|CAN71139.1|  hypothetical protein VITISV_005470                   85.1    7e-19   Vitis vinifera
ref|XP_010024912.1|  PREDICTED: germin-like protein subfamily 1 m...  86.7    7e-19   
gb|KDP23768.1|  hypothetical protein JCGZ_23601                       86.7    8e-19   
ref|XP_010441036.1|  PREDICTED: germin-like protein subfamily 1 m...  86.7    8e-19   
ref|XP_008237524.1|  PREDICTED: germin-like protein subfamily 1 m...  86.7    8e-19   
gb|KDP23764.1|  hypothetical protein JCGZ_23597                       86.7    8e-19   
ref|XP_008243694.1|  PREDICTED: germin-like protein 9-1               88.6    8e-19   
ref|XP_008237526.1|  PREDICTED: germin-like protein subfamily 1 m...  86.7    8e-19   
emb|CDP16787.1|  unnamed protein product                              86.7    9e-19   
ref|XP_008237522.1|  PREDICTED: germin-like protein subfamily 1 m...  86.7    9e-19   
gb|KDO36579.1|  hypothetical protein CISIN_1g048097mg                 86.3    9e-19   
ref|XP_010241946.1|  PREDICTED: putative germin-like protein 2-1      86.3    1e-18   
sp|P92997.2|GL113_ARATH  RecName: Full=Germin-like protein subfam...  86.3    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAB51572.1|  germin-like protein                                   86.3    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284624.1|  PREDICTED: germin-like protein subfamily 1 m...  85.9    1e-18   Vitis vinifera
emb|CAN71348.1|  hypothetical protein VITISV_024253                   85.9    1e-18   Vitis vinifera
ref|XP_006405658.1|  hypothetical protein EUTSA_v10027918mg           85.9    1e-18   
ref|NP_001267944.1|  germin-like protein 7 precursor                  85.9    1e-18   
emb|CDP16790.1|  unnamed protein product                              86.3    1e-18   
ref|XP_009786127.1|  PREDICTED: putative germin-like protein 2-1      85.9    1e-18   
ref|XP_007030176.1|  Germin-like protein subfamily 1 member 18        86.7    1e-18   
emb|CBI36780.3|  unnamed protein product                              86.7    1e-18   
gb|KDP32127.1|  hypothetical protein JCGZ_12588                       85.9    2e-18   
ref|XP_009625530.1|  PREDICTED: putative germin-like protein 2-1      85.9    2e-18   
ref|XP_009786133.1|  PREDICTED: germin-like protein subfamily 1 m...  84.0    2e-18   
ref|XP_007201148.1|  hypothetical protein PRUPE_ppa016020mg           85.5    2e-18   
ref|XP_006358461.1|  PREDICTED: germin-like protein subfamily 1 m...  85.5    2e-18   
ref|XP_009612542.1|  PREDICTED: putative germin-like protein 2-1      85.5    2e-18   
ref|XP_009612541.1|  PREDICTED: germin-like protein subfamily 1 m...  85.5    2e-18   
ref|XP_010450835.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  85.5    2e-18   
ref|XP_009620917.1|  PREDICTED: germin-like protein subfamily 1 m...  85.5    2e-18   
ref|XP_009795501.1|  PREDICTED: putative germin-like protein 2-1      85.5    2e-18   
emb|CDP16788.1|  unnamed protein product                              85.5    2e-18   
ref|XP_009140209.1|  PREDICTED: germin-like protein subfamily 1 m...  85.1    2e-18   
ref|XP_007030278.1|  Germin-like protein subfamily 1 member 18        87.4    2e-18   
gb|EYU20541.1|  hypothetical protein MIMGU_mgv1a018988mg              85.1    2e-18   
gb|EYU40210.1|  hypothetical protein MIMGU_mgv1a022317mg              85.1    3e-18   
gb|EYU20545.1|  hypothetical protein MIMGU_mgv1a020779mg              85.1    3e-18   
ref|XP_002270404.2|  PREDICTED: putative germin-like protein 2-1      85.1    3e-18   Vitis vinifera
gb|EYU20547.1|  hypothetical protein MIMGU_mgv1a023357mg              85.1    3e-18   
ref|XP_009620404.1|  PREDICTED: germin-like protein subfamily 1 m...  85.1    3e-18   
emb|CAA63023.1|  germin type2                                         84.7    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002319672.1|  hypothetical protein POPTR_0013s04850g           84.7    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006405659.1|  hypothetical protein EUTSA_v10028158mg           84.7    4e-18   
gb|KDP23773.1|  hypothetical protein JCGZ_23606                       84.0    4e-18   
ref|XP_006349265.1|  PREDICTED: germin-like protein subfamily 1 m...  84.7    4e-18   
ref|XP_010251866.1|  PREDICTED: putative germin-like protein 2-1      84.7    4e-18   
ref|XP_004142551.1|  PREDICTED: germin-like protein subfamily 1 m...  84.3    5e-18   
ref|XP_006845051.1|  hypothetical protein AMTR_s00794p00001640        84.3    5e-18   
ref|XP_004155681.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  84.3    5e-18   
ref|XP_002870302.1|  predicted protein                                84.3    5e-18   
emb|CAN63434.1|  hypothetical protein VITISV_033830                   84.0    6e-18   Vitis vinifera
ref|XP_004142552.1|  PREDICTED: germin-like protein subfamily 1 m...  84.0    6e-18   
ref|XP_002868741.1|  predicted protein                                84.0    7e-18   
ref|XP_006840195.1|  hypothetical protein AMTR_s00089p00119070        84.0    7e-18   
emb|CAN71140.1|  hypothetical protein VITISV_005471                   84.0    7e-18   Vitis vinifera
gb|EYU20536.1|  hypothetical protein MIMGU_mgv1a025658mg              84.0    8e-18   
emb|CDP21353.1|  unnamed protein product                              85.9    8e-18   
ref|XP_007143989.1|  hypothetical protein PHAVU_007G119700g           83.6    8e-18   
emb|CDP16789.1|  unnamed protein product                              86.3    9e-18   
emb|CDP16791.1|  unnamed protein product                              84.0    9e-18   
emb|CBI36790.3|  unnamed protein product                              83.6    9e-18   
ref|NP_001267940.1|  germin-like protein 1                            83.6    9e-18   
ref|NP_193199.1|  germin-like protein 9                               83.6    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006477881.1|  PREDICTED: germin-like protein subfamily 1 m...  83.6    1e-17   
emb|CDP16786.1|  unnamed protein product                              86.7    1e-17   
ref|XP_002319671.1|  hypothetical protein POPTR_0013s04840g           83.6    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002284616.2|  PREDICTED: germin-like protein subfamily 1 m...  83.6    1e-17   Vitis vinifera
gb|AAD00509.1|  germin-like protein                                   83.6    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009786129.1|  PREDICTED: putative germin-like protein 2-1      83.6    1e-17   
gb|KCW82831.1|  hypothetical protein EUGRSUZ_C04202                   83.2    1e-17   
ref|XP_006358460.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  83.6    1e-17   
ref|XP_002868742.1|  predicted protein                                83.2    1e-17   
ref|XP_007030274.1|  Germin-like protein subfamily 1 member 18        86.3    1e-17   
ref|XP_007030272.1|  RmlC-like cupins superfamily protein             83.2    1e-17   
ref|XP_010051708.1|  PREDICTED: germin-like protein subfamily 1 m...  83.6    1e-17   
ref|XP_006840201.1|  hypothetical protein AMTR_s00089p00122070        82.0    1e-17   
ref|XP_010024915.1|  PREDICTED: putative germin-like protein 2-1      83.2    1e-17   
gb|KCW61443.1|  hypothetical protein EUGRSUZ_H04174                   83.2    1e-17   
gb|KCW61437.1|  hypothetical protein EUGRSUZ_H04167                   83.2    1e-17   
ref|XP_010024914.1|  PREDICTED: putative germin-like protein 2-1      83.2    1e-17   
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...  83.2    2e-17   
ref|NP_198727.1|  germin-like protein subfamily 1 member 14           82.8    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KCW61434.1|  hypothetical protein EUGRSUZ_H04164                   82.8    2e-17   
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600        82.8    2e-17   
gb|KCW44232.1|  hypothetical protein EUGRSUZ_L02342                   82.8    2e-17   
ref|XP_010024910.1|  PREDICTED: germin-like protein subfamily 1 m...  82.8    2e-17   
gb|KCW61436.1|  hypothetical protein EUGRSUZ_H04166                   82.8    2e-17   
emb|CBI33612.3|  unnamed protein product                              82.8    2e-17   
ref|XP_010050940.1|  PREDICTED: germin-like protein subfamily 1 m...  80.9    2e-17   
ref|XP_011046609.1|  PREDICTED: germin-like protein subfamily 1 m...  82.8    2e-17   
ref|XP_010041604.1|  PREDICTED: germin-like protein subfamily 1 m...  82.8    2e-17   
ref|XP_010549632.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    2e-17   
ref|XP_006443307.1|  hypothetical protein CICLE_v10022117mg           82.4    2e-17   
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1      82.4    2e-17   
gb|KCW61442.1|  hypothetical protein EUGRSUZ_H04173                   82.4    2e-17   
ref|XP_003535383.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  82.8    2e-17   
ref|XP_011046611.1|  PREDICTED: germin-like protein subfamily 1 m...  82.8    2e-17   
ref|XP_006443305.1|  hypothetical protein CICLE_v10023700mg           82.4    2e-17   
ref|XP_011039266.1|  PREDICTED: germin-like protein subfamily 1 m...  82.8    2e-17   
ref|XP_010066342.1|  PREDICTED: germin-like protein subfamily 1 m...  82.4    2e-17   
ref|XP_008778966.1|  PREDICTED: putative germin-like protein 2-1      82.4    2e-17   
ref|XP_007201563.1|  hypothetical protein PRUPE_ppa018105mg           82.4    3e-17   
ref|XP_008240380.1|  PREDICTED: germin-like protein subfamily 1 m...  82.4    3e-17   
ref|XP_010027139.1|  PREDICTED: germin-like protein subfamily 1 m...  82.0    3e-17   
ref|XP_007210592.1|  hypothetical protein PRUPE_ppa016616mg           82.4    3e-17   
emb|CAN73846.1|  hypothetical protein VITISV_021637                   81.6    3e-17   Vitis vinifera
ref|XP_007030211.1|  Uncharacterized protein TCM_026019               82.4    3e-17   
gb|KCW76699.1|  hypothetical protein EUGRSUZ_D01059                   82.0    3e-17   
ref|XP_006479011.1|  PREDICTED: germin-like protein subfamily 1 m...  82.0    3e-17   
ref|XP_007030267.1|  Germin-like protein subfamily 1 member 18        82.4    3e-17   
gb|KCW61438.1|  hypothetical protein EUGRSUZ_H04168                   82.0    4e-17   
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1      82.0    4e-17   Vitis vinifera
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1      82.0    4e-17   Vitis vinifera
gb|KCW80409.1|  hypothetical protein EUGRSUZ_C01766                   82.0    4e-17   
ref|XP_011099650.1|  PREDICTED: germin-like protein subfamily 1 m...  82.0    4e-17   
ref|XP_011099652.1|  PREDICTED: putative germin-like protein 2-1      82.0    4e-17   
ref|XP_007030276.1|  RmlC-like cupins superfamily protein             81.6    4e-17   
ref|XP_008393482.1|  PREDICTED: germin-like protein subfamily 1 m...  82.0    4e-17   
gb|KCW82834.1|  hypothetical protein EUGRSUZ_C04205                   81.6    5e-17   
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1      81.6    5e-17   Vitis vinifera
ref|XP_004513533.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    5e-17   
ref|XP_010049996.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    5e-17   
ref|XP_010049991.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    5e-17   
ref|XP_010049995.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    5e-17   
ref|XP_010049993.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    5e-17   
ref|XP_007030265.1|  Germin-like protein 2                            81.6    5e-17   
ref|XP_010049990.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    5e-17   
emb|CBI33611.3|  unnamed protein product                              82.0    6e-17   
ref|XP_006346966.1|  PREDICTED: putative germin-like protein 2-1-...  81.6    6e-17   
ref|XP_010024925.1|  PREDICTED: germin-like protein subfamily 1 m...  81.3    6e-17   
ref|XP_010024923.1|  PREDICTED: germin-like protein subfamily 1 m...  81.3    6e-17   
ref|XP_010463901.1|  PREDICTED: germin-like protein subfamily 1 m...  81.3    7e-17   
ref|XP_002277055.1|  PREDICTED: putative germin-like protein 2-1      81.3    7e-17   Vitis vinifera
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1      81.3    7e-17   
gb|AFK48994.1|  unknown                                               81.3    7e-17   
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...  81.3    7e-17   
ref|XP_007030263.1|  Germin-like protein subfamily 1 member 18        81.6    7e-17   
ref|XP_006854750.1|  hypothetical protein AMTR_s03649p00000860        78.6    7e-17   
ref|XP_009341765.1|  PREDICTED: germin-like protein subfamily 1 m...  81.3    8e-17   
emb|CAN82524.1|  hypothetical protein VITISV_028056                   80.9    8e-17   Vitis vinifera
ref|XP_006349263.1|  PREDICTED: germin-like protein subfamily 1 m...  81.3    8e-17   
ref|XP_008443751.1|  PREDICTED: germin-like protein subfamily 1 m...  80.9    8e-17   
emb|CAN72994.1|  hypothetical protein VITISV_000563                   80.9    8e-17   
ref|XP_006840196.1|  hypothetical protein AMTR_s00089p00119480        80.9    9e-17   
ref|XP_010435821.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    9e-17   
ref|XP_006443298.1|  hypothetical protein CICLE_v10022108mg           80.9    9e-17   
ref|XP_002281186.2|  PREDICTED: uncharacterized protein LOC100244552  83.2    1e-16   
ref|XP_006286150.1|  hypothetical protein CARUB_v10007709mg           80.9    1e-16   
ref|XP_002306210.1|  hypothetical protein POPTR_0004s18690g           80.9    1e-16   
gb|KFK33208.1|  hypothetical protein AALP_AA6G344800                  80.9    1e-16   
ref|XP_006405663.1|  hypothetical protein EUTSA_v10027916mg           80.9    1e-16   
ref|NP_198728.1|  germin-like protein subfamily 1 member 15           80.5    1e-16   
gb|KHN14792.1|  Germin-like protein subfamily 1 member 7              80.9    1e-16   
ref|NP_198731.1|  germin-like protein subfamily 1 member 17           80.5    1e-16   
ref|XP_010024926.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    1e-16   
ref|XP_010024924.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    1e-16   
ref|NP_198734.1|  germin-like protein subfamily 1 member 19           80.5    1e-16   
ref|XP_006349267.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    1e-16   
ref|XP_010027136.1|  PREDICTED: uncharacterized protein LOC104417584  82.8    1e-16   
gb|AFW90592.1|  germin-like protein subfamily 1 member 20 precursor   80.5    1e-16   
ref|XP_008237521.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    1e-16   
ref|XP_011046612.1|  PREDICTED: germin-like protein subfamily 1 m...  80.9    1e-16   
ref|XP_010027135.1|  PREDICTED: germin-like protein subfamily 1 m...  81.3    1e-16   
gb|KCW61435.1|  hypothetical protein EUGRSUZ_H04165                   80.1    1e-16   
gb|KFK24125.1|  hypothetical protein AALP_AAs58370U000100             80.5    1e-16   
ref|XP_002276926.2|  PREDICTED: uncharacterized protein LOC100251187  82.4    1e-16   
ref|XP_011046613.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    2e-16   
ref|XP_011046610.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    2e-16   
ref|XP_010051710.1|  PREDICTED: germin-like protein subfamily 1 m...  80.1    2e-16   
ref|XP_006857270.1|  hypothetical protein AMTR_s00067p00014150        80.1    2e-16   
ref|XP_008363404.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  80.1    2e-16   
ref|NP_001268198.1|  germin-like protein 3 precursor                  80.1    2e-16   
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1      80.1    2e-16   
gb|KCW61433.1|  hypothetical protein EUGRSUZ_H04161                   80.1    2e-16   
ref|XP_007143990.1|  hypothetical protein PHAVU_007G119700g           80.1    2e-16   
ref|XP_008237525.1|  PREDICTED: germin-like protein subfamily 1 m...  80.1    2e-16   
emb|CBI33610.3|  unnamed protein product                              80.5    2e-16   
ref|XP_010050748.1|  PREDICTED: uncharacterized protein LOC104439371  82.0    2e-16   
ref|XP_010054506.1|  PREDICTED: uncharacterized protein LOC104442816  82.0    2e-16   
emb|CBI39473.3|  unnamed protein product                              79.7    3e-16   
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1      79.7    3e-16   
ref|XP_004230404.1|  PREDICTED: putative germin-like protein 2-1      79.7    3e-16   
ref|XP_002284284.2|  PREDICTED: germin-like protein subfamily 1 m...  79.7    3e-16   
gb|KFK33209.1|  hypothetical protein AALP_AA6G344900                  79.3    3e-16   
ref|XP_009139822.1|  PREDICTED: germin-like protein subfamily 1 m...  79.7    3e-16   
gb|KCW64218.1|  hypothetical protein EUGRSUZ_G01868                   79.3    3e-16   
ref|XP_006479010.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  79.3    3e-16   
emb|CDY37880.1|  BnaC04g31260D                                        79.3    3e-16   
emb|CAN79051.1|  hypothetical protein VITISV_025926                   79.3    3e-16   
gb|KCW64217.1|  hypothetical protein EUGRSUZ_G018671                  77.8    3e-16   
ref|XP_009349816.1|  PREDICTED: germin-like protein subfamily 1 m...  79.3    3e-16   
ref|NP_187070.1|  RmlC-like cupins superfamily protein                79.3    3e-16   
ref|XP_010049992.1|  PREDICTED: germin-like protein subfamily 1 m...  79.3    3e-16   
ref|XP_002276445.2|  PREDICTED: uncharacterized protein LOC100254460  82.0    3e-16   
gb|KHN04965.1|  Germin-like protein subfamily 1 member 7              79.3    3e-16   
ref|NP_001240963.1|  germin-like protein subfamily 1 member 7-lik...  79.3    3e-16   
ref|XP_010066338.1|  PREDICTED: germin-like protein subfamily 1 m...  79.3    4e-16   
ref|NP_001190438.1|  germin-like protein subfamily 1 member 18        79.3    4e-16   
ref|XP_002265447.3|  PREDICTED: uncharacterized protein LOC100242782  81.3    4e-16   
ref|XP_010041605.1|  PREDICTED: germin-like protein subfamily 1 m...  79.3    4e-16   
gb|KDO42111.1|  hypothetical protein CISIN_1g027345mg                 79.3    4e-16   
ref|XP_002265297.3|  PREDICTED: uncharacterized protein LOC100247931  81.3    4e-16   
gb|KCW44233.1|  hypothetical protein EUGRSUZ_L02343                   79.0    4e-16   
ref|XP_010066343.1|  PREDICTED: germin-like protein subfamily 1 m...  79.0    4e-16   
gb|KCW80407.1|  hypothetical protein EUGRSUZ_C01764                   79.0    4e-16   
ref|XP_006479020.1|  PREDICTED: germin-like protein subfamily 1 m...  79.0    5e-16   
emb|CDY36875.1|  BnaC08g09720D                                        79.0    5e-16   
ref|XP_009107789.1|  PREDICTED: germin-like protein subfamily 1 m...  79.0    5e-16   
ref|XP_004513532.1|  PREDICTED: germin-like protein subfamily 1 m...  79.0    5e-16   
ref|XP_010528696.1|  PREDICTED: germin-like protein subfamily 1 m...  78.6    5e-16   
ref|XP_007199406.1|  hypothetical protein PRUPE_ppa026225mg           79.0    5e-16   
ref|XP_010528694.1|  PREDICTED: germin-like protein subfamily 1 m...  78.6    6e-16   
ref|NP_198712.1|  RmlC-like cupins superfamily protein                78.6    6e-16   
ref|NP_187246.1|  germin-like protein subfamily 1 member 7            78.6    6e-16   
sp|Q9FMA6.1|GL112_ARATH  RecName: Full=Putative germin-like prote...  78.6    6e-16   
ref|XP_010048594.1|  PREDICTED: germin-like protein subfamily 1 m...  78.6    6e-16   
gb|KCW76697.1|  hypothetical protein EUGRSUZ_D01057                   78.6    7e-16   
ref|XP_006840197.1|  hypothetical protein AMTR_s00089p00120230        78.6    7e-16   
ref|XP_010463900.1|  PREDICTED: germin-like protein subfamily 1 m...  78.6    7e-16   
ref|XP_006443299.1|  hypothetical protein CICLE_v10023949mg           77.8    7e-16   
ref|XP_006443310.1|  hypothetical protein CICLE_v10022111mg           78.2    8e-16   
ref|XP_010464157.1|  PREDICTED: germin-like protein subfamily 1 m...  78.2    8e-16   
ref|XP_010435820.1|  PREDICTED: germin-like protein subfamily 1 m...  78.2    9e-16   
ref|XP_008393146.1|  PREDICTED: germin-like protein subfamily 1 m...  78.2    9e-16   
ref|XP_011045439.1|  PREDICTED: germin-like protein subfamily 1 m...  78.2    9e-16   
ref|XP_010051709.1|  PREDICTED: germin-like protein subfamily 1 m...  78.2    1e-15   
ref|XP_010024917.1|  PREDICTED: germin-like protein subfamily 1 m...  77.8    1e-15   
ref|XP_008393483.1|  PREDICTED: germin-like protein subfamily 1 m...  77.8    1e-15   
gb|AAM76225.1|  putative germin E protein precursor                   77.4    1e-15   
ref|XP_002313686.1|  germin-like protein 1                            77.8    1e-15   
ref|XP_007140908.1|  hypothetical protein PHAVU_008G1513001g          75.1    1e-15   
gb|AAM76227.1|  putative germin E protein precursor                   77.4    1e-15   
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1      77.4    1e-15   
ref|XP_002313687.2|  hypothetical protein POPTR_0009s14250g           77.4    1e-15   
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...  77.4    2e-15   
gb|EPS67173.1|  hypothetical protein M569_07603                       77.4    2e-15   
ref|XP_006414672.1|  hypothetical protein EUTSA_v10026186mg           77.4    2e-15   
ref|XP_010434310.1|  PREDICTED: germin-like protein subfamily 1 m...  77.4    2e-15   
ref|NP_187065.1|  putative germin-like protein subfamily 1 member 2   77.0    2e-15   
ref|XP_006443308.1|  hypothetical protein CICLE_v10022113mg           77.0    2e-15   
ref|XP_009402547.1|  PREDICTED: putative germin-like protein 2-1 ...  77.0    2e-15   
ref|XP_008371812.1|  PREDICTED: germin-like protein subfamily 1 m...  77.0    2e-15   
gb|AAM76229.1|  putative germin E protein precursor                   76.6    2e-15   
ref|XP_006443302.1|  hypothetical protein CICLE_v10024109mg           75.9    2e-15   
gb|KFK23658.1|  germin-like protein                                   77.0    2e-15   
emb|CDY36876.1|  BnaC08g09710D                                        77.0    3e-15   
ref|XP_006405676.1|  hypothetical protein EUTSA_v10027913mg           77.0    3e-15   
ref|XP_010450836.1|  PREDICTED: germin-like protein subfamily 1 m...  76.6    3e-15   
gb|AAM76226.1|  putative germin E protein precursor                   76.3    3e-15   
gb|EPS65260.1|  hypothetical protein M569_09517                       74.7    3e-15   
ref|XP_006405677.1|  hypothetical protein EUTSA_v10027920mg           76.6    3e-15   
ref|XP_003536153.1|  PREDICTED: germin-like protein subfamily 1 m...  76.6    4e-15   
ref|XP_006298965.1|  hypothetical protein CARUB_v10015090mg           76.6    4e-15   
emb|CBI36791.3|  unnamed protein product                              76.3    4e-15   
ref|XP_006479315.1|  PREDICTED: germin-like protein subfamily 1 m...  76.3    4e-15   
ref|XP_007140906.1|  hypothetical protein PHAVU_008G151100g           73.9    4e-15   
ref|XP_002868739.1|  predicted protein                                75.9    5e-15   
emb|CAN66771.1|  hypothetical protein VITISV_022559                   75.9    5e-15   
ref|XP_008367619.1|  PREDICTED: germin-like protein subfamily 1 m...  75.9    6e-15   
ref|XP_006349266.1|  PREDICTED: germin-like protein subfamily 1 m...  75.5    6e-15   
ref|XP_010024913.1|  PREDICTED: germin-like protein subfamily 1 m...  75.9    6e-15   
ref|XP_010024911.1|  PREDICTED: germin-like protein subfamily 1 m...  75.9    6e-15   
ref|XP_009124949.1|  PREDICTED: germin-like protein subfamily 1 m...  75.9    6e-15   
ref|XP_008351931.1|  PREDICTED: germin-like protein subfamily 1 m...  75.9    6e-15   
ref|XP_006299843.1|  hypothetical protein CARUB_v10016046mg           75.9    6e-15   
ref|XP_009385875.1|  PREDICTED: putative germin-like protein 2-1      75.9    6e-15   
ref|XP_006405680.1|  hypothetical protein EUTSA_v10027917mg           75.9    6e-15   
ref|XP_010528697.1|  PREDICTED: germin-like protein subfamily 1 m...  75.9    7e-15   
ref|XP_010412923.1|  PREDICTED: germin-like protein subfamily 1 m...  75.5    7e-15   
ref|XP_006408007.1|  hypothetical protein EUTSA_v10021469mg           75.5    8e-15   
gb|KCW64213.1|  hypothetical protein EUGRSUZ_G01863                   75.5    8e-15   
gb|KDP45307.1|  hypothetical protein JCGZ_09556                       75.5    8e-15   
ref|XP_002870809.1|  predicted protein                                74.3    8e-15   
ref|XP_008360941.1|  PREDICTED: germin-like protein subfamily 1 m...  75.5    8e-15   
ref|XP_007140900.1|  hypothetical protein PHAVU_008G1508001g          73.2    8e-15   
gb|EPS68344.1|  hypothetical protein M569_06425                       75.1    1e-14   
ref|XP_006405679.1|  hypothetical protein EUTSA_v10027925mg           75.1    1e-14   
ref|XP_009419633.1|  PREDICTED: uncharacterized protein LOC103999573  77.4    1e-14   
ref|XP_009113441.1|  PREDICTED: germin-like protein subfamily 1 m...  75.1    1e-14   
ref|XP_009357348.1|  PREDICTED: germin-like protein subfamily 1 m...  75.1    1e-14   
ref|XP_008375054.1|  PREDICTED: germin-like protein subfamily 1 m...  74.7    1e-14   
ref|XP_011034308.1|  PREDICTED: germin-like protein subfamily 1 m...  74.7    1e-14   
gb|KDO36089.1|  hypothetical protein CISIN_1g027381mg                 74.7    2e-14   
ref|NP_001189803.1|  putative germin-like protein subfamily 1 mem...  74.7    2e-14   
ref|XP_003604729.1|  Germin-like protein subfamily 1 member           74.7    2e-14   
ref|XP_003604730.1|  Germin-like protein subfamily 1 member           74.7    2e-14   
ref|XP_011034305.1|  PREDICTED: germin-like protein subfamily 1 m...  74.7    2e-14   
ref|XP_003593910.1|  Germin-like protein subfamily 1 member           74.3    2e-14   
ref|XP_004489240.1|  PREDICTED: germin-like protein subfamily 1 m...  74.3    2e-14   
ref|XP_009355938.1|  PREDICTED: germin-like protein subfamily 1 m...  74.7    2e-14   
gb|EYU40207.1|  hypothetical protein MIMGU_mgv1a012993mg              74.7    2e-14   
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...  74.3    2e-14   
ref|XP_011034444.1|  PREDICTED: germin-like protein subfamily 1 m...  73.9    3e-14   
ref|XP_011034442.1|  PREDICTED: germin-like protein subfamily 1 m...  73.9    3e-14   
ref|XP_011038438.1|  PREDICTED: germin-like protein subfamily 1 m...  73.9    3e-14   
gb|KFK36029.1|  hypothetical protein AALP_AA4G068500                  73.6    3e-14   
ref|XP_002319184.1|  hypothetical protein POPTR_0013s06030g           73.9    3e-14   
ref|XP_010489667.1|  PREDICTED: uncharacterized protein LOC104767323  75.9    3e-14   
ref|XP_003618164.1|  Germin-like protein subfamily 1 member           73.9    3e-14   
ref|XP_003604731.1|  Germin-like protein subfamily 1 member           73.9    3e-14   
ref|XP_006405681.1|  hypothetical protein EUTSA_v10027922mg           73.6    4e-14   
ref|XP_007140911.1|  hypothetical protein PHAVU_008G1514000g          70.9    4e-14   
gb|KDP45308.1|  hypothetical protein JCGZ_09557                       73.6    4e-14   
ref|XP_006408215.1|  hypothetical protein EUTSA_v10022237mg           73.2    4e-14   
ref|XP_006387364.1|  hypothetical protein POPTR_1158s00200g           73.6    4e-14   
emb|CAN72946.1|  hypothetical protein VITISV_034968                   76.3    5e-14   
ref|XP_011034307.1|  PREDICTED: germin-like protein subfamily 1 m...  73.6    5e-14   
ref|XP_011085184.1|  PREDICTED: putative germin-like protein 2-1      73.2    6e-14   
gb|KDP34916.1|  hypothetical protein JCGZ_09204                       73.2    6e-14   
gb|KDP46445.1|  hypothetical protein JCGZ_10285                       73.2    6e-14   
ref|XP_011013026.1|  PREDICTED: germin-like protein subfamily 1 m...  73.2    6e-14   
gb|AFN02126.1|  germin-like protein                                   72.8    7e-14   
ref|XP_011034443.1|  PREDICTED: germin-like protein subfamily 1 m...  72.8    7e-14   
gb|KDP45129.1|  hypothetical protein JCGZ_17461                       72.8    7e-14   
gb|KCW80410.1|  hypothetical protein EUGRSUZ_C01767                   72.8    7e-14   
ref|XP_010441025.1|  PREDICTED: germin-like protein subfamily 1 m...  72.8    7e-14   
ref|XP_003618162.1|  Germin-like protein subfamily 1 member           72.8    8e-14   
gb|AGZ13502.1|  germin-like protein 2                                 72.4    9e-14   
ref|XP_006299201.1|  hypothetical protein CARUB_v10015347mg           72.4    9e-14   
ref|XP_006375870.1|  germin-like protein 1                            72.4    9e-14   
ref|XP_002319674.2|  hypothetical protein POPTR_0013s04920g           72.4    9e-14   
ref|XP_002884546.1|  hypothetical protein ARALYDRAFT_477892           72.4    9e-14   
ref|XP_004291649.1|  PREDICTED: germin-like protein subfamily 1 m...  72.4    1e-13   
ref|XP_008237387.1|  PREDICTED: germin-like protein subfamily 1 m...  72.4    1e-13   
gb|AFK34934.1|  unknown                                               71.2    1e-13   
ref|XP_006377950.1|  germin-like protein 1                            72.0    1e-13   
ref|XP_006443309.1|  hypothetical protein CICLE_v10023846mg           72.0    1e-13   
gb|EYU43220.1|  hypothetical protein MIMGU_mgv11b017722mg             72.0    1e-13   
ref|XP_011037735.1|  PREDICTED: putative germin-like protein 2-1      72.0    1e-13   
ref|XP_010435804.1|  PREDICTED: germin-like protein subfamily 1 m...  72.0    2e-13   
ref|XP_011046314.1|  PREDICTED: germin-like protein subfamily 1 m...  72.0    2e-13   
ref|XP_009402551.1|  PREDICTED: putative germin-like protein 2-1      71.6    2e-13   
ref|XP_006299408.1|  hypothetical protein CARUB_v10015568mg           71.6    2e-13   
ref|XP_009135968.1|  PREDICTED: putative germin-like protein subf...  71.6    2e-13   
ref|XP_010450848.1|  PREDICTED: germin-like protein subfamily 1 m...  71.6    2e-13   
gb|AFK39387.1|  unknown                                               71.6    2e-13   
ref|XP_007214154.1|  hypothetical protein PRUPE_ppa018894mg           71.6    2e-13   
ref|XP_009402546.1|  PREDICTED: germin-like protein 12-2              71.6    2e-13   
emb|CDP10932.1|  unnamed protein product                              71.2    2e-13   
ref|XP_006405674.1|  hypothetical protein EUTSA_v10027914mg           71.2    2e-13   
ref|XP_004134896.1|  PREDICTED: germin-like protein 8-2-like          71.2    2e-13   
gb|KCW77248.1|  hypothetical protein EUGRSUZ_D01606                   71.2    3e-13   
ref|XP_010672578.1|  PREDICTED: putative germin-like protein 2-1      71.2    3e-13   
ref|XP_007201630.1|  hypothetical protein PRUPE_ppa020060mg           70.9    3e-13   
ref|XP_003618165.1|  Germin-like protein subfamily 1 member           70.9    4e-13   
ref|XP_006285306.1|  hypothetical protein CARUB_v10006688mg           70.9    4e-13   
ref|XP_010911182.1|  PREDICTED: putative germin-like protein 2-1      70.5    5e-13   
ref|XP_006375871.1|  hypothetical protein POPTR_0013s04880g           70.5    5e-13   
ref|XP_010463902.1|  PREDICTED: germin-like protein subfamily 1 m...  70.5    5e-13   
sp|P45852.1|GLP1_MESCR  RecName: Full=Germin-like protein; Flags:...  70.5    5e-13   
ref|XP_010911724.1|  PREDICTED: putative germin-like protein 2-1      70.5    5e-13   
gb|KDP45127.1|  hypothetical protein JCGZ_17459                       70.5    5e-13   
dbj|BAA78563.1|  germin-like protein                                  70.5    6e-13   
ref|XP_002870812.1|  predicted protein                                70.1    6e-13   
ref|XP_006405675.1|  hypothetical protein EUTSA_v10027915mg           70.1    6e-13   
emb|CAN70904.1|  hypothetical protein VITISV_032927                   70.1    6e-13   
ref|XP_006284934.1|  hypothetical protein CARUB_v10006233mg           70.1    7e-13   
gb|EYU20538.1|  hypothetical protein MIMGU_mgv1a012929mg              70.1    7e-13   
ref|XP_010672589.1|  PREDICTED: putative germin-like protein 2-1      70.1    7e-13   
ref|XP_011037736.1|  PREDICTED: putative germin-like protein 2-1      70.1    7e-13   
ref|XP_002870813.1|  predicted protein                                70.1    7e-13   
ref|XP_003618167.1|  Germin-like protein                              70.1    8e-13   
gb|KDP45119.1|  hypothetical protein JCGZ_17451                       70.1    8e-13   



>ref|XP_010257844.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=224

 Score =   101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A A+DP PLQD CVAI+DP   + VNGKFCKNP  A A DF F GL++PGNTSNP
Sbjct  15   LASSLAFASDPSPLQDFCVAIKDPKAAVLVNGKFCKNPKLAKAKDFFFSGLHKPGNTSNP  74

Query  36   LGSNVTAVNVNN  1
            +GS VTAVNV  
Sbjct  75   VGSKVTAVNVEQ  86



>ref|NP_001268128.1| germin-like protein 5 [Vitis vinifera]
 gb|ABL60874.1| germin-like protein 5 [Vitis vinifera]
 emb|CBI39475.3| unnamed protein product [Vitis vinifera]
Length=207

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQD CVAI+DP   +FVNGKFCKNPN   A DF F+GLN PGNT NP
Sbjct  3    LASSLASAFDPSPLQDTCVAIDDPKAAVFVNGKFCKNPNLTVAEDFFFQGLNIPGNTENP  62

Query  36   LGSNVTAVNVNN  1
            LG NVT VNV+ 
Sbjct  63   LGFNVTTVNVDQ  74



>gb|KDP23769.1| hypothetical protein JCGZ_23602 [Jatropha curcas]
Length=223

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA SFA+A DP PLQD CVA+E+P + +FVNGKFCK+PN A A DF+F GLN PGNT+N 
Sbjct  15   LAFSFASAYDPSPLQDFCVAVEEPKNAIFVNGKFCKDPNLAKANDFSFSGLNIPGNTNNG  74

Query  36   LGSNVTAVNVN  4
            +GSNVT VNV+
Sbjct  75   VGSNVTLVNVD  85



>gb|KCW61445.1| hypothetical protein EUGRSUZ_H04176 [Eucalyptus grandis]
Length=223

 Score = 97.1 bits (240),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA++ A A DP PLQDICVAI DP   +FVNG+FCK+P  ANA DFTF G+ +PGNT+NP
Sbjct  13   LATTTAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGVRKPGNTANP  72

Query  36   LGSNVTAVNVNN  1
            LGS VT   VN 
Sbjct  73   LGSKVTPATVNE  84



>ref|XP_010659615.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI39472.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+P    A DF F GL++PGNTSNP
Sbjct  16   LVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTEAEDFFFSGLDKPGNTSNP  75

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV  
Sbjct  76   VASNVTTVNVEQ  87



>gb|EYU40209.1| hypothetical protein MIMGU_mgv1a013129mg [Erythranthe guttata]
Length=230

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++FA A+DP PLQD CVA+ D    +FVNGK CKNPN   A DF FRGLN+PGNTSNPLG
Sbjct  18   ATFAYASDPSPLQDFCVAVNDTKAFVFVNGKICKNPNMVVAEDFLFRGLNKPGNTSNPLG  77

Query  30   SNVTAVNVNN  1
            S VT V VN 
Sbjct  78   SRVTPVTVNQ  87



>gb|EYU40211.1| hypothetical protein MIMGU_mgv1a013108mg [Erythranthe guttata]
Length=230

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++FA A+DP PLQD CVA+ D    +FVNGK CKNPN   A DF FRGLN+PGNTSNPLG
Sbjct  18   ATFAYASDPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAEDFLFRGLNKPGNTSNPLG  77

Query  30   SNVTAVNVNN  1
            S VT V VN 
Sbjct  78   SRVTPVTVNQ  87



>gb|EYU20546.1| hypothetical protein MIMGU_mgv1a013111mg [Erythranthe guttata]
Length=230

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++FA A+DP PLQD CVA+ D    +FVNGK CKNPN   A DF FRGLN+PGNTSNPLG
Sbjct  18   ATFAYASDPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAEDFLFRGLNKPGNTSNPLG  77

Query  30   SNVTAVNVNN  1
            S VT V VN 
Sbjct  78   SRVTPVTVNQ  87



>ref|XP_006371118.1| hypothetical protein POPTR_0019s042602g, partial [Populus trichocarpa]
 gb|ERP48915.1| hypothetical protein POPTR_0019s042602g, partial [Populus trichocarpa]
Length=105

 Score = 92.8 bits (229),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A+DP PLQD CVAI DP   +FVNGKFCK+P  A A DF+F GLN P NT N 
Sbjct  15   LASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDPKMATANDFSFSGLNIPRNTGNR  74

Query  36   LGSNVTAVNVNN  1
            +GSNVT +NV+ 
Sbjct  75   VGSNVTLLNVDQ  86



>emb|CBI36786.3| unnamed protein product [Vitis vinifera]
Length=193

 Score = 94.4 bits (233),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQD CVAI++P + +FVNGKFCKNPN   A DF ++GLN PGNT+N 
Sbjct  3    LASSLASAFDPRPLQDTCVAIDEPENAVFVNGKFCKNPNLTVADDFLYQGLNIPGNTTNL  62

Query  36   LGSNVTAVNVN  4
            +GSNVT +NV+
Sbjct  63   VGSNVTIINVD  73



>gb|EYU20539.1| hypothetical protein MIMGU_mgv1a013072mg [Erythranthe guttata]
Length=231

 Score = 94.7 bits (234),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = -1

Query  216  LASSFAN---AADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNT  46
            + +SFA    A+DP PLQD CVA+ D    +FVNGK CKNPN   A DF FRGLN+PGNT
Sbjct  14   VVASFATLGFASDPSPLQDFCVAVNDAKSAVFVNGKVCKNPNMVVAKDFLFRGLNKPGNT  73

Query  45   SNPLGSNVTAVNVNN  1
            SNPLGS VT VNVN 
Sbjct  74   SNPLGSRVTPVNVNQ  88



>gb|EYU20535.1| hypothetical protein MIMGU_mgv1a013054mg [Erythranthe guttata]
Length=231

 Score = 94.4 bits (233),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = -1

Query  216  LASSFAN---AADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNT  46
            + +SFA    A+DP PLQD CVA+ D    +FVNGK CKNPN   A DF FRGLN+PGNT
Sbjct  14   VVASFATLGFASDPSPLQDFCVAVNDAQSAVFVNGKVCKNPNMVVAEDFLFRGLNKPGNT  73

Query  45   SNPLGSNVTAVNVNN  1
            SNPLGS VT VNVN 
Sbjct  74   SNPLGSRVTPVNVNQ  88



>emb|CDP10695.1| unnamed protein product [Coffea canephora]
Length=223

 Score = 94.4 bits (233),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A A+DP PLQD CVAI DP   +FVNGK CK+P    A DF F+GLN+P NT+N 
Sbjct  14   LFSSLATASDPSPLQDFCVAINDPKTAVFVNGKICKDPKVVKANDFLFQGLNKPRNTANR  73

Query  36   LGSNVTAVNVNN  1
             GSNVTAVNVNN
Sbjct  74   QGSNVTAVNVNN  85



>gb|EYU20540.1| hypothetical protein MIMGU_mgv1a013117mg [Erythranthe guttata]
Length=230

 Score = 94.4 bits (233),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++F  A+DP PLQD CVA+ D    +FVNGK CKNPN   A DF FRGLN+PGNTSNPLG
Sbjct  18   ATFGYASDPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAEDFLFRGLNKPGNTSNPLG  77

Query  30   SNVTAVNVNN  1
            S VT V VN 
Sbjct  78   SRVTPVTVNQ  87



>ref|XP_010027140.1| PREDICTED: uncharacterized protein LOC104417587 [Eucalyptus grandis]
Length=549

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA++ A A DP PLQDICVAI DP   +FVNG+FCK+P  ANA DFTF G+ +PGNT+NP
Sbjct  339  LATTTAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGVRKPGNTANP  398

Query  36   LGSNVTAVNVNN  1
            LGS VT   VN 
Sbjct  399  LGSKVTPATVNE  410


 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A A+DP PLQD CVAI D    + VNGKFCK+P  A A DF+F     PGNTSNP
Sbjct  13   LASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSFTKFRYPGNTSNP  72

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  73   LGSKVTTAFVDQ  84



>ref|XP_010528770.1| PREDICTED: germin-like protein subfamily 1 member 18 [Tarenaya 
hassleriana]
Length=252

 Score = 94.4 bits (233),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPL  34
            ASSFA+A DP PLQD CVAI D    +FVNG+FCK+P  ANA DF F GLN+PGNT+N +
Sbjct  46   ASSFASAYDPSPLQDFCVAINDLKSGVFVNGRFCKDPQLANANDFFFSGLNKPGNTNNQV  105

Query  33   GSNVTAVNVNN  1
            GSNVT VNV+ 
Sbjct  106  GSNVTTVNVDQ  116



>emb|CBI36783.3| unnamed protein product [Vitis vinifera]
Length=281

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQD CVAI++P + +FVNGKFCKNPN   A DF ++GLN PGNT+N 
Sbjct  77   LASSLASAFDPRPLQDTCVAIDEPENAVFVNGKFCKNPNLTVADDFLYQGLNIPGNTANL  136

Query  36   LGSNVTAVNVN  4
            +GSNVT +NV+
Sbjct  137  VGSNVTIINVD  147



>gb|KDP23767.1| hypothetical protein JCGZ_23600 [Jatropha curcas]
Length=176

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA S+A+A DP PLQD CVAI++P + +FVNGKFCKNPN     DF+F GLN PGNT N 
Sbjct  15   LALSYASAYDPSPLQDFCVAIDEPKNAVFVNGKFCKNPNLTTPNDFSFSGLNIPGNTMNQ  74

Query  36   LGSNVTAVNVN  4
            +GSNVT +NV+
Sbjct  75   VGSNVTLLNVD  85



>gb|KDP23763.1| hypothetical protein JCGZ_23596 [Jatropha curcas]
Length=176

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA S+A+A DP PLQD CVAI++P + +FVNGKFCKNPN     DF+F GLN PGNT N 
Sbjct  15   LALSYASAYDPSPLQDFCVAIDEPKNAMFVNGKFCKNPNLTAPNDFSFSGLNIPGNTMNQ  74

Query  36   LGSNVTAVNVN  4
            +GSNVT +NV+
Sbjct  75   VGSNVTLLNVD  85



>gb|KDP23759.1| hypothetical protein JCGZ_23592 [Jatropha curcas]
Length=182

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA S+A+A DP PLQD CVAI++P + +FVNGKFCKNPN     DF+F GLN PGNT N 
Sbjct  21   LALSYASAYDPSPLQDFCVAIDEPKNAVFVNGKFCKNPNLTTPNDFSFSGLNIPGNTMNQ  80

Query  36   LGSNVTAVNVN  4
            +GSNVT +NV+
Sbjct  81   VGSNVTLLNVD  91



>ref|XP_011002009.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQD CVAI DP   +FVNGKFCK+P  A A DF+F GLN P +T NP
Sbjct  15   LASSIASAYDPSPLQDFCVAINDPKAAVFVNGKFCKDPKMATANDFSFSGLNIPRDTGNP  74

Query  36   LGSNVTAVNVNN  1
            +GSNVT +NV+ 
Sbjct  75   VGSNVTLLNVDQ  86



>emb|CBI36811.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+PN   A DF F GL++PGNTSN 
Sbjct  16   LVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPNLTVAEDFFFSGLDKPGNTSNA  75

Query  36   LGSNVTAVNVNN  1
              SNVT VNV+ 
Sbjct  76   AASNVTTVNVDK  87



>ref|XP_010024920.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61459.1| hypothetical protein EUGRSUZ_H04195 [Eucalyptus grandis]
Length=223

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L ++ A A DP PLQDICVAI DP   +FVNG+FCK+P  ANA DFTF G  +PGNT+NP
Sbjct  13   LVAATAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANP  72

Query  36   LGSNVTAVNV  7
            LGS VT   V
Sbjct  73   LGSKVTPATV  82



>ref|NP_001267943.1| germin-like protein 4 precursor [Vitis vinifera]
 gb|ABL60873.1| germin-like protein 4 [Vitis vinifera]
Length=220

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+P    A DF F GL++PGNTSN 
Sbjct  16   LVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNA  75

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV  
Sbjct  76   VASNVTTVNVEK  87



>emb|CBI36816.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+P    A DF F GL++PGNTSN 
Sbjct  16   LVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNA  75

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV  
Sbjct  76   VASNVTTVNVEQ  87



>ref|XP_002284320.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI36817.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+P    A DF F GL++PGNTSN 
Sbjct  16   LVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNA  75

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV  
Sbjct  76   VASNVTTVNVEQ  87



>ref|XP_002284661.2| PREDICTED: uncharacterized protein LOC100240807 [Vitis vinifera]
Length=455

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQD CVAI++P + +FVNGKFCKNPN   A DF ++GLN PGNT+N 
Sbjct  16   LASSLASAFDPRPLQDTCVAIDEPENAVFVNGKFCKNPNLTVADDFLYQGLNIPGNTANL  75

Query  36   LGSNVTAVNVN  4
            +GSNVT +NV+
Sbjct  76   VGSNVTIINVD  86


 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 11/83 (13%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDP-----------YHVLFVNGKFCKNPNDANAGDFTFR  70
            LAS  A+A DP PL+D CVA+++P            H +FVNGKFCKNPN   A DF ++
Sbjct  240  LASFLASAYDPSPLEDTCVAVDEPKNAGYIFSFFLLHAVFVNGKFCKNPNLTVAEDFLYQ  299

Query  69   GLNRPGNTSNPLGSNVTAVNVNN  1
            GLN PGNTSN +GS V  +NV+ 
Sbjct  300  GLNIPGNTSNYVGSIVNLINVDQ  322



>emb|CBI36815.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 92.4 bits (228),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+P    A DF F GL++PGNTSN 
Sbjct  16   LVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNA  75

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV  
Sbjct  76   VASNVTTVNVEQ  87



>emb|CBI36812.3| unnamed protein product [Vitis vinifera]
Length=447

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+PN   A DF F GL++PGNTSN 
Sbjct  243  LVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPNLTVAEDFFFSGLDKPGNTSNA  302

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  303  VASNVTTVNVDK  314


 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI+ P   +FVNGKFCK+P    A DF F GL++PGNTSN 
Sbjct  16   LVSSLASASDPSPLQDTCVAIDGPKEAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNA  75

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  76   VASNVTTVNVDK  87



>ref|XP_007030270.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10772.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=329

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI D  + +FVNGKFCK+P  ANA DF F GLN+ GNTSN 
Sbjct  92   LVSSLASASDPSPLQDFCVAINDAKNGVFVNGKFCKDPKLANADDFFFSGLNKQGNTSNQ  151

Query  36   LGSNVTAVNVNN  1
            LGS VT VNV  
Sbjct  152  LGSKVTPVNVEQ  163



>ref|XP_011002008.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score = 92.0 bits (227),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            +ASS A+A DP PLQD CVAI DP   +FVNGKFCK+P  A A DF+F GLN P +T NP
Sbjct  15   VASSIASAYDPSPLQDFCVAINDPKAAVFVNGKFCKDPKMATAHDFSFSGLNIPRDTGNP  74

Query  36   LGSNVTAVNVNN  1
            +GSNVT +NV+ 
Sbjct  75   VGSNVTLLNVDQ  86



>gb|ABR68690.1| oxalate oxidase [Theobroma cacao]
Length=144

 Score = 90.5 bits (223),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A+S A+A DP PLQD CVAI D  + +FVNGKFCK+P  A A DF + GLN PGNTSNP
Sbjct  16   FANSLASAFDPSPLQDFCVAINDTKNGVFVNGKFCKDPKLAVADDFFYSGLNMPGNTSNP  75

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  76   VGSNVTTVNVDQ  87



>emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera]
Length=224

 Score = 91.7 bits (226),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA S ++A DP PLQD CVA++DP   +FVNGKFCK+P  A A DF F GL+ PGNTSNP
Sbjct  16   LACSISSAYDPSPLQDTCVAVDDPKAAVFVNGKFCKDPKLAMADDFFFSGLHIPGNTSNP  75

Query  36   LGSNVTAVNV  7
            +GS VT VNV
Sbjct  76   VGSAVTPVNV  85



>emb|CDP10701.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 92.0 bits (227),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A A+DP PLQD CVAI DP   +FVNGK CK+P    A DF F+GLN+P NT+N 
Sbjct  14   LFSSLATASDPSPLQDFCVAINDPKTAVFVNGKICKDPKVVKANDFFFQGLNKPRNTANR  73

Query  36   LGSNVTAVNVNN  1
             GS VTAVNVNN
Sbjct  74   QGSTVTAVNVNN  85



>ref|XP_010024918.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61457.1| hypothetical protein EUGRSUZ_H04193 [Eucalyptus grandis]
Length=223

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAI DP   +FVNG+FCK+P  ANA DFTF G  +PGNT+NPLGS VT   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  9    VNN  1
            VN 
Sbjct  82   VNE  84



>ref|XP_010024919.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 ref|XP_010042113.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61458.1| hypothetical protein EUGRSUZ_H04194 [Eucalyptus grandis]
Length=223

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAI DP   +FVNG+FCK+P  ANA DFTF G  +PGNT+NPLGS VT   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  9    VNN  1
            VN 
Sbjct  82   VNE  84



>gb|KCW61456.1| hypothetical protein EUGRSUZ_H04192 [Eucalyptus grandis]
Length=223

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAI DP   +FVNG+FCK+P  ANA DFTF G  +PGNT+NPLGS VT   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  9    VNN  1
            VN 
Sbjct  82   VNE  84



>emb|CDP10694.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A A+DP PLQD CVAI DP   +FVNGK CK+P   NA DF F+GLN P +T+N 
Sbjct  14   LLSSLAIASDPSPLQDFCVAINDPKTAVFVNGKICKDPKVVNANDFFFQGLNIPRSTANR  73

Query  36   LGSNVTAVNVNN  1
             GSNVTAVNVNN
Sbjct  74   QGSNVTAVNVNN  85



>ref|XP_002325797.2| hypothetical protein POPTR_0019s04340g [Populus trichocarpa]
 gb|EEF00179.2| hypothetical protein POPTR_0019s04340g [Populus trichocarpa]
Length=225

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A+DP PLQD CVAI DP   +FVNGKFCK+P  A A DF+F GLN P +T N 
Sbjct  15   LASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDPKMATANDFSFSGLNIPRDTGNR  74

Query  36   LGSNVTAVNVNN  1
            +GSNVT +NV+ 
Sbjct  75   VGSNVTLLNVDQ  86



>ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + +S ++A+DP PLQD CVA+ED    +FVNGKFCK+P D  A DF   GLN PGNTSN 
Sbjct  15   VVTSISHASDPSPLQDFCVAVEDSKSAVFVNGKFCKDPKDVTADDFFRPGLNVPGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            LGS V AVNVNN
Sbjct  75   LGSVVIAVNVNN  86



>ref|XP_002280481.2| PREDICTED: uncharacterized protein LOC100252737 [Vitis vinifera]
Length=685

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+PN   A DF F GL++PGNTSN 
Sbjct  16   LVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPNLTVAEDFFFSGLDKPGNTSNA  75

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  76   VASNVTTVNVDK  87


 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+P    A DF   GL++PGNTSN 
Sbjct  476  LVSSLASASDPGPLQDTCVAIDEPSDAVFVNGKFCKDPKLTMAEDFFSSGLDKPGNTSNQ  535

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  536  VRSNVTTVNVDK  547



>ref|XP_002325370.2| hypothetical protein POPTR_0019s04270g [Populus trichocarpa]
 gb|EEE99751.2| hypothetical protein POPTR_0019s04270g [Populus trichocarpa]
Length=205

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A+DP PLQD CVAI DP   +FVNGKFCK+P  A A DF+F GLN P +T N 
Sbjct  15   LASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDPKLATANDFSFSGLNIPRDTGNR  74

Query  36   LGSNVTAVNVNN  1
            +GSNVT +NV+ 
Sbjct  75   VGSNVTLLNVDQ  86



>ref|XP_007200157.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
 gb|EMJ01356.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
Length=226

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPL  34
            A+   +A+DP PLQD CVA+ D    +FVNGKFCK+P  ANA DF F GL  P NT NPL
Sbjct  17   ATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPL  76

Query  33   GSNVTAVNVNN  1
            GSNVTAVNV+N
Sbjct  77   GSNVTAVNVDN  87



>ref|XP_010683101.1| PREDICTED: germin-like protein subfamily 1 member 13 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + S  A AADP PLQD CVAI++P + LFVNGKFCKNP  A   DF FRGL+ PGNT+N 
Sbjct  15   ITSYVAYAADPSPLQDFCVAIDEPKNALFVNGKFCKNPMAAKVEDFRFRGLDIPGNTNNQ  74

Query  36   LGSNVTAVNVNN  1
            +GSNVT +  +N
Sbjct  75   VGSNVTRITPDN  86



>ref|XP_007201862.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
 gb|EMJ03061.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
Length=226

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPL  34
            A+   +A+DP PLQD CVA+ D    +FVNGKFCK+P  ANA DF F GL  P NT NPL
Sbjct  17   ATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPL  76

Query  33   GSNVTAVNVNN  1
            GSNVTAVNV+N
Sbjct  77   GSNVTAVNVDN  87



>ref|XP_007030273.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10775.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=224

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A+S A+A DP PLQD CVAI D  + +FVNGKFCK+P  A A DF + GLN PGNTSNP
Sbjct  16   FANSLASAFDPSPLQDFCVAINDTKNGVFVNGKFCKDPKLAVADDFFYSGLNMPGNTSNP  75

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  76   VGSNVTTVNVDQ  87



>ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + +S ++A+DP PLQD CVA+ D  + +FVNGKFCKNP D NA DF   GLN  GNTSN 
Sbjct  15   VVTSISHASDPSPLQDFCVAVNDSMNAVFVNGKFCKNPMDVNADDFFRPGLNLAGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNVNN
Sbjct  75   LGSAVTAVNVNN  86



>ref|XP_006371120.1| hypothetical protein POPTR_0019s04280g [Populus trichocarpa]
 ref|XP_002325371.2| hypothetical protein POPTR_0019s04290g [Populus trichocarpa]
 gb|ERP48917.1| hypothetical protein POPTR_0019s04280g [Populus trichocarpa]
 gb|EEE99752.2| hypothetical protein POPTR_0019s04290g [Populus trichocarpa]
Length=225

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A+DP PLQD CVAI DP   +FVNGKFCK+P  A A DF+F GLN P +T N 
Sbjct  15   LASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDPKLATANDFSFSGLNIPRDTGNR  74

Query  36   LGSNVTAVNVNN  1
            +GSNVT +NV+ 
Sbjct  75   VGSNVTLLNVDQ  86



>ref|XP_011012323.1| PREDICTED: germin-like protein subfamily 1 member 20 [Populus 
euphratica]
Length=392

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            +ASS A+A DP PLQD CVAI DP   +FVNGKFCK+P  A A DF+F GLN P +T NP
Sbjct  15   VASSIASAYDPSPLQDFCVAINDPKAAVFVNGKFCKDPKMATAHDFSFSGLNIPRDTGNP  74

Query  36   LGSNVTAVNVNN  1
            +GSNVT +NV+ 
Sbjct  75   VGSNVTLLNVDQ  86



>gb|EYU28622.1| hypothetical protein MIMGU_mgv1a018753mg [Erythranthe guttata]
Length=230

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++   A+DP PLQD CVA++D    +FVNGK CKNP+   A DF +RGLN+PGNTSNP+G
Sbjct  18   ATLGYASDPSPLQDFCVAVKDADAAVFVNGKICKNPDLVVAEDFIYRGLNKPGNTSNPIG  77

Query  30   SNVTAVNVNN  1
            S VT VNVN 
Sbjct  78   SRVTPVNVNQ  87



>ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            SS ++A+DP PLQD CVA++D    +FVNGKFCKNP D  A DF   GLN  GNTSN LG
Sbjct  17   SSMSHASDPSPLQDFCVAVDDSKSAVFVNGKFCKNPMDVTADDFFRPGLNMAGNTSNQLG  76

Query  30   SNVTAVNVNN  1
            S VTAVNVNN
Sbjct  77   SAVTAVNVNN  86



>ref|XP_006443311.1| hypothetical protein CICLE_v10022142mg [Citrus clementina]
 ref|XP_006479019.1| PREDICTED: germin-like protein subfamily 1 member 17-like isoform 
X1 [Citrus sinensis]
 ref|XP_006479021.1| PREDICTED: germin-like protein subfamily 1 member 17-like isoform 
X1 [Citrus sinensis]
 gb|ESR56551.1| hypothetical protein CICLE_v10022142mg [Citrus clementina]
 gb|KDO42112.1| hypothetical protein CISIN_1g027622mg [Citrus sinensis]
Length=221

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A A DF   GL++PGNT+N 
Sbjct  16   LASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLAKAQDFFLSGLDKPGNTANR  75

Query  36   LGSNVTAVNVNN  1
            LG +VT  NV  
Sbjct  76   LGFSVTNANVEQ  87



>ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            SS ++A+DP PLQD CVA++D    +FVNGKFCKNP D  A DF   GLN  GNTSN LG
Sbjct  17   SSMSHASDPSPLQDFCVAVDDSKSAVFVNGKFCKNPMDVTADDFFRPGLNMAGNTSNQLG  76

Query  30   SNVTAVNVNN  1
            S VTAVNVNN
Sbjct  77   SAVTAVNVNN  86



>gb|EYU38444.1| hypothetical protein MIMGU_mgv1a013102mg [Erythranthe guttata]
Length=230

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++   A+DP PLQD CVA++D    +FVNGK CKNP    A DF +RGLN+PGNTSNP+G
Sbjct  18   ATLGYASDPSPLQDFCVAVKDADAAVFVNGKICKNPELVVAEDFIYRGLNKPGNTSNPIG  77

Query  30   SNVTAVNVNN  1
            S VT VNVN 
Sbjct  78   SRVTPVNVNQ  87



>ref|XP_002284343.2| PREDICTED: uncharacterized protein LOC100256308 [Vitis vinifera]
Length=477

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+P    A DF F GL++PGNTSN 
Sbjct  16   LVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNA  75

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV  
Sbjct  76   VASNVTTVNVEQ  87


 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+P    A DF F GL++PGNTSN 
Sbjct  273  LVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFFSGLDKPGNTSNA  332

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV  
Sbjct  333  VASNVTTVNVEQ  344



>ref|XP_010659856.1| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
Length=222

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS   A DP PLQD CVAI +P + +FVNGKFCKN N   A DF F+GLN PGNT+N 
Sbjct  16   LASSLVAAFDPSPLQDTCVAIPEPKNAVFVNGKFCKNANLTVAEDFFFQGLNIPGNTANR  75

Query  36   LGSNVTAVNVN  4
            +GSNVT VNV+
Sbjct  76   VGSNVTTVNVD  86



>emb|CDP10698.1| unnamed protein product [Coffea canephora]
Length=223

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A A+DP PLQD CVAI D    +FVNGK CK+P   NA DF F+G N PGNT+NP
Sbjct  14   LLSSLAIASDPSPLQDFCVAINDSKAAVFVNGKICKDPKVVNANDFFFQGFNIPGNTNNP  73

Query  36   LGSNVTAVNVNN  1
            +GSNVT V VNN
Sbjct  74   VGSNVTRVLVNN  85



>ref|XP_010024921.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61460.1| hypothetical protein EUGRSUZ_H04196 [Eucalyptus grandis]
Length=223

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAI DP   +FVNG+FCK+P  ANA DFTF G  +PGNT+NPLGS VT   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  9    V  7
            V
Sbjct  82   V  82



>gb|EYU20549.1| hypothetical protein MIMGU_mgv1a020596mg [Erythranthe guttata]
Length=231

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++ A A+DP PLQD CVA++D    +FVNGK CKNPN   A DF F GLN+PGNTSNP+G
Sbjct  19   ATLAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNPNMVVAEDFFFPGLNKPGNTSNPVG  78

Query  30   SNVTAVNVNN  1
            S VT VNVN 
Sbjct  79   SRVTPVNVNQ  88



>ref|XP_010251871.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            S A A+DP PLQD CVAI+D    +FVNGKFCKNPN   A DF F GL++PGNTSNP+GS
Sbjct  16   SQALASDPSPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGS  75

Query  27   NVTAVNV  7
             VT VNV
Sbjct  76   KVTPVNV  82



>ref|XP_007200176.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
 gb|EMJ01375.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
Length=226

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A+  A+A DP PLQD CVA++D    +FVNGKFCK+P  ANA DF F GL  P NT NP
Sbjct  16   FATFLASAYDPSPLQDFCVAVKDIKSGVFVNGKFCKDPKLANANDFFFSGLQNPRNTKNP  75

Query  36   LGSNVTAVNVNN  1
            +GSNVTAVNV+N
Sbjct  76   VGSNVTAVNVDN  87



>ref|XP_010251869.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            S A A+DP PLQD CVAI+D    +FVNGKFCKNPN   A DF F GL++PGNTSNP+GS
Sbjct  16   SQALASDPSPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGS  75

Query  27   NVTAVNV  7
             VT VNV
Sbjct  76   KVTPVNV  82



>ref|XP_011099651.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=229

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            S FA+A+DP PLQD CVA+ D    +FVNGK CKNPN   A DF F GLN+PGNTSN +G
Sbjct  17   SPFAHASDPSPLQDFCVAVNDSVAAVFVNGKICKNPNMVVAEDFFFPGLNKPGNTSNQVG  76

Query  30   SNVTAVNVNN  1
            S VT VNVN 
Sbjct  77   SMVTPVNVNQ  86



>ref|XP_010251872.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            S A A+DP+PLQD CVAI+D    +FVNGKFCKNPN   A DF F GL++PGNTSNP+GS
Sbjct  16   SQALASDPNPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGS  75

Query  27   NVTAVNV  7
             VT VNV
Sbjct  76   KVTPVNV  82



>ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPL  34
             +S ++A+DP PLQD CVA+ D    +FVNGKFCK+P D  A DF   GLN PGNTSN L
Sbjct  16   VTSISHASDPSPLQDFCVAVNDSKSAVFVNGKFCKDPKDVTADDFFRPGLNVPGNTSNQL  75

Query  33   GSNVTAVNVNN  1
            GS VTAVNVNN
Sbjct  76   GSVVTAVNVNN  86



>ref|XP_006442438.1| hypothetical protein CICLE_v10024000mg [Citrus clementina]
 gb|ESR55678.1| hypothetical protein CICLE_v10024000mg [Citrus clementina]
Length=220

 Score = 89.4 bits (220),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N 
Sbjct  15   LASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARTGDFFLSGLDKPGNTANR  74

Query  36   LGSNVTAVNVNN  1
            LG +V   NV+ 
Sbjct  75   LGFSVKNANVDQ  86



>ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
 ref|XP_006349262.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score = 89.7 bits (221),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + +S ++A+DP PLQD CVA+ D  + +FVNGKFCKNP D  A DF   GLN  GNTSN 
Sbjct  15   VVTSISHASDPSPLQDFCVAVNDSMNAVFVNGKFCKNPMDVTADDFFRPGLNMAGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNVNN
Sbjct  75   LGSAVTAVNVNN  86



>ref|XP_002531992.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30391.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=223

 Score = 89.4 bits (220),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L+SSFA A DP PLQD CVA +DP   +FVNGK CK+P  A A DF+F GLN P +TSNP
Sbjct  15   LSSSFALAFDPSPLQDFCVATDDPKDAVFVNGKLCKDPKLATANDFSFSGLNVPRDTSNP  74

Query  36   LGSNVTAVN  10
            +GSNVT +N
Sbjct  75   VGSNVTLLN  83



>ref|XP_010027143.1| PREDICTED: uncharacterized protein LOC104417591 [Eucalyptus grandis]
Length=451

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAI DP   +FVNG+FCK+P  ANA DFTF G  +PGNT+NPLGS VT   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  9    VNN  1
            VN 
Sbjct  82   VNE  84


 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAI DP   +FVNG+FCK+P  ANA DFTF G  +PGNT+NPLGS VT   
Sbjct  250  DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  309

Query  9    VNN  1
            VN 
Sbjct  310  VNE  312



>emb|CAN73847.1| hypothetical protein VITISV_021638 [Vitis vinifera]
Length=224

 Score = 89.4 bits (220),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDP----YHVLFVNGKFCKNPNDANAGDFTFRGLNRPGN  49
            LASS A+A DP PLQD CVAI++P      + FVNGKFCKNPN   A DF ++GLN PGN
Sbjct  16   LASSLASAFDPRPLQDTCVAIDEPENAGISLYFVNGKFCKNPNLTVADDFLYQGLNIPGN  75

Query  48   TSNPLGSNVTAVNVN  4
            T+N +GSNVT +NV+
Sbjct  76   TANLVGSNVTIINVD  90



>ref|XP_006371122.1| Germin-like protein subfamily 1 member 6 precursor [Populus trichocarpa]
 gb|ERP48919.1| Germin-like protein subfamily 1 member 6 precursor [Populus trichocarpa]
Length=224

 Score = 89.4 bits (220),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQD CVAI DP   +FVNGKFC +P  A A DF+F GLN P NT N 
Sbjct  15   LASSIASAYDPSPLQDFCVAINDPKAAVFVNGKFCTDPKMATANDFSFSGLNIPRNTGNR  74

Query  36   LGSNVTAVNVNN  1
            +GSNVT +NV+ 
Sbjct  75   VGSNVTLLNVDQ  86



>ref|XP_006442440.1| hypothetical protein CICLE_v10023726mg [Citrus clementina]
 gb|ESR55680.1| hypothetical protein CICLE_v10023726mg [Citrus clementina]
Length=220

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N 
Sbjct  15   LASSLASACDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARPGDFFLSGLDKPGNTANR  74

Query  36   LGSNVTAVNVNN  1
            LG +V   NV+ 
Sbjct  75   LGFSVKNANVDQ  86



>ref|XP_007030281.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY10783.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
Length=226

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A S A+A+DPDPLQD CVAI D    +FVNGKFCK+P  A A DF + GLN P NTSNP
Sbjct  16   FAWSLASASDPDPLQDFCVAINDTKDGVFVNGKFCKDPKLAKAEDFFYSGLNIPRNTSNP  75

Query  36   LGSNVTAVNV  7
            +GS VT VNV
Sbjct  76   VGSTVTQVNV  85



>ref|XP_007030280.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY10782.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
Length=226

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A S A+A+DPDPLQD CVAI D    +FVNGKFCK+P  A A DF + GLN P NTSNP
Sbjct  16   FAWSLASASDPDPLQDFCVAINDTKDGVFVNGKFCKDPKLAKAEDFFYSGLNIPRNTSNP  75

Query  36   LGSNVTAVNV  7
            +GS VT VNV
Sbjct  76   VGSTVTQVNV  85



>ref|XP_007199217.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
 gb|EMJ00416.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
Length=226

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A+  A+A DP PLQD CVA++D    +FVNGKFCK+P  ANA DF F GL  P NT NP
Sbjct  16   FATFLASAYDPSPLQDFCVALKDIKDGVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNP  75

Query  36   LGSNVTAVNVNN  1
            +GSNVTAVNV+N
Sbjct  76   VGSNVTAVNVDN  87



>ref|XP_006443312.1| hypothetical protein CICLE_v10022118mg [Citrus clementina]
 ref|XP_006479023.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
 gb|ESR56552.1| hypothetical protein CICLE_v10022118mg [Citrus clementina]
Length=224

 Score = 89.0 bits (219),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPL  34
            ASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A   DF F GL++PG+T+N L
Sbjct  16   ASSLASAYDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLAKPEDFFFSGLDQPGDTANRL  75

Query  33   GSNVTAVNVNN  1
            G  VT VNV  
Sbjct  76   GFKVTTVNVEQ  86



>ref|NP_001237300.1| uncharacterized protein LOC100527781 precursor [Glycine max]
 gb|ACG69488.1| germin-like protein 12 [Glycine max]
 gb|ACU16953.1| unknown [Glycine max]
 gb|KHN04964.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=222

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A A DP PLQD CVAI D    +FVNGKFCK+P  A A DF F GL  PGNTSNP
Sbjct  13   LASSIAFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDPKLAKAEDFFFPGLG-PGNTSNP  71

Query  36   LGSNVTAVNVNN  1
            LGS VTAV VN 
Sbjct  72   LGSKVTAVTVNE  83



>ref|XP_006282503.1| hypothetical protein CARUB_v10006909mg [Capsella rubella]
 gb|EOA15401.1| hypothetical protein CARUB_v10006909mg [Capsella rubella]
Length=221

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI+DP + +FVNGKFCK+P  A A DF F GLN+ G T+N 
Sbjct  14   LVISFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFFSGLNQAGYTNNA  73

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  74   VKSNVTTVNVDQ  85



>gb|KDO42113.1| hypothetical protein CISIN_1g027369mg [Citrus sinensis]
Length=224

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPL  34
            ASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A   DF F GL++PG+T+N L
Sbjct  16   ASSLASAYDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLAKPEDFFFSGLDQPGDTANRL  75

Query  33   GSNVTAVNVNN  1
            G  VT VNV  
Sbjct  76   GFKVTTVNVEQ  86



>gb|EYU40208.1| hypothetical protein MIMGU_mgv1a020439mg [Erythranthe guttata]
Length=230

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            +SFA A+DP PLQD CVA++D    +FVNGK CK+PN   A DF   GLN+PGNTSNP+G
Sbjct  18   ASFAYASDPSPLQDFCVAVKDADAAVFVNGKICKDPNMVVAEDFFLSGLNKPGNTSNPVG  77

Query  30   SNVTAVNVNN  1
            S VT  NVN 
Sbjct  78   SRVTPANVNQ  87



>ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 member 14 [Solanum 
lycopersicum]
Length=228

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            S ++A+DP PLQD CVA+ D  + +FVNGKFCKNP D NA DF   GLN  GNTSN LGS
Sbjct  18   SLSHASDPSPLQDFCVAVNDSKNAVFVNGKFCKNPLDVNADDFFRPGLNLAGNTSNQLGS  77

Query  27   NVTAVNVNN  1
             VTAVNVNN
Sbjct  78   AVTAVNVNN  86



>ref|XP_010435818.1| PREDICTED: germin-like protein subfamily 1 member 13 [Camelina 
sativa]
Length=222

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI+DP + +FVNGKFCK+P  A   DF F GLN+ GNT N 
Sbjct  15   LVISFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKPEDFFFSGLNKAGNTDND  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VKSNVTTVNVDQ  86



>emb|CDY11695.1| BnaC06g13030D [Brassica napus]
Length=219

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            SFA A DP PLQD CVAI+DP + +FVNGKFCK+P  A A DF + GLN+ GNT+N + S
Sbjct  15   SFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFYSGLNKAGNTNNDVKS  74

Query  27   NVTAVNVNN  1
            NVT VNV+ 
Sbjct  75   NVTTVNVDK  83



>emb|CDY69099.1| BnaA07g37570D [Brassica napus]
Length=219

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            SFA A DP PLQD CVAI+DP + +FVNGKFCK+P  A A DF + GLN+ GNT N + S
Sbjct  15   SFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQARAEDFFYSGLNKAGNTDNDVKS  74

Query  27   NVTAVNVNN  1
            NVT VNV+ 
Sbjct  75   NVTTVNVDQ  83



>emb|CAN80133.1| hypothetical protein VITISV_012032 [Vitis vinifera]
Length=220

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA S A A DP+PLQD CVAI+DP   +FVNGKFCK+P  A   DF F GL+ P NTSNP
Sbjct  16   LAFSLAYAYDPNPLQDTCVAIDDPKAAVFVNGKFCKDPKLATPEDFFFSGLHIPRNTSNP  75

Query  36   LGSNVTAVNV  7
            +GS VT VNV
Sbjct  76   VGSTVTPVNV  85



>ref|XP_006442444.1| hypothetical protein CICLE_v10023384mg [Citrus clementina]
 gb|ESR55684.1| hypothetical protein CICLE_v10023384mg [Citrus clementina]
Length=220

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N 
Sbjct  15   LASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARPGDFFLSGLDKPGNTANR  74

Query  36   LGSNVTAVNVNN  1
            LG +V   NV+ 
Sbjct  75   LGFSVKNANVDQ  86



>emb|CBI39477.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA S A A DP PLQD CVAI+DP   +FVNGKFCK+P  A   DF F GL+ P NTSNP
Sbjct  16   LAFSLAYAYDPSPLQDTCVAIDDPKAAVFVNGKFCKDPKLATPEDFFFSGLHIPRNTSNP  75

Query  36   LGSNVTAVNV  7
            +GS VT VNV
Sbjct  76   VGSTVTPVNV  85



>ref|XP_006442442.1| hypothetical protein CICLE_v10022152mg [Citrus clementina]
 gb|ESR55682.1| hypothetical protein CICLE_v10022152mg [Citrus clementina]
Length=220

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N 
Sbjct  15   LASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARPGDFFLSGLDKPGNTANR  74

Query  36   LGSNVTAVNVNN  1
            LG +V   NV+ 
Sbjct  75   LGFSVKNANVDQ  86



>ref|XP_006442447.1| hypothetical protein CICLE_v10024005mg [Citrus clementina]
 gb|ESR55687.1| hypothetical protein CICLE_v10024005mg [Citrus clementina]
Length=220

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N 
Sbjct  15   LASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARPGDFFLSGLDKPGNTANR  74

Query  36   LGSNVTAVNVNN  1
            LG +V   NV+ 
Sbjct  75   LGFSVKNANVDQ  86



>ref|XP_010251870.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Nelumbo 
nucifera]
Length=222

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            S A A+DP PLQD CVAI D    +FVNGKFCKNPN   A DF F GL++PGNTSNP+GS
Sbjct  16   SQALASDPSPLQDFCVAINDTESPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGS  75

Query  27   NVTAVNV  7
             VT VNV
Sbjct  76   KVTPVNV  82



>ref|XP_006477875.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
 ref|XP_006477880.1| PREDICTED: germin-like protein subfamily 1 member 17-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477882.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
Length=220

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N 
Sbjct  15   LASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARPGDFFLSGLDKPGNTANR  74

Query  36   LGSNVTAVNVNN  1
            LG +V   NV  
Sbjct  75   LGFSVKNANVEQ  86



>emb|CBI36810.3| unnamed protein product [Vitis vinifera]
Length=305

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+P    A DF   GL++PGNTSN 
Sbjct  16   LVSSLASASDPGPLQDTCVAIDEPNDAVFVNGKFCKDPKLTMAEDFFSPGLDKPGNTSNQ  75

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  76   VGSNVTTVNVDK  87


 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKF  115
            L SS A+A+DP PLQD CV I++P   +FVNGKF
Sbjct  272  LVSSLASASDPSPLQDTCVVIDEPKDAVFVNGKF  305



>ref|XP_006442436.1| hypothetical protein CICLE_v10024280mg [Citrus clementina]
 gb|ESR55676.1| hypothetical protein CICLE_v10024280mg [Citrus clementina]
Length=220

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N 
Sbjct  15   LASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARPGDFFLSGLDKPGNTANR  74

Query  36   LGSNVTAVNVNN  1
            LG +V   NV+ 
Sbjct  75   LGFSVKNANVDQ  86



>ref|XP_009612543.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS ++A DP PLQDICVA++D    +FVNGK CK+P    A DF   GLN PGNTSN 
Sbjct  15   LLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNV N
Sbjct  75   LGSTVTAVNVGN  86



>ref|XP_006477879.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
Length=220

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N 
Sbjct  15   LASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARPGDFFLSGLDKPGNTANR  74

Query  36   LGSNVTAVNVNN  1
            LG +V   NV  
Sbjct  75   LGFSVKNANVEQ  86



>ref|XP_006477883.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
 ref|XP_006477885.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
Length=220

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N 
Sbjct  15   LASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARPGDFFLSGLDKPGNTANR  74

Query  36   LGSNVTAVNVNN  1
            LG +V   NV  
Sbjct  75   LGFSVKNANVEQ  86



>ref|XP_006477877.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
Length=220

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N 
Sbjct  15   LASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARPGDFFLSGLDKPGNTANR  74

Query  36   LGSNVTAVNVNN  1
            LG +V   NV  
Sbjct  75   LGFSVKNANVEQ  86



>emb|CDY15957.1| BnaA04g11540D [Brassica napus]
Length=223

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI+D  + +FVNG+FCK+P   NA DF F GLN PGNTSN 
Sbjct  17   LVISFAEAYDPSPLQDFCVAIDD-LNGVFVNGRFCKDPMRVNAEDFFFSGLNVPGNTSNQ  75

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  76   VGSNVTTVNVDQ  87



>ref|XP_002868738.1| hypothetical protein ARALYDRAFT_494073 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44997.1| hypothetical protein ARALYDRAFT_494073 [Arabidopsis lyrata subsp. 
lyrata]
Length=222

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFANA DP PLQD CVAI+D   V FVNG+FCK+P   +A DF F GLN PGNT N 
Sbjct  15   LVISFANAYDPSPLQDFCVAIDDLKGV-FVNGRFCKDPKRVDAKDFFFSGLNVPGNTDNQ  73

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  74   VGSNVTIVNVDQ  85



>ref|XP_009129904.1| PREDICTED: germin-like protein subfamily 1 member 16 [Brassica 
rapa]
 emb|CDY05545.1| BnaA02g31460D [Brassica napus]
Length=223

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI+D  + +FVNG+FCK+P   NA DF F GLN PGNTSN 
Sbjct  17   LVISFAEAYDPSPLQDFCVAIDD-LNGVFVNGRFCKDPMRVNAEDFFFSGLNVPGNTSNQ  75

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  76   VGSNVTTVNVDQ  87



>emb|CDX99669.1| BnaC04g34260D [Brassica napus]
Length=223

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI+D  + +FVNG+FCK+P   NA DF F GLN PGNTSN 
Sbjct  17   LVISFAEAYDPSPLQDFCVAIDD-LNGVFVNGRFCKDPMRVNAEDFFFSGLNVPGNTSNQ  75

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  76   VGSNVTTVNVDQ  87



>ref|XP_006358462.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS + A+DP PLQD CVA+ D    +FVNGK CK+P    A DF   GLN+PGNTSN 
Sbjct  17   LASSPSTASDPSPLQDFCVAVNDSKTTVFVNGKVCKDPKLVTADDFFRSGLNKPGNTSNQ  76

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNVNN
Sbjct  77   LGSIVTAVNVNN  88



>ref|XP_010042132.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAI DP   +FVNG+FCK+P  A A DFTF G   PGNT+NPLGS VT   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPAT  81

Query  9    VNN  1
            VN 
Sbjct  82   VNE  84



>ref|XP_009784933.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
sylvestris]
Length=228

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS ++A DP PLQDICVA++D    +FVNGK CK+P    A DF   GLN PGNTSN 
Sbjct  15   LLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNV N
Sbjct  75   LGSAVTAVNVGN  86



>ref|XP_009627660.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS ++A DP PLQDICVA++D    +FVNGK CK+P    A DF   GLN PGNTSN 
Sbjct  15   LLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNV N
Sbjct  75   LGSAVTAVNVGN  86



>ref|XP_003590904.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES61155.1| germin family protein [Medicago truncatula]
 gb|AFK44678.1| unknown [Medicago truncatula]
Length=222

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS   A DP PLQD CVAI D    +FVNGKFCK+P  ANA DF F+GL  PGNTSNP
Sbjct  13   LASSVGFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDPKLANADDFFFQGLG-PGNTSNP  71

Query  36   LGSNVTAVNVNN  1
            LGS VT V VN 
Sbjct  72   LGSKVTPVTVNE  83



>ref|XP_010052624.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW76696.1| hypothetical protein EUGRSUZ_D01056 [Eucalyptus grandis]
Length=223

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAI DP   +FVNG+FCK+P  A A DFTF G   PGNT+NPLGS VT   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPAT  81

Query  9    VNN  1
            VN 
Sbjct  82   VNE  84



>ref|XP_007200183.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
 gb|EMJ01382.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
Length=226

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPL  34
            A+   +A+DP PLQD CVA+ D    +FVNGKFCK+P   NA DF F GL  P NT NP+
Sbjct  17   ATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLVNANDFFFSGLQNPRNTQNPV  76

Query  33   GSNVTAVNVNN  1
            GSNVTAVNV+N
Sbjct  77   GSNVTAVNVDN  87



>ref|XP_010048221.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW80406.1| hypothetical protein EUGRSUZ_C01763 [Eucalyptus grandis]
Length=223

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAI DP   +FVNG+FCK+P  A A DFTF G   PGNT+NPLGS VT   
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPAT  81

Query  9    VNN  1
            VN 
Sbjct  82   VNE  84



>ref|XP_007030289.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10791.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=221

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA S A+A+DP  LQD CVA+ D  H +FVNGKFCK+P  A A DF F GL++ GNTSN 
Sbjct  16   LAFSLASASDPSSLQDFCVALNDTKHAIFVNGKFCKDPKLATADDFFFSGLDKAGNTSNA  75

Query  36   LGSNVTAVNVNN  1
            +GS VT VNV+ 
Sbjct  76   VGSRVTPVNVDQ  87



>ref|XP_009795503.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009795504.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X2 [Nicotiana sylvestris]
Length=228

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS ++A DP PLQDICVA++D    +FVNGK CK+P    A DF   GLN PGNTSN 
Sbjct  15   LLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNV N
Sbjct  75   LGSVVTAVNVGN  86



>ref|XP_002868743.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45002.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A+DP PLQD CVAI D  + +FVNGKFCK+P  A A DF F GLN+ GNT+N 
Sbjct  15   LVISFAEASDPSPLQDFCVAIGDLKNGVFVNGKFCKDPKQAKAEDFFFAGLNKAGNTTNR  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VKSNVTTVNVDQ  86



>ref|XP_010450837.1| PREDICTED: germin-like protein subfamily 1 member 13 [Camelina 
sativa]
Length=222

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI+DP + +FVNGKFCK+P  A   DF F GLN  GNT N 
Sbjct  15   LVISFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKPEDFFFSGLNEAGNTVND  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VKSNVTTVNVDQ  86



>emb|CBI36789.3| unnamed protein product [Vitis vinifera]
Length=131

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI++P + +FVNGKFCKNPN   A DF ++GLN PGNT+N +GSNVT VN
Sbjct  12   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFYQGLNIPGNTTNRVGSNVTTVN  71

Query  9    VN  4
            V+
Sbjct  72   VD  73



>emb|CBI36814.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A+A+DP PLQD CVAI++P   +FVNGKFCK+P    A DF   GL++PGNTSN 
Sbjct  16   LVSSLASASDPGPLQDTCVAIDEPSDAVFVNGKFCKDPKLTMAEDFFSSGLDKPGNTSNQ  75

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  76   VRSNVTTVNVDK  87



>emb|CBI36785.3| unnamed protein product [Vitis vinifera]
Length=189

 Score = 87.0 bits (214),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI++P + +FVNGKFCKNPN   A DF ++GLN PGNT+N +GSNVT VN
Sbjct  86   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFYQGLNIPGNTTNRVGSNVTTVN  145

Query  9    VN  4
            V+
Sbjct  146  VD  147



>ref|XP_006358464.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS + A+DP PLQD CVA+ D    +FVNGK CK P    A DF   GLN+PGNTSN 
Sbjct  17   LASSPSTASDPSPLQDFCVAVNDSKTTVFVNGKVCKYPKLVTADDFFRSGLNKPGNTSNQ  76

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNVNN
Sbjct  77   LGSIVTAVNVNN  88



>ref|XP_010251867.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI+D  + +FVNGKFCKNPN   A DF F GL++PGNTSNP+GS VT VN
Sbjct  22   DPSPLQDFCVAIKDTDYPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVN  81

Query  9    V  7
            V
Sbjct  82   V  82



>ref|NP_198732.2| germin-like protein subfamily 1 member 18 [Arabidopsis thaliana]
 sp|P92999.2|GL118_ARATH RecName: Full=Germin-like protein subfamily 1 member 18; AltName: 
Full=GLP2a copy 1; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09370.1| oxalate oxidase (germin protein)-like protein [Arabidopsis thaliana]
 gb|AAM98218.1| germin-like protein GLP2a copy1 [Arabidopsis thaliana]
 gb|AAN72181.1| germin-like protein GLP2a copy1 [Arabidopsis thaliana]
 gb|AED94400.1| germin-like protein subfamily 1 member 18 [Arabidopsis thaliana]
Length=222

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SF NA DP PLQD CVAI+D   V FVNG+FCK+P   +A DF F GLN PGNT+N 
Sbjct  15   LVLSFVNAYDPSPLQDFCVAIDDLKGV-FVNGRFCKDPKRVDAKDFFFSGLNMPGNTNNQ  73

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  74   VGSNVTTVNVDQ  85



>ref|XP_002868798.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45057.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI D  + +FVNGKFCK+P  A A DF F+GLN+ GNT+N 
Sbjct  15   LVISFAEANDPSPLQDFCVAIGDLKNGVFVNGKFCKDPKQAKAEDFFFQGLNKAGNTTNR  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VKSNVTTVNVDQ  86



>ref|XP_009125150.1| PREDICTED: germin-like protein subfamily 1 member 13 [Brassica 
rapa]
Length=219

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            SFA A DP PLQD CVAI+DP + +FVNGKFCK+P  A A DF + GLN+ G T+N + S
Sbjct  15   SFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFYSGLNKAGKTNNDVKS  74

Query  27   NVTAVNVNN  1
            NVT VNV+ 
Sbjct  75   NVTTVNVDQ  83



>ref|XP_011034445.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
 ref|XP_011038441.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASSFA+A DP PLQD CVA+++   V FVNGKFCK+P D  A DF   GLN PG+TS  
Sbjct  15   LASSFASAFDPSPLQDFCVAVDETDGV-FVNGKFCKDPKDVTAKDFFSSGLNIPGDTSGR  73

Query  36   LGSNVTAVNVNN  1
            +GSNVTAVNV  
Sbjct  74   VGSNVTAVNVEK  85



>gb|KCW61441.1| hypothetical protein EUGRSUZ_H04171 [Eucalyptus grandis]
Length=217

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 6/69 (9%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPY------HVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            DP PLQDICVAI DP       + +FVNG+FCK+P  ANA DFTF G  +PGNT+NPLGS
Sbjct  22   DPSPLQDICVAINDPKSAVLFSYAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGS  81

Query  27   NVTAVNVNN  1
             VT   VN 
Sbjct  82   KVTPATVNE  90



>ref|XP_011038440.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASSFA+A DP PLQD CVA+++   V FVNGKFCK+P D  A DF   GLN PG+TS  
Sbjct  15   LASSFASAFDPSPLQDFCVAVDETDGV-FVNGKFCKDPKDVTAKDFFSSGLNIPGDTSGR  73

Query  36   LGSNVTAVNVNN  1
            +GSNVTAVNV  
Sbjct  74   VGSNVTAVNVEK  85



>ref|XP_007030284.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10786.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=226

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A S A+A+DP PLQD CVAI D    +FVNGKFC++P  A A DF + GLN P NTSNP
Sbjct  16   FAWSLASASDPSPLQDFCVAINDTKDGVFVNGKFCQDPKLAKAEDFFYSGLNIPRNTSNP  75

Query  36   LGSNVTAVNV  7
            LGS VT VNV
Sbjct  76   LGSTVTQVNV  85



>ref|XP_002284682.1| PREDICTED: germin-like protein subfamily 1 member 15 [Vitis vinifera]
Length=220

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LAS  A+A DP PL+D CVA+++P + +FVNGKFCKNPN   A DF ++GLN PGNTSN 
Sbjct  16   LASFLASAYDPSPLEDTCVAVDEPKNAVFVNGKFCKNPNLTVAEDFLYQGLNIPGNTSNY  75

Query  36   LGSNVTAVNVNN  1
            +GS V  +NV+ 
Sbjct  76   VGSIVNLINVDQ  87



>emb|CBI36782.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LAS  A+A DP PL+D CVA+++P + +FVNGKFCKNPN   A DF ++GLN PGNTSN 
Sbjct  9    LASFLASAYDPSPLEDTCVAVDEPKNAVFVNGKFCKNPNLTVAEDFLYQGLNIPGNTSNY  68

Query  36   LGSNVTAVNVNN  1
            +GS V  +NV+ 
Sbjct  69   VGSIVNLINVDQ  80



>gb|EYU20542.1| hypothetical protein MIMGU_mgv1a020630mg [Erythranthe guttata]
Length=231

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++FA A+DP PLQD CVA++D    +FVNGK CKNP+   A DF F GLN+PGNTSN +G
Sbjct  19   ATFAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNPDMVVAEDFFFPGLNKPGNTSNLVG  78

Query  30   SNVTAVNVNN  1
            S VT VNVN 
Sbjct  79   SRVTPVNVNQ  88



>gb|EYU20548.1| hypothetical protein MIMGU_mgv1a013109mg [Erythranthe guttata]
Length=230

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++ A A+DP PLQD CVA++D    +FVNGK CKNPN   A DF   GLN+PGNTSNP+G
Sbjct  18   ATLAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNPNMVVAEDFFLSGLNKPGNTSNPVG  77

Query  30   SNVTAVNVNN  1
            S VT  NVN 
Sbjct  78   SRVTPANVNQ  87



>emb|CDP10693.1| unnamed protein product [Coffea canephora]
Length=219

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 55/78 (71%), Gaps = 6/78 (8%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDP------YHVLFVNGKFCKNPNDANAGDFTFRGLNRP  55
            L SS A A+DP PLQD CVAI DP      ++ +FVNGK CK+P   NA DF F+GLN P
Sbjct  3    LLSSLAIASDPSPLQDFCVAINDPKTAASFFNAVFVNGKICKDPKVVNANDFFFQGLNIP  62

Query  54   GNTSNPLGSNVTAVNVNN  1
             +T+N  GSNVTAVNVNN
Sbjct  63   RSTANRQGSNVTAVNVNN  80



>ref|NP_198735.1| germin-like protein 2a [Arabidopsis thaliana]
 sp|P92996.1|GL120_ARATH RecName: Full=Germin-like protein subfamily 1 member 20; AltName: 
Full=GLP2a copy 2; AltName: Full=GLP2b; AltName: Full=Germin 
type 2; Short=At-GERM2; Short=AtGER2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAB51570.1| germin-like protein [Arabidopsis thaliana]
 dbj|BAB09373.1| germin-like protein [Arabidopsis thaliana]
 gb|AAO42026.1| putative germin-like protein (GLP2a) copy2 [Arabidopsis thaliana]
 gb|AAO50602.1| putative germin-like protein (GLP2a) copy2 [Arabidopsis thaliana]
 gb|AED94405.1| germin-like protein 2a [Arabidopsis thaliana]
Length=222

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SF NA DP PLQD CVAI+D   V FVNG+FCK+P   +A DF F GLN PGNT+N 
Sbjct  15   LVLSFVNAYDPSPLQDFCVAIDDLKGV-FVNGRFCKDPKRVDAKDFFFSGLNVPGNTNNQ  73

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  74   VGSNVTTVNVDQ  85



>ref|XP_010672478.1| PREDICTED: germin-like protein subfamily 1 member 17 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L S  A A DP+ LQD CVAI++P + LFVNG+FCKNP      DF F+GL+RPGNT N 
Sbjct  15   LTSYLAYATDPNQLQDFCVAIDEPNNALFVNGRFCKNPMAVKVEDFHFQGLDRPGNTQNQ  74

Query  36   LGSNVTAVNVNN  1
            +GS+VT V  +N
Sbjct  75   VGSSVTRVTTDN  86



>emb|CDP22064.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +  +A+DP PLQD CVA+ D    +FVNGK CK+P    A DF F GL  PG+TSNP
Sbjct  14   LVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVEAKDFFFPGLKEPGSTSNP  73

Query  36   LGSNVTAVNVNN  1
            LGSNVTAVNVN 
Sbjct  74   LGSNVTAVNVNQ  85



>ref|NP_198729.1| germin-like protein subfamily 1 member 16 [Arabidopsis thaliana]
 sp|Q9FIC8.1|GL116_ARATH RecName: Full=Germin-like protein subfamily 1 member 16; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10834.1| germin-like protein [Arabidopsis thaliana]
 gb|AAL32875.1| germin-like protein [Arabidopsis thaliana]
 gb|AAO29972.1| germin-like protein [Arabidopsis thaliana]
 gb|AED94397.1| germin-like protein subfamily 1 member 16 [Arabidopsis thaliana]
Length=222

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SF NA DP PLQD CVAI+D   V FVNG+FCK+P   +A DF F GLN PGNT+N 
Sbjct  15   LVLSFVNAYDPSPLQDFCVAIDDLKGV-FVNGRFCKDPERVDAKDFFFSGLNVPGNTNNQ  73

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  74   VGSNVTTVNVDQ  85



>emb|CBI36778.3| unnamed protein product [Vitis vinifera]
Length=1271

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -1

Query  216   LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             LAS  A+A DP PL+D CVA+++P + +FVNGKFCKNPN   A DF ++GLN PGNTSN 
Sbjct  1067  LASFLASAYDPSPLEDTCVAVDEPKNAVFVNGKFCKNPNLTVAEDFLYQGLNIPGNTSNY  1126

Query  36    LGSNVTAVNVN  4
             +GS V  +NV+
Sbjct  1127  VGSIVNLINVD  1137



>ref|XP_008443754.1| PREDICTED: germin-like protein subfamily 1 member 17 [Cucumis 
melo]
Length=223

 Score = 86.7 bits (213),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -1

Query  201  ANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNV  22
            A+A DP PLQD CVA+++P   +FVNGKFCKNP    A DF FRGLN  GNT N  GSNV
Sbjct  23   ASAFDPSPLQDFCVAVDEPKSAVFVNGKFCKNPKFVRAEDFLFRGLNIAGNTMNKQGSNV  82

Query  21   TAVNVNN  1
            T VNV+ 
Sbjct  83   TLVNVDR  89



>emb|CAN71139.1| hypothetical protein VITISV_005470 [Vitis vinifera]
Length=145

 Score = 85.1 bits (209),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI+ P + +FVNGKFCKNPN   A DF ++GLN PGNT+N +GSNVT VN
Sbjct  25   DPSPLQDTCVAIDAPKNAVFVNGKFCKNPNLTVAEDFFYQGLNIPGNTTNRVGSNVTTVN  84

Query  9    VN  4
            V+
Sbjct  85   VD  86



>ref|XP_010024912.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=229

 Score = 86.7 bits (213),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 6/69 (9%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPY------HVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            DP PLQDICVAI DP       + +FVNG+FCK+P  ANA DFTF G  +PGNT+NPLGS
Sbjct  22   DPSPLQDICVAINDPKSAVLFSYAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGS  81

Query  27   NVTAVNVNN  1
             VT   VN 
Sbjct  82   KVTPATVNE  90



>gb|KDP23768.1| hypothetical protein JCGZ_23601 [Jatropha curcas]
Length=229

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            S F +A DP PLQD CVAI++P + +FVNGKFCK+PN   A DF+F GLN P NT N +G
Sbjct  24   SPFVSAYDPSPLQDFCVAIDEPKNAVFVNGKFCKDPNLVVADDFSFSGLNTPRNTGNKVG  83

Query  30   SNVTAVNVN  4
            SNVT +NV+
Sbjct  84   SNVTLLNVD  92



>ref|XP_010441036.1| PREDICTED: germin-like protein subfamily 1 member 13 [Camelina 
sativa]
Length=222

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SF  A DP PLQD CVAI+DP + +FVNGKFCK+P  A   DF F GLN  GNT N 
Sbjct  15   LVISFVKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKPEDFFFSGLNEAGNTDND  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VKSNVTTVNVDQ  86



>ref|XP_008237524.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X2 [Prunus mume]
Length=228

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIEDPY--HVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSN  40
            A+   +A+DP PLQD CVA+ D      +FVNGKFCK+P  ANA DF F GL  P NT N
Sbjct  17   ATFLVSASDPSPLQDFCVALNDTKSAEAVFVNGKFCKDPKLANANDFFFSGLQNPRNTQN  76

Query  39   PLGSNVTAVNVNN  1
            PLGSNVTAVNV+N
Sbjct  77   PLGSNVTAVNVDN  89



>gb|KDP23764.1| hypothetical protein JCGZ_23597 [Jatropha curcas]
Length=229

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            S F +A DP PLQD CVAI++P + +FVNGKFCK+PN   A DF+F GLN P NT N +G
Sbjct  24   SPFVSAYDPSPLQDFCVAIDEPKNAVFVNGKFCKDPNLVVADDFSFSGLNTPRNTGNKVG  83

Query  30   SNVTAVNVN  4
            SNVT +NV+
Sbjct  84   SNVTLLNVD  92



>ref|XP_008243694.1| PREDICTED: germin-like protein 9-1 [Prunus mume]
Length=456

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A+  A+A DP PLQD CVA++D    +FVNGKFCK+P  ANA DF F GL  P NT NP
Sbjct  16   FATFLASADDPSPLQDFCVALKDIKDGVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNP  75

Query  36   LGSNVTAVNVNN  1
            +GSNVTAVNV+N
Sbjct  76   VGSNVTAVNVDN  87


 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  FANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSN  25
             A+A DP PLQD CVAI+D    +FVNGKFCK+P  ANA DF F GL  P NT NP+GSN
Sbjct  250  LASAYDPSPLQDFCVAIKDIKDGVFVNGKFCKDPKLANANDFFFSGLQNPRNTQNPVGSN  309

Query  24   VTAVNVNN  1
            VTAVNV+N
Sbjct  310  VTAVNVDN  317



>ref|XP_008237526.1| PREDICTED: germin-like protein subfamily 1 member 11 [Prunus 
mume]
Length=228

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIEDPY--HVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSN  40
            A+   +A+DP PLQD CVA+ D      +FVNGKFCK+P  ANA DF F GL  P NT N
Sbjct  17   ATFLVSASDPSPLQDFCVALNDTKSAEAVFVNGKFCKDPKLANANDFFFSGLQNPRNTQN  76

Query  39   PLGSNVTAVNVNN  1
            PLGSNVTAVNV+N
Sbjct  77   PLGSNVTAVNVDN  89



>emb|CDP16787.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +  +A+DP PLQD CVA+ D    +FVNGK CK+P    A DF F GLN PG+TSNP
Sbjct  14   LVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVEAEDFFFPGLNEPGSTSNP  73

Query  36   LGSNVTAVNVNN  1
            LGSNVT VNVN 
Sbjct  74   LGSNVTTVNVNQ  85



>ref|XP_008237522.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X1 [Prunus mume]
Length=229

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIED---PYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTS  43
            A+   +A+DP PLQD CVA+ D       +FVNGKFCK+P  ANA DF F GL  P NT 
Sbjct  17   ATFLVSASDPSPLQDFCVALNDTKSAVEAVFVNGKFCKDPKLANANDFFFSGLQNPRNTQ  76

Query  42   NPLGSNVTAVNVNN  1
            NPLGSNVTAVNV+N
Sbjct  77   NPLGSNVTAVNVDN  90



>gb|KDO36579.1| hypothetical protein CISIN_1g048097mg [Citrus sinensis]
Length=224

 Score = 86.3 bits (212),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A+A DP PLQDICVAI D    +FVNGKFCK+P  A A DF   GL++PGNT N 
Sbjct  15   LASSLASAYDPSPLQDICVAIIDHKDGVFVNGKFCKDPKLAKAEDFFLSGLDKPGNTENR  74

Query  36   LGSNVTAVNVNN  1
            LG NVT  NV  
Sbjct  75   LGFNVTNANVEQ  86



>ref|XP_010241946.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=223

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYH-VLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            S A A+DP PLQD CVAI+D     +FVNGKFCKNPN   A DF F GL++PGNTSNP+G
Sbjct  16   SQALASDPSPLQDFCVAIKDTESPAVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVG  75

Query  30   SNVTAVNV  7
            S VT VNV
Sbjct  76   SKVTPVNV  83



>sp|P92997.2|GL113_ARATH RecName: Full=Germin-like protein subfamily 1 member 13; Flags: 
Precursor [Arabidopsis thaliana]
Length=222

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI+D  + +FVNGKFCK+P  A A DF F GLN+ G+T+N 
Sbjct  15   LVISFAEAYDPSPLQDFCVAIDDLKNGVFVNGKFCKDPKQAKAEDFFFSGLNQAGSTNNK  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VRSNVTTVNVDQ  86



>gb|AAB51572.1| germin-like protein [Arabidopsis thaliana]
Length=222

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI+D  + +FVNGKFCK+P  A A DF F GLN+ G+T+N 
Sbjct  15   LVISFAEAYDPSPLQDFCVAIDDLKNGVFVNGKFCKDPKQAKAEDFFFSGLNQAGSTNNK  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VRSNVTTVNVDQ  86



>ref|XP_002284624.1| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
 emb|CBI36787.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI +P + +FVNGKFCKNPN   A DF F+GLN PGNT+N +GSNVT VN
Sbjct  25   DPSPLQDTCVAIPEPENAVFVNGKFCKNPNLTVAEDFFFQGLNIPGNTANRVGSNVTTVN  84

Query  9    VN  4
            V+
Sbjct  85   VD  86



>emb|CAN71348.1| hypothetical protein VITISV_024253 [Vitis vinifera]
Length=220

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LAS  A+A DP PL+D CVA+++P + +FVNGKFCKNPN   A DF ++GLN PGNTSN 
Sbjct  16   LASFLASAYDPSPLEDTCVAVDEPNNAVFVNGKFCKNPNLTVAEDFLYQGLNIPGNTSNY  75

Query  36   LGSNVTAVNVNN  1
            +GS V  +NV+ 
Sbjct  76   VGSIVNLINVDQ  87



>ref|XP_006405658.1| hypothetical protein EUTSA_v10027918mg [Eutrema salsugineum]
 gb|ESQ47111.1| hypothetical protein EUTSA_v10027918mg [Eutrema salsugineum]
Length=221

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L +SFA+A DP PLQD CVAI+D  + +FVNG+FCK+P    A DF F GLN PGNT N 
Sbjct  15   LVTSFADAYDPSPLQDFCVAIDD-LNGVFVNGRFCKDPRRVVAKDFFFSGLNVPGNTDNQ  73

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  74   VGSNVTTVNVDQ  85



>ref|NP_001267944.1| germin-like protein 7 precursor [Vitis vinifera]
 gb|ABL60876.1| germin-like protein 7 [Vitis vinifera]
Length=220

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LAS  A+A DP PL+D CVA+++P + +FVNGKFCKNPN   A DF ++GLN PGNTSN 
Sbjct  16   LASFLASAYDPSPLEDTCVAVDEPNNAVFVNGKFCKNPNLTVAEDFLYQGLNIPGNTSNY  75

Query  36   LGSNVTAVNVNN  1
            +GS V  +NV+ 
Sbjct  76   VGSIVNLINVDQ  87



>emb|CDP16790.1| unnamed protein product [Coffea canephora]
Length=232

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +  +A+DP PLQD CVA+ D    +FVNGK C++P      DF F+GLN+PG+TSNP
Sbjct  16   LVFTSVHASDPSPLQDFCVAVPDANAGVFVNGKICQDPKLVKPEDFFFQGLNKPGSTSNP  75

Query  36   LGSNVTAVNVNN  1
            LGSNVTAVNVN 
Sbjct  76   LGSNVTAVNVNQ  87



>ref|XP_009786127.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=229

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + SS ++A+DP PLQD CVA+ D    +FVNGK CK+P   NA DF   GLN PGNTSN 
Sbjct  15   IVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            +GS VTAVNV N
Sbjct  75   VGSAVTAVNVGN  86



>ref|XP_007030176.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10678.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=295

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 49/79 (62%), Gaps = 7/79 (9%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDP-------YHVLFVNGKFCKNPNDANAGDFTFRGLNR  58
            LA SFA A+DP PLQD CVA+ D         + LFVNGKFCK+P    A D  F GLN 
Sbjct  49   LAFSFATASDPSPLQDFCVALRDAQNGAMFSLYFLFVNGKFCKDPKLVKAEDLFFSGLNM  108

Query  57   PGNTSNPLGSNVTAVNVNN  1
            PGNTSN LGS  T VNV  
Sbjct  109  PGNTSNQLGSKFTLVNVEQ  127



>emb|CBI36780.3| unnamed protein product [Vitis vinifera]
Length=313

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LAS  A+A DP PL+D CVA+++P + +FVNGKFCKNPN   A DF ++GLN PGNTSN 
Sbjct  109  LASFLASAYDPSPLEDTCVAVDEPNNAVFVNGKFCKNPNLTVAEDFLYQGLNIPGNTSNY  168

Query  36   LGSNVTAVNVNN  1
            +GS V  +NV+ 
Sbjct  169  VGSIVNLINVDQ  180



>gb|KDP32127.1| hypothetical protein JCGZ_12588 [Jatropha curcas]
Length=223

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L+ SFA A DP PLQD CVAI+ P   +FVNGKFC +P  A A DF F GLN P NT N 
Sbjct  15   LSYSFAFAFDPSPLQDFCVAIKKPTDGIFVNGKFCMDPMRATANDFFFPGLNIPANTKNQ  74

Query  36   LGSNVTAVNVNN  1
            LGSNVT V+V+ 
Sbjct  75   LGSNVTLVSVDT  86



>ref|XP_009625530.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + SS ++A+DP PLQD CVA+ D    +FVNGK CK+P   NA DF   GLN PGNTSN 
Sbjct  15   VVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            +GS VTAVNV N
Sbjct  75   VGSAVTAVNVGN  86



>ref|XP_009786133.1| PREDICTED: germin-like protein subfamily 1 member 14 [Nicotiana 
sylvestris]
Length=139

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + SS ++A+DP PLQD CVA+ D    +FVNGK CK+P   NA DF   GLN PGNTSN 
Sbjct  15   IVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQ  74

Query  36   LGSNVTAVN  10
            +GS VTAVN
Sbjct  75   VGSAVTAVN  83



>ref|XP_007201148.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
 gb|EMJ02347.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
Length=226

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  ASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPL  34
            A+   +A+DP PLQD CVA+ D    +FVNGKFCK+P   NA DF F GL  P NT NPL
Sbjct  17   ATFLVSASDPSPLQDFCVALNDNKSAVFVNGKFCKDPKLVNANDFFFSGLQNPRNTQNPL  76

Query  33   GSNVTAVNVNN  1
            GSNVT VNV+ 
Sbjct  77   GSNVTTVNVDQ  87



>ref|XP_006358461.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS + A+DP PLQD CVA+ +    +FVNGK CK+P    A DF   GLN+PGNTSN 
Sbjct  17   LTSSPSTASDPSPLQDFCVAVNESKETVFVNGKVCKDPKLVTADDFFRPGLNKPGNTSNQ  76

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNVNN
Sbjct  77   LGSIVTAVNVNN  88



>ref|XP_009612542.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + SS ++A+DP PLQD CVA+ D    +FVNGK CK+P   NA DF   GLN PGNTSN 
Sbjct  15   VVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            +GS VTAVNV N
Sbjct  75   VGSAVTAVNVGN  86



>ref|XP_009612541.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            S ++A DP PLQDICVA++D    +FVNGK CK+P    A DF   GLN PGNTSN LGS
Sbjct  18   SMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQLGS  77

Query  27   NVTAVNVNN  1
             VTAVNV N
Sbjct  78   AVTAVNVGN  86



>ref|XP_010450835.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 18 [Camelina sativa]
Length=224

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFANA DP PLQD CVA +D  + +FVNG+FCK+P  ++A DF F GLN PGNT+N 
Sbjct  15   LVISFANAYDPXPLQDFCVATDD-LNGVFVNGRFCKDPTLSDAKDFFFSGLNMPGNTNNQ  73

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  74   VGSNVTTVNVDQ  85



>ref|XP_009620917.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            S ++A DP PLQDICVA++D    +FVNGK CK+P    A DF   GLN PGNTSN LGS
Sbjct  18   SMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDFFKSGLNIPGNTSNQLGS  77

Query  27   NVTAVNVNN  1
             VTAVNV N
Sbjct  78   AVTAVNVGN  86



>ref|XP_009795501.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + SS ++A+DP PLQD CVA+ D    +FVNGK CK+P   NA DF   GLN PGNTSN 
Sbjct  15   VVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            +GS VTAVNV N
Sbjct  75   VGSAVTAVNVGN  86



>emb|CDP16788.1| unnamed protein product [Coffea canephora]
Length=229

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +  +A+DP PLQD CVA+ D    +FVNGK CK+P      DF F GLN+PG+T+NP
Sbjct  14   LVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANP  73

Query  36   LGSNVTAVNVNN  1
            LGSNVTAVNVN 
Sbjct  74   LGSNVTAVNVNQ  85



>ref|XP_009140209.1| PREDICTED: germin-like protein subfamily 1 member 16 [Brassica 
rapa]
Length=223

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI+D  + +FVN +FCK+P   NA DF F GLN PGNTSN 
Sbjct  17   LVISFAEAYDPSPLQDFCVAIDD-LNGVFVNDRFCKDPMRVNAEDFFFSGLNVPGNTSNQ  75

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  76   VGSNVTTVNVDQ  87



>ref|XP_007030278.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10780.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=476

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A S A+A+DPDPLQD CVAI D    +FVNGKFC++P  A A DF + GLN P NTSNP
Sbjct  16   FAWSLASASDPDPLQDFCVAINDTKDGVFVNGKFCQDPKLAKAEDFFYSGLNIPRNTSNP  75

Query  36   LGSNVTAVNV  7
            +GS VT VNV
Sbjct  76   VGSTVTQVNV  85


 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVA+ D  + +FVNGKFCK+P  A A DF F GLN PGNTSN LGS VT VN
Sbjct  275  DPSPLQDFCVALNDTKNAVFVNGKFCKDPMLAKAEDFFFSGLNVPGNTSNQLGSKVTPVN  334

Query  9    VNN  1
            V  
Sbjct  335  VEQ  337



>gb|EYU20541.1| hypothetical protein MIMGU_mgv1a018988mg [Erythranthe guttata]
Length=230

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++FA A+DP PLQD CVA++D    +FVNGK CKNP+   A +F F GLN+ GNTSNP+G
Sbjct  18   ATFAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNPDMVVAENFFFPGLNKSGNTSNPVG  77

Query  30   SNVTAVNVNN  1
            S VT VNVN 
Sbjct  78   SRVTPVNVNQ  87



>gb|EYU40210.1| hypothetical protein MIMGU_mgv1a022317mg [Erythranthe guttata]
Length=230

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            +SFA A+DP PLQD CVA+++    +FVNGK CK+PN   A DF   GLN+PGNT NP+G
Sbjct  18   ASFAYASDPSPLQDFCVAVKEADAAVFVNGKICKDPNMVVAEDFFLSGLNKPGNTLNPVG  77

Query  30   SNVTAVNVNN  1
            S VT  NVN 
Sbjct  78   SRVTPANVNQ  87



>gb|EYU20545.1| hypothetical protein MIMGU_mgv1a020779mg [Erythranthe guttata]
Length=231

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++ A A+DP PLQD CVA++D    +FVNGK CKNP+   A DF F GLN+PGNTSN +G
Sbjct  19   ATLAYASDPSPLQDFCVAVKDEDAAVFVNGKVCKNPDMVVAEDFFFPGLNKPGNTSNLVG  78

Query  30   SNVTAVNVNN  1
            S VT VNVN 
Sbjct  79   SRVTPVNVNQ  88



>ref|XP_002270404.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            +A SFA+A+DP PLQD CVA+ D    +FVNGKFC++P  A   DF F GL  PGNTSN 
Sbjct  17   MAFSFASASDPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGLRLPGNTSNK  76

Query  36   LGSNVTAVNV  7
            LGS VT  NV
Sbjct  77   LGSMVTPANV  86



>gb|EYU20547.1| hypothetical protein MIMGU_mgv1a023357mg [Erythranthe guttata]
Length=231

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++ A A+DP PLQD CVA++D    +FVNGK CKNP+   A DF F GLN+PGNTSN +G
Sbjct  19   ATLAYASDPSPLQDFCVAVKDEDAAVFVNGKVCKNPDMVVAEDFFFPGLNKPGNTSNLVG  78

Query  30   SNVTAVNVNN  1
            S VT VNVN 
Sbjct  79   SRVTPVNVNQ  88



>ref|XP_009620404.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + SS ++A DP PLQD CVA+ D    +FVNGK CK+P   NA DF   GLN PGNTSN 
Sbjct  15   IVSSISHAYDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDFFKSGLNIPGNTSNQ  74

Query  36   LGSNVTAVNVNN  1
            +GS VTAVNV N
Sbjct  75   VGSAVTAVNVGN  86



>emb|CAA63023.1| germin type2 [Arabidopsis thaliana]
Length=222

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SF NA DP PLQD CVAI+D   V FVNG+FCK+P   +A DF F  LN PGNT+N 
Sbjct  15   LVLSFVNAYDPSPLQDFCVAIDDLKGV-FVNGRFCKDPKRVDAKDFFFSALNVPGNTNNQ  73

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  74   VGSNVTTVNVDQ  85



>ref|XP_002319672.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
 gb|EEE95595.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
Length=221

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASSFA+A DP PLQD CVA+++   V FVNGKFCK+P D    DF   GLN PG+TS  
Sbjct  15   LASSFASAFDPSPLQDFCVAVDETDGV-FVNGKFCKDPKDVTEKDFFSSGLNIPGDTSGR  73

Query  36   LGSNVTAVNVNN  1
            +GSNVTAVN+  
Sbjct  74   VGSNVTAVNIEK  85



>ref|XP_006405659.1| hypothetical protein EUTSA_v10028158mg [Eutrema salsugineum]
 gb|ESQ47112.1| hypothetical protein EUTSA_v10028158mg [Eutrema salsugineum]
Length=222

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVA +D    +FVNGKFCK+P  A A DF F GLN+ GNT+N 
Sbjct  15   LVISFAKAYDPSPLQDFCVATDDIKIGVFVNGKFCKDPKQAKAEDFFFSGLNKAGNTNND  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VKSNVTTVNVDQ  86



>gb|KDP23773.1| hypothetical protein JCGZ_23606 [Jatropha curcas]
Length=182

 Score = 84.0 bits (206),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            S F +A DP PLQD CVAI++P + +FVNGKFCK+PN   A DF+F GL  P NT N +G
Sbjct  24   SPFVSAYDPSPLQDFCVAIDEPTNAVFVNGKFCKDPNLFVADDFSFLGLKTPRNTGNKVG  83

Query  30   SNVTAVNVN  4
            SNVT +NV+
Sbjct  84   SNVTLLNVD  92



>ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + SS ++A+DP PLQD CVA++D  + +FVNGKFCK+P    A DF   GLN PGNTSN 
Sbjct  15   VLSSMSHASDPSPLQDFCVAVDDTKNAVFVNGKFCKDPKLVVAEDFFKSGLNMPGNTSNN  74

Query  36   LGSNVTAVNVNN  1
            +GS VT VNVNN
Sbjct  75   VGSAVTPVNVNN  86



>ref|XP_010251866.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            S A A+DP PLQD CVAI+D    +FVNGKFCKNP    A DF F GL++PGNTSN +GS
Sbjct  16   SQALASDPSPLQDFCVAIKDTDSRVFVNGKFCKNPYYTTADDFFFSGLDKPGNTSNSVGS  75

Query  27   NVTAVNV  7
             VT VNV
Sbjct  76   KVTPVNV  82



>ref|XP_004142551.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Cucumis 
sativus]
 gb|KGN66717.1| hypothetical protein Csa_1G662810 [Cucumis sativus]
Length=223

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L S  A++ DP PLQD CVAI D    +F+NGKFCK+P  A   DF F+GLN PGNT NP
Sbjct  13   LQSFLASSFDPSPLQDFCVAINDARSPVFLNGKFCKDPKYAVVNDFLFQGLNIPGNTENP  72

Query  36   LGSNVTAVNVNN  1
             GSNVT VNV+ 
Sbjct  73   NGSNVTLVNVDK  84



>ref|XP_006845051.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
 gb|ERN06726.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
Length=220

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L +SFA A+DP PLQD CVA  D    +FVNGK CK+P  A A DF F GLN+PGNT+NP
Sbjct  13   LVASFALASDPSPLQDFCVA--DNASKVFVNGKVCKDPKLAQANDFFFCGLNKPGNTANP  70

Query  36   LGSNVTAVNV  7
            LGS VT VNV
Sbjct  71   LGSRVTPVNV  80



>ref|XP_004155681.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 7-like [Cucumis sativus]
Length=223

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L S  A++ DP PLQD CVAI D    +F+NGKFCK+P  A   DF F+GLN PGNT NP
Sbjct  13   LQSFLASSFDPSPLQDFCVAINDARSPVFLNGKFCKDPKYAVVNDFXFQGLNIPGNTENP  72

Query  36   LGSNVTAVNVNN  1
             GSNVT VNV+ 
Sbjct  73   NGSNVTLVNVDK  84



>ref|XP_002870302.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46561.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -1

Query  195  AADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTA  16
            A+DP PLQD CV +  P   +FVNGKFCK+P   +A DF F GLNR GNT+N +GSNVT 
Sbjct  24   ASDPSPLQDFCVGVNTPVDGVFVNGKFCKDPRIVSADDFFFSGLNRAGNTNNAVGSNVTT  83

Query  15   VNVNN  1
            VNVNN
Sbjct  84   VNVNN  88



>emb|CAN63434.1| hypothetical protein VITISV_033830 [Vitis vinifera]
Length=212

 Score = 84.0 bits (206),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            +A S A+A+DP PLQD CVA+ D   V+F+NGKFC++PN     DF+F GL  PGNTSN 
Sbjct  1    MAFSLASASDPSPLQDFCVAVNDTNVVVFMNGKFCQDPNLVTPNDFSFSGLRLPGNTSNQ  60

Query  36   LGSNVTAVNV  7
            LGS VT  NV
Sbjct  61   LGSMVTPANV  70



>ref|XP_004142552.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 ref|XP_004155680.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 gb|KGN66715.1| Rhicadhesin receptor [Cucumis sativus]
Length=224

 Score = 84.0 bits (206),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -1

Query  201  ANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNV  22
            A+A DP PLQD CVA ++P   +FVNGKFCKNP    A DF FRGLN  GNT N  GSNV
Sbjct  24   ASAFDPSPLQDFCVAADEPNSAVFVNGKFCKNPKLVRAEDFLFRGLNIAGNTMNKQGSNV  83

Query  21   TAVNVNN  1
            T VNV+ 
Sbjct  84   TLVNVDR  90



>ref|XP_002868741.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45000.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score = 84.0 bits (206),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A+DP PLQD CVAI D  + +FVNGKFCK+P  A A DF + GLN+ G T+N 
Sbjct  15   LVISFAEASDPSPLQDFCVAIGDLKNGVFVNGKFCKDPKQAKAEDFFYSGLNQAGTTNNR  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VKSNVTTVNVDQ  86



>ref|XP_006840195.1| hypothetical protein AMTR_s00089p00119070 [Amborella trichopoda]
 gb|ERN01870.1| hypothetical protein AMTR_s00089p00119070 [Amborella trichopoda]
Length=219

 Score = 84.0 bits (206),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L +S  +A+DP PLQD CVA  D Y  +FVNGK CK+P  A A DF F GL++PGNTSNP
Sbjct  12   LTASHVSASDPSPLQDFCVA--DNYSKVFVNGKVCKDPKLATANDFFFAGLDKPGNTSNP  69

Query  36   LGSNVTAVNV  7
            +GS VT VNV
Sbjct  70   VGSKVTPVNV  79



>emb|CAN71140.1| hypothetical protein VITISV_005471 [Vitis vinifera]
Length=220

 Score = 84.0 bits (206),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI++P + +FVNGKFCKNPN   A DF  +GLN PGNTSN +GS+VT VN
Sbjct  25   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVN  84

Query  9    VN  4
            V+
Sbjct  85   VD  86



>gb|EYU20536.1| hypothetical protein MIMGU_mgv1a025658mg [Erythranthe guttata]
Length=231

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -1

Query  216  LASSFAN---AADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNT  46
            + +SFA    A+DP PLQD CVA+ D    +FVNGK CK+PN   A DF   GLN+ GNT
Sbjct  14   VVASFATLGFASDPSPLQDFCVAVNDAKSAVFVNGKVCKDPNMVVAEDFFLSGLNKLGNT  73

Query  45   SNPLGSNVTAVNVNN  1
            SNPLGS VT VNVN 
Sbjct  74   SNPLGSRVTPVNVNQ  88



>emb|CDP21353.1| unnamed protein product [Coffea canephora]
Length=459

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +  +A+DP PLQD CVA+ D    +FVNGK CK+P      DF F GLN PG+TSNP
Sbjct  243  LVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNEPGSTSNP  302

Query  36   LGSNVTAVNVNN  1
            LGSNVTAVNVN 
Sbjct  303  LGSNVTAVNVNQ  314


 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +  +A+DP PLQD CVA+ D    +FVNGK CK+P      DF F GLN+PG+T+NP
Sbjct  14   LVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANP  73

Query  36   LGSNVTAVNVNN  1
            LGSNVTAVNVN 
Sbjct  74   LGSNVTAVNVNQ  85



>ref|XP_007143989.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15983.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=224

 Score = 83.6 bits (205),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A A DP PLQD CVAI D    +FVNGKFCK+P  ANA DF FRGL   G+T+NP
Sbjct  13   LASSVAFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDPKFANADDFFFRGLG-AGDTANP  71

Query  36   LGSNVTAVNVNN  1
            +GS VT V VN 
Sbjct  72   VGSKVTPVAVNE  83



>emb|CDP16789.1| unnamed protein product [Coffea canephora]
Length=488

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +  +A+DP PLQD CVA+ D    +FVNGK CK+P      DF F GLN+PG+T+NP
Sbjct  14   LVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANP  73

Query  36   LGSNVTAVNVNN  1
            LGSNVTAVNVN 
Sbjct  74   LGSNVTAVNVNQ  85


 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +  +A+DP PLQD CVA+ D    +FVNGK CK+P      DF F GLN PG+T+NP
Sbjct  272  LVFAVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNMPGSTANP  331

Query  36   LGSNVTAVNVNN  1
            LGSNVTAVNVN 
Sbjct  332  LGSNVTAVNVNQ  343



>emb|CDP16791.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +   A+DP PLQD CVA+ D    +FVNGK CK+P      DF F GLN+PG+T+NP
Sbjct  14   LVFAIVCASDPSPLQDFCVAVPDANATVFVNGKICKDPKLVKPKDFFFPGLNKPGSTANP  73

Query  36   LGSNVTAVNVNN  1
            LGSNVT VNVN 
Sbjct  74   LGSNVTQVNVNQ  85



>emb|CBI36790.3| unnamed protein product [Vitis vinifera]
Length=207

 Score = 83.6 bits (205),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI++P + +FVNGKFCKNPN   A DF  +GLN PGNTSN +GS+VT VN
Sbjct  12   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVN  71

Query  9    VN  4
            V+
Sbjct  72   VD  73



>ref|NP_001267940.1| germin-like protein 1 [Vitis vinifera]
 gb|ABL60872.1| germin-like protein 1 [Vitis vinifera]
Length=207

 Score = 83.6 bits (205),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI++P + +FVNGKFCKNPN   A DF  +GLN PGNTSN +GS+VT VN
Sbjct  12   DPSPLQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVN  71

Query  9    VN  4
            V+
Sbjct  72   VD  73



>ref|NP_193199.1| germin-like protein 9 [Arabidopsis thaliana]
 sp|Q9LEA7.2|GL18_ARATH RecName: Full=Germin-like protein subfamily 1 member 8; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB10242.1| germin precursor oxalate oxidase [Arabidopsis thaliana]
 emb|CAB78505.1| germin precursor oxalate oxidase [Arabidopsis thaliana]
 dbj|BAD94883.1| germin precursor oxalate oxidase [Arabidopsis thaliana]
 gb|ABK32194.1| At4g14630 [Arabidopsis thaliana]
 gb|AEE83469.1| germin-like protein subfamily 1 member 8 [Arabidopsis thaliana]
Length=222

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  195  AADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTA  16
            A+DP PLQD CV +  P   +FVNGKFCK+P    A DF F  LNRPGNT+N +GSNVT 
Sbjct  24   ASDPSPLQDFCVGVNTPADGVFVNGKFCKDPRIVFADDFFFSSLNRPGNTNNAVGSNVTT  83

Query  15   VNVNN  1
            VNVNN
Sbjct  84   VNVNN  88



>ref|XP_006477881.1| PREDICTED: germin-like protein subfamily 1 member 17-like isoform 
X2 [Citrus sinensis]
Length=219

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  SSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLG  31
            ++ A+A DP PLQDICVAI++P + +FVNGKFCK+P  A  GDF   GL++PGNT+N LG
Sbjct  16   ATLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDPKLARPGDFFLSGLDKPGNTANRLG  75

Query  30   SNVTAVNVNN  1
             +V   NV  
Sbjct  76   FSVKNANVEQ  85



>emb|CDP16786.1| unnamed protein product [Coffea canephora]
Length=690

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +   A+DP PLQD CVA+ D    +FVNGK CK+P    A DF F+GLN+PG+T+NP
Sbjct  14   LVFTIVYASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKAEDFFFQGLNKPGSTANP  73

Query  36   LGSNVTAVNVNN  1
            LGSNVT VNVN 
Sbjct  74   LGSNVTQVNVNQ  85


 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +  +A+DP PLQD CVA+ D    +FVNGK CK+P      DF F GLN+PG+T+NP
Sbjct  245  LVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANP  304

Query  36   LGSNVTAVNVNN  1
            LGSNVTAVNVN 
Sbjct  305  LGSNVTAVNVNQ  316


 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  +  +A+DP PLQD CVA+ D    +FVNGK CK+P      DF F GLN+PG+T+NP
Sbjct  475  LVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANP  534

Query  36   LGSNVTAVNVNN  1
            LGSNVTAVNVN 
Sbjct  535  LGSNVTAVNVNQ  546



>ref|XP_002319671.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
 gb|EEE95594.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
Length=221

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASSFA+A DP PLQD CVA+++   V FVNGKFCK+P D    DF   GL+ PG+TS  
Sbjct  15   LASSFASAFDPSPLQDFCVAVDETDGV-FVNGKFCKDPKDVTEKDFFSSGLDIPGDTSGR  73

Query  36   LGSNVTAVNVNN  1
            +GSNVTAVN+  
Sbjct  74   VGSNVTAVNIEK  85



>ref|XP_002284616.2| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
 emb|CBI36788.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI +P + +FVNGKFCKNPN   A DF F+GLN PGNT+N +GSNV  VN
Sbjct  25   DPSPLQDTCVAIPEPKNAVFVNGKFCKNPNLTVAEDFFFQGLNIPGNTANLVGSNVNTVN  84

Query  9    VN  4
            V+
Sbjct  85   VD  86



>gb|AAD00509.1| germin-like protein [Arabidopsis thaliana]
Length=218

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  195  AADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTA  16
            A+DP PLQD CV +  P   +FVNGKFCK+P    A DF F  LNRPGNT+N +GSNVT 
Sbjct  20   ASDPSPLQDFCVGVNTPADGVFVNGKFCKDPRIVFADDFFFSSLNRPGNTNNAVGSNVTT  79

Query  15   VNVNN  1
            VNVNN
Sbjct  80   VNVNN  84



>ref|XP_009786129.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  SFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGS  28
            S ++A DP PLQD CVA+ D    +FVNGK CK+PN  NA DF   GLN PGNTSN +GS
Sbjct  18   SISHAYDPSPLQDFCVAVNDSMAAVFVNGKICKDPNVVNADDFFKSGLNIPGNTSNQVGS  77

Query  27   NVTAVNVNN  1
             VTAVNV N
Sbjct  78   AVTAVNVIN  86



>gb|KCW82831.1| hypothetical protein EUGRSUZ_C04202, partial [Eucalyptus grandis]
Length=216

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  201  ANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNV  22
            A A DP PLQDICVA  D    +FVNGKFCK+P  A A DF F GL  PGNTSNPLGS V
Sbjct  11   ALAYDPSPLQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKV  70

Query  21   TAVNVNN  1
            T   V  
Sbjct  71   TQAFVQQ  77



>ref|XP_006358460.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 18-like [Solanum tuberosum]
Length=233

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS + A+DP PL+  CVA+ D    +FVNGK CK+P    A DF   GLN+PGNTSN 
Sbjct  17   LASSPSTASDPSPLKIFCVAVNDSKTTVFVNGKVCKDPKLVTADDFFRSGLNKPGNTSNQ  76

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNVNN
Sbjct  77   LGSIVTAVNVNN  88



>ref|XP_002868742.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45001.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SF  A+DP PLQD CVAI D  + +FVNGKFCK+P  A A DF + GLN+ G T+N 
Sbjct  15   LVISFGEASDPSPLQDFCVAISDLKNGVFVNGKFCKDPKQAKAEDFFYSGLNQAGTTNNR  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VKSNVTTVNVDQ  86



>ref|XP_007030274.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10776.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=675

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A S A+A+DP PLQD CVAI D    +FVNGKFCK+P  A A DF + GLN P NTSNP
Sbjct  465  FAWSLASASDPSPLQDFCVAINDTKDGVFVNGKFCKDPKLAKAEDFFYSGLNIPRNTSNP  524

Query  36   LGSNVTAVNV  7
            +GS VT VNV
Sbjct  525  VGSTVTPVNV  534


 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI D  + +FVNGKFCK+P  A A DF + GLN PGNTSNP+GSNVT VN
Sbjct  252  DPSPLQDFCVAINDTKNGVFVNGKFCKDPKLAVADDFFYSGLNMPGNTSNPVGSNVTTVN  311

Query  9    VNN  1
            V+ 
Sbjct  312  VDQ  314



>ref|XP_007030272.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10774.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -1

Query  204  FANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSN  25
            FA A+DP PLQD CVAI D    +FVNGKFCK+P  A A DF F GLN P N SNP+GS 
Sbjct  19   FAYASDPSPLQDYCVAINDAKDGVFVNGKFCKDPKLAKAEDFFFSGLNIPRNKSNPVGST  78

Query  24   VTAVNV  7
            VT VNV
Sbjct  79   VTPVNV  84



>ref|XP_010051708.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=251

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  201  ANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNV  22
            A A DP PLQDICVA  D    +FVNGKFCK+P  A A DF F GL  PGNTSNPLGS V
Sbjct  46   ALAYDPSPLQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKV  105

Query  21   TAVNVNN  1
            T   V  
Sbjct  106  TQAFVQQ  112



>ref|XP_006840201.1| hypothetical protein AMTR_s00089p00122070 [Amborella trichopoda]
 gb|ERN01876.1| hypothetical protein AMTR_s00089p00122070 [Amborella trichopoda]
Length=155

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L +S  +A+DP PLQD CVA  D Y  +FVNGK CK+P  A A DF F GL++PGNTSNP
Sbjct  12   LIASHISASDPSPLQDFCVA--DNYSKVFVNGKVCKDPKLATANDFFFAGLDKPGNTSNP  69

Query  36   LGSNVTAVNV  7
            LGS V  VNV
Sbjct  70   LGSKVNPVNV  79



>ref|XP_010024915.1| PREDICTED: putative germin-like protein 2-1 [Eucalyptus grandis]
Length=223

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A A+DP PLQD CVAI D    + VNGKFCK+P  A A DF+F     PGNTSNP
Sbjct  13   LASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSFTKFRYPGNTSNP  72

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  73   LGSKVTTAFVDQ  84



>gb|KCW61443.1| hypothetical protein EUGRSUZ_H04174 [Eucalyptus grandis]
Length=222

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A A+DP PLQD CVAI D    + VNGKFCK+P  A A DF+F     PGNTSNP
Sbjct  12   LASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSFTKFRYPGNTSNP  71

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  72   LGSKVTTAFVDQ  83



>gb|KCW61437.1| hypothetical protein EUGRSUZ_H04167 [Eucalyptus grandis]
Length=222

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A A+DP PLQD CVAI D    + VNGKFCK+P  A A DF+F     PGNTSNP
Sbjct  12   LASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSFTKFRYPGNTSNP  71

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  72   LGSKVTTAFVDQ  83



>ref|XP_010024914.1| PREDICTED: putative germin-like protein 2-1 [Eucalyptus grandis]
 gb|KCW61439.1| hypothetical protein EUGRSUZ_H04169 [Eucalyptus grandis]
Length=222

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A A+DP PLQD CVAI D    + VNGKFCK+P  A A DF+F     PGNTSNP
Sbjct  12   LASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSFTKFRYPGNTSNP  71

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  72   LGSKVTTAFVDQ  83



>ref|XP_010050174.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89289.1| hypothetical protein EUGRSUZ_A01579 [Eucalyptus grandis]
Length=223

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVA  DP   +FVNGKFCK+P  A+A DF F GL  PGNT+NPLGS VT   
Sbjct  22   DPSPLQDICVATNDPNSGVFVNGKFCKDPKQASADDFLFMGLRNPGNTANPLGSKVTQAF  81

Query  9    VNN  1
            V+ 
Sbjct  82   VDQ  84



>ref|NP_198727.1| germin-like protein subfamily 1 member 14 [Arabidopsis thaliana]
 sp|Q9FID0.1|GL114_ARATH RecName: Full=Germin-like protein subfamily 1 member 14; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10832.1| germin-like protein [Arabidopsis thaliana]
 gb|AED94395.1| germin-like protein subfamily 1 member 14 [Arabidopsis thaliana]
Length=222

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L  SFA A DP PLQD CVAI D  + +FVNGKFCK+P  A A DF + GLN+ G T+N 
Sbjct  15   LVISFAEANDPSPLQDFCVAIGDLKNGVFVNGKFCKDPKQAKAEDFFYSGLNQAGTTNNK  74

Query  36   LGSNVTAVNVNN  1
            + SNVT VNV+ 
Sbjct  75   VKSNVTTVNVDQ  86



>gb|KCW61434.1| hypothetical protein EUGRSUZ_H04164 [Eucalyptus grandis]
Length=225

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVA+ +P++ LFVNGKFCKNP+   A DF   GL  P +T+NP+GSNVT V 
Sbjct  25   DPSPLQDICVAVPEPHNALFVNGKFCKNPSLTTADDFFLSGLQVPRSTANPVGSNVTQVT  84

Query  9    VN  4
            V+
Sbjct  85   VD  86



>ref|XP_006840206.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
 gb|ERN01881.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
Length=219

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            + +S   A+DP PLQD CVA  D Y  +FVNGK CK+P  A A DF + GLN+PGNTSNP
Sbjct  12   MIASLGLASDPSPLQDFCVA--DNYSKVFVNGKVCKDPMLATANDFFYDGLNKPGNTSNP  69

Query  36   LGSNVTAVNV  7
            LGS VT VNV
Sbjct  70   LGSMVTPVNV  79



>gb|KCW44232.1| hypothetical protein EUGRSUZ_L02342, partial [Eucalyptus grandis]
Length=218

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LAS  A A+DP PLQD CVA+ DP   +FVNGKFCK+P    A DF+F     PG+TSNP
Sbjct  13   LASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSFTKFRYPGSTSNP  72

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  73   LGSKVTTAFVDQ  84



>ref|XP_010024910.1| PREDICTED: germin-like protein subfamily 1 member 16 [Eucalyptus 
grandis]
Length=224

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVA+ +P++ LFVNGKFCKNP+   A DF   GL  P +T+NP+GSNVT V 
Sbjct  24   DPSPLQDICVAVPEPHNALFVNGKFCKNPSLTTADDFFLSGLQVPRSTANPVGSNVTQVT  83

Query  9    VN  4
            V+
Sbjct  84   VD  85



>gb|KCW61436.1| hypothetical protein EUGRSUZ_H04166, partial [Eucalyptus grandis]
Length=216

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA++   A DP PLQD CVAI DP   +FVNGKFCK+P    A DF F+G   PGNT+NP
Sbjct  13   LATATTFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTANP  70

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  71   LGSKVTPAFVDQ  82



>emb|CBI33612.3| unnamed protein product [Vitis vinifera]
Length=221

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = -1

Query  216  LASSF--ANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTS  43
            LA SF  A+A+DP PLQD CVA+ D    +FVNGK CK+P  A A DF F GL  PGNTS
Sbjct  15   LAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTS  74

Query  42   NPLGSNVTAVNV  7
            N LGS VT  NV
Sbjct  75   NKLGSMVTPANV  86



>ref|XP_010050940.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=132

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDIC+A  D    +FVNGKFCKNPN A A DF F G   PGNTSNPLGS VT   
Sbjct  22   DPSPLQDICMATNDLESGVFVNGKFCKNPNQATADDFLFTGFRIPGNTSNPLGSKVTPAF  81

Query  9    VNN  1
            VN 
Sbjct  82   VNQ  84



>ref|XP_011046609.1| PREDICTED: germin-like protein subfamily 1 member 16 isoform 
X1 [Populus euphratica]
Length=226

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASSF  A DP PLQD CVAI+D    + VNGK CKNP  A A DF++ GL+ PGNTSN 
Sbjct  16   LASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNPGLATADDFSYSGLDVPGNTSNQ  75

Query  36   LGSNVTAVNVN  4
            LG+ V  +  +
Sbjct  76   LGARVNIITAD  86



>ref|XP_010041604.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LAS  A A+DP PLQD CVA+ DP   +FVNGKFCK+P    A DF+F     PG+TSNP
Sbjct  13   LASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSFTKFRYPGSTSNP  72

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  73   LGSKVTTAFVDQ  84



>ref|XP_010549632.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X3 
[Tarenaya hassleriana]
Length=114

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             AS FA+  DP PLQD CVAI+D ++ +FVNGKFCK+P    A DF   GLN PG T N 
Sbjct  16   FASPFASCYDPSPLQDFCVAIDD-FNGVFVNGKFCKDPKLVTAEDFFTSGLNIPGTTVNR  74

Query  36   LGSNVTAVNVNN  1
            +GSNVT VNV+ 
Sbjct  75   VGSNVTTVNVDR  86



>ref|XP_006443307.1| hypothetical protein CICLE_v10022117mg [Citrus clementina]
 ref|XP_006479013.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Citrus 
sinensis]
 gb|ESR56547.1| hypothetical protein CICLE_v10022117mg [Citrus clementina]
Length=224

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAIEDP   +FVNGKFCK+P  A A DF F GL++PGNT+N LG + T  N
Sbjct  24   DPSPLQDICVAIEDPKDGVFVNGKFCKDPKLARADDFFFSGLDKPGNTANRLGVDETDAN  83

Query  9    VNN  1
            V  
Sbjct  84   VEQ  86



>ref|XP_003633711.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = -1

Query  216  LASSF--ANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTS  43
            LA SF  A+A+DP PLQD CVA+ D    +FVNGK CK+P  A A DF F GL  PGNTS
Sbjct  15   LAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTS  74

Query  42   NPLGSNVTAVNV  7
            N LGS VT  NV
Sbjct  75   NKLGSMVTPANV  86



>gb|KCW61442.1| hypothetical protein EUGRSUZ_H04173, partial [Eucalyptus grandis]
Length=216

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA++   A DP PLQD CVAI DP   +FVNGKFCK+P    A DF F+G   PGNT NP
Sbjct  13   LATATTYAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNP  70

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  71   LGSKVTPAFVDQ  82



>ref|XP_003535383.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 13-like [Glycine max]
Length=244

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASS A A DP PLQD CVAI D    +FVNGK C++P  A A DF F GL  PG+TSNP
Sbjct  40   LASSVAFAYDPSPLQDFCVAINDTKTGVFVNGKLCQDPKLAKAEDFFFSGLG-PGDTSNP  98

Query  36   LGSNVTAVNVNN  1
            LGS V AV VN 
Sbjct  99   LGSKVAAVTVNE  110



>ref|XP_011046611.1| PREDICTED: germin-like protein subfamily 1 member 16 isoform 
X3 [Populus euphratica]
Length=256

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASSF  A DP PLQD CVAI+D    + VNGK CKNP  A A DF++ GL+ PGNTSN 
Sbjct  46   LASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNPGLATADDFSYSGLDVPGNTSNQ  105

Query  36   LGSNVTAVNVN  4
            LG+ V  +  +
Sbjct  106  LGARVNIITAD  116



>ref|XP_006443305.1| hypothetical protein CICLE_v10023700mg [Citrus clementina]
 gb|ESR56545.1| hypothetical protein CICLE_v10023700mg [Citrus clementina]
Length=224

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAIEDP   +FVNGKFCK+P  A A DF F GL++PGNT+N LG + T  N
Sbjct  24   DPSPLQDICVAIEDPKDGVFVNGKFCKDPKLARADDFFFSGLDKPGNTANRLGVDETDAN  83

Query  9    VNN  1
            V  
Sbjct  84   VEQ  86



>ref|XP_011039266.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=256

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LASSF  A DP PLQD CVAI+D    + VNGK CKNP  A A DF++ GL+ PGNTSN 
Sbjct  46   LASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNPGLATADDFSYSGLDVPGNTSNQ  105

Query  36   LGSNVTAVNVN  4
            LG+ V  +  +
Sbjct  106  LGARVNIITAD  116



>ref|XP_010066342.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LAS  A A+DP PLQD CVA+ DP   +FVNGKFCK+P    A DF+F     PG+TSNP
Sbjct  13   LASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSFTKFRYPGSTSNP  72

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  73   LGSKVTTAFVDQ  84



>ref|XP_008778966.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=221

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            L SS A A+DP PLQD CVA  D    +FVNG  CKNPND  A DF F GL+RPG+ +N 
Sbjct  13   LVSSHAIASDPSPLQDFCVA--DKTSHVFVNGLVCKNPNDVKADDFFFSGLDRPGDAANK  70

Query  36   LGSNVTAVNVNN  1
            LGSNVT VNV  
Sbjct  71   LGSNVTLVNVEK  82



>ref|XP_007201563.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
 gb|EMJ02762.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
Length=227

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
             A+    A+DP PLQD CVA+ D    +FVNGKFCK+P  ANA DF F GL    +T NP
Sbjct  16   FATILVFASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFFFSGLQIARSTQNP  75

Query  36   LGSNVTAVNVNN  1
            LGS VTAVNV+ 
Sbjct  76   LGSTVTAVNVDQ  87



>ref|XP_008240380.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=227

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA+   +A+DP PLQD CVAI +    +FVNGKFCK+P    A DF F GL  PGNTSNP
Sbjct  17   LATFLVSASDPSPLQDFCVAINNTESAVFVNGKFCKDPKLVTANDFFFSGLRIPGNTSNP  76

Query  36   LGSNVTAVNVNN  1
            +GS VT  NV  
Sbjct  77   VGSFVTPANVEQ  88



>ref|XP_010027139.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA++   A DP PLQD CVAI DP   +FVNGKFCK+P    A DF F+G   PGNT NP
Sbjct  13   LATATTYAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNP  70

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  71   LGSKVTPAFVDQ  82



>ref|XP_007210592.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
 gb|EMJ11791.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
Length=227

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA+   +A+DP PLQD CVAI +    +FVNGKFCK+P    A DF F GL  PGNTSNP
Sbjct  17   LATFLVSASDPSPLQDFCVAINNTESAVFVNGKFCKDPKFVTANDFFFSGLRIPGNTSNP  76

Query  36   LGSNVTAVNVNN  1
            +GS VT  NV  
Sbjct  77   VGSFVTPANVEQ  88



>emb|CAN73846.1| hypothetical protein VITISV_021637 [Vitis vinifera]
Length=177

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVT  19
            DP PLQD CVAI +P + +FVNGKFCKNPN   A DF F+GLN PGNT+N +GSNVT
Sbjct  25   DPSPLQDTCVAIPEPENAVFVNGKFCKNPNLTVAEDFFFQGLNIPGNTANRVGSNVT  81



>ref|XP_007030211.1| Uncharacterized protein TCM_026019 [Theobroma cacao]
 gb|EOY10713.1| Uncharacterized protein TCM_026019 [Theobroma cacao]
Length=229

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA S A A+DP PLQD  VA++D  + +FVNG FCK+P    A DF F GLN PGNTSN 
Sbjct  79   LAFSVATASDPSPLQDFFVALKDAQNGVFVNGNFCKDPKLVKAEDFFFSGLNIPGNTSNQ  138

Query  36   LGSNVTAVNVNN  1
            LGS VT VNV  
Sbjct  139  LGSKVTPVNVEQ  150



>gb|KCW76699.1| hypothetical protein EUGRSUZ_D01059 [Eucalyptus grandis]
Length=221

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA++ + A DP PLQD CVAI DP   +FVNGKFCK+P    A DF F+G   PGNT NP
Sbjct  13   LATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNP  70

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  71   LGSKVTPAFVDQ  82



>ref|XP_006479011.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Citrus 
sinensis]
Length=224

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQDICVAIEDP   +FVNGKFCK+P  A A DF F GL +PGNT+N LG + T  N
Sbjct  24   DPSPLQDICVAIEDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDAN  83

Query  9    VNN  1
            V  
Sbjct  84   VEQ  86



>ref|XP_007030267.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10769.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=298

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -1

Query  189  DPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNPLGSNVTAVN  10
            DP PLQD CVAI D  + +FVNGKFCK+P   NA DF F GLN+ GNTSN LGS VT VN
Sbjct  25   DPSPLQDFCVAINDTKNGVFVNGKFCKDPKLVNAEDFFFSGLNKQGNTSNQLGSKVTLVN  84

Query  9    V  7
            V
Sbjct  85   V  85



>gb|KCW61438.1| hypothetical protein EUGRSUZ_H04168 [Eucalyptus grandis]
Length=221

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            LA++ + A DP PLQD CVAI DP   +FVNGKFCK+P    A DF F+G   PGNT NP
Sbjct  13   LATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNP  70

Query  36   LGSNVTAVNVNN  1
            LGS VT   V+ 
Sbjct  71   LGSKVTPAFVDQ  82



>ref|XP_002276644.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            +A S A+A+DP PLQD CVA+ D    +FVNGKFCK+P  A   DF F GL  PGNTSN 
Sbjct  17   MAFSVASASDPSPLQDFCVAVNDTNDSVFVNGKFCKDPKLATPNDFFFSGLRVPGNTSNK  76

Query  36   LGSNVTAVNV  7
            LGS VT  NV
Sbjct  77   LGSMVTPANV  86



>ref|XP_002276756.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  216  LASSFANAADPDPLQDICVAIEDPYHVLFVNGKFCKNPNDANAGDFTFRGLNRPGNTSNP  37
            +A S A+A+DP PLQD CVA+ D    +FVNGKFCK+P  A   DF F GL  PGNTSN 
Sbjct  17   MAFSVASASDPSPLQDFCVAVNDTNDSVFVNGKFCKDPKLATPNDFFFSGLRVPGNTSNK  76

Query  36   LGSNVTAVNV  7
            LGS VT  NV
Sbjct  77   LGSMVTPANV  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522210656744