BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3701_g1_i1 len=155 path=[1:0-154]

Length=155
                                                                      Score     E

emb|CAN71595.1|  hypothetical protein VITISV_010143                   73.6    3e-13   Vitis vinifera
emb|CAN67762.1|  hypothetical protein VITISV_040650                   69.7    5e-12   Vitis vinifera
ref|XP_010419216.1|  PREDICTED: uncharacterized protein LOC104704906  67.8    2e-11   
ref|XP_010419217.1|  PREDICTED: uncharacterized protein LOC104704907  67.8    2e-11   
gb|AAD25646.1|  putative retroelement pol polyprotein                 67.8    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424680.1|  PREDICTED: uncharacterized protein LOC104709822  66.2    7e-11   
ref|XP_009144811.1|  PREDICTED: uncharacterized protein LOC103868473  64.3    3e-10   
ref|XP_010278082.1|  PREDICTED: uncharacterized protein LOC104612388  63.9    4e-10   
ref|XP_010268948.1|  PREDICTED: uncharacterized protein LOC104605761  63.9    4e-10   
gb|AAC62795.1|  contains similarity to retroviral aspartyl protea...  63.9    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542100.1|  PREDICTED: uncharacterized protein LOC104815417  63.5    6e-10   
gb|AAG51258.1|AC025782_3  Ty1/copia-element polyprotein               63.5    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670882.1|  PREDICTED: uncharacterized protein LOC104887829  62.8    8e-10   
ref|XP_010526684.1|  PREDICTED: retrovirus-related Pol polyprotei...  63.2    9e-10   
gb|AAG10817.1|AC011808_5  Putative retroelement polyprotein           63.2    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526683.1|  PREDICTED: retrovirus-related Pol polyprotei...  63.2    1e-09   
ref|XP_010526682.1|  PREDICTED: retrovirus-related Pol polyprotei...  63.2    1e-09   
ref|XP_010526681.1|  PREDICTED: retrovirus-related Pol polyprotei...  63.2    1e-09   
ref|XP_010526680.1|  PREDICTED: retrovirus-related Pol polyprotei...  63.2    1e-09   
ref|XP_010526678.1|  PREDICTED: retrovirus-related Pol polyprotei...  63.2    1e-09   
gb|AAB61111.1|  Strong similarity to Zea mays retrotransposon Hop...  63.2    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010256211.1|  PREDICTED: uncharacterized protein LOC104596654  62.0    2e-09   
gb|AAC67205.1|  putative retroelement pol polyprotein                 62.0    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004250863.1|  PREDICTED: uncharacterized protein LOC101267084  62.0    2e-09   
dbj|BAA97287.1|  retroelement pol polyprotein-like                    62.0    2e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73795.1|  hypothetical protein VITISV_036649                   62.0    2e-09   Vitis vinifera
ref|XP_008778555.1|  PREDICTED: uncharacterized protein LOC103698337  62.0    2e-09   
gb|AAD41979.1|  putative retroelement pol polyprotein                 61.6    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009801985.1|  PREDICTED: uncharacterized protein LOC104247620  61.2    3e-09   
gb|AAD26943.1|  putative retroelement pol polyprotein                 61.6    4e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10503.1|  retroelement pol polyprotein-like                    61.6    4e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAA72989.1|  unnamed protein product                              61.2    4e-09   Brassica oleracea
ref|XP_010262896.1|  PREDICTED: uncharacterized protein LOC104601304  60.5    4e-09   
emb|CAN72141.1|  hypothetical protein VITISV_017108                   60.8    6e-09   Vitis vinifera
gb|AAD23883.1|  putative retroelement pol polyprotein                 60.8    6e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAN71553.1|  hypothetical protein VITISV_034738                   60.8    6e-09   Vitis vinifera
ref|XP_010436765.1|  PREDICTED: uncharacterized protein LOC104720575  58.9    6e-09   
ref|XP_010451244.1|  PREDICTED: uncharacterized protein LOC104733360  60.8    6e-09   
gb|AAG50751.1|AC079733_19  polyprotein, putative                      60.8    7e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAD19784.1|  putative retroelement pol polyprotein                 60.5    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123417.1|  PREDICTED: uncharacterized protein LOC103848213  60.1    9e-09   
ref|XP_010692440.1|  PREDICTED: uncharacterized protein LOC104905550  60.1    9e-09   
dbj|BAB10743.1|  retroelement pol polyprotein-like                    60.5    9e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KHN01991.1|  Retrovirus-related Pol polyprotein from transposo...  60.5    9e-09   
ref|XP_004229082.1|  PREDICTED: uncharacterized protein LOC101247852  59.7    9e-09   
emb|CAA18107.1|  LTR retrotransposon like protein                     60.1    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004235138.1|  PREDICTED: uncharacterized protein LOC101243773  60.1    1e-08   
ref|XP_004498431.1|  PREDICTED: uncharacterized protein LOC101490285  59.7    1e-08   
ref|XP_011079197.1|  PREDICTED: uncharacterized protein LOC105162774  59.3    1e-08   
gb|AAB87099.1|  putative retroelement pol polyprotein                 59.3    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004499523.1|  PREDICTED: uncharacterized protein LOC101509950  57.8    3e-08   
ref|XP_009796454.1|  PREDICTED: uncharacterized protein LOC104243030  58.5    3e-08   
emb|CAN65213.1|  hypothetical protein VITISV_009492                   57.8    5e-08   Vitis vinifera
ref|XP_009150436.1|  PREDICTED: uncharacterized protein LOC103873788  57.8    5e-08   
emb|CAN83990.1|  hypothetical protein VITISV_018454                   57.8    6e-08   Vitis vinifera
emb|CAN76546.1|  hypothetical protein VITISV_010420                   57.8    6e-08   Vitis vinifera
ref|XP_007034104.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  57.8    6e-08   
emb|CAN81124.1|  hypothetical protein VITISV_030991                   57.4    8e-08   Vitis vinifera
ref|XP_009795207.1|  PREDICTED: uncharacterized protein LOC104241936  57.4    9e-08   
emb|CAN72408.1|  hypothetical protein VITISV_038204                   57.4    1e-07   Vitis vinifera
ref|XP_010245298.1|  PREDICTED: uncharacterized protein LOC104588872  57.0    1e-07   
emb|CAN79134.1|  hypothetical protein VITISV_000843                   57.0    1e-07   Vitis vinifera
emb|CAN74794.1|  hypothetical protein VITISV_041689                   57.0    1e-07   Vitis vinifera
ref|XP_010684008.1|  PREDICTED: uncharacterized protein LOC104898610  57.0    1e-07   
emb|CAN71267.1|  hypothetical protein VITISV_017889                   57.0    1e-07   Vitis vinifera
dbj|BAD99220.1|  polypeptide with an integrase domain                 56.2    2e-07   Petunia x hybrida [garden petunia]
ref|XP_010667912.1|  PREDICTED: uncharacterized protein LOC104884908  56.6    2e-07   
emb|CAN71164.1|  hypothetical protein VITISV_031057                   56.6    2e-07   Vitis vinifera
emb|CAN67992.1|  hypothetical protein VITISV_015686                   56.6    2e-07   Vitis vinifera
gb|AAG09097.1|AC009323_8  Putative retroelement polyprotein           56.6    2e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAN69184.1|  hypothetical protein VITISV_004341                   56.2    2e-07   Vitis vinifera
emb|CAN67970.1|  hypothetical protein VITISV_025093                   56.2    2e-07   Vitis vinifera
ref|XP_004246827.1|  PREDICTED: uncharacterized protein LOC101260567  56.2    2e-07   
pir||S00954  pol polyprotein - fruit fly (Drosophila melanogaster...  56.2    2e-07
emb|CAN60702.1|  hypothetical protein VITISV_015869                   56.2    2e-07   Vitis vinifera
emb|CAN82103.1|  hypothetical protein VITISV_035488                   56.2    3e-07   Vitis vinifera
ref|XP_009128559.1|  PREDICTED: uncharacterized protein LOC103853393  55.8    3e-07   
emb|CAN73102.1|  hypothetical protein VITISV_042891                   55.8    3e-07   Vitis vinifera
ref|XP_010675539.1|  PREDICTED: uncharacterized protein LOC104891530  55.8    3e-07   
ref|XP_010113352.1|  Retrovirus-related Pol polyprotein from tran...  56.2    3e-07   
ref|XP_010242510.1|  PREDICTED: uncharacterized protein LOC104586844  55.8    3e-07   
ref|XP_010445345.1|  PREDICTED: uncharacterized protein LOC104727998  55.1    3e-07   
ref|XP_010495376.1|  PREDICTED: uncharacterized protein LOC104772464  55.8    3e-07   
emb|CAN68148.1|  hypothetical protein VITISV_035665                   55.8    3e-07   Vitis vinifera
ref|XP_010675988.1|  PREDICTED: uncharacterized protein LOC104891900  55.8    3e-07   
ref|XP_009771994.1|  PREDICTED: uncharacterized protein LOC104222458  55.5    4e-07   
ref|XP_010692573.1|  PREDICTED: uncharacterized protein LOC104905670  55.5    4e-07   
emb|CAN74194.1|  hypothetical protein VITISV_040578                   55.5    4e-07   Vitis vinifera
emb|CAA19696.1|  putative LTR retrotransposon (fragment)              53.9    4e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAN64225.1|  hypothetical protein VITISV_016222                   55.5    4e-07   Vitis vinifera
ref|XP_010474506.1|  PREDICTED: uncharacterized protein LOC104754043  55.1    5e-07   
ref|XP_010025850.1|  PREDICTED: uncharacterized protein LOC104416112  55.5    5e-07   
gb|AAD32906.1|  putative retroelement pol polyprotein                 55.1    5e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAN79936.1|  hypothetical protein VITISV_033548                   55.1    5e-07   Vitis vinifera
ref|XP_007029159.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  54.7    5e-07   
gb|AFN88207.1|  integrase core domain containing protein              55.1    5e-07   
emb|CAN77602.1|  hypothetical protein VITISV_024474                   55.1    6e-07   Vitis vinifera
ref|XP_010030630.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  55.1    6e-07   
ref|XP_010677705.1|  PREDICTED: uncharacterized protein LOC104893304  55.1    6e-07   
ref|XP_010532348.1|  PREDICTED: uncharacterized protein LOC104808371  55.1    6e-07   
gb|KFK32108.1|  hypothetical protein AALP_AA6G199700                  55.1    6e-07   
emb|CAN65540.1|  hypothetical protein VITISV_029946                   55.1    6e-07   Vitis vinifera
emb|CAN68489.1|  hypothetical protein VITISV_037543                   55.1    6e-07   Vitis vinifera
ref|XP_009774503.1|  PREDICTED: uncharacterized protein LOC104224521  54.3    6e-07   
gb|AAK38381.1|AC079028_5  polyprotein, putative                       54.7    6e-07   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10837.1|  retroelement pol polyprotein-like                    55.1    6e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAN74160.1|  hypothetical protein VITISV_018405                   54.7    7e-07   Vitis vinifera
ref|XP_009778353.1|  PREDICTED: uncharacterized protein LOC104227744  54.7    7e-07   
emb|CAN66323.1|  hypothetical protein VITISV_007384                   54.7    7e-07   Vitis vinifera
emb|CAN75440.1|  hypothetical protein VITISV_007304                   54.7    7e-07   Vitis vinifera
emb|CAN77432.1|  hypothetical protein VITISV_017814                   53.9    7e-07   Vitis vinifera
ref|XP_008387850.1|  PREDICTED: uncharacterized protein LOC103450292  54.7    7e-07   
ref|XP_010312989.1|  PREDICTED: uncharacterized protein LOC104644607  54.7    8e-07   
ref|XP_004228785.1|  PREDICTED: uncharacterized protein LOC101255821  54.7    8e-07   
dbj|BAA11674.1|  unnamed protein product                              54.7    8e-07   Nicotiana tabacum [American tobacco]
emb|CAN62906.1|  hypothetical protein VITISV_043610                   54.7    8e-07   Vitis vinifera
ref|XP_009123006.1|  PREDICTED: uncharacterized protein LOC103847675  54.7    8e-07   
emb|CAN76196.1|  hypothetical protein VITISV_041073                   54.7    9e-07   Vitis vinifera
emb|CAN77529.1|  hypothetical protein VITISV_041425                   54.7    9e-07   Vitis vinifera
emb|CAN63782.1|  hypothetical protein VITISV_010855                   54.3    9e-07   Vitis vinifera
emb|CAN73696.1|  hypothetical protein VITISV_038483                   54.7    9e-07   Vitis vinifera
emb|CAN79492.1|  hypothetical protein VITISV_033373                   54.7    1e-06   Vitis vinifera
ref|XP_010436828.1|  PREDICTED: uncharacterized protein LOC104720645  54.3    1e-06   
emb|CAN81385.1|  hypothetical protein VITISV_012324                   54.3    1e-06   Vitis vinifera
emb|CAN78598.1|  hypothetical protein VITISV_001332                   54.3    1e-06   Vitis vinifera
emb|CAN83808.1|  hypothetical protein VITISV_026963                   54.3    1e-06   Vitis vinifera
ref|XP_010463099.1|  PREDICTED: uncharacterized protein LOC104743749  54.3    1e-06   
ref|XP_010683397.1|  PREDICTED: uncharacterized protein LOC104898087  53.9    1e-06   
ref|XP_010424226.1|  PREDICTED: uncharacterized protein LOC104709284  53.9    1e-06   
ref|XP_004240625.1|  PREDICTED: uncharacterized protein LOC101261123  53.9    1e-06   
gb|ADK92880.1|  retrotransposon 4 protein                             53.9    1e-06   
ref|XP_010696216.1|  PREDICTED: uncharacterized protein LOC104908765  53.5    1e-06   
gb|ABW74573.1|  putative pol polyprotein                              53.9    1e-06   Boechera divaricarpa
emb|CBL54154.1|  hypothetical protein                                 52.4    1e-06   
ref|XP_010674610.1|  PREDICTED: uncharacterized protein LOC104890733  53.5    1e-06   
ref|XP_002064813.1|  GK15001                                          53.9    1e-06   Drosophila willistoni
ref|XP_009783587.1|  PREDICTED: uncharacterized protein LOC104232161  52.4    2e-06   
emb|CAA36615.1|  unnamed protein product                              53.5    2e-06   Solanum tuberosum [potatoes]
gb|AAF79879.1|AC000348_32  T7N9.5                                     53.9    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484894.1|  PREDICTED: uncharacterized protein LOC104763183  53.9    2e-06   
emb|CAN77868.1|  hypothetical protein VITISV_001383                   53.5    2e-06   Vitis vinifera
gb|AAF19226.1|AC007505_2  Highly similar to Ta1-3 polyprotein         53.9    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692480.1|  PREDICTED: uncharacterized protein LOC104905592  53.5    2e-06   
gb|ABH07899.1|  putative polyprotein                                  53.5    2e-06   Solanum lycopersicum
emb|CDP17739.1|  unnamed protein product                              53.1    2e-06   
emb|CAN69911.1|  hypothetical protein VITISV_027081                   53.5    2e-06   Vitis vinifera
emb|CAN67539.1|  hypothetical protein VITISV_021584                   53.5    2e-06   Vitis vinifera
gb|KHN06274.1|  Retrovirus-related Pol polyprotein from transposo...  53.5    2e-06   
emb|CAN69836.1|  hypothetical protein VITISV_026000                   53.5    2e-06   Vitis vinifera
emb|CAN79422.1|  hypothetical protein VITISV_002126                   53.5    2e-06   Vitis vinifera
emb|CAN72498.1|  hypothetical protein VITISV_010513                   53.5    2e-06   Vitis vinifera
emb|CAN83937.1|  hypothetical protein VITISV_042335                   53.1    2e-06   Vitis vinifera
emb|CAN67449.1|  hypothetical protein VITISV_031400                   53.5    2e-06   Vitis vinifera
emb|CAB10225.1|  retrovirus-related like polyprotein                  53.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CCA28129.1|  putative polyprotein                                 50.8    2e-06   
emb|CAN64452.1|  hypothetical protein VITISV_009528                   53.5    2e-06   Vitis vinifera
emb|CCA26486.1|  putative polyprotein                                 51.6    2e-06   
gb|AAF69161.1|AC007915_13  F27F5.19                                   53.1    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAD20307.1|  copia-type pol polyprotein                            53.1    3e-06   Zea mays [maize]
gb|ABF67921.1|  Ji1 putative pol protein                              53.1    3e-06   Zea mays [maize]
emb|CAN76332.1|  hypothetical protein VITISV_006269                   53.1    3e-06   Vitis vinifera
emb|CAN67587.1|  hypothetical protein VITISV_036279                   53.1    3e-06   Vitis vinifera
gb|AAV88069.1|  hypothetical retrotransposon                          53.1    3e-06   Ipomoea batatas [batate]
emb|CAN69870.1|  hypothetical protein VITISV_032283                   53.1    3e-06   Vitis vinifera
gb|AAL76004.1|AF466646_12  putative gag-pol polyprotein               53.1    3e-06   Zea mays [maize]
emb|CAN66125.1|  hypothetical protein VITISV_044030                   53.1    3e-06   Vitis vinifera
emb|CAN74229.1|  hypothetical protein VITISV_000584                   53.1    3e-06   Vitis vinifera
ref|XP_008644598.1|  PREDICTED: retrovirus-related Pol polyprotei...  52.0    3e-06   
ref|XP_010412990.1|  PREDICTED: uncharacterized protein LOC104699374  53.1    3e-06   
emb|CAN67009.1|  hypothetical protein VITISV_004754                   53.1    3e-06   Vitis vinifera
gb|AAN40025.1|  putative gag-pol polyprotein                          53.1    3e-06   Zea mays [maize]
emb|CAN72168.1|  hypothetical protein VITISV_004170                   53.1    3e-06   Vitis vinifera
emb|CAN64765.1|  hypothetical protein VITISV_009574                   53.1    3e-06   Vitis vinifera
emb|CAN82928.1|  hypothetical protein VITISV_025045                   53.1    3e-06   Vitis vinifera
emb|CAN59964.1|  hypothetical protein VITISV_022757                   53.1    3e-06   Vitis vinifera
emb|CAN62538.1|  hypothetical protein VITISV_031159                   53.1    3e-06   Vitis vinifera
emb|CAN79175.1|  hypothetical protein VITISV_001884                   53.1    3e-06   Vitis vinifera
emb|CAN72886.1|  hypothetical protein VITISV_019713                   53.1    3e-06   Vitis vinifera
emb|CAN70357.1|  hypothetical protein VITISV_013713                   53.1    3e-06   Vitis vinifera
emb|CAN63881.1|  hypothetical protein VITISV_039357                   53.1    3e-06   Vitis vinifera
ref|XP_009612717.1|  PREDICTED: uncharacterized protein LOC104105976  52.8    3e-06   
ref|XP_010677195.1|  PREDICTED: uncharacterized protein LOC104892872  52.8    3e-06   
emb|CAN69597.1|  hypothetical protein VITISV_038518                   53.1    3e-06   Vitis vinifera
emb|CAN65406.1|  hypothetical protein VITISV_030853                   52.8    3e-06   Vitis vinifera
emb|CAN81016.1|  hypothetical protein VITISV_025518                   52.8    3e-06   Vitis vinifera
emb|CAN70669.1|  hypothetical protein VITISV_037506                   53.1    3e-06   Vitis vinifera
emb|CAN72674.1|  hypothetical protein VITISV_020404                   52.0    3e-06   Vitis vinifera
ref|XP_010678923.1|  PREDICTED: uncharacterized protein LOC104894400  52.8    4e-06   
ref|XP_010683416.1|  PREDICTED: uncharacterized protein LOC104898103  52.4    4e-06   
dbj|BAA97099.1|  retroelement pol polyprotein-like                    52.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAD32759.1|  putative retroelement pol polyprotein                 52.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675050.1|  PREDICTED: uncharacterized protein LOC104891098  52.4    4e-06   
emb|CDP21887.1|  unnamed protein product                              52.4    4e-06   
emb|CAN66596.1|  hypothetical protein VITISV_019893                   52.8    4e-06   Vitis vinifera
ref|XP_010322961.1|  PREDICTED: uncharacterized protein LOC104648099  52.4    4e-06   
emb|CAN82221.1|  hypothetical protein VITISV_015226                   52.4    4e-06   Vitis vinifera
emb|CCA18867.1|  putative polyprotein                                 50.8    4e-06   
emb|CAN82754.1|  hypothetical protein VITISV_034296                   51.6    5e-06   Vitis vinifera
ref|XP_010695294.1|  PREDICTED: uncharacterized protein LOC104907962  52.4    5e-06   
gb|AAL55241.1|AF295693_1  polyprotein                                 52.4    5e-06   Anopheles gambiae
ref|XP_010274487.1|  PREDICTED: uncharacterized protein LOC104609798  52.0    5e-06   
ref|XP_007043660.1|  Uncharacterized protein TCM_008173               52.0    5e-06   
ref|XP_011070152.1|  PREDICTED: uncharacterized protein LOC105155865  52.0    5e-06   
ref|XP_010424200.1|  PREDICTED: uncharacterized protein LOC104709252  52.0    5e-06   
ref|XP_010686695.1|  PREDICTED: uncharacterized protein LOC104900863  52.0    6e-06   
ref|XP_004137882.1|  PREDICTED: ABC transporter C family member 1...  52.4    6e-06   
ref|XP_009781907.1|  PREDICTED: uncharacterized protein LOC104230728  52.0    6e-06   
emb|CAN83015.1|  hypothetical protein VITISV_041694                   52.0    6e-06   Vitis vinifera
emb|CAN79148.1|  hypothetical protein VITISV_004343                   52.4    6e-06   Vitis vinifera
emb|CAN82171.1|  hypothetical protein VITISV_040546                   52.0    6e-06   Vitis vinifera
emb|CAN73924.1|  hypothetical protein VITISV_041509                   52.4    6e-06   Vitis vinifera
emb|CAN73272.1|  hypothetical protein VITISV_013115                   52.0    6e-06   Vitis vinifera
ref|XP_010665837.1|  PREDICTED: uncharacterized protein LOC104883080  51.6    6e-06   
emb|CAN74847.1|  hypothetical protein VITISV_028741                   52.0    6e-06   Vitis vinifera
gb|ABI34342.1|  Polyprotein, putative                                 52.0    6e-06   Solanum demissum
gb|AAD24600.1|  putative retroelement pol polyprotein                 52.0    6e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAN81026.1|  hypothetical protein VITISV_023317                   52.0    6e-06   Vitis vinifera
emb|CAN82380.1|  hypothetical protein VITISV_021579                   52.0    6e-06   Vitis vinifera
ref|XP_007023091.1|  Uncharacterized protein TCM_027093               52.0    6e-06   
emb|CAA31653.1|  polyprotein                                          52.0    6e-06   
ref|XP_009804044.1|  PREDICTED: uncharacterized protein LOC104249333  51.6    6e-06   
emb|CAN67247.1|  hypothetical protein VITISV_008682                   52.0    6e-06   Vitis vinifera
emb|CDP17738.1|  unnamed protein product                              52.0    6e-06   
ref|XP_009348351.1|  PREDICTED: uncharacterized protein LOC103939989  52.0    6e-06   
emb|CAN82610.1|  hypothetical protein VITISV_021745                   52.0    7e-06   Vitis vinifera
emb|CAB46043.1|  retrotransposon like protein                         52.0    7e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAI72292.1|  putative polyprotein                                 52.0    7e-06   Phytophthora infestans [potato late blight]
emb|CAB75481.1|  copia-like polyprotein                               52.0    7e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAN76645.1|  hypothetical protein VITISV_004685                   52.0    7e-06   Vitis vinifera
ref|XP_009597447.1|  PREDICTED: uncharacterized protein LOC104093413  51.6    7e-06   
emb|CAN65308.1|  hypothetical protein VITISV_002323                   51.6    8e-06   Vitis vinifera
gb|AEJ72555.1|  putative retroelement polyprotein                     51.6    8e-06   
ref|XP_009788320.1|  PREDICTED: uncharacterized protein LOC104236139  51.6    8e-06   
emb|CAN75812.1|  hypothetical protein VITISV_004633                   51.2    8e-06   Vitis vinifera
emb|CAN81712.1|  hypothetical protein VITISV_038973                   51.6    9e-06   Vitis vinifera
emb|CAN60374.1|  hypothetical protein VITISV_001215                   51.6    9e-06   Vitis vinifera
emb|CAN72268.1|  hypothetical protein VITISV_017854                   51.6    9e-06   Vitis vinifera
gb|AAK51235.1|AF287471_1  polyprotein                                 51.6    1e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CAN76439.1|  hypothetical protein VITISV_001759                   51.2    1e-05   Vitis vinifera
ref|XP_010665586.1|  PREDICTED: uncharacterized protein LOC104882867  51.2    1e-05   
emb|CAN73014.1|  hypothetical protein VITISV_007603                   51.2    1e-05   Vitis vinifera
emb|CAN82851.1|  hypothetical protein VITISV_027998                   51.2    1e-05   Vitis vinifera
ref|XP_009623631.1|  PREDICTED: uncharacterized protein LOC104114778  51.2    1e-05   
emb|CAN75466.1|  hypothetical protein VITISV_025054                   51.2    1e-05   Vitis vinifera
emb|CAN80566.1|  hypothetical protein VITISV_029672                   51.2    1e-05   Vitis vinifera
emb|CAN68802.1|  hypothetical protein VITISV_008809                   51.2    1e-05   Vitis vinifera
emb|CAN82483.1|  hypothetical protein VITISV_006799                   51.2    1e-05   Vitis vinifera
ref|XP_004514853.1|  PREDICTED: uncharacterized protein LOC101509170  51.2    1e-05   
gb|ABE88096.1|  Integrase, catalytic region                           50.8    1e-05   Medicago truncatula
emb|CAN78262.1|  hypothetical protein VITISV_006704                   50.8    1e-05   Vitis vinifera
gb|AAM91874.1|  putative copia-like polyprotein                       51.2    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ACB45089.1|  putative polyprotein                                  50.8    1e-05   Solanum habrochaites
pir||S23319  hypothetical protein 2 - Arabidopsis thaliana retrot...  50.8    1e-05
emb|CAN67245.1|  hypothetical protein VITISV_008680                   50.8    1e-05   Vitis vinifera
ref|XP_011071708.1|  PREDICTED: uncharacterized protein LOC105157106  50.8    1e-05   
gb|KFY82599.1|  hypothetical protein V500_10440                       50.8    1e-05   
emb|CCA21190.1|  putative polyprotein                                 49.7    1e-05   
gb|AAC33963.1|  contains similarity to reverse transcriptases (Pf...  50.8    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682952.1|  PREDICTED: uncharacterized protein LOC104897713  50.8    2e-05   
emb|CAN75292.1|  hypothetical protein VITISV_014745                   50.8    2e-05   Vitis vinifera
emb|CAN62271.1|  hypothetical protein VITISV_010713                   50.8    2e-05   Vitis vinifera
emb|CAN80919.1|  hypothetical protein VITISV_002640                   50.8    2e-05   Vitis vinifera
emb|CAN62498.1|  hypothetical protein VITISV_000081                   50.8    2e-05   Vitis vinifera
ref|XP_010690723.1|  PREDICTED: uncharacterized protein LOC104904224  50.4    2e-05   
emb|CAN67322.1|  hypothetical protein VITISV_004158                   50.8    2e-05   Vitis vinifera
emb|CAN60972.1|  hypothetical protein VITISV_032051                   50.8    2e-05   Vitis vinifera
emb|CAN71161.1|  hypothetical protein VITISV_009113                   50.8    2e-05   Vitis vinifera
emb|CAN71436.1|  hypothetical protein VITISV_039529                   50.8    2e-05   Vitis vinifera
gb|AAT38797.2|  Polyprotein, putative                                 50.8    2e-05   Solanum demissum
emb|CAN69804.1|  hypothetical protein VITISV_017631                   50.8    2e-05   Vitis vinifera
emb|CAN80320.1|  hypothetical protein VITISV_034560                   50.8    2e-05   Vitis vinifera
ref|XP_010034499.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.8    2e-05   
gb|AEJ07943.1|  Ji4 putative pol protein                              50.8    2e-05   
gb|AAF99727.1|AC004557_6  F17L21.7                                    50.8    2e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CAN65504.1|  hypothetical protein VITISV_028342                   50.8    2e-05   Vitis vinifera
ref|XP_004233950.1|  PREDICTED: uncharacterized protein LOC101265997  50.4    2e-05   
emb|CAN64955.1|  hypothetical protein VITISV_029829                   50.8    2e-05   Vitis vinifera
ref|XP_010681616.1|  PREDICTED: uncharacterized protein LOC104896556  50.4    2e-05   
emb|CAN82105.1|  hypothetical protein VITISV_002577                   50.4    2e-05   Vitis vinifera
emb|CAN66087.1|  hypothetical protein VITISV_044185                   50.4    2e-05   
gb|ABI34329.1|  Integrase core domain containing protein              50.8    2e-05   
ref|XP_004149403.1|  PREDICTED: uncharacterized protein LOC101215551  50.1    2e-05   
gb|AAC02672.1|  polyprotein                                           50.4    2e-05   
ref|XP_010688568.1|  PREDICTED: uncharacterized protein LOC104902479  50.4    2e-05   
ref|XP_008384570.1|  PREDICTED: uncharacterized protein LOC103447138  50.4    2e-05   
ref|XP_006354297.1|  PREDICTED: uncharacterized protein LOC102601066  50.4    2e-05   
emb|CAN75041.1|  hypothetical protein VITISV_027174                   50.4    2e-05   
emb|CAN83799.1|  hypothetical protein VITISV_033272                   50.4    2e-05   
emb|CAN63908.1|  hypothetical protein VITISV_044218                   50.4    2e-05   
emb|CAN75186.1|  hypothetical protein VITISV_001913                   50.1    2e-05   
emb|CAN71109.1|  hypothetical protein VITISV_001479                   50.4    2e-05   
emb|CAN80715.1|  hypothetical protein VITISV_042933                   50.4    2e-05   
emb|CAN69680.1|  hypothetical protein VITISV_003773                   50.4    2e-05   
ref|XP_010412437.1|  PREDICTED: uncharacterized protein LOC104698730  49.7    2e-05   
emb|CAN79393.1|  hypothetical protein VITISV_010428                   50.1    2e-05   
ref|XP_007032202.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  50.1    3e-05   
ref|XP_009757051.1|  PREDICTED: uncharacterized protein LOC104209975  49.7    3e-05   
emb|CAN61929.1|  hypothetical protein VITISV_014855                   50.1    3e-05   
emb|CAN80131.1|  hypothetical protein VITISV_012432                   50.1    3e-05   
ref|XP_009631565.1|  PREDICTED: uncharacterized protein LOC104121310  49.7    3e-05   
ref|XP_010325686.1|  PREDICTED: uncharacterized protein LOC104649000  50.1    3e-05   
emb|CAN76896.1|  hypothetical protein VITISV_010605                   50.1    3e-05   
emb|CAN66898.1|  hypothetical protein VITISV_037436                   50.1    3e-05   
gb|KFK45117.1|  hypothetical protein AALP_AA1G346500                  50.1    3e-05   
ref|XP_010542220.1|  PREDICTED: uncharacterized protein LOC104815...  50.1    3e-05   
emb|CAN62181.1|  hypothetical protein VITISV_044399                   50.1    3e-05   
emb|CAN71029.1|  hypothetical protein VITISV_001707                   50.1    3e-05   
emb|CAN69340.1|  hypothetical protein VITISV_032634                   50.1    3e-05   
emb|CAN67882.1|  hypothetical protein VITISV_022356                   50.1    3e-05   
emb|CAN77638.1|  hypothetical protein VITISV_007620                   49.7    3e-05   
ref|XP_010412617.1|  PREDICTED: uncharacterized protein LOC104698945  50.1    3e-05   
ref|XP_009595927.1|  PREDICTED: uncharacterized protein LOC104092120  49.7    3e-05   
ref|XP_010473846.1|  PREDICTED: uncharacterized protein LOC104753269  50.1    3e-05   
ref|XP_010318106.1|  PREDICTED: uncharacterized protein LOC101244...  49.3    3e-05   
emb|CAB40067.1|  putative retrotransposon polyprotein                 50.1    3e-05   
ref|XP_009778056.1|  PREDICTED: uncharacterized protein LOC104227505  49.7    3e-05   
emb|CAN62394.1|  hypothetical protein VITISV_021305                   50.1    3e-05   
gb|KHN05285.1|  Retrovirus-related Pol polyprotein from transposo...  49.7    4e-05   
ref|XP_010420948.1|  PREDICTED: uncharacterized protein LOC104706448  49.7    4e-05   
ref|XP_009377992.1|  PREDICTED: uncharacterized protein LOC103966547  49.7    4e-05   
emb|CAN81217.1|  hypothetical protein VITISV_020309                   49.7    4e-05   
emb|CCA25182.1|  putative polyprotein                                 49.3    4e-05   
emb|CAN62130.1|  hypothetical protein VITISV_019730                   49.3    4e-05   
emb|CAN59949.1|  hypothetical protein VITISV_043423                   49.7    4e-05   
emb|CAN68496.1|  hypothetical protein VITISV_010947                   49.7    4e-05   
emb|CAN61548.1|  hypothetical protein VITISV_043524                   49.7    4e-05   
ref|XP_010318103.1|  PREDICTED: uncharacterized protein LOC101244...  49.3    4e-05   
gb|AAT38758.1|  Putative gag-pol polyprotein, identical               49.7    4e-05   
ref|XP_010318097.1|  PREDICTED: uncharacterized protein LOC101244...  49.3    4e-05   
ref|XP_003605102.1|  Peptide transporter PTR2                         49.7    4e-05   
ref|XP_010412743.1|  PREDICTED: uncharacterized protein LOC104699096  49.7    4e-05   
emb|CAN76078.1|  hypothetical protein VITISV_008973                   49.7    4e-05   
ref|XP_010273338.1|  PREDICTED: uncharacterized protein LOC104608907  49.7    4e-05   
gb|EPS62921.1|  hypothetical protein M569_11867                       49.7    4e-05   
ref|XP_009780502.1|  PREDICTED: uncharacterized protein LOC104229549  49.3    4e-05   
ref|XP_010318102.1|  PREDICTED: uncharacterized protein LOC101244...  49.3    4e-05   
emb|CAN62636.1|  hypothetical protein VITISV_006313                   49.7    4e-05   
ref|XP_010318104.1|  PREDICTED: uncharacterized protein LOC101244...  49.3    4e-05   
emb|CAN70229.1|  hypothetical protein VITISV_024789                   49.7    4e-05   
emb|CAN69998.1|  hypothetical protein VITISV_006839                   49.7    4e-05   
emb|CAN70361.1|  hypothetical protein VITISV_033646                   49.7    4e-05   
emb|CAN65235.1|  hypothetical protein VITISV_040876                   49.7    4e-05   
ref|XP_010672345.1|  PREDICTED: uncharacterized protein LOC104888929  49.3    4e-05   
gb|AAT38747.2|  Polyprotein, putative                                 49.7    5e-05   
emb|CAN74430.1|  hypothetical protein VITISV_010987                   49.7    5e-05   
ref|XP_003599760.1|  Peptide transporter PTR2                         49.3    5e-05   
ref|XP_003599761.1|  Peptide transporter PTR2                         49.3    5e-05   
gb|EMS66757.1|  Anthranilate synthase component I-1, chloroplastic    49.3    5e-05   
ref|XP_004149623.1|  PREDICTED: uncharacterized protein LOC101211618  49.7    5e-05   
emb|CDN96898.1|  putative Ty-1 copia retrotransposon                  49.3    6e-05   
ref|XP_009354649.1|  PREDICTED: uncharacterized protein LOC103945791  48.9    6e-05   
ref|XP_010671949.1|  PREDICTED: uncharacterized protein LOC104888623  48.9    6e-05   
ref|XP_004509781.1|  PREDICTED: uncharacterized protein LOC101498326  48.9    6e-05   
ref|XP_008460736.1|  PREDICTED: uncharacterized protein LOC103499498  48.9    6e-05   
gb|ABO36622.1|  copia LTR rider                                       49.3    6e-05   
ref|XP_010436367.1|  PREDICTED: uncharacterized protein LOC104720097  48.9    6e-05   
ref|XP_009623363.1|  PREDICTED: uncharacterized protein LOC104114593  48.9    6e-05   
ref|XP_008214030.1|  PREDICTED: uncharacterized protein LOC103317529  48.9    7e-05   
dbj|BAB01972.1|  copia-like retrotransposable element                 48.9    7e-05   
gb|ABA95797.1|  retrotransposon protein, putative, unclassified       48.9    7e-05   
ref|XP_010229840.1|  PREDICTED: uncharacterized protein LOC104582180  48.9    7e-05   
ref|XP_009591989.1|  PREDICTED: uncharacterized protein LOC104088926  48.9    7e-05   
ref|XP_008654353.1|  PREDICTED: uncharacterized protein LOC100193...  48.9    7e-05   
ref|XP_007033295.1|  Uncharacterized protein TCM_019488               48.9    7e-05   
ref|XP_008654354.1|  PREDICTED: uncharacterized protein LOC100193...  48.5    8e-05   
emb|CAN63612.1|  hypothetical protein VITISV_032683                   48.9    8e-05   
emb|CAN68682.1|  hypothetical protein VITISV_024814                   48.9    8e-05   
emb|CDY09583.1|  BnaC05g23360D                                        48.9    8e-05   
emb|CAN64580.1|  hypothetical protein VITISV_002159                   48.9    9e-05   
ref|XP_008647645.1|  PREDICTED: uncharacterized protein LOC100502...  48.5    9e-05   
ref|XP_010418794.1|  PREDICTED: uncharacterized protein LOC104704393  48.5    9e-05   
ref|XP_008669041.1|  PREDICTED: uncharacterized protein LOC103646095  48.5    9e-05   
gb|AAD36943.1|AF069441_3  putative polyprotein                        48.5    9e-05   
ref|XP_008654352.1|  PREDICTED: uncharacterized protein LOC100193...  48.5    9e-05   
emb|CAN69647.1|  hypothetical protein VITISV_022133                   48.9    9e-05   
gb|KFK44388.1|  hypothetical protein AALP_AA1G251100                  48.5    1e-04   
ref|XP_008674201.1|  PREDICTED: uncharacterized protein LOC100279...  48.5    1e-04   
emb|CAN78464.1|  hypothetical protein VITISV_025101                   48.5    1e-04   
ref|XP_010690733.1|  PREDICTED: uncharacterized protein LOC104904233  48.1    1e-04   
gb|ABI34306.1|  Polyprotein, putative                                 48.5    1e-04   
ref|XP_010474097.1|  PREDICTED: uncharacterized protein LOC104753560  48.1    1e-04   
ref|XP_009356290.1|  PREDICTED: retrovirus-related Pol polyprotei...  48.1    1e-04   
ref|XP_009775421.1|  PREDICTED: uncharacterized protein LOC104225345  47.8    1e-04   
ref|XP_004241086.1|  PREDICTED: uncharacterized protein LOC101248883  48.1    1e-04   
ref|XP_008465178.1|  PREDICTED: uncharacterized protein LOC103502842  47.8    1e-04   
gb|AAK43485.1|AC084807_10  polyprotein, putative                      48.5    1e-04   
ref|XP_008651726.1|  PREDICTED: hypothetical protein isoform X1       48.1    1e-04   
ref|XP_006359484.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  48.5    1e-04   
ref|XP_003376336.1|  retrovirus-related Pol polyprotein from tran...  48.1    1e-04   
ref|XP_009145096.1|  PREDICTED: uncharacterized protein LOC103868780  48.5    1e-04   
ref|XP_008213150.1|  PREDICTED: retrovirus-related Pol polyprotei...  48.1    1e-04   
ref|XP_009802374.1|  PREDICTED: uncharacterized protein LOC104247922  47.0    1e-04   
emb|CAE05707.2|  OSJNBb0065J09.3                                      48.1    1e-04   
emb|CAN74198.1|  hypothetical protein VITISV_005765                   48.1    1e-04   
gb|AIC77183.1|  polyprotein                                           48.1    1e-04   
emb|CAN77072.1|  hypothetical protein VITISV_006213                   48.1    1e-04   
ref|XP_004231364.1|  PREDICTED: uncharacterized protein LOC101245809  48.1    1e-04   
emb|CAN67240.1|  hypothetical protein VITISV_037460                   48.1    1e-04   
emb|CAN76321.1|  hypothetical protein VITISV_044445                   48.1    1e-04   
ref|XP_010444961.1|  PREDICTED: uncharacterized protein LOC104727565  48.1    1e-04   
emb|CAH66391.1|  OSIGBa0134J07.9                                      48.1    1e-04   
gb|AER13172.1|  putative gag/pol polyprotein                          48.1    1e-04   
emb|CAN74984.1|  hypothetical protein VITISV_035210                   48.1    1e-04   
ref|XP_008674202.1|  PREDICTED: retrovirus-related Pol polyprotei...  47.8    1e-04   
ref|XP_009123624.1|  PREDICTED: uncharacterized protein LOC103848474  47.8    2e-04   
emb|CAN77085.1|  hypothetical protein VITISV_044282                   48.1    2e-04   
emb|CAN78912.1|  hypothetical protein VITISV_004522                   47.8    2e-04   
emb|CAN83869.1|  hypothetical protein VITISV_037705                   47.8    2e-04   
ref|XP_009348182.1|  PREDICTED: uncharacterized protein LOC103939788  47.8    2e-04   
emb|CAN62623.1|  hypothetical protein VITISV_001656                   47.8    2e-04   
dbj|BAA78425.1|  polyprotein                                          47.8    2e-04   
dbj|BAK41507.1|  polyprotein                                          47.8    2e-04   
ref|XP_006603607.1|  PREDICTED: uncharacterized protein LOC100791776  47.8    2e-04   
emb|CAN65149.1|  hypothetical protein VITISV_037085                   47.8    2e-04   
emb|CAN73532.1|  hypothetical protein VITISV_012827                   47.8    2e-04   
emb|CAN65367.1|  hypothetical protein VITISV_032069                   47.8    2e-04   
ref|XP_009760003.1|  PREDICTED: uncharacterized protein LOC104212438  47.0    2e-04   
gb|ACS74199.1|  putative gag-pol polyprotein                          47.8    2e-04   
ref|XP_007027404.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  47.8    2e-04   
emb|CAJ09951.2|  putative gag-pol polyprotein                         47.8    2e-04   
emb|CAN82574.1|  hypothetical protein VITISV_034720                   47.8    2e-04   
ref|XP_009623549.1|  PREDICTED: uncharacterized protein LOC104114741  47.4    2e-04   
emb|CAN73119.1|  hypothetical protein VITISV_020442                   47.4    2e-04   
emb|CAN63730.1|  hypothetical protein VITISV_030286                   47.8    2e-04   
gb|ABR67407.1|  integrase                                             47.8    2e-04   
emb|CAN65229.1|  hypothetical protein VITISV_011708                   47.8    2e-04   
ref|XP_010513552.1|  PREDICTED: uncharacterized protein LOC104789576  47.4    2e-04   
ref|XP_009109940.1|  PREDICTED: uncharacterized protein LOC103835509  47.4    2e-04   
ref|XP_010325229.1|  PREDICTED: uncharacterized protein LOC104648889  47.4    2e-04   
gb|ACL97387.1|  Gag-Pol polyprotein                                   47.4    2e-04   
emb|CCA28017.1|  putative polyprotein                                 47.0    2e-04   
gb|ABA93844.2|  retrotransposon protein, putative, unclassified       47.4    2e-04   
emb|CAN75744.1|  hypothetical protein VITISV_040125                   47.4    2e-04   
emb|CAN76679.1|  hypothetical protein VITISV_034325                   47.4    2e-04   
dbj|BAB10876.1|  polyprotein                                          47.4    2e-04   
ref|XP_008372204.1|  PREDICTED: uncharacterized protein LOC103435597  47.4    2e-04   
ref|XP_009612658.1|  PREDICTED: uncharacterized protein LOC104105930  47.4    2e-04   
ref|XP_010666172.1|  PREDICTED: uncharacterized protein LOC104883361  47.4    2e-04   
gb|AAR88589.1|  putative copia-like retrotransposon protein           47.4    2e-04   
emb|CAN63563.1|  hypothetical protein VITISV_003097                   47.4    3e-04   
emb|CAN77201.1|  hypothetical protein VITISV_002545                   47.0    3e-04   
emb|CAN83378.1|  hypothetical protein VITISV_011333                   47.0    3e-04   
gb|ADB85429.1|  putative retrotransposon protein                      47.4    3e-04   
ref|XP_008238705.1|  PREDICTED: uncharacterized protein LOC103337321  46.6    3e-04   
emb|CAC95126.1|  gag-pol polyprotein                                  47.4    3e-04   
ref|XP_010501854.1|  PREDICTED: uncharacterized protein LOC104779171  47.0    3e-04   
emb|CAN60366.1|  hypothetical protein VITISV_031870                   47.4    3e-04   
gb|AAL68641.1|AF458765_1  polyprotein                                 47.4    3e-04   
emb|CAN71759.1|  hypothetical protein VITISV_020777                   47.4    3e-04   
ref|XP_007009039.1|  Copia-like retrotransposable element, putative   47.4    3e-04   
emb|CCI55315.1|  PH01B001I13.11                                       47.0    3e-04   
gb|ABD32757.1|  Integrase, catalytic region                           47.0    3e-04   
emb|CAN81715.1|  hypothetical protein VITISV_032902                   47.0    3e-04   
emb|CAN79526.1|  hypothetical protein VITISV_001135                   47.0    3e-04   
emb|CAN82753.1|  hypothetical protein VITISV_034295                   46.6    3e-04   
emb|CAN61011.1|  hypothetical protein VITISV_038445                   47.0    3e-04   
emb|CAN80547.1|  hypothetical protein VITISV_010898                   47.0    3e-04   
ref|XP_008672007.1|  PREDICTED: uncharacterized protein LOC100191...  45.8    3e-04   
emb|CAN62074.1|  hypothetical protein VITISV_001619                   47.0    3e-04   
emb|CAN74286.1|  hypothetical protein VITISV_036410                   47.0    3e-04   
emb|CAN80753.1|  hypothetical protein VITISV_003323                   47.0    3e-04   
emb|CAN84135.1|  hypothetical protein VITISV_000113                   47.0    3e-04   
ref|XP_010275351.1|  PREDICTED: uncharacterized protein LOC104610434  46.2    3e-04   
emb|CCA24687.1|  putative polyprotein                                 46.6    4e-04   
emb|CAN60498.1|  hypothetical protein VITISV_027869                   47.0    4e-04   
emb|CAN80469.1|  hypothetical protein VITISV_008623                   47.0    4e-04   
gb|EMS45473.1|  Retrovirus-related Pol polyprotein from transposo...  46.6    4e-04   
gb|AAC28238.1|  contains similarity to reverse trancriptase (Pfam...  47.0    4e-04   
emb|CAN82064.1|  hypothetical protein VITISV_022772                   47.0    4e-04   
ref|XP_008801814.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...  46.6    4e-04   
emb|CAN60238.1|  hypothetical protein VITISV_032906                   47.0    4e-04   
emb|CAN80763.1|  hypothetical protein VITISV_017069                   46.6    4e-04   
dbj|BAD34493.1|  Gag-Pol                                              47.0    4e-04   
ref|XP_009797254.1|  PREDICTED: uncharacterized protein LOC104243714  46.6    4e-04   
emb|CAN63777.1|  hypothetical protein VITISV_043745                   46.6    4e-04   
dbj|BAA87949.1|  retrotransposon homolog                              46.6    4e-04   
emb|CAN72663.1|  hypothetical protein VITISV_031849                   46.6    4e-04   
emb|CAN82041.1|  hypothetical protein VITISV_033522                   46.6    4e-04   
emb|CAN77664.1|  hypothetical protein VITISV_007221                   46.6    4e-04   
emb|CAN72951.1|  hypothetical protein VITISV_020157                   46.6    4e-04   
emb|CAN64882.1|  hypothetical protein VITISV_027289                   45.8    4e-04   
dbj|BAK41512.1|  C-end truncated polyprotein                          46.6    4e-04   
emb|CAN61179.1|  hypothetical protein VITISV_032292                   46.6    4e-04   
ref|XP_007014704.1|  Uncharacterized protein TCM_040108               46.2    4e-04   
gb|ADE10067.1|  rve                                                   46.6    4e-04   
dbj|BAA78423.1|  polyprotein                                          46.6    5e-04   
gb|AAK62788.1|AC027036_9  polyprotein, putative                       46.6    5e-04   
dbj|BAK41511.1|  polyprotein                                          46.6    5e-04   
gb|AAK62793.1|AC027036_14  polyprotein, putative                      46.6    5e-04   
emb|CAE03644.2|  OSJNBa0060N03.9                                      46.6    5e-04   
emb|CAN76032.1|  hypothetical protein VITISV_040150                   46.6    5e-04   
emb|CAN82526.1|  hypothetical protein VITISV_028058                   46.6    5e-04   
ref|XP_009614489.1|  PREDICTED: uncharacterized protein LOC104107402  46.2    5e-04   
ref|XP_009373186.1|  PREDICTED: uncharacterized protein LOC103962231  46.6    5e-04   
gb|ACI62137.1|  polyprotein                                           46.6    5e-04   
gb|AAT47077.1|  putative polyprotein                                  46.6    5e-04   
gb|ABA95820.1|  retrotransposon protein, putative, unclassified       46.6    5e-04   
gb|AAL58228.1|AC084762_2  putative gag-pol polyprotein                46.6    5e-04   
emb|CAA20201.1|  putative transposable element                        46.6    5e-04   
gb|ABA95799.2|  retrotransposon protein, putative, unclassified, ...  46.6    5e-04   



>emb|CAN71595.1| hypothetical protein VITISV_010143 [Vitis vinifera]
Length=1523

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDHSR+ WVYLM  KSE RS L+ F NLV NQFG++++ +R
Sbjct  603  GAQYFLTIVDDHSRSTWVYLMHHKSEARSLLVHFVNLVANQFGSQVKIVR  652



>emb|CAN67762.1| hypothetical protein VITISV_040650 [Vitis vinifera]
Length=1316

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLTI+DDHSR VW+YLM+ KSE +  L  FC + + QF   ++CIR
Sbjct  462  GAHYFLTIVDDHSRGVWIYLMKEKSETKDILQNFCFMTKTQFDKPVKCIR  511



>ref|XP_010419216.1| PREDICTED: uncharacterized protein LOC104704906 [Camelina sativa]
Length=973

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +FLTI+DDHSRA WVYL+R KSE  + L GF ++VE QF T+I+ +R
Sbjct  463  YFLTIVDDHSRATWVYLLRNKSEAITVLPGFVSMVETQFDTKIKAVR  509



>ref|XP_010419217.1| PREDICTED: uncharacterized protein LOC104704907 [Camelina sativa]
Length=1032

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +FLTI+DDHSRA WVYL+R KSE  + L GF ++VE QF T+I+ +R
Sbjct  463  YFLTIVDDHSRATWVYLLRNKSEAITVLPGFVSMVETQFDTKIKAVR  509



>gb|AAD25646.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1461

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDHSRA W+YL+++KS+V +    F +LVENQ+ TR++ +R
Sbjct  643  GYKYFLTIVDDHSRATWIYLLKSKSDVLTVFPAFIDLVENQYDTRVKSVR  692



>ref|XP_010424680.1| PREDICTED: uncharacterized protein LOC104709822 [Camelina sativa]
Length=1185

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDHSRA WVYL++ KS+V +    F N VENQ+ T+++ +R
Sbjct  580  GYKYFLTIVDDHSRATWVYLLKNKSDVHTVFPAFVNQVENQYNTKVKSVR  629



>ref|XP_009144811.1| PREDICTED: uncharacterized protein LOC103868473 [Brassica rapa]
Length=860

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW++L+  KSEV++ L  FCNLV  QFG  +R +R
Sbjct  457  GAVYFLTIVDDFSRAVWIHLLLEKSEVKTVLPNFCNLVLRQFGHPVRTVR  506



>ref|XP_010278082.1| PREDICTED: uncharacterized protein LOC104612388 [Nelumbo nucifera]
Length=815

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SR VW+YLM  KSEV + ++ FC +V  QF +++R IR
Sbjct  436  GAIYFLTIVDDYSRVVWIYLMAEKSEVGANIVKFCAMVMTQFDSKVRVIR  485



>ref|XP_010268948.1| PREDICTED: uncharacterized protein LOC104605761 [Nelumbo nucifera]
Length=680

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SRAVWVYL+  KSEV   +  FC +VE QFG ++R ++
Sbjct  324  GAIYFLTIVDDYSRAVWVYLLLEKSEVAHIIENFCAMVERQFGKQVRAVQ  373



>gb|AAC62795.1| contains similarity to retroviral aspartyl proteases (Pfam: rvp.hmm, 
score: 11.80) [Arabidopsis thaliana]
Length=1244

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDHSRA WVYL++ KSEV S    F   VENQ+  +++ +R
Sbjct  604  GFKYFLTIVDDHSRATWVYLLKTKSEVLSVFPAFVTRVENQYNVKVKAVR  653



>ref|XP_010542100.1| PREDICTED: uncharacterized protein LOC104815417 [Tarenaya hassleriana]
 ref|XP_010552828.1| PREDICTED: uncharacterized protein LOC104823102 [Tarenaya hassleriana]
Length=614

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+TI+DDHSR  WVY++R KSEV++ +  F +LVE QF  +++ IR
Sbjct  557  GYKYFVTIVDDHSRTTWVYMLRQKSEVKAIIPQFISLVERQFTVKVKAIR  606



>gb|AAG51258.1|AC025782_3 Ty1/copia-element polyprotein [Arabidopsis thaliana]
Length=1152

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLTI+DDHSRAVW++LM AKSEV S L  F  +   QF  +++ +R
Sbjct  589  GAHYFLTIVDDHSRAVWIHLMLAKSEVASLLQQFIAMASRQFNKQVKTVR  638



>ref|XP_010670882.1| PREDICTED: uncharacterized protein LOC104887829 [Beta vulgaris 
subsp. vulgaris]
Length=605

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  HGRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +G H+FLTILDDHSR VW YL++ K +V  T+  F  L+E QF  +++ IR
Sbjct  545  NGAHYFLTILDDHSRVVWTYLLQNKFQVAKTISDFLALIETQFEKKVKSIR  595



>ref|XP_010526684.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X6 [Tarenaya hassleriana]
Length=789

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  FFL+I+DD+SR  WVYL+++KS+V      F + VENQF   I+C+R
Sbjct  166  GHRFFLSIVDDYSRCTWVYLLKSKSDVLQKFPEFVSFVENQFNASIKCVR  215



>gb|AAG10817.1|AC011808_5 Putative retroelement polyprotein [Arabidopsis thaliana]
Length=1413

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLTI+DDH+R  WVYLM+ KS+V +    F  +VE Q+ T+++ +R
Sbjct  608  GYHYFLTIVDDHTRVTWVYLMKYKSDVLTIFPDFITMVETQYDTKVKAVR  657



>ref|XP_010526683.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X5 [Tarenaya hassleriana]
Length=886

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  FFL+I+DD+SR  WVYL+++KS+V      F + VENQF   I+C+R
Sbjct  263  GHRFFLSIVDDYSRCTWVYLLKSKSDVLQKFPEFVSFVENQFNASIKCVR  312



>ref|XP_010526682.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X4 [Tarenaya hassleriana]
Length=940

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  FFL+I+DD+SR  WVYL+++KS+V      F + VENQF   I+C+R
Sbjct  317  GHRFFLSIVDDYSRCTWVYLLKSKSDVLQKFPEFVSFVENQFNASIKCVR  366



>ref|XP_010526681.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X3 [Tarenaya hassleriana]
Length=1238

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  FFL+I+DD+SR  WVYL+++KS+V      F + VENQF   I+C+R
Sbjct  652  GHRFFLSIVDDYSRCTWVYLLKSKSDVLQKFPEFVSFVENQFNASIKCVR  701



>ref|XP_010526680.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X2 [Tarenaya hassleriana]
Length=1244

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  FFL+I+DD+SR  WVYL+++KS+V      F + VENQF   I+C+R
Sbjct  621  GHRFFLSIVDDYSRCTWVYLLKSKSDVLQKFPEFVSFVENQFNASIKCVR  670



>ref|XP_010526678.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X1 [Tarenaya hassleriana]
Length=1275

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  FFL+I+DD+SR  WVYL+++KS+V      F + VENQF   I+C+R
Sbjct  652  GHRFFLSIVDDYSRCTWVYLLKSKSDVLQKFPEFVSFVENQFNASIKCVR  701



>gb|AAB61111.1| Strong similarity to Zea mays retrotransposon Hopscotch polyprotein 
(gb|U12626) [Arabidopsis thaliana]
Length=1315

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SRA WVYL+R KS+V + +  F  +VENQF T I+ +R
Sbjct  481  GYRYFLTIVDDYSRATWVYLLRNKSDVLTVIPTFVTMVENQFETTIKGVR  530



>ref|XP_010256211.1| PREDICTED: uncharacterized protein LOC104596654 [Nelumbo nucifera]
Length=597

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIR  11
            G  +FLTI+DD+SRA+W+YL+  KSEV  TL  FC +VE QF  +++
Sbjct  256  GAAYFLTIVDDYSRAIWIYLLAEKSEVGRTLKNFCAMVERQFNKKVK  302



>gb|AAC67205.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1413

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SR+VW YL+ AKSEVRS L  F    E QFG  ++ IR
Sbjct  585  GAVYFLTIVDDFSRSVWTYLLLAKSEVRSVLTNFLAYTEKQFGKSVKIIR  634



>ref|XP_004250863.1| PREDICTED: uncharacterized protein LOC101267084 [Solanum lycopersicum]
Length=747

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLT++DD+SRA W  L+R KS    T+  F +L+ENQF TR++ IR
Sbjct  682  GYHYFLTMVDDNSRATWTQLIRCKSNALHTIKAFISLIENQFHTRLKTIR  731



>dbj|BAA97287.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1491

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SR+VW YL+ AKSEVRS L  F    E QFG  ++ IR
Sbjct  585  GAVYFLTIVDDFSRSVWTYLLLAKSEVRSVLTNFLAYTEKQFGKSVKIIR  634



>emb|CAN73795.1| hypothetical protein VITISV_036649 [Vitis vinifera]
Length=828

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL ++DD+SR VW+YL+  K +V ST + F  LVENQF T I+C++
Sbjct  194  GARYFLLLIDDYSRFVWLYLLSTKDQVHSTFVQFKTLVENQFQTTIKCLQ  243



>ref|XP_008778555.1| PREDICTED: uncharacterized protein LOC103698337 [Phoenix dactylifera]
Length=848

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SRA WVYLM++K++ R  +  F  L+E QF T+I+ IR
Sbjct  483  GSKYFLTIVDDYSRATWVYLMQSKAQTRDIIRSFYVLIEVQFSTKIKMIR  532



>gb|AAD41979.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1264

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDHSRA W+YL++ KSEV +    F   VENQ+  +++ +R
Sbjct  491  GYQYFLTIVDDHSRATWIYLLKTKSEVLTIFHDFIQQVENQYKVKVKAVR  540



>ref|XP_009801985.1| PREDICTED: uncharacterized protein LOC104247620 [Nicotiana sylvestris]
Length=686

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +FLTI+DD+SR  W+YLM+ KS+V   LI F  LV+NQF T I+ IR
Sbjct  628  YFLTIVDDYSRMTWIYLMKMKSDVFLLLISFLALVKNQFSTTIKIIR  674



>gb|AAD26943.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1454

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDHSRA W+YL++ KSEV +    F   VENQ+  +++ +R
Sbjct  632  GYKYFLTIVDDHSRATWMYLLKTKSEVLTVFPAFIQQVENQYKVKVKAVR  681



>dbj|BAB10503.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1475

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SRA WVYLM+AK++V      F  +VE Q+GT ++ +R
Sbjct  660  GYKYFLTIVDDYSRATWVYLMKAKNDVLQIFPDFLKMVETQYGTLVKAVR  709



>emb|CAA72989.1| unnamed protein product [Brassica oleracea var. viridis]
Length=1131

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDHSRA W+YL+++KS+V      F N +E Q+ T+I+ +R
Sbjct  592  GYKYFLTIVDDHSRATWIYLLQSKSDVLHIFPTFVNQIETQYNTKIKSVR  641



>ref|XP_010262896.1| PREDICTED: uncharacterized protein LOC104601304 [Nelumbo nucifera]
Length=471

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SR VWVYL+  KSEV   +  FC + E QFG ++R +R
Sbjct  242  GAVYFLTIVDDYSRVVWVYLLLEKSEVAHIVDNFCAMAERQFGKQVRVVR  291



>emb|CAN72141.1| hypothetical protein VITISV_017108 [Vitis vinifera]
Length=1416

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ +F+T +DDH+R  WVYLMR KSEV      F  ++ENQF T+I  +R
Sbjct  491  GKKWFVTFIDDHTRLCWVYLMREKSEVERIFKEFYKMIENQFQTKISILR  540



>gb|AAD23883.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1156

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW YL+ AKSEVR+ L  F    E QFG  ++ +R
Sbjct  163  GAVYFLTIVDDFSRAVWTYLLLAKSEVRTVLTNFLVYTEKQFGKSVKVLR  212



>emb|CAN71553.1| hypothetical protein VITISV_034738 [Vitis vinifera]
Length=1312

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL ++DD+SR VW YL+  K +V ST + F  LVENQF T I+C++
Sbjct  481  GARYFLLLMDDYSRFVWFYLLPTKDQVHSTFVQFKTLVENQFQTTIKCLQ  530



>ref|XP_010436765.1| PREDICTED: uncharacterized protein LOC104720575 [Camelina sativa]
Length=282

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  HGRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +G  +FLTI+DD  RAVW YLM AKSEVR  L  F    E QFG  +R IR
Sbjct  222  YGAVYFLTIVDDFLRAVWTYLMPAKSEVRGVLTNFFAYTEKQFGKTVRMIR  272



>ref|XP_010451244.1| PREDICTED: uncharacterized protein LOC104733360 [Camelina sativa]
Length=1126

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDHSRA W+YL++ KS+V S    F   VE Q+ T+++ +R
Sbjct  459  GYKYFLTIVDDHSRATWIYLIKNKSDVLSVFPAFIKRVETQYNTKVKSVR  508



>gb|AAG50751.1|AC079733_19 polyprotein, putative [Arabidopsis thaliana]
Length=1468

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SR VWVYLM  KSE +  L  F  LVE QF T I+ +R
Sbjct  589  GARYFLTIVDDYSRGVWVYLMTDKSETQKHLKDFIALVERQFDTEIKIVR  638



>gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1501

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SRAVW YL+  KSEVR  L  F    E QFG  ++ +R
Sbjct  602  GAVYFLTIVDDYSRAVWTYLLLEKSEVRQVLTNFLKYAEKQFGKTVKMVR  651



>ref|XP_009123417.1| PREDICTED: uncharacterized protein LOC103848213 [Brassica rapa]
Length=747

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SRAVW Y +  KSEV++ L  FC +   QFG  ++ +R
Sbjct  419  GAVYFLTIVDDYSRAVWTYFLLEKSEVKTVLQNFCTMTYKQFGKHVKIVR  468



>ref|XP_010692440.1| PREDICTED: uncharacterized protein LOC104905550 [Beta vulgaris 
subsp. vulgaris]
Length=626

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLT++DD+SR VWVYL+ +K+EV S    F  ++E QF   ++ IR
Sbjct  369  GAHYFLTLVDDYSRGVWVYLLDSKTEVSSAFCSFFAMIERQFEVPVKLIR  418



>dbj|BAB10743.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1109

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SR VWVYLM  KSE +  L  F  LVE QF T I+ +R
Sbjct  365  GARYFLTIVDDYSRGVWVYLMTDKSETQKHLKDFIALVERQFDTEIKTVR  414



>gb|KHN01991.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1311

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  HGRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            HG  +FLTI+DDHSR  WV+LM  K+E R  ++ F   VE Q+  +I+ IR
Sbjct  474  HGHKYFLTIVDDHSRFTWVHLMHTKAETRDIIVNFIASVETQYNKKIKKIR  524



>ref|XP_004229082.1| PREDICTED: uncharacterized protein LOC101247852 [Solanum lycopersicum]
Length=575

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD+SR  W++LMR KS+V S L  F   VE QFG RI+ IR
Sbjct  488  GMRYFLTVVDDYSRCTWIFLMRLKSDVVSLLKHFFTEVETQFGKRIQKIR  537



>emb|CAA18107.1| LTR retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB79159.1| LTR retrotransposon like protein [Arabidopsis thaliana]
Length=1109

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SR VWVYLM  KSE +  L  F  LVE QF T I+ +R
Sbjct  365  GARYFLTIVDDYSRGVWVYLMTDKSETQKHLKDFMALVERQFDTEIKTVR  414



>ref|XP_004235138.1| PREDICTED: uncharacterized protein LOC101243773 [Solanum lycopersicum]
Length=957

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLT++DD++R+ W  L+R KS    T+  F +L+ENQF T+++ IR
Sbjct  673  GYHYFLTMVDDYNRSTWTQLLRCKSNALQTIKAFVSLIENQFQTKLKAIR  722



>ref|XP_004498431.1| PREDICTED: uncharacterized protein LOC101490285 [Cicer arietinum]
Length=924

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD SR  W+YLM+ KSE  S +  F ++V+ QFG  ++CIR
Sbjct  574  GFKYFLTVVDDKSRFCWIYLMKLKSETSSLVKSFVSMVKTQFGKTVKCIR  623



>ref|XP_011079197.1| PREDICTED: uncharacterized protein LOC105162774 [Sesamum indicum]
Length=473

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G ++ LTILDD+SR++W YL++ K +V STL  F  LVE Q+ T+I+ IR
Sbjct  270  GFNYVLTILDDYSRSLWTYLLKHKDQVASTLQTFVALVETQYETKIKVIR  319



>gb|AAB87099.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1496

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD+SR+VW YLM +K+EV   +  FC + E QFG +++  R
Sbjct  575  GAVYFLTLVDDYSRSVWTYLMSSKTEVSQLIKNFCAMSERQFGKQVKAFR  624



>ref|XP_004499523.1| PREDICTED: uncharacterized protein LOC101509950 [Cicer arietinum]
Length=370

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  HGRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            HG  +FLTI+DD +R  W+YLM+AK E +  +  F  LVENQF   I+ IR
Sbjct  310  HGHKYFLTIVDDCTRHTWIYLMKAKFETQKLMHDFVVLVENQFDKVIKVIR  360



>ref|XP_009796454.1| PREDICTED: uncharacterized protein LOC104243030 [Nicotiana sylvestris]
Length=783

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -2

Query  154  HGRH-FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCI  5
            H RH +F+TI+DD+SR+ W +L+ +KS     L  F NLVENQFG  I+ I
Sbjct  544  HDRHKYFITIVDDYSRSTWTHLLSSKSNTIEILKNFMNLVENQFGVTIKSI  594



>emb|CAN65213.1| hypothetical protein VITISV_009492 [Vitis vinifera]
Length=659

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +FLTI+DD+S   WVYL+++KS V S    FC L+  QFG  I+ +R
Sbjct  82   YFLTIVDDYSHFTWVYLLKSKSNVNSIFPAFCTLIHTQFGANIKSVR  128



>ref|XP_009150436.1| PREDICTED: uncharacterized protein LOC103873788 [Brassica rapa]
Length=921

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDHSR+ WV+L+R K EV +    F   VEN++ T+++ ++
Sbjct  597  GFRYFLTIVDDHSRSTWVFLLRTKQEVLTVFPTFIQQVENKYNTKVKSVK  646



>emb|CAN83990.1| hypothetical protein VITISV_018454 [Vitis vinifera]
Length=1243

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  FFLTI+DD+SR  WVY+++ KSEV+  +  F   V+ QFG  ++ IR
Sbjct  487  GYKFFLTIVDDYSRVTWVYMLKNKSEVQKYIPDFFAFVKKQFGKEVKAIR  536



>emb|CAN76546.1| hypothetical protein VITISV_010420 [Vitis vinifera]
Length=1288

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  FFLTI+DD+SR  WVY+++ KSEV+  +  F   V+ QFG  ++ IR
Sbjct  488  GYKFFLTIVDDYSRVTWVYMLKNKSEVQKYIPDFFAFVKKQFGKEVKAIR  537



>ref|XP_007034104.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY05030.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=1141

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI++D+SRA+WVYLM+ KS+ R  L+ F   V  QF T+++ +R
Sbjct  371  GAVYFLTIVNDYSRAIWVYLMKHKSKTRDYLLHFYQWVRTQFNTQVKIVR  420



>emb|CAN81124.1| hypothetical protein VITISV_030991 [Vitis vinifera]
Length=896

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIR  11
            G H+FL  +DDH+R  W YL++ K E   T + F  L+ENQF T+I+
Sbjct  310  GAHYFLLFIDDHTRFTWFYLLKTKCETYPTFLKFQALIENQFNTKIK  356



>ref|XP_009795207.1| PREDICTED: uncharacterized protein LOC104241936 [Nicotiana sylvestris]
Length=852

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  154  HGRH-FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            H +H +F+TI+DD+SR+ W +L+ +KS     L  F +LVENQFG  I+ IR
Sbjct  478  HDKHKYFITIVDDYSRSTWTHLLSSKSNAIDILKNFMSLVENQFGINIKSIR  529



>emb|CAN72408.1| hypothetical protein VITISV_038204 [Vitis vinifera]
Length=1721

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  RHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            + +F+T +DDH+R  WVYL+  K+EVRS  + F ++++ QF T+I+ +R
Sbjct  364  KKWFITFIDDHTRLCWVYLLTDKTEVRSVFLNFHSMIQTQFQTKIQILR  412



>ref|XP_010245298.1| PREDICTED: uncharacterized protein LOC104588872 [Nelumbo nucifera]
Length=629

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +FLTI++D+SRAV VYL+  KSEV   +  FC +VE QFG ++R +R
Sbjct  355  YFLTIVNDYSRAVCVYLLLEKSEVAHIIEKFCAMVERQFGKQVRTVR  401



>emb|CAN79134.1| hypothetical protein VITISV_000843 [Vitis vinifera]
Length=1253

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ +F+T ++DH+R  WVYLMR KS+V      F  ++ENQF T+I  +R
Sbjct  424  GKKWFVTFINDHTRLCWVYLMREKSKVERIFKEFYRMIENQFQTKISILR  473



>emb|CAN74794.1| hypothetical protein VITISV_041689 [Vitis vinifera]
Length=845

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +++T +DDHSR  WVY +R+KSEV  T   F   V+NQF T I+ +R
Sbjct  550  YYVTFIDDHSRFTWVYFLRSKSEVFXTFTEFLAYVDNQFSTSIKTLR  596



>ref|XP_010684008.1| PREDICTED: uncharacterized protein LOC104898610 [Beta vulgaris 
subsp. vulgaris]
Length=983

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD+SRAVWVYL+  K+EV S  I F  L++ QF   I+ ++
Sbjct  531  GARYFLTLVDDYSRAVWVYLLVDKTEVFSMFIAFIALIDRQFSQTIKIVQ  580



>emb|CAN71267.1| hypothetical protein VITISV_017889 [Vitis vinifera]
Length=1576

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +++T +DDHSR  WVY +R+KSEV  T   F   V+NQF T I+ +R
Sbjct  715  YYVTFIDDHSRFTWVYFLRSKSEVFRTFTEFLAYVDNQFSTSIKTLR  761



>dbj|BAD99220.1| polypeptide with an integrase domain [Petunia x hybrida]
Length=492

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRA W YL+  KS   +TL    +L+E QF ++++ IR
Sbjct  88   GERYFLTIVDDFSRATWTYLLTTKSNAFATLKSLLSLIERQFSSKVKIIR  137



>ref|XP_010667912.1| PREDICTED: uncharacterized protein LOC104884908 [Beta vulgaris 
subsp. vulgaris]
Length=1117

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLT++DD SRA WVYL+ +K++V  +   F  +VE QF   ++ +R
Sbjct  497  GAHYFLTLVDDFSRATWVYLLTSKTDVYQSFCSFFAMVERQFEVTVKTVR  546



>emb|CAN71164.1| hypothetical protein VITISV_031057 [Vitis vinifera]
Length=1303

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +++T +DDHSR  WVY +R+KSEV  T   F   V+NQF T I+ +R
Sbjct  693  YYVTFIDDHSRFTWVYFLRSKSEVFRTFTEFLAYVDNQFSTSIKTLR  739



>emb|CAN67992.1| hypothetical protein VITISV_015686 [Vitis vinifera]
Length=1308

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +++T +DDH+R  WVY +R+KSEV  T I F   V+NQF T I+ +R
Sbjct  510  YYVTFIDDHNRFTWVYFLRSKSEVFRTFIEFLAYVDNQFSTSIKTLR  556



>gb|AAG09097.1|AC009323_8 Putative retroelement polyprotein [Arabidopsis thaliana]
Length=1486

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD+SRAVW+YL+ +K E    L  F  LVE Q+ T I+ IR
Sbjct  579  GSRYFLTLVDDYSRAVWLYLLPSKQEAPKHLKNFIALVERQYTTNIKMIR  628



>emb|CAN69184.1| hypothetical protein VITISV_004341 [Vitis vinifera]
Length=1360

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEVR     F N+V+  F  +I+ +R
Sbjct  522  GSRWFVTFVDDHTRVTWVFLMKKKSEVREIFENFNNMVQTXFQAKIQVLR  571



>emb|CAN67970.1| hypothetical protein VITISV_025093 [Vitis vinifera]
Length=1023

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +++T +DDHSR  WVY +R+KSEV  T I F   V+NQF   I+ +R
Sbjct  469  YYVTFIDDHSRFTWVYFLRSKSEVFRTFIEFLAYVDNQFSISIKTLR  515



>ref|XP_004246827.1| PREDICTED: uncharacterized protein LOC101260567 [Solanum lycopersicum]
Length=923

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            + +T++DD+SRA W YL+  KS     L  F N++ENQF T ++CIR
Sbjct  673  YCITLVDDYSRATWTYLLSTKSNAIQILQTFINMIENQFQTTVKCIR  719



>pir||S00954 pol polyprotein - fruit fly (Drosophila melanogaster) transposon 
1731
 emb|CAA30503.1| unnamed protein product [Drosophila melanogaster]
Length=982

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT +DD SR ++VY +R K EV +  + F  LVE Q G +I+CIR
Sbjct  217  GSKYFLTFIDDKSRRIFVYFLRKKDEVFTKFVEFKKLVERQTGRKIKCIR  266



>emb|CAN60702.1| hypothetical protein VITISV_015869 [Vitis vinifera]
Length=3028

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  RHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            + +F+T +DDH+R  WVYL+  K+EVRS  + F ++++ QF T+I+ +R
Sbjct  283  KKWFVTFIDDHTRLCWVYLLTDKTEVRSVFMNFHSMIQTQFHTKIQILR  331



>emb|CAN82103.1| hypothetical protein VITISV_035488 [Vitis vinifera]
Length=1152

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  RHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            + +F+T +DDH+R  WVYL+  K+EVRS  + F ++++ QF T+I+  R
Sbjct  405  KKWFITFIDDHTRMCWVYLLTDKTEVRSVFMNFHSMIQTQFHTKIQIFR  453



>ref|XP_009128559.1| PREDICTED: uncharacterized protein LOC103853393 [Brassica rapa]
Length=964

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G   FLTI+DDH+R +W+YL+R K+EV +    F  ++E ++ ++++ +R
Sbjct  638  GYKHFLTIVDDHTRVIWIYLLRTKNEVLTVFPDFIQMIETKYKSKVKAVR  687



>emb|CAN73102.1| hypothetical protein VITISV_042891 [Vitis vinifera]
Length=1493

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  RHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            + +F+T +DDH+R  WVYL+  K+EVRS  + F  +++ QF T+I+ +R
Sbjct  625  KKWFITFIDDHTRLCWVYLLTDKTEVRSVFMNFHYMIQTQFHTKIQILR  673



>ref|XP_010675539.1| PREDICTED: uncharacterized protein LOC104891530 [Beta vulgaris 
subsp. vulgaris]
Length=1011

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVWVYLM  K+EV    + F  +V+ QF   I+ ++
Sbjct  486  GARYFLTIVDDFSRAVWVYLMEDKTEVFGMFMSFVAMVDRQFSQTIKLVQ  535



>ref|XP_010113352.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
 gb|EXC35359.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
Length=3263

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WVYLM+ KSEV      F  +V+NQF +RI+ ++
Sbjct  591  GTRWFVTFVDDHTRVTWVYLMKEKSEVGQIFHTFNLMVQNQFNSRIQVLK  640



>ref|XP_010242510.1| PREDICTED: uncharacterized protein LOC104586844 [Nelumbo nucifera]
Length=900

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F TI++D+SR VW+YL+  K EV  TL   C ++E QF  +++ +R
Sbjct  307  GAAYFFTIVEDYSRVVWIYLLAEKIEVGRTLKNLCTMIERQFNKKVKVVR  356



>ref|XP_010445345.1| PREDICTED: uncharacterized protein LOC104727998 [Camelina sativa]
Length=447

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCI  5
            G  +FLTI+DD SRAVW YL+  KSEVR  L  F    E QFG  ++ +
Sbjct  17   GAVYFLTIVDDFSRAVWTYLLLEKSEVRCVLTIFLKYTERQFGRTVKTV  65



>ref|XP_010495376.1| PREDICTED: uncharacterized protein LOC104772464 [Camelina sativa]
Length=1032

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SR  WVYL+  KSEV      F  LVE Q+ T+++ IR
Sbjct  681  GYKYFLTIVDDYSRVTWVYLLHNKSEVSVKFPLFLKLVETQYHTKVKKIR  730



>emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera]
Length=1813

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SR  W++LM  KSE +S L  F   V+ QF T ++ +R
Sbjct  842  GSRYFLTIVDDFSRCTWIFLMHHKSETQSLLTNFVQFVKTQFHTDVQTVR  891



>ref|XP_010675988.1| PREDICTED: uncharacterized protein LOC104891900 [Beta vulgaris 
subsp. vulgaris]
Length=968

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD+SRAVWVYL+  K+EV S  + F  +++ QF   I+ ++
Sbjct  583  GARYFLTLVDDYSRAVWVYLLTDKTEVFSMFMAFIAMIDRQFSQTIKVVQ  632



>ref|XP_009771994.1| PREDICTED: uncharacterized protein LOC104222458 [Nicotiana sylvestris]
Length=902

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  154  HGRH-FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            H +H +F+T++DD+SR+ W +L+ +KS V   L  F +LVENQF   I+ IR
Sbjct  714  HDKHKYFVTVVDDYSRSTWTHLLSSKSNVIDILKNFMSLVENQFSINIKSIR  765



>ref|XP_010692573.1| PREDICTED: uncharacterized protein LOC104905670 [Beta vulgaris 
subsp. vulgaris]
Length=864

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  HGRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +G  +FLT++DDH+R  W YL+  K +V  T+  F ++V+ QFG +I+ IR
Sbjct  646  NGARYFLTLVDDHNRVTWTYLLHNKLQVAKTICDFLSMVDTQFGKKIKQIR  696



>emb|CAN74194.1| hypothetical protein VITISV_040578 [Vitis vinifera]
Length=1353

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  + +T +DDH+R  WV+LM+ KSEVR     F N+V+ QF  +I+ +R
Sbjct  533  GSRWXVTFVDDHTRVTWVFLMKKKSEVREIFENFNNMVQTQFQAKIQVLR  582



>emb|CAA19696.1| putative LTR retrotransposon (fragment) [Arabidopsis thaliana]
 emb|CAB78981.1| putative LTR retrotransposon (fragment) [Arabidopsis thaliana]
Length=281

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRA W+YL++ KS+V      F N+V  Q+ T+++ +R
Sbjct  222  GFKYFLTIVDDFSRATWIYLLKNKSDVLHVFPAFINMVHTQYQTKLKSVR  271



>emb|CAN64225.1| hypothetical protein VITISV_016222 [Vitis vinifera]
Length=987

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD +R  WV+L+RAKS+V++    F ++V+ QFG  I+ +R
Sbjct  446  GFRYFLTIVDDCTRNTWVHLLRAKSDVKTIFPQFFSMVKTQFGLTIKAVR  495



>ref|XP_010474506.1| PREDICTED: uncharacterized protein LOC104754043 [Camelina sativa]
Length=823

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW+YL+  KS V  T+  F  LVE QF   ++ IR
Sbjct  448  GSRYFLTIVDDCSRAVWLYLLPDKSTVSHTIHNFLQLVERQFTKEVKRIR  497



>ref|XP_010025850.1| PREDICTED: uncharacterized protein LOC104416112 [Eucalyptus grandis]
Length=1383

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+S A W+YLM++KS+  + L  F +L+ NQF   ++ IR
Sbjct  547  GSRYFLTIVDDYSHATWLYLMQSKSQTFTHLSNFLSLIRNQFDKSVQQIR  596



>gb|AAD32906.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=822

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  HGRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +G  + LT +DD +R VWVY ++AKSEV  T   F NLVEN    RI+ +R
Sbjct  236  NGSRYILTFIDDATRMVWVYFLKAKSEVFQTFKKFKNLVENNANCRIKKLR  286



>emb|CAN79936.1| hypothetical protein VITISV_033548 [Vitis vinifera]
Length=981

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +++T +DDHS+  WVY +R+KSEV  T   F   V+NQF T I+ +R
Sbjct  274  YYVTFIDDHSKFTWVYFLRSKSEVFRTFTEFLAYVDNQFSTSIKTLR  320



>ref|XP_007029159.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY09661.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=492

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ +FL ++DD +R  WV+LM  KS+V + ++ F N V+ QF  +I+CIR
Sbjct  38   GQRYFLIVVDDFTRFTWVFLMSNKSDVLTIILSFNNHVQKQFELQIKCIR  87



>gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris]
Length=1387

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DD+SR  WV+LM+ +SE+ S    F N ++NQFG  IR +R
Sbjct  553  GFQYFVTFIDDYSRCTWVFLMKNRSELFSIFQLFYNEIKNQFGISIRILR  602



>emb|CAN77602.1| hypothetical protein VITISV_024474 [Vitis vinifera]
Length=1207

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDHSR +WVY ++ K +V      F  LVE Q G +++CIR
Sbjct  380  GSLYFVTFIDDHSRKIWVYTLKTKDQVLDVFKQFHALVERQSGEKLKCIR  429



>ref|XP_010030630.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104420491 
[Eucalyptus grandis]
Length=1191

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  FFL I+DD+SRA W++L+++KS+V S L  F +L + QF   IR IR
Sbjct  717  GSRFFLIIVDDYSRATWIFLLQSKSQVFSHLKTFISLSKTQFQKSIRRIR  766



>ref|XP_010677705.1| PREDICTED: uncharacterized protein LOC104893304 [Beta vulgaris 
subsp. vulgaris]
Length=1239

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F T++DD SRAVWVYLM  K+EV    + F  +VE QF   I+ ++
Sbjct  470  GARYFFTLVDDFSRAVWVYLMEDKTEVFGMFMSFVAMVERQFSQTIKVVQ  519



>ref|XP_010532348.1| PREDICTED: uncharacterized protein LOC104808371 [Tarenaya hassleriana]
Length=1788

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL I+DD SR+ W+Y++R KS+V      F  L+ENQF   I+ IR
Sbjct  399  GYRYFLIIVDDASRSTWIYMLRFKSDVMHIFPAFVTLIENQFQKVIKAIR  448



>gb|KFK32108.1| hypothetical protein AALP_AA6G199700 [Arabis alpina]
Length=1415

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDHSR +WVY M+ K  V      F  LVE Q G +++CIR
Sbjct  259  GASYFVTFIDDHSRKLWVYTMKTKDYVLGYFKHFVALVERQTGKKLKCIR  308



>emb|CAN65540.1| hypothetical protein VITISV_029946 [Vitis vinifera]
Length=1240

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD +R  WV+L+RAKS+V++    F ++V+ QFG  I+ +R
Sbjct  446  GFRYFLTIVDDCTRNTWVHLLRAKSDVKTIFPQFFSMVKTQFGLTIKXVR  495



>emb|CAN68489.1| hypothetical protein VITISV_037543 [Vitis vinifera]
Length=1449

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+  +DD SR  W+Y + +K +  S  I F +LVENQF +RI+C+R
Sbjct  595  GARYFILFVDDFSRFSWIYPLHSKDQALSVFIKFKSLVENQFNSRIQCLR  644



>ref|XP_009774503.1| PREDICTED: uncharacterized protein LOC104224521 [Nicotiana sylvestris]
Length=479

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SR  W YL+  KS   + L GF  +VE QF ++++ IR
Sbjct  418  GFRYFLTIVDDFSRGTWTYLLTNKSNAFTILKGFLAMVERQFNSKVKTIR  467



>gb|AAK38381.1|AC079028_5 polyprotein, putative [Arabidopsis thaliana]
Length=855

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL+I+DD SR VW+Y +R+K E       +  LVENQ   R++C+R
Sbjct  198  GNKYFLSIIDDKSRKVWLYFLRSKDETFDKFCEWKELVENQTDKRVKCLR  247



>dbj|BAB10837.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1462

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G ++FLT++D+++RAVW+YL+ +K      L  F +LVE QF T+I+ IR
Sbjct  543  GSNYFLTLVDNYTRAVWLYLLPSKQTAPMHLKNFISLVERQFSTKIKTIR  592



>emb|CAN74160.1| hypothetical protein VITISV_018405 [Vitis vinifera]
Length=1302

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDHSR +WVY ++ K +V      F  LVE Q G +++CIR
Sbjct  364  GSLYFVTFIDDHSRKIWVYTLKXKDQVLDVFKQFHALVERQSGEKLKCIR  413



>ref|XP_009778353.1| PREDICTED: uncharacterized protein LOC104227744 [Nicotiana sylvestris]
Length=1133

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F++ +DD+SR  W++LM+ +SE+ S    FC  ++NQFG  IR  R
Sbjct  704  GFRYFVSFIDDYSRCTWLFLMKDRSELFSIFQSFCAEIKNQFGVSIRIFR  753



>emb|CAN66323.1| hypothetical protein VITISV_007384 [Vitis vinifera]
Length=1317

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDHSR +WVY ++ K +V      F  LVE Q G +++CIR
Sbjct  448  GSLYFVTFIDDHSRKIWVYTLKTKDQVLDVFKQFHALVERQSGEKLKCIR  497



>emb|CAN75440.1| hypothetical protein VITISV_007304 [Vitis vinifera]
Length=1362

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDHSR +WVY ++ K +V      F  LVE Q G +++CIR
Sbjct  477  GSLYFVTFIDDHSRKIWVYTLKTKDQVLDVFKQFHALVERQSGEKLKCIR  526



>emb|CAN77432.1| hypothetical protein VITISV_017814 [Vitis vinifera]
Length=356

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIR  11
            G  +FL  +DDH+R  W YL++ K E   T + F  L+ENQF T+I+
Sbjct  71   GARYFLLFIDDHTRFTWFYLLKTKCEAYPTFLKFQALIENQFNTKIK  117



>ref|XP_008387850.1| PREDICTED: uncharacterized protein LOC103450292 [Malus domestica]
Length=778

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+  +DD+SR  W+YL+++KSEV      F NLV+N F ++I+ +R
Sbjct  455  GYKYFIIFVDDYSRTTWLYLLKSKSEVXXVFKDFHNLVKNHFSSQIKTLR  504



>ref|XP_010312989.1| PREDICTED: uncharacterized protein LOC104644607 [Solanum lycopersicum]
Length=926

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ +FLTI+DD SR  W++L+  KS V S++  F   V+ QFG R++ +R
Sbjct  538  GKKYFLTIVDDFSRVTWLFLLSHKSAVCSSIQTFLKFVQTQFGKRVKVLR  587



>ref|XP_004228785.1| PREDICTED: uncharacterized protein LOC101255821 [Solanum lycopersicum]
Length=1125

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLT++DD+SR+    L+R KS    T+  F +L+EN+F T+++ IR
Sbjct  680  GYHYFLTMVDDYSRSTCTQLLRCKSNALQTIKAFVSLIENEFQTKLKAIR  729



>dbj|BAA11674.1| unnamed protein product [Nicotiana tabacum]
Length=1338

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDHSR  WVY ++ K +V      F  LVE + G +++CIR
Sbjct  497  GARYFVTFIDDHSRKTWVYTLKTKDQVFQVFKQFLTLVERETGKKLKCIR  546



>emb|CAN62906.1| hypothetical protein VITISV_043610 [Vitis vinifera]
Length=1498

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLTI+DD++R  W++LMR K E +S L  F + V  QF  RI+  R
Sbjct  591  GAHYFLTIVDDYTRFTWIFLMRHKDEAQSLLKRFFSYVFTQFEFRIKTFR  640



>ref|XP_009123006.1| PREDICTED: uncharacterized protein LOC103847675 [Brassica rapa]
Length=1066

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD +R  W+Y+++ KS+V +    F NLV  QF  +I+ IR
Sbjct  466  GYKYFLTLVDDCTRVTWIYMLKNKSDVSTVFPAFLNLVSTQFDKKIKAIR  515



>emb|CAN76196.1| hypothetical protein VITISV_041073 [Vitis vinifera]
Length=1505

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ +F+T +DDH+R  WVYL+R KSEV      F  +V  QF T+I+  R
Sbjct  569  GKKWFVTFIDDHTRVSWVYLLREKSEVEEVFKIFYTMVLTQFQTKIQVFR  618



>emb|CAN77529.1| hypothetical protein VITISV_041425 [Vitis vinifera]
Length=1047

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL  +DD+SR  W+Y +  K +V ST I F  ++ENQ  + I+CI+
Sbjct  441  GARYFLLFIDDYSRYTWIYFLFTKDQVLSTFITFRKMIENQLNSTIKCIQ  490



>emb|CAN63782.1| hypothetical protein VITISV_010855 [Vitis vinifera]
Length=698

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +++T +D+HSR  WVY +R+KS+V  T I F   V+NQF T I+ +R
Sbjct  164  YYVTFIDNHSRFTWVYFLRSKSKVFRTFIEFLAYVDNQFSTSIKTLR  210



>emb|CAN73696.1| hypothetical protein VITISV_038483 [Vitis vinifera]
Length=1783

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151   GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
             G H+FLTI+DD++R  W++LMR K E +S L  F + V  QF  RI+  R
Sbjct  963   GAHYFLTIVDDYTRFTWIFLMRHKDEAQSLLKHFFSYVFTQFEFRIKTFR  1012



>emb|CAN79492.1| hypothetical protein VITISV_033373 [Vitis vinifera]
Length=2116

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  142   FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCI  5
             +++T +DDHSR  WVY +R+KSEV  T   F   V+NQF T I+ +
Sbjct  1335  YYVTFIDDHSRFTWVYFLRSKSEVFRTFTEFLAYVDNQFSTSIKTL  1380



>ref|XP_010436828.1| PREDICTED: uncharacterized protein LOC104720645 [Camelina sativa]
Length=823

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW+YL+  KS +   +  F  LVE QF  +++ IR
Sbjct  415  GSRYFLTIVDDCSRAVWLYLLPDKSTISHKIRNFLQLVERQFNKKVKRIR  464



>emb|CAN81385.1| hypothetical protein VITISV_012324 [Vitis vinifera]
Length=1369

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  576  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNRMVQNQFNSKIQVLK  625



>emb|CAN78598.1| hypothetical protein VITISV_001332 [Vitis vinifera]
Length=1701

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  823  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNRMVQNQFNSKIQVLK  872



>emb|CAN83808.1| hypothetical protein VITISV_026963 [Vitis vinifera]
Length=971

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIR  11
            G  +F+T +DDH+R  WV LM+ KSEVR     F N+V+ QF  +I+
Sbjct  446  GSRWFVTFVDDHTRVTWVLLMKKKSEVREIFENFNNIVQTQFQAKIQ  492



>ref|XP_010463099.1| PREDICTED: uncharacterized protein LOC104743749 [Camelina sativa]
Length=1164

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIR  11
            G  +FLT++DD SRAVW +L+  KSEVR  L  F    E QFG  ++
Sbjct  499  GAIYFLTVVDDFSRAVWTFLLLEKSEVRGVLTNFLQYTEKQFGKAVK  545



>ref|XP_010683397.1| PREDICTED: uncharacterized protein LOC104898087 [Beta vulgaris 
subsp. vulgaris]
Length=1038

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTILDD+SR  W +L+ +KS+V + L  F   VEN F T I+ IR
Sbjct  626  GACYFLTILDDYSRTTWTHLVSSKSQVPTLLQEFIAYVENHFNTSIKIIR  675



>ref|XP_010424226.1| PREDICTED: uncharacterized protein LOC104709284 [Camelina sativa]
Length=608

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  FFLTI+DD+SR+VW++L+  KSE  + L  F  +   QF T+++ IR
Sbjct  529  GARFFLTIVDDYSRSVWIHLLNEKSEAPTQLKNFLTITTRQFNTQVQKIR  578



>ref|XP_004240625.1| PREDICTED: uncharacterized protein LOC101261123 [Solanum lycopersicum]
Length=943

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F TI+DD+SR  W +LMR KS+V S L  F   +E QF  RI+ IR
Sbjct  605  GMRYFFTIVDDYSRWTWTFLMRLKSDVVSLLKQFVAEIETQFDKRIKRIR  654



>gb|ADK92880.1| retrotransposon 4 protein [Hypericum perforatum]
Length=1347

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +F+T +D HSR+ W+YL++ K EV S    F NLV NQF  +I+ +R
Sbjct  492  YFVTFIDHHSRSTWIYLLKHKHEVFSVFKEFHNLVRNQFDKKIKILR  538



>ref|XP_010696216.1| PREDICTED: uncharacterized protein LOC104908765 [Beta vulgaris 
subsp. vulgaris]
Length=445

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            FFL I+DD++RA WV+L++ KS+  ST+  FC     QF  ++R IR
Sbjct  339  FFLIIVDDYTRATWVHLLKNKSDSLSTIKSFCVFARTQFDRKVRIIR  385



>gb|ABW74573.1| putative pol polyprotein [Boechera divaricarpa]
Length=937

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL I+DD SRA WVYL++ K+EV      F   VENQ+G +++ +R
Sbjct  552  GFKYFLIIVDDCSRATWVYLLKTKNEVLIVFPVFIQKVENQYGVKVKALR  601



>emb|CBL54154.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima]
Length=266

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +F+TI+DD+SR +WV L++ KS+    + GF  +V+ Q+G +++ IR
Sbjct  66   YFMTIVDDYSRVIWVQLLKQKSDAYEAIKGFLKMVKTQYGKQVKVIR  112



>ref|XP_010674610.1| PREDICTED: uncharacterized protein LOC104890733 [Beta vulgaris 
subsp. vulgaris]
Length=585

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVWVYLM  K+EV    + F  +++ QF   I+ ++
Sbjct  506  GARYFLTIVDDFSRAVWVYLMTDKTEVFPLFMNFVAMIDRQFSQTIKVVQ  555



>ref|XP_002064813.1| GK15001 [Drosophila willistoni]
 gb|EDW75799.1| GK15001 [Drosophila willistoni]
Length=1249

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT +DD SR ++VY ++ K EV    + F +LVE Q G +++CIR
Sbjct  473  GSRYFLTFIDDKSRRIFVYFLKGKDEVFGKFLEFKSLVERQTGKKLKCIR  522



>ref|XP_009783587.1| PREDICTED: uncharacterized protein LOC104232161 [Nicotiana sylvestris]
Length=272

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  HGRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            HG  +F+T +DD +R  +VYL+  KSE  S  + F NLVENQ   +I+ +R
Sbjct  7    HGAIYFITFIDDFTRYGYVYLISHKSEALSCFVKFMNLVENQLDRKIKALR  57



>emb|CAA36615.1| unnamed protein product [Solanum tuberosum]
Length=675

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ +F+T +DDH+R  WV+L++ KSEV++    F  +VE QF  +I+  R
Sbjct  177  GKRWFVTFIDDHTRLSWVFLLKGKSEVKNVFETFHVMVETQFNEKIKIFR  226



>gb|AAF79879.1|AC000348_32 T7N9.5 [Arabidopsis thaliana]
Length=1436

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +FLTI+DD SRA W+YL++ KS+V +    F  +VE Q+ T++  +R
Sbjct  636  YFLTIVDDFSRATWIYLLKQKSDVLTVFPSFLKMVETQYHTKVCSVR  682



>ref|XP_010484894.1| PREDICTED: uncharacterized protein LOC104763183 [Camelina sativa]
Length=1077

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCI  5
            G  +FLTILDD+SR VW+YL+ +KS+       F  LVE QF   ++ +
Sbjct  587  GSRYFLTILDDYSRVVWIYLLPSKSDAPHHFKNFLKLVETQFSAHVKTV  635



>emb|CAN77868.1| hypothetical protein VITISV_001383 [Vitis vinifera]
Length=662

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +++T +DDH++  WVY +R+KSEV  T   F   V+NQF T I+ +R
Sbjct  153  YYVTFIDDHNKFTWVYFLRSKSEVFRTFTKFLAYVDNQFSTSIKSLR  199



>gb|AAF19226.1|AC007505_2 Highly similar to Ta1-3 polyprotein [Arabidopsis thaliana]
Length=1356

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ +FL+I+DD +R VW+Y +++K E       + +LVENQ   +++C+R
Sbjct  515  GKQYFLSIIDDKTRKVWLYFLKSKDETFDKFCEWKSLVENQVNKKVKCLR  564



>ref|XP_010692480.1| PREDICTED: uncharacterized protein LOC104905592 [Beta vulgaris 
subsp. vulgaris]
Length=1085

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD+SRAVWVYL++ K++V      F  +V  QF T ++ +R
Sbjct  598  GAVYFLTLVDDYSRAVWVYLLKNKTKVYQYFTSFFAMVARQFDTSVKIVR  647



>gb|ABH07899.1| putative polyprotein [Solanum lycopersicum]
Length=1428

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  RHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +H+FLTI+DD+SR VWV+L++ KSE    +  F +++  QF + ++ +R
Sbjct  577  KHYFLTIVDDYSRFVWVHLLQLKSETIVAIKNFFSMINTQFNSHVKVVR  625



>emb|CDP17739.1| unnamed protein product [Coffea canephora]
Length=435

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            GR++F+T +DD SR VWV+ M++K EV    + +   VENQ G +I+ +R
Sbjct  128  GRYYFVTFIDDFSRRVWVFTMKSKDEVLEIFLKWKARVENQTGRKIKILR  177



>emb|CAN69911.1| hypothetical protein VITISV_027081 [Vitis vinifera]
Length=1204

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +F+T +DDHSR +WVY ++ K +V      F  LVE Q G +++CIR
Sbjct  452  YFVTFIDDHSRKIWVYTLKTKDQVLDVFKQFHALVERQSGEKLKCIR  498



>emb|CAN67539.1| hypothetical protein VITISV_021584 [Vitis vinifera]
Length=1652

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +++T +DDHSR  WVY +R+K EV  T   F   V+NQF T I+ +R
Sbjct  634  YYVTFIDDHSRFTWVYFLRSKFEVFRTFTEFLAYVDNQFSTSIKTLR  680



>gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1353

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +D+ SR  WVYLM+ +SE+    + F N +ENQF T I+  R
Sbjct  500  GFRYFVTFIDEFSRCTWVYLMKDRSELLPIFMSFLNEIENQFKTTIQVFR  549



>emb|CAN69836.1| hypothetical protein VITISV_026000 [Vitis vinifera]
Length=1263

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  136  LTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
             T +DDH+R  WVYL+  K+EVRS  + F ++++ QF T+I+ +R
Sbjct  473  FTFIDDHTRLCWVYLLTDKTEVRSVFLNFHSMIQTQFQTKIQILR  517



>emb|CAN79422.1| hypothetical protein VITISV_002126 [Vitis vinifera]
Length=1065

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  315  GNRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  364



>emb|CAN72498.1| hypothetical protein VITISV_010513 [Vitis vinifera]
Length=1394

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL  +DD+SR  W+Y +  K +  ST I F  ++ENQ  + I+CI+
Sbjct  563  GAXYFLLFIDDYSRYTWIYFLSTKDQALSTFITFRKMIENQLNSTIKCIQ  612



>emb|CAN83937.1| hypothetical protein VITISV_042335 [Vitis vinifera]
Length=641

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  538  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  587



>emb|CAN67449.1| hypothetical protein VITISV_031400 [Vitis vinifera]
Length=1618

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  713  GTRWFVTFIDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  762



>emb|CAB10225.1| retrovirus-related like polyprotein [Arabidopsis thaliana]
 emb|CAB78488.1| retrovirus-related like polyprotein [Arabidopsis thaliana]
Length=1489

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD +R  WVY++R K +V S    F  LV  QF  +I+ IR
Sbjct  651  GFRYFLTVVDDCTRTTWVYMLRNKKDVSSVFPEFIKLVSTQFNAKIKAIR  700



>emb|CCA28129.1| putative polyprotein [Albugo laibachii Nc14]
Length=191

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  + +T +DD SR +  Y +++K EV S    F  LVENQFG RI+C+R
Sbjct  72   GVRYLVTFIDDFSRLIHAYFIQSKREVFSKFNDFKALVENQFGKRIKCLR  121



>emb|CAN64452.1| hypothetical protein VITISV_009528 [Vitis vinifera]
Length=2220

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151   GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
             G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  1358  GTQWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  1407



>emb|CCA26486.1| putative polyprotein [Albugo laibachii Nc14]
Length=240

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  + LT +D+ SR +  Y ++ K EV S    F  LVENQFG RI+C+R
Sbjct  181  GAKYMLTFIDEFSRFIHAYFIQTKGEVFSKFTEFKALVENQFGKRIKCLR  230



>gb|AAF69161.1|AC007915_13 F27F5.19 [Arabidopsis thaliana]
Length=1309

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRA W YL++ KS+V      F N+V  Q+ T+++ +R
Sbjct  608  GFRYFLTIVDDFSRATWNYLLKNKSDVLHAFPTFINMVHTQYQTKLKSVR  657



>gb|AAD20307.1| copia-type pol polyprotein [Zea mays]
Length=1063

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  + L I+DD+SR  WV+ ++ KS+ + TL GF    +N+FG RI+ IR
Sbjct  200  GSKYCLVIVDDYSRFTWVFFLQEKSQTQETLKGFLRRAQNEFGLRIKKIR  249



>gb|ABF67921.1| Ji1 putative pol protein [Zea mays]
Length=1063

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  + L I+DD+SR  WV+ ++ KS+ + TL GF    +N+FG RI+ IR
Sbjct  200  GSKYCLVIVDDYSRFTWVFFLQEKSQTQETLKGFLRRAQNEFGLRIKKIR  249



>emb|CAN76332.1| hypothetical protein VITISV_006269 [Vitis vinifera]
Length=850

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  504  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  553



>emb|CAN67587.1| hypothetical protein VITISV_036279 [Vitis vinifera]
Length=1034

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCI  5
            +++T +DDHSR  WVY +R+KSEV  T   F   V+NQF T I+ +
Sbjct  532  YYVTFIDDHSRFTWVYFLRSKSEVFRTFTEFLVYVDNQFSTSIKTL  577



>gb|AAV88069.1| hypothetical retrotransposon [Ipomoea batatas]
Length=1415

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DD+SR +WVY ++ KS+V      F  LVE Q G +++CIR
Sbjct  495  GASYFVTFIDDYSRKLWVYTLKHKSDVLGVFKEFHALVERQTGKKLKCIR  544



>emb|CAN69870.1| hypothetical protein VITISV_032283 [Vitis vinifera]
Length=959

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  206  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  255



>gb|AAL76004.1|AF466646_12 putative gag-pol polyprotein [Zea mays]
Length=1694

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151   GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
             G  + L I+DD+SR  WV+ ++ KS+ + TL GF    +N+FG RI+ IR
Sbjct  1039  GSKYCLVIVDDYSRFTWVFFLQEKSQTQETLKGFLRRTQNEFGLRIKKIR  1088



>emb|CAN66125.1| hypothetical protein VITISV_044030 [Vitis vinifera]
Length=1070

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  839  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  888



>emb|CAN74229.1| hypothetical protein VITISV_000584 [Vitis vinifera]
Length=1039

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDH+R  W++LM  KSE +  L  F + VE QF   I+ +R
Sbjct  203  GARYFLTIVDDHTRYTWIHLMSFKSETQGILQSFISWVETQFNRCIKTLR  252



>ref|XP_008644598.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X1 [Zea mays]
 gb|ACF86440.1| unknown [Zea mays]
Length=305

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  + L I+DD+SR  WV+ ++ KS+ + TL GF    +N+FG RI+ IR
Sbjct  83   GSKYCLVIVDDYSRFTWVFFLQEKSQTQETLKGFLRRAQNEFGLRIKKIR  132



>ref|XP_010412990.1| PREDICTED: uncharacterized protein LOC104699374 [Camelina sativa]
Length=1511

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SR VW+YL+  K+EV   L  F    + QFG  +R +R
Sbjct  607  GAKYFLTIVDDYSRGVWLYLLVDKTEVARHLKNFLAFTKRQFGEDVRTVR  656



>emb|CAN67009.1| hypothetical protein VITISV_004754 [Vitis vinifera]
Length=1237

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  366  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  415



>gb|AAN40025.1| putative gag-pol polyprotein [Zea mays]
Length=1892

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151   GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
             G  + L I+DD+SR  WV+ ++ KS+ + TL GF    +N+FG RI+ IR
Sbjct  1029  GSKYCLVIVDDYSRFTWVFFLQEKSQTQETLKGFLRRAQNEFGLRIKKIR  1078



>emb|CAN72168.1| hypothetical protein VITISV_004170 [Vitis vinifera]
Length=1415

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  542  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  591



>emb|CAN64765.1| hypothetical protein VITISV_009574 [Vitis vinifera]
Length=1426

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  576  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  625



>emb|CAN82928.1| hypothetical protein VITISV_025045 [Vitis vinifera]
Length=1468

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  576  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  625



>emb|CAN59964.1| hypothetical protein VITISV_022757 [Vitis vinifera]
Length=1481

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  576  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  625



>emb|CAN62538.1| hypothetical protein VITISV_031159 [Vitis vinifera]
Length=1481

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  576  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  625



>emb|CAN79175.1| hypothetical protein VITISV_001884 [Vitis vinifera]
Length=1487

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  506  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  555



>emb|CAN72886.1| hypothetical protein VITISV_019713 [Vitis vinifera]
Length=1504

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  767  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  816



>emb|CAN70357.1| hypothetical protein VITISV_013713 [Vitis vinifera]
Length=1568

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  687  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  736



>emb|CAN63881.1| hypothetical protein VITISV_039357 [Vitis vinifera]
Length=1611

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  581  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  630



>ref|XP_009612717.1| PREDICTED: uncharacterized protein LOC104105976 [Nicotiana tomentosiformis]
Length=706

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ +FLT++DD+S+  W++L+ +KS++   L  F  L+  QF ++++C+R
Sbjct  477  GKRYFLTLVDDYSKYTWLFLLHSKSDIVEVLKNFIALIFTQFDSKLKCLR  526



>ref|XP_010677195.1| PREDICTED: uncharacterized protein LOC104892872 [Beta vulgaris 
subsp. vulgaris]
Length=897

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD+SRAVWVYL+  K+EV      F  +V  QF T ++ +R
Sbjct  542  GAIYFLTLVDDYSRAVWVYLLHNKTEVEKYFSSFFAMVTCQFETTVKIVR  591



>emb|CAN69597.1| hypothetical protein VITISV_038518 [Vitis vinifera]
Length=1893

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151   GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
             G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  1005  GTRWFVTFVDDHTRVTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  1054



>emb|CAN65406.1| hypothetical protein VITISV_030853 [Vitis vinifera]
Length=1017

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDHSR +WVY ++ K +V      F  LVE Q G +++CI+
Sbjct  251  GSLYFVTFIDDHSRKIWVYTLKTKDQVLDVFKQFHALVERQSGEKLKCIQ  300



>emb|CAN81016.1| hypothetical protein VITISV_025518 [Vitis vinifera]
Length=1461

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DDH+R  W++LM  KSE +  L  F + VE QF   I+ +R
Sbjct  611  GAXYFLTIVDDHTRYTWIHLMSFKSETQGILQSFISWVETQFNRCIKTLR  660



>emb|CAN70669.1| hypothetical protein VITISV_037506 [Vitis vinifera]
Length=2825

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151   GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
             G  +F+T +DDH+R  WV+LM+ KSEV      F  +V+NQF ++I+ ++
Sbjct  2016  GTRWFVTFVDDHTRGTWVFLMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  2065



>emb|CAN72674.1| hypothetical protein VITISV_020404 [Vitis vinifera]
Length=366

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ F++T +DD+SR   VYL+R K E R   I + N VENQ   +I+ +R
Sbjct  5    GKRFYITFIDDYSRYTRVYLLRNKDEARDVFIKYINEVENQLSKKIKRLR  54



>ref|XP_010678923.1| PREDICTED: uncharacterized protein LOC104894400 [Beta vulgaris 
subsp. vulgaris]
Length=1277

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT+LDDHSR  W +L+ +K++V   +  F   +E QFG  ++ IR
Sbjct  554  GATYFLTLLDDHSRVTWTHLVHSKTQVPVIITHFLAYIETQFGKHLKVIR  603



>ref|XP_010683416.1| PREDICTED: uncharacterized protein LOC104898103 [Beta vulgaris 
subsp. vulgaris]
Length=654

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW YL+  K+EV S  + F  +V+ QF   I+ ++
Sbjct  584  GARYFLTIVDDFSRAVWTYLLVDKTEVFSMFMSFIAMVDRQFSQTIKIVQ  633



>dbj|BAA97099.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1098

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCI  5
            G  +FLTI+DD SR+VW +LM  KSEV   +  FC + E QF   I+ +
Sbjct  578  GSVYFLTIVDDFSRSVWTFLMAEKSEVSRLIRNFCAMSERQFCKSIKTV  626



>gb|AAD32759.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1356

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  HFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
             +F++I+DD +R VWVY M+ K E     + + NLVENQ   R++ +R
Sbjct  518  QYFMSIIDDFTRKVWVYFMKTKDEAFEKFVEWVNLVENQTDRRVKTLR  565



>ref|XP_010675050.1| PREDICTED: uncharacterized protein LOC104891098 [Beta vulgaris 
subsp. vulgaris]
Length=667

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FL I+DD+SRAVW YL+  K EV +  + F  +++ QF   I+ ++
Sbjct  579  GAHYFLAIVDDYSRAVWTYLLIDKLEVFAVFMSFVAMIDRQFSQTIKIVQ  628



>emb|CDP21887.1| unnamed protein product [Coffea canephora]
Length=633

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLTI+DD SR  WV+L++ K +    L  FC   + QFG  ++ +R
Sbjct  526  GAHYFLTIVDDFSRCTWVFLLKNKFQAYDFLTMFCQSTQTQFGYPVQVVR  575



>emb|CAN66596.1| hypothetical protein VITISV_019893 [Vitis vinifera]
Length=1430

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R +WV+ M+ KSEV      F  +V+NQF ++I+ ++
Sbjct  576  GTRWFVTFVDDHTRVIWVFFMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  625



>ref|XP_010322961.1| PREDICTED: uncharacterized protein LOC104648099 [Solanum lycopersicum]
Length=790

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +F+TI+DD SR+ W +L+  KS     L  F N++ENQF T ++ +R
Sbjct  393  YFITIVDDFSRSTWTHLLSTKSNALQVLKNFVNMIENQFQTTVKIVR  439



>emb|CAN82221.1| hypothetical protein VITISV_015226 [Vitis vinifera]
Length=1007

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+  +DD S   W+Y + +K +  S  I F +LVENQF +RI+C+R
Sbjct  247  GARYFILFVDDFSHFSWIYPLHSKDQALSXFIKFKSLVENQFNSRIQCLR  296



>emb|CCA18867.1| putative polyprotein [Albugo laibachii Nc14]
Length=245

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  + +T +DD SR +  + ++ K +V S  I F  LVENQFG RI+C+R
Sbjct  69   GSKYMVTFIDDFSRFIRAHFIQTKGKVFSNFIEFKALVENQFGKRIKCLR  118



>emb|CAN82754.1| hypothetical protein VITISV_034296 [Vitis vinifera]
Length=387

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+  +DD SR  W+Y +  K +  S  I F +LVENQF +RI+C+R
Sbjct  92   GARYFILFVDDFSRFSWIYPLHNKDQALSIFIKFKSLVENQFNSRIQCLR  141



>ref|XP_010695294.1| PREDICTED: uncharacterized protein LOC104907962 [Beta vulgaris 
subsp. vulgaris]
Length=797

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  139  FLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            FLTI+DD +R  WV+L++ KS+V S L  FC  V  QF T+I  +R
Sbjct  489  FLTIVDDFTRFTWVHLLKLKSDVVSILQSFCQYVATQFNTKILYVR  534



>gb|AAL55241.1|AF295693_1 polyprotein [Anopheles gambiae]
Length=786

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +++T++DDHSR  +VY ++ KSE    +  +  LV+NQFG + R IR
Sbjct  357  GCRYYMTLIDDHSRYTFVYFLKKKSEAEDKIHEYVKLVQNQFGRKPRIIR  406



>ref|XP_010274487.1| PREDICTED: uncharacterized protein LOC104609798 [Nelumbo nucifera]
Length=569

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW++L+  K+EV  TL  F  +V++Q+   ++ +R
Sbjct  506  GATYFLTIVDDFSRAVWIFLLNDKNEVGKTLRNFFTMVKHQYDKLVKIVR  555



>ref|XP_007043660.1| Uncharacterized protein TCM_008173 [Theobroma cacao]
 gb|EOX99491.1| Uncharacterized protein TCM_008173 [Theobroma cacao]
Length=490

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCI  5
            G HF LTI+DD +RA WV+LM+ KS+    L+ F N V  QF  +++ +
Sbjct  61   GSHFILTIIDDFNRATWVFLMKYKSKTEMYLLQFYNEVYTQFKVQVKIL  109



>ref|XP_011070152.1| PREDICTED: uncharacterized protein LOC105155865 [Sesamum indicum]
Length=747

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIR  11
            G H+ L +LDD++R++W YL++ K +V S L  F  +VE QFG +++
Sbjct  525  GCHYVLIVLDDYNRSLWTYLIKHKDQVVSNLQAFAAMVEVQFGAKVK  571



>ref|XP_010424200.1| PREDICTED: uncharacterized protein LOC104709252 [Camelina sativa]
Length=492

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SR+VW YL+  KSEV + L  F    + +FG  ++ +R
Sbjct  438  GAVYFLTIVDDFSRSVWTYLLLEKSEVHTVLTNFPAYTDKKFGKPVKTVR  487



>ref|XP_010686695.1| PREDICTED: uncharacterized protein LOC104900863 [Beta vulgaris 
subsp. vulgaris]
Length=545

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT+LDDHSR  W +L+  K +V   +  F ++VE  F  +IR IR
Sbjct  298  GASYFLTVLDDHSRITWTFLLHNKMQVERVIEEFLSMVETHFNNKIRRIR  347



>ref|XP_004137882.1| PREDICTED: ABC transporter C family member 13-like [Cucumis sativus]
Length=2377

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151   GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
             G  +F+T +DDHSR  W+YLM+ +SE+ S    F   ++NQF   I+ +R
Sbjct  1086  GFRYFVTFVDDHSRLTWLYLMKNRSELLSHFCAFHTEIKNQFNVSIKTLR  1135



>ref|XP_009781907.1| PREDICTED: uncharacterized protein LOC104230728 [Nicotiana sylvestris]
Length=765

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD+S + W YL+  KS   +TL  F  +VE QF  R++ +R
Sbjct  477  GNRYFLTLVDDYSGSTWTYLLSTKSNAFTTLKDFIVMVETQFSYRVKTVR  526



>emb|CAN83015.1| hypothetical protein VITISV_041694 [Vitis vinifera]
Length=1099

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW+YL+  K+EV    + F  +V+ QF   ++ ++
Sbjct  254  GARYFLTIVDDFSRAVWIYLLVDKTEVFRMFMSFIAMVDRQFSQTVKVVQ  303



>emb|CAN79148.1| hypothetical protein VITISV_004343 [Vitis vinifera]
Length=1334

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL  +DD+SR  W+Y +  K +   + I F  +VENQ  T I+CI+
Sbjct  555  GARYFLIFIDDYSRHTWIYFLSTKDQALQSFITFRKMVENQLQTTIKCIQ  604



>emb|CAN82171.1| hypothetical protein VITISV_040546 [Vitis vinifera]
Length=1129

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW+YL+  K+EV    + F  +V+ QF   ++ ++
Sbjct  335  GARYFLTIVDDFSRAVWIYLLVDKTEVFRMFMSFIAMVDRQFSQTVKVVQ  384



>emb|CAN73924.1| hypothetical protein VITISV_041509 [Vitis vinifera]
Length=1434

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL  +DD+SR  W+Y +  K +   + I F  +VENQ  T I+CI+
Sbjct  555  GARYFLIFIDDYSRHTWIYFLSTKDQALQSFITFRKMVENQLQTTIKCIQ  604



>emb|CAN73272.1| hypothetical protein VITISV_013115 [Vitis vinifera]
Length=1178

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW+YL+  K+EV    + F  +V+ QF   ++ ++
Sbjct  340  GARYFLTIVDDFSRAVWIYLLVDKTEVFRMFMSFIAMVDRQFSQTVKVVQ  389



>ref|XP_010665837.1| PREDICTED: uncharacterized protein LOC104883080 [Beta vulgaris 
subsp. vulgaris]
Length=516

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLT++DD+SRAVWVYL+  K++V    + F  +V+ QF T ++ +R
Sbjct  416  GVVYFLTLVDDYSRAVWVYLLHNKTQVYKYFLSFFAMVKRQFATNVQIVR  465



>emb|CAN74847.1| hypothetical protein VITISV_028741 [Vitis vinifera]
Length=1262

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW+YL+  K+EV    + F  +V+ QF   ++ ++
Sbjct  586  GARYFLTIVDDFSRAVWIYLLVDKTEVFRMFMSFIAMVDRQFSQTVKVVQ  635



>gb|ABI34342.1| Polyprotein, putative [Solanum demissum]
Length=1054

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F++ +DD+SR  WV+LM+ +SE+ S    F   ++NQFG  IR  R
Sbjct  319  GFRYFVSFIDDYSRCTWVFLMKDRSELFSIFKSFFAEIQNQFGVSIRTFR  368



>gb|AAD24600.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1333

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SR VW+YL+  KSE    L  F  + + QF  +I+ +R
Sbjct  465  GARYFLTIIDDYSRGVWLYLLNDKSEAPCHLKNFFAMTDRQFNVKIKTVR  514



>emb|CAN81026.1| hypothetical protein VITISV_023317 [Vitis vinifera]
Length=1158

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLTI+DD++R  W++LM  K E +S L  F + V  QF  RI+  R
Sbjct  545  GAHYFLTIVDDYTRFTWIFLMXHKDEAQSLLKHFFSYVFTQFEFRIKTFR  594



>emb|CAN82380.1| hypothetical protein VITISV_021579 [Vitis vinifera]
Length=828

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL  +DD+SR  W+Y +  K +V  + I F  ++ENQ  T I+CI+
Sbjct  458  GARYFLIFIDDYSRHTWIYFLSTKDQVLHSFITFRKMIENQLHTTIKCIQ  507



>ref|XP_007023091.1| Uncharacterized protein TCM_027093 [Theobroma cacao]
 gb|EOY25713.1| Uncharacterized protein TCM_027093 [Theobroma cacao]
Length=994

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCI  5
            G+ +FL ++DDH+R  W+++M+AKSEV   +  F   V+ QF + I+ I
Sbjct  393  GQRYFLIVVDDHTRFTWIFIMKAKSEVSIIIPSFNAFVQKQFNSAIKSI  441



>emb|CAA31653.1| polyprotein [Arabidopsis thaliana]
Length=1291

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL+I+DD +R VW+Y +R+K E       +  LVENQ   +++C+R
Sbjct  525  GNKYFLSIIDDKTRKVWLYFLRSKDETFDRFCEWKELVENQQNKKVKCLR  574



>ref|XP_009804044.1| PREDICTED: uncharacterized protein LOC104249333 [Nicotiana sylvestris]
Length=621

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD +RA W +L+ AK+     L  F ++VE QF TR++ +R
Sbjct  477  GAKYFLTIVDDCTRATWTHLLGAKNNAFDLLKAFISMVETQFQTRVQIVR  526



>emb|CAN67247.1| hypothetical protein VITISV_008682 [Vitis vinifera]
Length=1270

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +FL  +DD+SR  W+Y +  K +  ST I F  ++ENQ  + I+CI+
Sbjct  450  YFLLFIDDYSRYTWIYFLSTKDQALSTFITFRKMIENQLNSTIKCIQ  496



>emb|CDP17738.1| unnamed protein product [Coffea canephora]
Length=798

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            GR++F+T +DD SR VWV+ M++K E+    + +   VENQ G +I+ +R
Sbjct  520  GRYYFVTFIDDFSRRVWVFTMKSKDEMLKIFLKWKARVENQTGRKIKILR  569



>ref|XP_009348351.1| PREDICTED: uncharacterized protein LOC103939989 [Pyrus x bretschneideri]
Length=911

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DD+SR  W+YL+++KSE  +    F  L+ NQF ++I  +R
Sbjct  565  GYKYFVTFIDDYSRVTWLYLLKSKSEFFTAFQDFHKLITNQFSSKIYTLR  614



>emb|CAN82610.1| hypothetical protein VITISV_021745 [Vitis vinifera]
Length=751

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FL  +DD+SR  W+Y +  K +   + I F  +VENQ  T I+CI+
Sbjct  342  GARYFLIFIDDYSRNTWIYFLSTKDQALHSFITFRKMVENQLHTTIKCIQ  391



>emb|CAB46043.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB80958.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1474

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCI  5
            ++L ++D H+R  W+Y ++ KS+V+ST I F  LVEN+F  +IR +
Sbjct  545  YYLVLVDHHTRYTWLYPLQQKSQVKSTFIAFKALVENRFQAKIRTL  590



>emb|CAI72292.1| putative polyprotein [Phytophthora infestans]
Length=1353

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  + LT +DD+SR V  Y M++KSEV S L  F  L E Q+G R++C+R
Sbjct  457  GAKYVLTFVDDYSRFVVAYFMKSKSEVGSKLKEFKALYETQWGERLKCLR  506



>emb|CAB75481.1| copia-like polyprotein [Arabidopsis thaliana]
Length=1363

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -2

Query  145  HFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
             +F++ +DD++R VWVY ++ K E     + + +LVENQ G R++ +R
Sbjct  525  QYFISFIDDYTRKVWVYFLKTKDEAFEKFVSWISLVENQSGERVKTLR  572



>emb|CAN76645.1| hypothetical protein VITISV_004685 [Vitis vinifera]
Length=1196

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD SRAVW+YL+  K+EV    + F  +V+ QF   ++ ++
Sbjct  467  GARYFLTIVDDFSRAVWIYLLVDKTEVFQMFMSFIAMVDQQFSQIVKVVQ  516



>ref|XP_009597447.1| PREDICTED: uncharacterized protein LOC104093413 [Nicotiana tomentosiformis]
Length=633

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  RHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            + FFL+++DD+S+ +W++L+  K +    L  F  +V NQF T I+C+R
Sbjct  391  KRFFLSLVDDYSKYIWIFLLTTKVDTIVALKNFLAMVRNQFRTSIKCLR  439



>emb|CAN65308.1| hypothetical protein VITISV_002323 [Vitis vinifera]
Length=1114

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +FLTI+DD+SR  WV+ M  KSE +  L+ F + V+ QF   I  IR
Sbjct  468  GAKYFLTIVDDYSRFTWVFFMHHKSETQHLLVNFFSFVQTQFHVSIANIR  517



>gb|AEJ72555.1| putative retroelement polyprotein [Malus domestica]
Length=1249

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DD SR  W+YL+++K EV +    F +LV NQF T+++ +R
Sbjct  512  GFRYFVTFVDDFSRCTWLYLLKSKDEVINVFQEFHSLVTNQFSTQLKVLR  561



>ref|XP_009788320.1| PREDICTED: uncharacterized protein LOC104236139 [Nicotiana sylvestris]
Length=665

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  HGRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +G  +FLTI+DD+SRA W +L+ +K    S L  F ++V+ QF  +++ IR
Sbjct  251  NGYTYFLTIVDDYSRATWTFLLSSKGNAFSVLKSFLSMVDRQFNLKVKKIR  301



>emb|CAN75812.1| hypothetical protein VITISV_004633 [Vitis vinifera]
Length=620

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -2

Query  136  LTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +T +DDHSR  WVY +R+KSEV  T   F   V+NQF   I+ +R
Sbjct  1    MTFIDDHSRFTWVYFLRSKSEVFRTFTEFLAYVDNQFSISIKTLR  45



>emb|CAN81712.1| hypothetical protein VITISV_038973 [Vitis vinifera]
Length=1615

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+ M+ KSEV      F  +V+NQF ++I+ ++
Sbjct  749  GTRWFVTFVDDHTRVTWVFFMKEKSEVGHIFQTFNLMVQNQFNSKIQVLK  798



>emb|CAN60374.1| hypothetical protein VITISV_001215 [Vitis vinifera]
Length=1535

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G H+FLTI+DD++R  W++LM+ K E +  +  F + V  QF + I+  R
Sbjct  620  GAHYFLTIVDDYTRFTWIFLMKHKDEAQPLIKHFFSYVSTQFASHIKIFR  669



>emb|CAN72268.1| hypothetical protein VITISV_017854 [Vitis vinifera]
Length=972

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +++T ++DHS   WVY +R+KSEV  T   F   V+NQF T I+ +R
Sbjct  424  YYVTFIBDHSIFTWVYFLRSKSEVFXTFTEFLVYVDNQFSTSIKTLR  470



>gb|AAK51235.1|AF287471_1 polyprotein [Arabidopsis thaliana]
Length=1453

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -2

Query  154  HGRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIR  11
             G  +++  +DD+SR  W Y ++AKS+  +  + F NLVENQF T+I+
Sbjct  532  QGFKYYVVFVDDYSRYSWFYPLKAKSDFFAVFVAFQNLVENQFNTKIK  579



>emb|CAN76439.1| hypothetical protein VITISV_001759 [Vitis vinifera]
Length=808

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ +F+T +DD+SR  WVY ++ KSE  ST   F  LVE + G  I+  R
Sbjct  58   GKRYFITFIDDYSRKTWVYFLQEKSEAFSTFKSFKMLVEKEAGKPIKIFR  107



>ref|XP_010665586.1| PREDICTED: uncharacterized protein LOC104882867 [Beta vulgaris 
subsp. vulgaris]
Length=872

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G ++FLTI+DD+SR  W +L+  K +VR  +  F   VENQF T ++ +R
Sbjct  631  GGNYFLTIVDDNSRVTWTHLLCNKEQVREIIKNFLIHVENQFHTTVKTVR  680



>emb|CAN73014.1| hypothetical protein VITISV_007603 [Vitis vinifera]
Length=1121

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ KS+V      F  +V+NQF ++I+ ++
Sbjct  716  GTRWFVTFVDDHTRVTWVFLMKEKSKVGHIFQTFNLMVQNQFNSKIQVLK  765



>emb|CAN82851.1| hypothetical protein VITISV_027998 [Vitis vinifera]
Length=1239

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F++ +DDH+R  WV+LM+ KSE       F N+++ QF ++I+ ++
Sbjct  386  GTRWFVSFIDDHTRLTWVFLMKEKSETSQIFKNFKNMIQTQFQSKIQILK  435



>ref|XP_009623631.1| PREDICTED: uncharacterized protein LOC104114778 [Nicotiana tomentosiformis]
Length=1272

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  FFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            +FL I+DD++RA W +LM  KS     L  F ++VE QF TR++ +R
Sbjct  809  YFLIIVDDYTRATWTHLMGGKSNAFDLLKAFISMVETQFQTRVQTVR  855



>emb|CAN75466.1| hypothetical protein VITISV_025054 [Vitis vinifera]
Length=1576

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F++ +DDH+R  WV+LM+ KSE       F N+++ QF ++I+ ++
Sbjct  707  GTRWFVSFIDDHTRLTWVFLMKEKSETSQIFKNFKNMIQTQFQSKIQILK  756



>emb|CAN80566.1| hypothetical protein VITISV_029672 [Vitis vinifera]
Length=1636

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F++ +DDH+R  WV+LM+ KSE       F N+++ QF ++I+ ++
Sbjct  592  GTRWFVSFIDDHTRLTWVFLMKEKSETSQIFKNFKNMIQTQFQSKIQILK  641



>emb|CAN68802.1| hypothetical protein VITISV_008809 [Vitis vinifera]
Length=1397

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+T +DDH+R  WV+LM+ K EV      F  +V+NQF ++I+ ++
Sbjct  576  GTRWFVTFVDDHTRVTWVFLMKEKXEVGHIFQTFNLMVQNQFNSKIQVLK  625



>emb|CAN82483.1| hypothetical protein VITISV_006799 [Vitis vinifera]
Length=1180

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F++ +DDH+R  WV+LM+ KSE       F N+++ QF ++I+ ++
Sbjct  311  GTRWFVSFIDDHTRLTWVFLMKEKSETSQIFKNFKNMIQTQFQSKIQILK  360



>ref|XP_004514853.1| PREDICTED: uncharacterized protein LOC101509170 [Cicer arietinum]
Length=718

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G  +F+  +DDH+R  WV+L++ KSEV S    F  +V+ QF + I+ +R
Sbjct  272  GSRWFVAFIDDHTRVTWVFLLKEKSEVGSIFENFHKMVQTQFQSNIQVLR  321



>gb|ABE88096.1| Integrase, catalytic region [Medicago truncatula]
Length=604

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  154  HGRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            HG+ +FLTI+DDHSR +W  L + KSEV S +  F  L++N+     + IR
Sbjct  367  HGQRYFLTIVDDHSRFLWTILFKNKSEVPSHIQHFIYLIQNKHKVTPKIIR  417



>emb|CAN78262.1| hypothetical protein VITISV_006704 [Vitis vinifera]
Length=565

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  151  GRHFFLTILDDHSRAVWVYLMRAKSEVRSTLIGFCNLVENQFGTRIRCIR  2
            G+ F++T +DD+SR   VYL+R K E R   I + N VENQ   +I  +R
Sbjct  401  GKRFYITFIDDYSRYTRVYLLRNKDEARDAFIKYKNEVENQLNKKIERLR  450



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522492721668