BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c36915_g1_i1 len=133 path=[1:0-132]

Length=133
                                                                      Score     E

ref|XP_006366876.1|  PREDICTED: protein LURP-one-related 15-like      77.4    4e-16   
ref|XP_011095098.1|  PREDICTED: protein LURP-one-related 15-like      73.9    9e-15   
ref|XP_009371970.1|  PREDICTED: protein LURP-one-related 15-like      72.8    2e-14   
ref|XP_009789207.1|  PREDICTED: protein LURP-one-related 10-like      72.8    2e-14   
ref|XP_004137685.1|  PREDICTED: protein LURP-one-related 15-like      72.4    3e-14   
ref|XP_008366795.1|  PREDICTED: protein LURP-one-related 15-like      72.4    4e-14   
ref|XP_008388315.1|  PREDICTED: protein LURP-one-related 15-like      71.6    6e-14   
ref|XP_010256975.1|  PREDICTED: protein LURP-one-related 10-like      70.1    2e-13   
ref|XP_009402217.1|  PREDICTED: protein LURP-one-related 15-like      70.1    2e-13   
gb|EYU41984.1|  hypothetical protein MIMGU_mgv1a013874mg              70.1    2e-13   
ref|XP_010035980.1|  PREDICTED: protein LURP-one-related 15-like      70.1    2e-13   
gb|KCW47497.1|  hypothetical protein EUGRSUZ_K01265                   70.1    3e-13   
ref|XP_009599218.1|  PREDICTED: protein LURP-one-related 10-like ...  69.3    4e-13   
ref|XP_010922672.1|  PREDICTED: protein LURP-one-related 15-like      69.3    4e-13   
ref|XP_010922670.1|  PREDICTED: protein LURP-one-related 15-like      68.9    5e-13   
ref|XP_004249679.1|  PREDICTED: protein LURP-one-related 10-like      68.9    7e-13   
ref|XP_004302604.1|  PREDICTED: protein LURP-one-related 15-like      68.9    7e-13   
ref|XP_007140161.1|  hypothetical protein PHAVU_008G089000g           68.2    1e-12   
gb|AGV54542.1|  protein LURP-one-related 15                           68.2    1e-12   
ref|XP_007206400.1|  hypothetical protein PRUPE_ppa016516mg           68.2    1e-12   
ref|XP_008799837.1|  PREDICTED: protein LURP-one-related 15-like      67.8    1e-12   
ref|XP_006338963.1|  PREDICTED: protein LURP-one-related 15-like      67.8    1e-12   
ref|XP_008799835.1|  PREDICTED: protein LURP-one-related 15-like      67.8    1e-12   
emb|CDP06411.1|  unnamed protein product                              67.4    2e-12   
gb|EYU41983.1|  hypothetical protein MIMGU_mgv11b011599mg             67.4    2e-12   
ref|XP_003534660.1|  PREDICTED: protein LURP-one-related 15-like      67.0    3e-12   
ref|XP_008245297.1|  PREDICTED: protein LURP-one-related 15-like      67.0    3e-12   
ref|XP_007205898.1|  hypothetical protein PRUPE_ppa011379mg           67.0    3e-12   
gb|KDO37302.1|  hypothetical protein CISIN_1g027334mg                 66.6    4e-12   
ref|XP_008442344.1|  PREDICTED: protein LURP-one-related 10           66.6    4e-12   
ref|XP_002266957.1|  PREDICTED: protein LURP-one-related 10           66.6    4e-12   Vitis vinifera
ref|XP_003623539.1|  hypothetical protein MTR_7g072170                66.6    4e-12   
ref|XP_008245303.1|  PREDICTED: uncharacterized protein LOC103343426  68.6    5e-12   
gb|EYU41982.1|  hypothetical protein MIMGU_mgv1a013977mg              66.2    5e-12   
ref|XP_003552292.1|  PREDICTED: protein LURP-one-related 15-like      66.2    5e-12   
emb|CBI18075.3|  unnamed protein product                              65.9    6e-12   
emb|CBW47299.1|  tubby structurally-related protein                   65.9    6e-12   
ref|XP_002533823.1|  conserved hypothetical protein                   65.9    7e-12   Ricinus communis
ref|XP_002266795.1|  PREDICTED: protein LURP-one-related 10           65.5    9e-12   Vitis vinifera
ref|XP_004246314.1|  PREDICTED: protein LURP-one-related 10-like      65.5    1e-11   
ref|XP_006481142.1|  PREDICTED: protein LURP-one-related 15-like      65.5    1e-11   
emb|CBI18076.3|  unnamed protein product                              65.1    1e-11   
ref|XP_004492957.1|  PREDICTED: protein LURP-one-related 15-like      65.1    1e-11   
ref|XP_004246313.1|  PREDICTED: protein LURP-one-related 10           65.1    1e-11   
ref|XP_003623537.1|  hypothetical protein MTR_7g072140                64.7    2e-11   
ref|XP_004302612.1|  PREDICTED: protein LURP-one-related 15-like      64.7    2e-11   
gb|ACU19112.1|  unknown                                               64.7    2e-11   Glycine max [soybeans]
gb|AFK40426.1|  unknown                                               64.3    2e-11   
ref|XP_006359803.1|  PREDICTED: protein LURP-one-related 15-like      64.3    2e-11   
gb|AFK46402.1|  unknown                                               64.3    2e-11   
gb|KHN44840.1|  Protein LURP-one-related 15                           63.5    3e-11   
ref|XP_003516997.1|  PREDICTED: protein LURP-one-related 15-like      63.9    3e-11   
gb|EPS73959.1|  hypothetical protein M569_00797                       63.9    4e-11   
ref|XP_002533825.1|  conserved hypothetical protein                   63.5    5e-11   Ricinus communis
ref|XP_006429530.1|  hypothetical protein CICLE_v10012677mg           63.2    6e-11   
gb|KDO39836.1|  hypothetical protein CISIN_1g044780mg                 62.8    9e-11   
ref|XP_006429525.1|  hypothetical protein CICLE_v10012901mg           62.4    1e-10   
ref|XP_006481139.1|  PREDICTED: protein LURP-one-related 15-like      62.4    1e-10   
ref|XP_007033608.1|  UPF0706 protein, putative isoform 1              62.8    1e-10   
ref|NP_001236124.1|  uncharacterized protein LOC100527184             62.0    2e-10   
ref|XP_004492624.1|  PREDICTED: uncharacterized protein LOC101492951  63.9    2e-10   
gb|KDO63310.1|  hypothetical protein CISIN_1g023131mg                 62.8    2e-10   
ref|XP_007033609.1|  UPF0706 protein, putative isoform 2              61.2    3e-10   
ref|XP_009384935.1|  PREDICTED: protein LURP-one-related 15-like      61.2    4e-10   
gb|KFK24635.1|  hypothetical protein AALP_AA8G005200                  60.8    4e-10   
ref|XP_007134609.1|  hypothetical protein PHAVU_010G061200g           60.8    5e-10   
ref|XP_007017093.1|  LURP-one-related 1, putative                     60.8    5e-10   
gb|KHN33239.1|  Protein LURP-one-related 15                           60.8    5e-10   
ref|XP_006429529.1|  hypothetical protein CICLE_v10013687mg           60.8    6e-10   
ref|XP_006658415.1|  PREDICTED: protein LURP-one-related 15-like      60.1    1e-09   
ref|XP_003623546.1|  hypothetical protein MTR_7g072270                59.7    1e-09   
ref|XP_003557363.1|  PREDICTED: protein LURP-one-related 15-like      59.7    1e-09   
gb|KEH23251.1|  LURP-one-like protein                                 59.3    1e-09   
gb|KHG20549.1|  hypothetical protein F383_24081                       59.7    1e-09   
ref|XP_007033606.1|  Uncharacterized protein TCM_019770               59.3    1e-09   
ref|XP_004955842.1|  PREDICTED: protein LURP-one-related 15-like      59.3    2e-09   
ref|XP_010066185.1|  PREDICTED: protein LURP-one-related 15-like      59.3    2e-09   
ref|NP_001238511.1|  uncharacterized protein LOC100527088             59.3    2e-09   
gb|EYU45785.1|  hypothetical protein MIMGU_mgv1a014369mg              58.9    2e-09   
ref|XP_003623535.1|  hypothetical protein MTR_7g072120                58.9    2e-09   
ref|XP_009599217.1|  PREDICTED: protein LURP-one-related 10-like ...  59.3    2e-09   
ref|XP_009371971.1|  PREDICTED: protein LURP-one-related 15-like      58.9    3e-09   
ref|XP_009373134.1|  PREDICTED: protein LURP-one-related 10-like      58.9    3e-09   
ref|XP_004302610.1|  PREDICTED: protein LURP-one-related 15-like      58.9    3e-09   
ref|XP_004955840.1|  PREDICTED: protein LURP-one-related 15-like      58.5    3e-09   
ref|XP_008364003.1|  PREDICTED: protein LURP-one-related 10-like      58.9    3e-09   
ref|XP_007205855.1|  hypothetical protein PRUPE_ppa011132mg           58.5    3e-09   
ref|XP_004302600.1|  PREDICTED: protein LURP-one-related 15-like ...  58.5    4e-09   
ref|XP_004955841.1|  PREDICTED: protein LURP-one-related 15-like      57.8    5e-09   
gb|AES79762.2|  tubby C 2 protein                                     58.2    7e-09   
ref|XP_002533824.1|  conserved hypothetical protein                   57.4    8e-09   Ricinus communis
ref|XP_009385279.1|  PREDICTED: protein LURP-one-related 15-like      57.0    9e-09   
ref|XP_009373121.1|  PREDICTED: protein LURP-one-related 10-like      57.4    1e-08   
ref|XP_008244814.1|  PREDICTED: protein LURP-one-related 10-like      57.4    1e-08   
ref|XP_004959099.1|  PREDICTED: protein LURP-one-related 15-like      57.0    1e-08   
gb|KFK24672.1|  hypothetical protein AALP_AA8G010000                  57.0    1e-08   
ref|XP_004302616.1|  PREDICTED: protein LURP-one-related 15-like      56.6    1e-08   
gb|EMT17785.1|  hypothetical protein F775_09844                       57.0    1e-08   
ref|XP_004955839.1|  PREDICTED: protein LURP-one-related 15-like      57.0    1e-08   
ref|XP_008363928.1|  PREDICTED: protein LURP-one-related 10-like      57.0    1e-08   
ref|NP_001143567.1|  uncharacterized protein LOC100276264             56.6    2e-08   Zea mays [maize]
ref|XP_007206684.1|  hypothetical protein PRUPE_ppa022042mg           56.2    2e-08   
ref|NP_001143025.1|  hypothetical protein                             56.6    2e-08   Zea mays [maize]
ref|XP_011009970.1|  PREDICTED: protein LURP-one-related 15-like ...  56.6    2e-08   
gb|KHG14025.1|  hypothetical protein F383_19046                       56.6    2e-08   
ref|XP_002323651.2|  hypothetical protein POPTR_0016s13820g           56.2    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_002461713.1|  hypothetical protein SORBIDRAFT_02g006920        56.2    2e-08   Sorghum bicolor [broomcorn]
ref|NP_568095.1|  uncharacterized protein                             55.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007140155.1|  hypothetical protein PHAVU_008G088500g           56.2    3e-08   
ref|XP_011003577.1|  PREDICTED: protein LURP-one-related 15-like      55.8    3e-08   
gb|KFK40276.1|  hypothetical protein AALP_AA3G354100                  55.8    3e-08   
gb|EMS68499.1|  hypothetical protein TRIUR3_16300                     57.0    4e-08   
ref|XP_011085848.1|  PREDICTED: protein LURP-one-related 15-like      55.5    4e-08   
ref|XP_008245298.1|  PREDICTED: protein LURP-one-related 15-like      55.5    4e-08   
ref|XP_002323653.2|  hypothetical protein POPTR_0016s13920g           55.1    5e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010553137.1|  PREDICTED: protein LURP-one-related 15           55.5    5e-08   
ref|XP_011042734.1|  PREDICTED: protein LURP-one-related 15-like      55.1    5e-08   
gb|KFK40277.1|  hypothetical protein AALP_AA3G354200                  55.1    6e-08   
ref|XP_009385280.1|  PREDICTED: protein LURP-one-related 15-like      55.5    6e-08   
ref|NP_850751.1|  uncharacterized protein                             55.1    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004955843.1|  PREDICTED: protein LURP-one-related 15-like      54.7    7e-08   
ref|XP_006429531.1|  hypothetical protein CICLE_v10012705mg           54.7    8e-08   
gb|KDO36505.1|  hypothetical protein CISIN_1g027044mg                 55.1    9e-08   
gb|AAM62599.1|  unknown                                               53.9    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY56592.1|  BnaC03g73380D                                        53.9    1e-07   
ref|XP_002323048.2|  hypothetical protein POPTR_0016s13930g           54.3    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_002323041.2|  hypothetical protein POPTR_0016s13840g           54.3    1e-07   Populus trichocarpa [western balsam poplar]
gb|KDO35832.1|  hypothetical protein CISIN_1g026111mg                 54.7    1e-07   
ref|XP_006396820.1|  hypothetical protein EUTSA_v10028998mg           53.5    2e-07   
ref|XP_011095095.1|  PREDICTED: protein LURP-one-related 15-like ...  53.5    2e-07   
emb|CDY47918.1|  BnaAnng09500D                                        53.1    2e-07   
pdb|1ZXU|A  Chain A, X-Ray Structure Of Protein From Arabidopsis ...  53.5    2e-07   
ref|XP_006387427.1|  hypothetical protein POPTR_1048s00200g           53.5    2e-07   
ref|XP_011095096.1|  PREDICTED: protein LURP-one-related 15-like ...  53.1    3e-07   
gb|KCW47498.1|  hypothetical protein EUGRSUZ_K01266                   52.8    3e-07   
ref|XP_009796279.1|  PREDICTED: protein LURP-one-related 10-like      53.1    3e-07   
ref|XP_004963225.1|  PREDICTED: protein LURP-one-related 15-like      54.7    3e-07   
ref|XP_010921083.1|  PREDICTED: protein LURP-one-related 10           53.5    3e-07   
ref|XP_006288633.1|  hypothetical protein CARUB_v10001936mg           53.1    3e-07   
ref|XP_010490512.1|  PREDICTED: protein LURP-one-related 15           53.1    4e-07   
ref|XP_010451939.1|  PREDICTED: protein LURP-one-related 15-like      53.1    4e-07   
ref|XP_010423989.1|  PREDICTED: protein LURP-one-related 15-like      53.1    4e-07   
ref|XP_002872996.1|  hypothetical protein ARALYDRAFT_486891           53.1    4e-07   
gb|KDO63312.1|  hypothetical protein CISIN_1g029811mg                 52.4    5e-07   
ref|XP_006429528.1|  hypothetical protein CICLE_v10012737mg           52.4    5e-07   
ref|XP_009121182.1|  PREDICTED: protein LURP-one-related 10           52.0    6e-07   
ref|XP_009385283.1|  PREDICTED: protein LURP-one-related 15-like      52.0    7e-07   
ref|XP_002882745.1|  hypothetical protein ARALYDRAFT_478520           52.0    7e-07   
gb|KDP22801.1|  hypothetical protein JCGZ_00388                       52.0    8e-07   
ref|XP_002323042.1|  hypothetical protein POPTR_0016s13850g           52.0    8e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006398584.1|  hypothetical protein EUTSA_v10014621mg           52.0    1e-06   
ref|XP_011009969.1|  PREDICTED: protein LURP-one-related 15-like ...  51.6    1e-06   
ref|XP_010325781.1|  PREDICTED: protein LURP-one-related 10-like      51.2    2e-06   
ref|XP_011032780.1|  PREDICTED: protein LURP-one-related 10-like      51.2    2e-06   
ref|XP_002323040.1|  hypothetical protein POPTR_0016s13810g           51.2    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007140154.1|  hypothetical protein PHAVU_008G088400g           50.4    2e-06   
ref|XP_009130626.1|  PREDICTED: protein LURP-one-related 15           51.2    2e-06   
ref|XP_004514892.1|  PREDICTED: protein LURP-one-related 15-like ...  50.8    2e-06   
ref|XP_006299992.1|  hypothetical protein CARUB_v10016206mg           50.8    2e-06   
ref|XP_002461710.1|  hypothetical protein SORBIDRAFT_02g006890        50.8    3e-06   Sorghum bicolor [broomcorn]
ref|XP_010416367.1|  PREDICTED: protein LURP-one-related 15-like ...  50.4    3e-06   
ref|XP_003522135.1|  PREDICTED: protein LURP-one-related 15           50.4    3e-06   
ref|XP_010498057.1|  PREDICTED: protein LURP-one-related 10           50.4    3e-06   
ref|XP_010471605.1|  PREDICTED: protein LURP-one-related 15-like ...  50.4    3e-06   
ref|XP_011016240.1|  PREDICTED: protein LURP-one-related 15-like      49.7    3e-06   
ref|XP_010416368.1|  PREDICTED: protein LURP-one-related 15-like ...  50.1    3e-06   
ref|XP_003605353.1|  hypothetical protein MTR_4g029430                50.4    3e-06   
ref|XP_011042664.1|  PREDICTED: protein LURP-one-related 15-like ...  50.4    3e-06   
ref|XP_010471606.1|  PREDICTED: protein LURP-one-related 15-like ...  50.1    3e-06   
ref|XP_006407416.1|  hypothetical protein EUTSA_v10022341mg           50.1    3e-06   
ref|XP_010464895.1|  PREDICTED: protein LURP-one-related 10-like      50.1    4e-06   
ref|XP_011042663.1|  PREDICTED: protein LURP-one-related 15-like ...  50.4    4e-06   
gb|EAZ39190.1|  hypothetical protein OsJ_23616                        50.1    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006429527.1|  hypothetical protein CICLE_v10012729mg           50.1    4e-06   
ref|XP_011042665.1|  PREDICTED: protein LURP-one-related 15-like ...  49.7    4e-06   
ref|XP_006413512.1|  hypothetical protein EUTSA_v10026215mg           50.1    4e-06   
ref|XP_009125396.1|  PREDICTED: protein LURP-one-related 15           50.1    5e-06   
emb|CDY04830.1|  BnaAnng00120D                                        50.1    5e-06   
gb|EAZ03288.1|  hypothetical protein OsI_25434                        49.7    5e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_006300551.1|  hypothetical protein CARUB_v10020946mg           50.1    5e-06   
ref|XP_011009971.1|  PREDICTED: protein LURP-one-related 15-like ...  49.7    5e-06   
ref|XP_010428507.1|  PREDICTED: protein LURP-one-related 15-like      49.7    6e-06   
ref|NP_001059232.1|  Os07g0230700                                     49.7    6e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006429526.1|  hypothetical protein CICLE_v10012456mg           50.4    6e-06   
gb|KFK38540.1|  hypothetical protein AALP_AA3G127300                  49.3    7e-06   
ref|XP_009135182.1|  PREDICTED: protein LURP-one-related 10-like      48.9    9e-06   
ref|XP_006481140.1|  PREDICTED: protein LURP-one-related 15-like      50.4    9e-06   
ref|NP_187780.2|  uncharacterized protein                             48.9    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923017.1|  PREDICTED: protein LURP-one-related 15-like      48.9    9e-06   
ref|XP_010474343.1|  PREDICTED: protein LURP-one-related 15-like      48.9    9e-06   
ref|XP_011009972.1|  PREDICTED: protein LURP-one-related 15-like      48.1    1e-05   
ref|XP_002323043.1|  hypothetical protein POPTR_0016s13870g           48.5    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010416365.1|  PREDICTED: protein LURP-one-related 15-like      48.9    1e-05   
ref|XP_002323044.2|  hypothetical protein POPTR_0016s13880g           48.1    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011042736.1|  PREDICTED: protein LURP-one-related 15-like      48.5    1e-05   
ref|XP_009629283.1|  PREDICTED: protein LURP-one-related 15-like      48.5    1e-05   
ref|XP_004959100.1|  PREDICTED: protein LURP-one-related 15-like      48.9    1e-05   
ref|XP_006413514.1|  hypothetical protein EUTSA_v10026191mg           48.9    2e-05   
gb|KCW88262.1|  hypothetical protein EUGRSUZ_A00646                   47.8    2e-05   
ref|XP_008652198.1|  PREDICTED: protein LURP-one-related 10-like      48.5    2e-05   
ref|XP_006481428.1|  PREDICTED: protein LURP-one-related 15-like      47.0    2e-05   
gb|KFK24637.1|  hypothetical protein AALP_AA8G005400                  50.1    2e-05   
ref|XP_009122395.1|  PREDICTED: protein LURP-one-related 10-like      48.5    2e-05   
gb|KFK24636.1|  hypothetical protein AALP_AA8G005300                  48.1    2e-05   
ref|XP_002865648.1|  predicted protein                                47.4    2e-05   
gb|KDO39837.1|  hypothetical protein CISIN_1g047297mg                 47.8    2e-05   
ref|XP_010486843.1|  PREDICTED: protein LURP-one-related 10           47.8    3e-05   
ref|XP_010066196.1|  PREDICTED: protein LURP-one-related 15-like      47.4    3e-05   
gb|KHN29540.1|  Protein LURP-one-related 15                           46.6    3e-05   
ref|XP_006413513.1|  hypothetical protein EUTSA_v10025938mg           48.5    3e-05   
ref|XP_010256970.1|  PREDICTED: protein LURP-one-related 14 isofo...  47.8    3e-05   
ref|XP_010091106.1|  hypothetical protein L484_021991                 47.8    4e-05   
ref|XP_010256969.1|  PREDICTED: protein LURP-one-related 14 isofo...  47.8    4e-05   
ref|XP_002893791.1|  hypothetical protein ARALYDRAFT_473540           47.0    4e-05   
ref|XP_011014020.1|  PREDICTED: protein LURP-one-related 15-like      47.4    5e-05   
emb|CDY59000.1|  BnaC08g49520D                                        47.4    5e-05   
gb|AAL49886.1|  unknown protein                                       47.0    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002323047.2|  hypothetical protein POPTR_0016s13910g           46.2    6e-05   Populus trichocarpa [western balsam poplar]
ref|XP_003533673.1|  PREDICTED: protein LURP-one-related 15-like ...  47.0    6e-05   
ref|XP_006587937.1|  PREDICTED: protein LURP-one-related 15-like ...  47.0    6e-05   
ref|XP_002323045.1|  hypothetical protein POPTR_0016s13890g           46.2    7e-05   Populus trichocarpa [western balsam poplar]
gb|AAG52207.1|AC022288_6  hypothetical protein; 65513-66156           46.2    7e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69996.1|  BnaA10g23450D                                        46.6    8e-05   
ref|XP_009117588.1|  PREDICTED: protein LURP-one-related 15-like      47.0    8e-05   
emb|CDY66599.1|  BnaAnng22510D                                        47.0    8e-05   
gb|EEC76413.1|  hypothetical protein OsI_14068                        46.2    9e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001051696.1|  Os03g0816800                                     46.6    9e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650795.1|  PREDICTED: protein LURP-one-related 15-like      46.2    1e-04   
gb|KFK39031.1|  hypothetical protein AALP_AA3G191800                  46.2    1e-04   
gb|KHN40667.1|  Protein LURP-one-related 15                           45.1    1e-04   
ref|NP_973456.1|  protein LURP1                                       45.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LQ36.2|LOR1_ARATH  RecName: Full=Protein LURP-one-related 1      46.6    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011009968.1|  PREDICTED: uncharacterized protein LOC105114932  47.4    1e-04   
ref|XP_002883033.1|  hypothetical protein ARALYDRAFT_341828           45.8    1e-04   
ref|XP_004514891.1|  PREDICTED: protein LURP-one-related 15-like ...  46.2    1e-04   
gb|KHN27556.1|  Protein LURP-one-related 15                           46.6    1e-04   
ref|XP_006599086.1|  PREDICTED: protein LURP-one-related 15-like      46.6    1e-04   
ref|NP_188315.1|  uncharacterized protein                             45.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174646.2|  uncharacterized protein                             46.2    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428508.1|  PREDICTED: protein LURP-one-related 15-like      46.2    2e-04   
ref|NP_179062.1|  protein LURP1                                       45.8    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KHN44839.1|  Protein LURP-one-related 15                           44.7    2e-04   
gb|EEE60176.1|  hypothetical protein OsJ_13108                        45.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010491289.1|  PREDICTED: protein LURP-one-related 14-like ...  45.4    2e-04   
ref|XP_010491288.1|  PREDICTED: protein LURP-one-related 14-like ...  45.4    3e-04   
gb|AAF97296.1|AC010164_18  Hypothetical protein                       45.8    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117597.1|  PREDICTED: protein LURP-one-related 15-like ...  45.4    3e-04   
ref|XP_007140158.1|  hypothetical protein PHAVU_008G088800g           44.3    3e-04   
ref|XP_006602691.1|  PREDICTED: protein LURP-one-related 15-like      45.1    3e-04   
ref|XP_003563792.2|  PREDICTED: protein LURP-one-related 15-like      45.1    3e-04   
ref|XP_002323046.1|  hypothetical protein POPTR_0016s13900g           43.9    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_004981281.1|  PREDICTED: protein LURP-one-related 15-like      44.7    4e-04   
ref|XP_003588870.1|  hypothetical protein MTR_1g014180                44.3    4e-04   
ref|XP_006298985.1|  hypothetical protein CARUB_v10015111mg           44.3    4e-04   
ref|XP_006288661.1|  hypothetical protein CARUB_v10001968mg           44.7    5e-04   
gb|EMT12071.1|  hypothetical protein F775_01087                       43.9    5e-04   
ref|XP_002316183.1|  hypothetical protein POPTR_0010s18950g           44.3    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_009114229.1|  PREDICTED: protein LURP-one-related 13           44.3    5e-04   
emb|CDY52725.1|  BnaC01g44100D                                        43.9    6e-04   
emb|CDX99023.1|  BnaC09g48120D                                        44.3    6e-04   
ref|NP_001144637.1|  uncharacterized protein LOC100277656             44.3    6e-04   Zea mays [maize]
tpg|DAA52160.1|  TPA: hypothetical protein ZEAMMB73_715609            44.3    6e-04   
gb|AGT16996.1|  hypothetical protein SHCRBa_063_N24_R_80              44.3    7e-04   
ref|XP_010911049.1|  PREDICTED: protein LURP-one-related 10-like      43.9    0.001   



>ref|XP_006366876.1| PREDICTED: protein LURP-one-related 15-like [Solanum tuberosum]
Length=202

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +P+VTFQQK+ TAH RWQAFRGESTDPK LLFSVK
Sbjct  65   RRVLVDGAGNPLVTFQQKLLTAHNRWQAFRGESTDPKQLLFSVK  108



>ref|XP_011095098.1| PREDICTED: protein LURP-one-related 15-like [Sesamum indicum]
Length=207

 Score = 73.9 bits (180),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    PI+TFQQK+ +AHRRWQ FRGESTD KDLLFSVK
Sbjct  66   RRVLLDATGIPIITFQQKLLSAHRRWQVFRGESTDAKDLLFSVK  109



>ref|XP_009371970.1| PREDICTED: protein LURP-one-related 15-like [Pyrus x bretschneideri]
Length=213

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +PIV+F+QKI TAHRRWQ +RGES+D KDLLFS K
Sbjct  73   RRVLVDNAGNPIVSFRQKIMTAHRRWQVYRGESSDSKDLLFSAK  116



>ref|XP_009789207.1| PREDICTED: protein LURP-one-related 10-like [Nicotiana sylvestris]
Length=213

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +P+VTFQQK+ TAHRRWQ +RGESTD K+ LFSVK
Sbjct  72   RRVLVDAAGNPLVTFQQKMLTAHRRWQVYRGESTDTKNFLFSVK  115



>ref|XP_004137685.1| PREDICTED: protein LURP-one-related 15-like [Cucumis sativus]
 ref|XP_004173646.1| PREDICTED: protein LURP-one-related 15-like [Cucumis sativus]
 gb|KGN58707.1| hypothetical protein Csa_3G730710 [Cucumis sativus]
Length=215

 Score = 72.4 bits (176),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D  D+P++TFQQK+F+AHR+W A+RGES D KDLLF+VK
Sbjct  74   RRVLLDAADNPVITFQQKLFSAHRKWYAYRGESRDSKDLLFTVK  117



>ref|XP_008366795.1| PREDICTED: protein LURP-one-related 15-like [Malus domestica]
Length=213

 Score = 72.4 bits (176),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +PIV+F+QKI TAHRRWQ +RGES+D KDLLFS K
Sbjct  73   RRVLVDNAGNPIVSFRQKIMTAHRRWQVYRGESSDSKDLLFSXK  116



>ref|XP_008388315.1| PREDICTED: protein LURP-one-related 15-like [Malus domestica]
Length=213

 Score = 71.6 bits (174),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +PIV+F+QKI TAHRRWQ +RGES+D KDLLFS K
Sbjct  73   RRVLVDNAGNPIVSFRQKIMTAHRRWQVYRGESSDSKDLLFSGK  116



>ref|XP_010256975.1| PREDICTED: protein LURP-one-related 10-like [Nelumbo nucifera]
Length=213

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +PIV+ QQKI TAH+RWQ FRGES+D +DLLFS K
Sbjct  72   RRVLVDAAGNPIVSLQQKILTAHKRWQVFRGESSDTEDLLFSAK  115



>ref|XP_009402217.1| PREDICTED: protein LURP-one-related 15-like [Musa acuminata subsp. 
malaccensis]
Length=209

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R VL+D   +P++T QQKI +AHRRWQ FRGESTD KDLLFSVK
Sbjct  68   RCVLLDAAGNPLLTLQQKILSAHRRWQVFRGESTDSKDLLFSVK  111



>gb|EYU41984.1| hypothetical protein MIMGU_mgv1a013874mg [Erythranthe guttata]
Length=208

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    PI+TFQQK+ +AH+RWQ FRGEST+ KD+LFSV+
Sbjct  67   RRVLLDAAGTPIITFQQKLLSAHQRWQVFRGESTNAKDMLFSVR  110



>ref|XP_010035980.1| PREDICTED: protein LURP-one-related 15-like [Eucalyptus grandis]
Length=199

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +P+VT  +KI +AH RWQAFRG+STDPKDL+F+VK
Sbjct  58   RRVLVDAAGNPLVTLTEKIMSAHDRWQAFRGDSTDPKDLIFTVK  101



>gb|KCW47497.1| hypothetical protein EUGRSUZ_K01265 [Eucalyptus grandis]
Length=258

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +P+VT  +KI +AH RWQAFRG+STDPKDL+F+VK
Sbjct  117  RRVLVDAAGNPLVTLTEKIMSAHDRWQAFRGDSTDPKDLIFTVK  160



>ref|XP_009599218.1| PREDICTED: protein LURP-one-related 10-like isoform X2 [Nicotiana 
tomentosiformis]
Length=213

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +P+VTFQQK+ TAHRRWQ +RGESTD  + LFSVK
Sbjct  72   RRVLLDAAGNPLVTFQQKMLTAHRRWQVYRGESTDTTNFLFSVK  115



>ref|XP_010922672.1| PREDICTED: protein LURP-one-related 15-like [Elaeis guineensis]
Length=207

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D+  +P+V+ QQKI +AHRRWQ +RGES+D KDLLFSVK
Sbjct  67   RVLLDSAGNPLVSMQQKILSAHRRWQVYRGESSDSKDLLFSVK  109



>ref|XP_010922670.1| PREDICTED: protein LURP-one-related 15-like [Elaeis guineensis]
Length=209

 Score = 68.9 bits (167),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L+D   +PI++ QQK+FT HRRW+A+RG+STD KDLLFS K
Sbjct  70   RRILLDNAGNPILSMQQKVFTVHRRWEAYRGDSTDSKDLLFSTK  113



>ref|XP_004249679.1| PREDICTED: protein LURP-one-related 10-like [Solanum lycopersicum]
 ref|XP_010312312.1| PREDICTED: protein LURP-one-related 10-like [Solanum lycopersicum]
Length=214

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L+D   + +VTFQQK+ +AHRRWQ +RGESTD KD LFSVK
Sbjct  73   RRILLDAAGNSLVTFQQKMLSAHRRWQVYRGESTDSKDFLFSVK  116



>ref|XP_004302604.1| PREDICTED: protein LURP-one-related 15-like [Fragaria vesca subsp. 
vesca]
Length=213

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR LVD+   PIV+F+QKI TAHRRW  FRGES+D K+LLFSVK
Sbjct  73   RRTLVDSAGTPIVSFRQKILTAHRRWHVFRGESSDAKNLLFSVK  116



>ref|XP_007140161.1| hypothetical protein PHAVU_008G089000g [Phaseolus vulgaris]
 gb|ESW12155.1| hypothetical protein PHAVU_008G089000g [Phaseolus vulgaris]
Length=214

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   HP+VT ++K+ TAH RWQAFRGESTD KDL+F++K
Sbjct  74   RRVLIDAAGHPLVTLRRKVMTAHDRWQAFRGESTDDKDLIFTLK  117



>gb|AGV54542.1| protein LURP-one-related 15 [Phaseolus vulgaris]
Length=214

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   HP+VT ++K+ TAH RWQAFRGESTD KDL+F++K
Sbjct  74   RRVLIDAAGHPLVTLRRKVMTAHDRWQAFRGESTDDKDLIFTLK  117



>ref|XP_007206400.1| hypothetical protein PRUPE_ppa016516mg [Prunus persica]
 gb|EMJ07599.1| hypothetical protein PRUPE_ppa016516mg [Prunus persica]
Length=213

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVLVD+   PIVTF+QKI TAHRRWQ +RG+S+D K+LLFS K
Sbjct  74   RVLVDSAGAPIVTFRQKILTAHRRWQVYRGDSSDSKELLFSAK  116



>ref|XP_008799837.1| PREDICTED: protein LURP-one-related 15-like [Phoenix dactylifera]
Length=208

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D+  +P+V+ QQKI +AHRRWQ +RG+S+D KDLLFSV+
Sbjct  67   RRVLLDSAGNPLVSMQQKIMSAHRRWQVYRGDSSDSKDLLFSVR  110



>ref|XP_006338963.1| PREDICTED: protein LURP-one-related 15-like [Solanum tuberosum]
Length=212

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L+D   + +VTFQQK+ +AHRRWQ +RGESTD KD LFSVK
Sbjct  73   RRILLDAAGNSLVTFQQKMLSAHRRWQVYRGESTDTKDFLFSVK  116



>ref|XP_008799835.1| PREDICTED: protein LURP-one-related 15-like [Phoenix dactylifera]
Length=211

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +P+++ QQK+FTAHRRW  +RG+STD KDLLFS K
Sbjct  72   RRVLLDNAGNPVLSMQQKVFTAHRRWVVYRGDSTDSKDLLFSTK  115



>emb|CDP06411.1| unnamed protein product [Coffea canephora]
Length=229

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L+D   +P++TFQQKI TAHRRW+ FRG+++D K+LLFSVK
Sbjct  88   RRILLDAAGNPLLTFQQKILTAHRRWKVFRGDASDDKNLLFSVK  131



>gb|EYU41983.1| hypothetical protein MIMGU_mgv11b011599mg [Erythranthe guttata]
Length=206

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    P++T+++K+ +AHRRW+ FRGESTD KD+LFSV+
Sbjct  66   RRVLLDAAGTPLITYKEKLMSAHRRWEVFRGESTDEKDMLFSVR  109



>ref|XP_003534660.1| PREDICTED: protein LURP-one-related 15-like [Glycine max]
Length=215

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +P+VT ++KI TAH RWQAFRGESTD KDL+F++K
Sbjct  75   RRVLLDAAGNPLVTLRRKIMTAHDRWQAFRGESTDAKDLIFTLK  118



>ref|XP_008245297.1| PREDICTED: protein LURP-one-related 15-like [Prunus mume]
Length=213

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVLVD+   PIVTF+QKI TAHRRWQ ++G+S+D K+LLFS K
Sbjct  74   RVLVDSAGAPIVTFRQKILTAHRRWQVYKGDSSDSKELLFSAK  116



>ref|XP_007205898.1| hypothetical protein PRUPE_ppa011379mg [Prunus persica]
 gb|EMJ07097.1| hypothetical protein PRUPE_ppa011379mg [Prunus persica]
Length=213

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD  D PI++F+QKI TAHRRW  +RGES++ KDLLF+ K
Sbjct  73   RRVLVDGADTPILSFRQKILTAHRRWHVYRGESSEAKDLLFTAK  116



>gb|KDO37302.1| hypothetical protein CISIN_1g027334mg [Citrus sinensis]
Length=225

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PIVT ++K  TAH RWQ FRGEST+P+DL+FS K
Sbjct  67   RRVLLDGAGNPIVTLREKAMTAHHRWQVFRGESTEPQDLIFSAK  110



>ref|XP_008442344.1| PREDICTED: protein LURP-one-related 10 [Cucumis melo]
Length=215

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PI+TF QK+ +AHR W A+RGESTD +DLLF+VK
Sbjct  74   RRVLLDAAGNPIITFMQKLISAHRTWYAYRGESTDSEDLLFTVK  117



>ref|XP_002266957.1| PREDICTED: protein LURP-one-related 10 [Vitis vinifera]
Length=216

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D    PIV+ Q K+ + HRRWQ FRGES+DPKDLLFS K
Sbjct  78   RVLLDAAGKPIVSLQSKMLSMHRRWQVFRGESSDPKDLLFSTK  120



>ref|XP_003623539.1| hypothetical protein MTR_7g072170 [Medicago truncatula]
 gb|AES79757.1| LURP-one-like protein [Medicago truncatula]
Length=226

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD  D+PI T ++KI T H RW+A+RGESTD KDL+F++K
Sbjct  73   RRVLVDAADNPITTLRRKIVTMHDRWEAYRGESTDSKDLIFTLK  116



>ref|XP_008245303.1| PREDICTED: uncharacterized protein LOC103343426 [Prunus mume]
Length=438

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD  D PI++F+QKI TAHRRW  +RGES+D KDLLF+ K
Sbjct  298  RRVLVDGADTPILSFRQKILTAHRRWHVYRGESSDAKDLLFTAK  341


 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+L+DT  +PI+T ++K  +AH RWQ FRG+ST+ +DL+FS K
Sbjct  87   RILLDTAGYPIITLRKKFVSAHDRWQVFRGDSTETRDLIFSAK  129



>gb|EYU41982.1| hypothetical protein MIMGU_mgv1a013977mg [Erythranthe guttata]
Length=204

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +P++T+QQK+ +A RRW+AFRG+STD +D+LFSV+
Sbjct  67   RRVLLDAAGNPLMTYQQKLMSARRRWEAFRGDSTDERDILFSVR  110



>ref|XP_003552292.1| PREDICTED: protein LURP-one-related 15-like [Glycine max]
Length=216

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+LVD   +P+VT ++KI TAH RWQAFRGEST+ KDL+F++K
Sbjct  76   RRILVDAAGNPLVTLRRKIMTAHDRWQAFRGESTEAKDLIFTLK  119



>emb|CBI18075.3| unnamed protein product [Vitis vinifera]
Length=192

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D    PIV+ Q K+ + HRRWQ FRGES+DPKDLLFS K
Sbjct  54   RVLLDAAGKPIVSLQSKMLSMHRRWQVFRGESSDPKDLLFSTK  96



>emb|CBW47299.1| tubby structurally-related protein [Carica papaya]
Length=210

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    P++T QQKI TAHRRWQ F+G STD KDLLFS K
Sbjct  69   RRVLLDASGAPLLTLQQKIITAHRRWQVFKGGSTDQKDLLFSAK  112



>ref|XP_002533823.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28558.1| conserved hypothetical protein [Ricinus communis]
Length=213

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D  ++ +VT +QKI TAHRRW+AFRGEST+ KDLLFSVK
Sbjct  73   RRYLKDAAENTLVTLRQKIMTAHRRWEAFRGESTEAKDLLFSVK  116



>ref|XP_002266795.1| PREDICTED: protein LURP-one-related 10 [Vitis vinifera]
Length=213

 Score = 65.5 bits (158),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D    PIV+ Q K+ + HRRW+ FRGES+DPKDLLFS K
Sbjct  78   RVLLDAAGKPIVSLQSKMLSMHRRWKVFRGESSDPKDLLFSTK  120



>ref|XP_004246314.1| PREDICTED: protein LURP-one-related 10-like [Solanum lycopersicum]
Length=224

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RV++D  D+P++T +QKI T H RW AF+GESTD KD LF++K
Sbjct  66   KRVILDAADNPLITLKQKILTEHSRWNAFKGESTDEKDFLFTIK  109



>ref|XP_006481142.1| PREDICTED: protein LURP-one-related 15-like [Citrus sinensis]
Length=225

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PI+T ++K  TAH RWQ FRGEST+P+DL+FS K
Sbjct  67   RRVLLDGAGNPILTLREKAMTAHHRWQVFRGESTEPQDLIFSAK  110



>emb|CBI18076.3| unnamed protein product [Vitis vinifera]
Length=167

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D    PIV+ Q K+ + HRRW+ FRGES+DPKDLLFS K
Sbjct  32   RVLLDAAGKPIVSLQSKMLSMHRRWKVFRGESSDPKDLLFSTK  74



>ref|XP_004492957.1| PREDICTED: protein LURP-one-related 15-like [Cicer arietinum]
Length=214

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +PIVT ++KI T H RW+A+RGESTD KDL+F++K
Sbjct  74   RRVLVDAAGYPIVTLRRKIVTMHDRWEAYRGESTDAKDLIFTLK  117



>ref|XP_004246313.1| PREDICTED: protein LURP-one-related 10 [Solanum lycopersicum]
Length=219

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RV++D  D+P++T +QKI T H RW AF+GESTD K LLF++K
Sbjct  66   KRVILDAADNPLITLKQKILTEHSRWNAFKGESTDEKHLLFTIK  109



>ref|XP_003623537.1| hypothetical protein MTR_7g072140 [Medicago truncatula]
 gb|AES79755.1| LURP-one-like protein [Medicago truncatula]
Length=215

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +PI T ++KI T H RW+AFRGESTD KDL+F++K
Sbjct  73   RRVLVDAAGYPIATLRRKIMTMHDRWEAFRGESTDAKDLIFTLK  116



>ref|XP_004302612.1| PREDICTED: protein LURP-one-related 15-like [Fragaria vesca subsp. 
vesca]
Length=201

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR LVDT   PI++F+QKI TAH+RW  FRGES+D KDLLF+ +
Sbjct  61   RRTLVDTAGTPILSFRQKILTAHKRWHVFRGESSDEKDLLFTAR  104



>gb|ACU19112.1| unknown [Glycine max]
Length=216

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+LVD   +P+VT ++KI T H RWQAFRGEST+ KDL+F++K
Sbjct  76   RRILVDAAGNPLVTLRRKIMTTHDRWQAFRGESTEAKDLIFTLK  119



>gb|AFK40426.1| unknown [Lotus japonicus]
Length=214

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PI T ++KI TAH RWQA+RGEST+ KDL+F++K
Sbjct  76   RRVLIDAAGNPIATLRRKIMTAHDRWQAYRGESTEAKDLIFTLK  119



>ref|XP_006359803.1| PREDICTED: protein LURP-one-related 15-like [Solanum tuberosum]
Length=223

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RV++D  D+P++T +QK+ T H RW AF+GESTD KD LF++K
Sbjct  66   KRVILDAADNPLITLKQKMLTEHSRWNAFKGESTDEKDFLFTIK  109



>gb|AFK46402.1| unknown [Lotus japonicus]
Length=216

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PI T ++KI TAH RWQA+RGEST+ KDL+F++K
Sbjct  76   RRVLIDAAGNPIATLRRKIMTAHDRWQAYRGESTEAKDLIFTLK  119



>gb|KHN44840.1| Protein LURP-one-related 15 [Glycine soja]
Length=146

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D    P+VT ++K+ +AH RWQ FRGEST+PKDL+FSVK
Sbjct  7    RVLLDAAGEPVVTLRRKLMSAHDRWQIFRGESTEPKDLIFSVK  49



>ref|XP_003516997.1| PREDICTED: protein LURP-one-related 15-like [Glycine max]
Length=198

 Score = 63.9 bits (154),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D    P+VT ++K+ +AH RWQ FRGEST+PKDL+FSVK
Sbjct  59   RVLLDAAGEPVVTLRRKLMSAHDRWQIFRGESTEPKDLIFSVK  101



>gb|EPS73959.1| hypothetical protein M569_00797 [Genlisea aurea]
Length=203

 Score = 63.9 bits (154),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R VL+D   +P+VTFQ+K+ +AH RW+ FRGEST+ KDL+FSVK
Sbjct  64   RHVLLDAAGNPLVTFQKKMLSAHGRWKVFRGESTEEKDLIFSVK  107



>ref|XP_002533825.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28560.1| conserved hypothetical protein [Ricinus communis]
Length=220

 Score = 63.5 bits (153),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L+D   + I TFQQKI TAHRRW+ FRGEST+ +DLLFSVK
Sbjct  74   RRHLLDIAGNVIATFQQKIMTAHRRWKVFRGESTNDQDLLFSVK  117



>ref|XP_006429530.1| hypothetical protein CICLE_v10012677mg [Citrus clementina]
 ref|XP_006481427.1| PREDICTED: protein LURP-one-related 15-like [Citrus sinensis]
 gb|ESR42770.1| hypothetical protein CICLE_v10012677mg [Citrus clementina]
Length=226

 Score = 63.2 bits (152),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PI T ++K  + HRRWQ FRGES+DP+DL+FS K
Sbjct  67   RRVLLDGAGNPIATIREKAMSRHRRWQVFRGESSDPRDLIFSAK  110



>gb|KDO39836.1| hypothetical protein CISIN_1g044780mg, partial [Citrus sinensis]
Length=220

 Score = 62.8 bits (151),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PI T ++K  + HRRWQ FRGES+DP+DL+FS K
Sbjct  63   RRVLLDGAGNPIATIREKAMSRHRRWQVFRGESSDPRDLIFSAK  106



>ref|XP_006429525.1| hypothetical protein CICLE_v10012901mg [Citrus clementina]
 gb|ESR42765.1| hypothetical protein CICLE_v10012901mg [Citrus clementina]
Length=179

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PIVT QQK+ +AH RWQ FRGEST+  DL+F+ K
Sbjct  67   RRVLLDASGNPIVTLQQKLMSAHDRWQVFRGESTESCDLIFTAK  110



>ref|XP_006481139.1| PREDICTED: protein LURP-one-related 15-like [Citrus sinensis]
Length=203

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PIVT QQK+ +AH RWQ FRGEST+  DL+F+ K
Sbjct  67   RRVLLDASGNPIVTLQQKLMSAHDRWQVFRGESTESCDLIFTAK  110



>ref|XP_007033608.1| UPF0706 protein, putative isoform 1 [Theobroma cacao]
 gb|EOY04534.1| UPF0706 protein, putative isoform 1 [Theobroma cacao]
Length=255

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D   +PI+TF+ K+ +AH RWQAFRG+STD  DL+F+VK
Sbjct  116  RVLLDAAGNPIITFKNKLRSAHDRWQAFRGDSTDSSDLIFTVK  158



>ref|NP_001236124.1| uncharacterized protein LOC100527184 [Glycine max]
 gb|ACU16235.1| unknown [Glycine max]
Length=198

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D    P+VT ++K+ TAH RW+ FRG ST+PKDL+FSVK
Sbjct  59   RVLLDAAGEPVVTLRRKLMTAHDRWEVFRGGSTEPKDLIFSVK  101



>ref|XP_004492624.1| PREDICTED: uncharacterized protein LOC101492951 [Cicer arietinum]
Length=429

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD   +PIVT ++KI T H RW+A+RGEST+ KDL+F++K
Sbjct  73   RRVLVDAAGYPIVTLRRKIVTMHDRWEAYRGESTNAKDLIFTLK  116


 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSV  130
            RV  D   +PI+T ++K+ T   RW+AFRGES   KDL+F++
Sbjct  280  RVFFDAAGNPILTLRKKLVTMSDRWEAFRGESIHAKDLIFTL  321



>gb|KDO63310.1| hypothetical protein CISIN_1g023131mg [Citrus sinensis]
Length=287

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PIVT QQK+ +AH RWQ FRGEST+  DL+F+ K
Sbjct  67   RRVLLDASGNPIVTLQQKLMSAHDRWQVFRGESTESCDLIFTAK  110



>ref|XP_007033609.1| UPF0706 protein, putative isoform 2, partial [Theobroma cacao]
 gb|EOY04535.1| UPF0706 protein, putative isoform 2, partial [Theobroma cacao]
Length=182

 Score = 61.2 bits (147),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D   +PI+TF+ K+ +AH RWQAFRG+STD  DL+F+VK
Sbjct  86   RVLLDAAGNPIITFKNKLRSAHDRWQAFRGDSTDSSDLIFTVK  128



>ref|XP_009384935.1| PREDICTED: protein LURP-one-related 15-like [Musa acuminata subsp. 
malaccensis]
Length=229

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+V+VD    P+++ QQK+ + H RWQ F+G+S+DPKDLLFSV+
Sbjct  64   RQVVVDASGKPVISMQQKLRSVHDRWQVFKGDSSDPKDLLFSVR  107



>gb|KFK24635.1| hypothetical protein AALP_AA8G005200 [Arabis alpina]
Length=215

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D   HP++TF++KI + H+RWQ FRG STD +DLL++VK
Sbjct  77   KRILLDDSGHPVLTFREKIMSMHQRWQVFRGGSTDQRDLLYTVK  120



>ref|XP_007134609.1| hypothetical protein PHAVU_010G061200g [Phaseolus vulgaris]
 gb|ESW06603.1| hypothetical protein PHAVU_010G061200g [Phaseolus vulgaris]
Length=200

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVLVD    PIVT  +K+ T H RWQ FRGEST+ KDL+FSVK
Sbjct  61   RVLVDAAGEPIVTLHRKMTTTHDRWQVFRGESTEMKDLIFSVK  103



>ref|XP_007017093.1| LURP-one-related 1, putative [Theobroma cacao]
 gb|EOY34712.1| LURP-one-related 1, putative [Theobroma cacao]
Length=222

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L+D   +PI T + KI T H RWQ FRGEST+ KD++F+VK
Sbjct  82   RRLLLDAAGNPICTLRPKIMTVHDRWQVFRGESTEEKDVIFTVK  125



>gb|KHN33239.1| Protein LURP-one-related 15 [Glycine soja]
Length=198

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D    PIVT ++KI +AH +WQ FRGEST+ KDL+FSVK
Sbjct  59   RVLLDAAGEPIVTLRRKIMSAHDQWQVFRGESTELKDLIFSVK  101



>ref|XP_006429529.1| hypothetical protein CICLE_v10013687mg [Citrus clementina]
 gb|ESR42769.1| hypothetical protein CICLE_v10013687mg [Citrus clementina]
Length=226

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRW-QAFRGESTDPKDLLFSVK  133
            RRVL+D   +PI+T ++K  TAH RW Q FRGEST+P+DL+FS K
Sbjct  67   RRVLLDGAGNPILTLREKAMTAHHRWQQVFRGESTEPQDLIFSAK  111



>ref|XP_006658415.1| PREDICTED: protein LURP-one-related 15-like [Oryza brachyantha]
Length=209

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    PI++  +K+ + H RW+ FRG+S++P+DLLFSVK
Sbjct  69   RRVLLDAAGQPILSMHEKVLSMHHRWEVFRGDSSNPRDLLFSVK  112



>ref|XP_003623546.1| hypothetical protein MTR_7g072270 [Medicago truncatula]
 gb|AES79764.1| LURP-one-like protein [Medicago truncatula]
Length=212

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVLVD   +PI+T ++KI T H RW+A+RG+ST+ KDL+F++K
Sbjct  72   RVLVDAAGNPIITLRRKILTMHDRWEAYRGQSTNAKDLIFTLK  114



>ref|XP_003557363.1| PREDICTED: protein LURP-one-related 15-like [Brachypodium distachyon]
Length=206

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    P+++ Q+K+F+ H RW+ FRG+ST+  DLLF+VK
Sbjct  67   RRVLLDAAGQPLLSMQEKVFSMHNRWEVFRGDSTNASDLLFTVK  110



>gb|KEH23251.1| LURP-one-like protein [Medicago truncatula]
Length=165

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVLVD   +PI+T ++KI T H RW+A+RG+ST+ KDL+F++K
Sbjct  72   RVLVDAAGNPIITLRRKILTMHDRWEAYRGQSTNAKDLIFTLK  114



>gb|KHG20549.1| hypothetical protein F383_24081 [Gossypium arboreum]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L D   +PI T + KI T H RWQ FRGEST+ KDL+F+VK
Sbjct  75   RRLLTDAAGNPICTLRPKIMTVHDRWQVFRGESTEEKDLIFTVK  118



>ref|XP_007033606.1| Uncharacterized protein TCM_019770 [Theobroma cacao]
 gb|EOY04532.1| Uncharacterized protein TCM_019770 [Theobroma cacao]
Length=193

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLF  124
            RRVL+D   +P+V+ +QKI T HRRWQ FRGES    DLLF
Sbjct  79   RRVLLDAAGNPLVSLKQKILTVHRRWQVFRGESNSSNDLLF  119



>ref|XP_004955842.1| PREDICTED: protein LURP-one-related 15-like [Setaria italica]
Length=202

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    PI++ QQK+F+ H+RW  FRG+S    DLLF+VK
Sbjct  63   RRVLLDAAGQPILSMQQKVFSMHKRWDVFRGDSAKASDLLFTVK  106



>ref|XP_010066185.1| PREDICTED: protein LURP-one-related 15-like [Eucalyptus grandis]
 gb|KCW88261.1| hypothetical protein EUGRSUZ_A00645 [Eucalyptus grandis]
Length=207

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R LVD   + I+TF+QK  TAH RWQ FRGEST+P DL+F+ +
Sbjct  66   KRALVDAAGNTILTFKQKKITAHSRWQVFRGESTEPDDLVFTAR  109



>ref|NP_001238511.1| uncharacterized protein LOC100527088 [Glycine max]
 gb|ACU16131.1| unknown [Glycine max]
Length=198

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D    PI T ++KI +AH +WQ FRGEST+ KDL+FSVK
Sbjct  59   RVLLDAAGEPIATLRRKIMSAHDQWQVFRGESTELKDLIFSVK  101



>gb|EYU45785.1| hypothetical protein MIMGU_mgv1a014369mg [Erythranthe guttata]
Length=192

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R VL+D    PIVTF++K  +AH+RW+ FRGES+D +DLLFS K
Sbjct  54   RHVLLDARGTPIVTFKKKHLSAHKRWEVFRGESSDAEDLLFSAK  97



>ref|XP_003623535.1| hypothetical protein MTR_7g072120 [Medicago truncatula]
 gb|AES79753.1| LURP-one-like protein [Medicago truncatula]
 gb|AFK35274.1| unknown [Medicago truncatula]
Length=212

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PI T ++KI T H RW+A+RGEST  KDL+F++K
Sbjct  73   RRVLLDAAGNPITTLRRKIVTMHDRWEAYRGESTHAKDLIFTLK  116



>ref|XP_009599217.1| PREDICTED: protein LURP-one-related 10-like isoform X1 [Nicotiana 
tomentosiformis]
Length=230

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 17/61 (28%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKI-----------------FTAHRRWQAFRGESTDPKDLLFSV  130
            RRVL+D   +P+VTFQQK+                  TAHRRWQ +RGESTD  + LFSV
Sbjct  72   RRVLLDAAGNPLVTFQQKVGFYAYSPSFISLRVRQMLTAHRRWQVYRGESTDTTNFLFSV  131

Query  131  K  133
            K
Sbjct  132  K  132



>ref|XP_009371971.1| PREDICTED: protein LURP-one-related 15-like [Pyrus x bretschneideri]
Length=210

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 3/44 (7%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+LVD+   PIVTF+QKI T HRRWQ ++G+S   KDLLFS K
Sbjct  73   KRILVDSAGTPIVTFRQKILTTHRRWQVYKGDS---KDLLFSAK  113



>ref|XP_009373134.1| PREDICTED: protein LURP-one-related 10-like [Pyrus x bretschneideri]
Length=225

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D   HPI+T ++K  TAH RWQ FRG+S D +DL+FS K
Sbjct  81   RVLLDAAGHPIITLRRKFNTAHERWQVFRGDSKDSRDLIFSAK  123



>ref|XP_004302610.1| PREDICTED: protein LURP-one-related 15-like [Fragaria vesca subsp. 
vesca]
Length=213

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R L+D+   PI+TF+QKI T HRRWQ +RG+S++ KDLLFS K
Sbjct  74   RRLLDSSGTPILTFRQKITTVHRRWQVYRGDSSNSKDLLFSAK  116



>ref|XP_004955840.1| PREDICTED: protein LURP-one-related 15-like [Setaria italica]
Length=209

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D    PI+T QQK+F+ H +W+ FRG+ST  +DLLF+VK
Sbjct  70   RRVLHDAAGRPILTMQQKVFSMHDKWKVFRGDSTSSRDLLFTVK  113



>ref|XP_008364003.1| PREDICTED: protein LURP-one-related 10-like [Malus domestica]
Length=234

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D   HPI+T ++K  TAH RWQ FRG+S D +DL+FS K
Sbjct  81   RVLLDAAGHPIITLRRKFNTAHERWQVFRGDSKDSRDLIFSAK  123



>ref|XP_007205855.1| hypothetical protein PRUPE_ppa011132mg [Prunus persica]
 gb|EMJ07054.1| hypothetical protein PRUPE_ppa011132mg [Prunus persica]
Length=222

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+L+DT  +PI+T ++K  +AH RWQ FRG+ST+ +DL+FS K
Sbjct  87   RILLDTAGYPIITLRKKFVSAHDRWQVFRGDSTETRDLIFSAK  129



>ref|XP_004302600.1| PREDICTED: protein LURP-one-related 15-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=217

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PIVTF++K+ + H RWQ FRG+ST+  +L+FSVK
Sbjct  79   RRVLLDAAGYPIVTFRKKLRSVHERWQVFRGDSTELSNLVFSVK  122



>ref|XP_004955841.1| PREDICTED: protein LURP-one-related 15-like [Setaria italica]
Length=209

 Score = 57.8 bits (138),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D    P+V+ ++K+F+ H RW+ FRG+ST+  DLLF+VK
Sbjct  70   RRVLHDAAGQPLVSMREKVFSMHNRWEVFRGDSTNASDLLFTVK  113



>gb|AES79762.2| tubby C 2 protein [Medicago truncatula]
Length=243

 Score = 58.2 bits (139),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+LVD   +PI+T ++KI T H RW+A+RG+ST+ K+++F+VK
Sbjct  103  RLLVDAARNPIITLRRKILTMHDRWEAYRGQSTNAKNMIFTVK  145



>ref|XP_002533824.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28559.1| conserved hypothetical protein [Ricinus communis]
Length=215

 Score = 57.4 bits (137),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +++++D   + IVT ++K  TAH RWQ FRGESTDPKD++F+ K
Sbjct  70   KKLILDPAGNTIVTLRRKAMTAHSRWQVFRGESTDPKDVIFTAK  113



>ref|XP_009385279.1| PREDICTED: protein LURP-one-related 15-like [Musa acuminata subsp. 
malaccensis]
Length=206

 Score = 57.0 bits (136),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+V+VD    P+++ QQK+ + H RWQ F+G S+DPK +LFSVK
Sbjct  62   RQVVVDASGKPVISMQQKLSSIHDRWQVFKGNSSDPKHMLFSVK  105



>ref|XP_009373121.1| PREDICTED: protein LURP-one-related 10-like [Pyrus x bretschneideri]
Length=222

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+DT  +PI+T ++K+ +AH RWQ +RG+S + +DL+FS K
Sbjct  87   RRVLLDTAGYPIITLRKKLTSAHDRWQVYRGDSKETRDLIFSAK  130



>ref|XP_008244814.1| PREDICTED: protein LURP-one-related 10-like [Prunus mume]
Length=221

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  11   LVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            L+D   +PI+T +QK+ +AH RWQ FRGEST  +DL+FS K
Sbjct  73   LLDAAGNPIITLRQKLMSAHERWQVFRGESTKSRDLIFSTK  113



>ref|XP_004959099.1| PREDICTED: protein LURP-one-related 15-like [Setaria italica]
Length=214

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD    PI++  +K+ + H RW+ FRG+S++  DLLF+VK
Sbjct  73   RRVLVDAAGQPILSMHEKVLSMHNRWEVFRGDSSNASDLLFTVK  116



>gb|KFK24672.1| hypothetical protein AALP_AA8G010000 [Arabis alpina]
Length=213

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D   +P++TF++KI + H+ WQ FRG STD +DLL++VK
Sbjct  75   KRILLDGSGYPVLTFREKIMSMHQSWQVFRGGSTDQRDLLYTVK  118



>ref|XP_004302616.1| PREDICTED: protein LURP-one-related 15-like [Fragaria vesca subsp. 
vesca]
Length=196

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR LVD   +PIVT Q+K+ + H RW+ +RG++TD ++L+FSVK
Sbjct  50   RRFLVDGAGNPIVTLQKKLPSTHHRWEVYRGDNTDSRNLVFSVK  93



>gb|EMT17785.1| hypothetical protein F775_09844 [Aegilops tauschii]
Length=216

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR ++D    P++T Q+K+F+ H RW+ FRG+ST+  DLLF+VK
Sbjct  64   RRTILDGAGMPLLTMQEKVFSMHHRWEVFRGDSTNAGDLLFTVK  107



>ref|XP_004955839.1| PREDICTED: protein LURP-one-related 15-like [Setaria italica]
Length=214

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVLVD    PI++  +K+ + H RW+ FRG+S++  DLLF+VK
Sbjct  73   RRVLVDAAGQPILSMHEKVLSMHNRWEVFRGDSSNASDLLFTVK  116



>ref|XP_008363928.1| PREDICTED: protein LURP-one-related 10-like [Malus domestica]
Length=222

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L+DT  +PI+T ++K+ +AH RWQ +RG+S + +DL+FS K
Sbjct  87   RRILLDTAGYPIITLRKKLTSAHDRWQVYRGDSKETRDLIFSAK  130



>ref|NP_001143567.1| uncharacterized protein LOC100276264 [Zea mays]
 gb|ACG33120.1| hypothetical protein [Zea mays]
Length=210

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    PI+T  +K+F+ H RW+ FRG+S++  DLLF+ K
Sbjct  71   RRVLLDAAGQPILTMLEKVFSMHNRWEVFRGDSSNESDLLFTAK  114



>ref|XP_007206684.1| hypothetical protein PRUPE_ppa022042mg [Prunus persica]
 gb|EMJ07883.1| hypothetical protein PRUPE_ppa022042mg [Prunus persica]
Length=200

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  11   LVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            L+DT  +PI+T +QK+ +AH RWQ FRG+ST  +DL+FS K
Sbjct  65   LLDTAGYPILTLRQKLMSAHERWQVFRGKSTKSRDLIFSTK  105



>ref|NP_001143025.1| hypothetical protein [Zea mays]
 gb|ACG28386.1| hypothetical protein [Zea mays]
 tpg|DAA39463.1| TPA: hypothetical protein ZEAMMB73_759374 [Zea mays]
Length=207

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    PI+T  +K+F+ H RW+ FRG+S++  DLLF+ K
Sbjct  68   RRVLLDAAGQPILTMLEKVFSMHNRWEVFRGDSSNESDLLFTAK  111



>ref|XP_011009970.1| PREDICTED: protein LURP-one-related 15-like isoform X2 [Populus 
euphratica]
Length=208

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T HRRW+AFRGES + KDLLF+ K
Sbjct  68   RRFLKDAAGNTLVNLRQKIMTMHRRWEAFRGESKEEKDLLFTAK  111



>gb|KHG14025.1| hypothetical protein F383_19046 [Gossypium arboreum]
Length=214

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L D   +P+ T + KI T H RWQ FR EST+ KDL+F+VK
Sbjct  75   RRLLTDAAGNPVCTLRHKIMTVHDRWQVFRRESTEEKDLIFTVK  118



>ref|XP_002323651.2| hypothetical protein POPTR_0016s13820g [Populus trichocarpa]
 gb|EEF05412.2| hypothetical protein POPTR_0016s13820g [Populus trichocarpa]
Length=177

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T HRRW+AFRGES + KDLLF+ K
Sbjct  76   RRFLKDAAGNILVNLRQKIMTMHRRWEAFRGESKEEKDLLFTAK  119



>ref|XP_002461713.1| hypothetical protein SORBIDRAFT_02g006920 [Sorghum bicolor]
 gb|EER98234.1| hypothetical protein SORBIDRAFT_02g006920 [Sorghum bicolor]
Length=220

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RVL+D    P+++ ++K+FT H RWQ FRG+ST+  DLLF+ K
Sbjct  71   RVLLDAAGQPLLSMREKVFTMHNRWQVFRGDSTNASDLLFTAK  113



>ref|NP_568095.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90386.1| uncharacterized protein AT5G01750 [Arabidopsis thaliana]
Length=174

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL+D    P+VT ++K+ + H RWQ FRG STD +DLL++VK
Sbjct  77   KRVLLDGSGTPVVTLREKMVSMHDRWQVFRGGSTDQRDLLYTVK  120



>ref|XP_007140155.1| hypothetical protein PHAVU_008G088500g [Phaseolus vulgaris]
 gb|ESW12149.1| hypothetical protein PHAVU_008G088500g [Phaseolus vulgaris]
Length=234

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D    PI+T  +KI T HRR Q FRG+S+D  +LLFSVK
Sbjct  84   RRVLYDDAGKPILTLYKKIMTMHRRCQVFRGQSSDSSELLFSVK  127



>ref|XP_011003577.1| PREDICTED: protein LURP-one-related 15-like [Populus euphratica]
Length=216

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T HRRW+AFRGES + KDLLF+ K
Sbjct  76   RRFLKDAAGNTLVNLRQKIMTMHRRWEAFRGESKEEKDLLFTAK  119



>gb|KFK40276.1| hypothetical protein AALP_AA3G354100 [Arabis alpina]
Length=227

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D   +P++TF++KI T H+RW+ FRG STD ++LL++VK
Sbjct  77   KRILLDGSGYPVLTFREKIRTLHQRWKVFRGGSTDQRNLLYTVK  120



>gb|EMS68499.1| hypothetical protein TRIUR3_16300 [Triticum urartu]
Length=305

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR ++D    P++T Q+K+F+ H RW+ FRG+ST   DLLFSVK
Sbjct  60   RRTILDGAGMPLLTMQEKVFSMHHRWEVFRGDSTSSGDLLFSVK  103



>ref|XP_011085848.1| PREDICTED: protein LURP-one-related 15-like [Sesamum indicum]
Length=202

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R VL+D    PI TF++K  +AH+RWQ FRG+S+   DLLFS K
Sbjct  64   RHVLLDAAGTPIATFRKKALSAHKRWQVFRGDSSASADLLFSAK  107



>ref|XP_008245298.1| PREDICTED: protein LURP-one-related 15-like [Prunus mume]
Length=204

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  11   LVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            L+D   +PI+T +QK+ +AH RWQ FRG+ST  +DL+FS K
Sbjct  65   LLDAAGYPIITLRQKLMSAHERWQVFRGKSTKSRDLIFSTK  105



>ref|XP_002323653.2| hypothetical protein POPTR_0016s13920g, partial [Populus trichocarpa]
 gb|EEF05414.2| hypothetical protein POPTR_0016s13920g, partial [Populus trichocarpa]
Length=186

 Score = 55.1 bits (131),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T HRRW+AFRGES + KDLLF+ K
Sbjct  46   RRFLKDAAGNTLVNLRQKIRTMHRRWEAFRGESKEEKDLLFTAK  89



>ref|XP_010553137.1| PREDICTED: protein LURP-one-related 15 [Tarenaya hassleriana]
Length=222

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D    P+VT ++KI + H RWQ FRG ST+ +DLL++VK
Sbjct  78   KRILLDASGSPVVTLREKIMSMHDRWQVFRGGSTEARDLLYTVK  121



>ref|XP_011042734.1| PREDICTED: protein LURP-one-related 15-like [Populus euphratica]
Length=188

 Score = 55.1 bits (131),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T HRRW+AFRGES + KDLLF+ K
Sbjct  48   RRFLKDAAGNTLVNLRQKIRTMHRRWEAFRGESKEEKDLLFTAK  91



>gb|KFK40277.1| hypothetical protein AALP_AA3G354200 [Arabis alpina]
Length=227

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D   +P++TF++KI T H RW+ FRG STD ++LL++VK
Sbjct  77   KRILLDGSGYPVLTFREKIRTLHHRWKVFRGGSTDKRNLLYTVK  120



>ref|XP_009385280.1| PREDICTED: protein LURP-one-related 15-like [Musa acuminata subsp. 
malaccensis]
Length=236

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+V+VD    P+++ QQK+ + H RW  F+G S+DPK LLFSV+
Sbjct  65   RQVVVDASGKPVISMQQKLSSIHDRWLVFKGNSSDPKHLLFSVR  108



>ref|NP_850751.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LZX1.1|LOR15_ARATH RecName: Full=Protein LURP-one-related 15 [Arabidopsis thaliana]
 gb|AAK49593.1|AF372877_1 AT5g01750/T20L15_20 [Arabidopsis thaliana]
 emb|CAB82745.1| putative protein [Arabidopsis thaliana]
 gb|AAM98298.1| At5g01750/T20L15_20 [Arabidopsis thaliana]
 gb|AED90387.1| uncharacterized protein AT5G01750 [Arabidopsis thaliana]
Length=217

 Score = 55.1 bits (131),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL+D    P+VT ++K+ + H RWQ FRG STD +DLL++VK
Sbjct  77   KRVLLDGSGTPVVTLREKMVSMHDRWQVFRGGSTDQRDLLYTVK  120



>ref|XP_004955843.1| PREDICTED: protein LURP-one-related 15-like [Setaria italica]
Length=209

 Score = 54.7 bits (130),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D    P+V+ ++K+F+ H+RW  FRG+S    DLLF+VK
Sbjct  70   RRVLHDAAGQPLVSMREKVFSMHKRWDVFRGDSAKASDLLFTVK  113



>ref|XP_006429531.1| hypothetical protein CICLE_v10012705mg [Citrus clementina]
 ref|XP_006481143.1| PREDICTED: protein LURP-one-related 15-like [Citrus sinensis]
 gb|ESR42771.1| hypothetical protein CICLE_v10012705mg [Citrus clementina]
Length=220

 Score = 54.7 bits (130),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PIVT ++K  + H RWQ FRGEST+ + L+FS K
Sbjct  67   RRVLLDGAGNPIVTLREKAISQHHRWQVFRGESTERRHLIFSAK  110



>gb|KDO36505.1| hypothetical protein CISIN_1g027044mg [Citrus sinensis]
Length=229

 Score = 55.1 bits (131),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PIVT ++K  + H RWQ FRGEST+ + L+FS K
Sbjct  67   RRVLLDGAGNPIVTLREKAMSRHHRWQVFRGESTERRHLIFSAK  110



>gb|AAM62599.1| unknown [Arabidopsis thaliana]
Length=174

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL+D    P+VT ++K+ + H RWQ FRG ST+ +DLL++VK
Sbjct  77   KRVLLDGSGTPVVTLREKMVSMHDRWQVFRGGSTEQRDLLYTVK  120



>emb|CDY56592.1| BnaC03g73380D [Brassica napus]
Length=194

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R L+D  D+PI+T ++   + H RWQ FRGESTD KDL++++K
Sbjct  53   KRFLLDASDNPIMTLRENKVSLHDRWQVFRGESTDQKDLVYTLK  96



>ref|XP_002323048.2| hypothetical protein POPTR_0016s13930g [Populus trichocarpa]
 gb|EEF04809.2| hypothetical protein POPTR_0016s13930g [Populus trichocarpa]
Length=216

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI + HRRW AFRGES + KDLLF+ K
Sbjct  76   RRFLKDAAGNTLVNLRQKIMSMHRRWDAFRGESKEEKDLLFTAK  119



>ref|XP_002323041.2| hypothetical protein POPTR_0016s13840g [Populus trichocarpa]
 gb|EEF04802.2| hypothetical protein POPTR_0016s13840g [Populus trichocarpa]
Length=216

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T HRRW+AFRGES + KDLLF+ K
Sbjct  76   RRFLKDAAGNTLVNLRQKIRTMHRRWEAFRGESKEEKDLLFTAK  119



>gb|KDO35832.1| hypothetical protein CISIN_1g026111mg [Citrus sinensis]
Length=243

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   +PIVT ++K  + H RWQ FRGEST+ + L+FS K
Sbjct  67   RRVLLDGAGNPIVTLREKAMSRHHRWQVFRGESTERRHLIFSAK  110



>ref|XP_006396820.1| hypothetical protein EUTSA_v10028998mg [Eutrema salsugineum]
 gb|ESQ38273.1| hypothetical protein EUTSA_v10028998mg [Eutrema salsugineum]
Length=187

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+LVD    P++T ++K  + H RWQ FRGEST+  DLL++VK
Sbjct  53   RILVDASGTPLLTLREKSMSLHSRWQVFRGESTEQCDLLYTVK  95



>ref|XP_011095095.1| PREDICTED: protein LURP-one-related 15-like isoform X1 [Sesamum 
indicum]
Length=204

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R +L+D+  +PIVTF++KI +  RRWQ FRG S+D  DL+F+ K
Sbjct  66   RLLLLDSGSNPIVTFKKKILSTRRRWQVFRGGSSDYVDLIFTTK  109



>emb|CDY47918.1| BnaAnng09500D [Brassica napus]
Length=194

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D  D+PI+T ++   + H RWQ FRG+STD  DL+F++K
Sbjct  53   KRILLDASDNPILTLKENKVSLHDRWQVFRGKSTDQNDLVFTLK  96



>pdb|1ZXU|A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana 
At5g01750
 pdb|2Q4M|A Chain A, Ensemble Refinement Of The Crystal Structure Of Protein 
From Arabidopsis Thaliana At5g01750
Length=217

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL+D    P+VT ++K  + H RWQ FRG STD +DLL++VK
Sbjct  77   KRVLLDGSGTPVVTLREKXVSXHDRWQVFRGGSTDQRDLLYTVK  120



>ref|XP_006387427.1| hypothetical protein POPTR_1048s00200g [Populus trichocarpa]
 gb|ERP46341.1| hypothetical protein POPTR_1048s00200g [Populus trichocarpa]
Length=216

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V   QKI + HRRW AFRGES + KDLLF+ K
Sbjct  76   RRFLKDAAGNTLVNLSQKIMSMHRRWDAFRGESKEEKDLLFTTK  119



>ref|XP_011095096.1| PREDICTED: protein LURP-one-related 15-like isoform X2 [Sesamum 
indicum]
Length=202

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R +L+D+  +PIVTF++KI +  RRWQ FRG S+D  DL+F+ K
Sbjct  66   RLLLLDSGSNPIVTFKKKILSTRRRWQVFRGGSSDYVDLIFTTK  109



>gb|KCW47498.1| hypothetical protein EUGRSUZ_K01266, partial [Eucalyptus grandis]
Length=172

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  8    VLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +L D   + +V+ QQKI TAHRRWQA+ G+S+ P +L+F  K
Sbjct  46   ILNDAASNAVVSLQQKILTAHRRWQAYSGDSSCPDNLIFMAK  87



>ref|XP_009796279.1| PREDICTED: protein LURP-one-related 10-like [Nicotiana sylvestris]
Length=203

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +2

Query  5    RVLV-DTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +VLV D  D PI+  + K F+ H RWQAF+G+ST+ KDL+FS K
Sbjct  59   KVLVFDAADIPILNLKSKKFSWHSRWQAFKGDSTNEKDLIFSAK  102



>ref|XP_004963225.1| PREDICTED: protein LURP-one-related 15-like [Setaria italica]
Length=341

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R +L+D   HPI+T ++K  T H RW+ FRG+S++ +DLLF  K
Sbjct  69   RLLLLDAAGHPILTLKEKKLTMHHRWEVFRGDSSNARDLLFYTK  112



>ref|XP_010921083.1| PREDICTED: protein LURP-one-related 10 [Elaeis guineensis]
Length=232

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L D  D+P+++ ++K  TAH RW AF G+S++ +DLLFSVK
Sbjct  69   KRMLHDADDNPLISMREKTLTAHERWGAFIGDSSEDRDLLFSVK  112



>ref|XP_006288633.1| hypothetical protein CARUB_v10001936mg [Capsella rubella]
 gb|EOA21531.1| hypothetical protein CARUB_v10001936mg [Capsella rubella]
Length=217

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D    P+VT ++K+ + H RWQ FRG ST+ +DLL++VK
Sbjct  77   KRILLDASGTPVVTLREKMVSMHDRWQVFRGGSTEQRDLLYTVK  120



>ref|XP_010490512.1| PREDICTED: protein LURP-one-related 15 [Camelina sativa]
Length=218

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D    P+VT ++K+ + H RWQ FRG ST+ +DLL++VK
Sbjct  78   KRILLDASGTPVVTLREKMVSMHDRWQVFRGGSTEQRDLLYTVK  121



>ref|XP_010451939.1| PREDICTED: protein LURP-one-related 15-like [Camelina sativa]
Length=218

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D    P+VT ++K+ + H RWQ FRG ST+ +DLL++VK
Sbjct  78   KRILLDASGTPVVTLREKMVSMHDRWQVFRGGSTEQRDLLYTVK  121



>ref|XP_010423989.1| PREDICTED: protein LURP-one-related 15-like [Camelina sativa]
Length=220

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D    P+VT ++K+ + H RWQ FRG ST+ +DLL++VK
Sbjct  80   KRILLDASGTPVVTLREKMVSMHDRWQVFRGGSTEQRDLLYTVK  123



>ref|XP_002872996.1| hypothetical protein ARALYDRAFT_486891 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49255.1| hypothetical protein ARALYDRAFT_486891 [Arabidopsis lyrata subsp. 
lyrata]
Length=217

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D   +P+VT ++K+ + H RWQ FRG ST+ +DLL++VK
Sbjct  77   KRILLDGSGNPVVTLREKMVSMHDRWQVFRGGSTEQRDLLYTVK  120



>gb|KDO63312.1| hypothetical protein CISIN_1g029811mg [Citrus sinensis]
Length=187

 Score = 52.4 bits (124),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSV  130
            +R L+D   +P+VT  +K+F+AH +   FRG STD KDLLF+V
Sbjct  76   KRTLLDPAGNPVVTITEKLFSAHEKHSVFRGASTDAKDLLFTV  118



>ref|XP_006429528.1| hypothetical protein CICLE_v10012737mg [Citrus clementina]
 gb|ESR42768.1| hypothetical protein CICLE_v10012737mg [Citrus clementina]
 gb|KDO63313.1| hypothetical protein CISIN_1g038304mg [Citrus sinensis]
Length=214

 Score = 52.4 bits (124),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSV  130
            RR ++D  D+PIVT  +K+ +AH +   FRG STD KDLLF+V
Sbjct  75   RRTVLDPYDNPIVTVTKKLISAHEKHYVFRGNSTDSKDLLFTV  117



>ref|XP_009121182.1| PREDICTED: protein LURP-one-related 10 [Brassica rapa]
Length=194

 Score = 52.0 bits (123),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D  D PI+T ++   + H RWQ FRG+STD  DL+F++K
Sbjct  53   KRILLDASDTPILTLKENKVSLHDRWQVFRGKSTDQNDLVFTLK  96



>ref|XP_009385283.1| PREDICTED: protein LURP-one-related 15-like [Musa acuminata subsp. 
malaccensis]
Length=192

 Score = 52.0 bits (123),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  8    VLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            V+VD    P+++ ++K+ + H RWQ F+G+S+DPK LLFSVK
Sbjct  66   VVVDASGKPVISMREKLRSVHDRWQVFKGDSSDPKYLLFSVK  107



>ref|XP_002882745.1| hypothetical protein ARALYDRAFT_478520 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59004.1| hypothetical protein ARALYDRAFT_478520 [Arabidopsis lyrata subsp. 
lyrata]
Length=193

 Score = 52.0 bits (123),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D  D PI+T ++   + H RWQ FRG+STD  DL++++K
Sbjct  53   KRILLDAYDTPILTLRENKVSLHDRWQVFRGKSTDQSDLVYTLK  96



>gb|KDP22801.1| hypothetical protein JCGZ_00388 [Jatropha curcas]
Length=204

 Score = 52.0 bits (123),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+ ++D     IVT ++K  TAH RWQ FRGES D  DL+F+ K
Sbjct  67   RKHIIDVTGKTIVTLRRKAMTAHSRWQVFRGESIDTNDLIFNAK  110



>ref|XP_002323042.1| hypothetical protein POPTR_0016s13850g [Populus trichocarpa]
 gb|EEF04803.1| hypothetical protein POPTR_0016s13850g [Populus trichocarpa]
Length=209

 Score = 52.0 bits (123),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  ++KI T HRRW+AFRG+S +  DLLF+ K
Sbjct  67   RRFLKDAAGNTVVHLRKKIMTMHRRWEAFRGKSKEKNDLLFTAK  110



>ref|XP_006398584.1| hypothetical protein EUTSA_v10014621mg [Eutrema salsugineum]
 ref|XP_006398585.1| hypothetical protein EUTSA_v10014621mg [Eutrema salsugineum]
 gb|ESQ40037.1| hypothetical protein EUTSA_v10014621mg [Eutrema salsugineum]
 gb|ESQ40038.1| hypothetical protein EUTSA_v10014621mg [Eutrema salsugineum]
Length=221

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D    P++T ++K+ + H RWQ +RG ST+ +DLL++VK
Sbjct  77   KRILLDASGSPVLTLREKMVSMHDRWQVYRGGSTEQRDLLYTVK  120



>ref|XP_011009969.1| PREDICTED: protein LURP-one-related 15-like isoform X1 [Populus 
euphratica]
Length=216

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T H RW+AFRGES +  DLLF+ K
Sbjct  68   RRFLKDAAGNTLVNLRQKIRTMHGRWEAFRGESKEKSDLLFTAK  111



>ref|XP_010325781.1| PREDICTED: protein LURP-one-related 10-like [Solanum lycopersicum]
Length=204

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  8    VLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            ++ D  + PI+T + K FT H RW+ F+G+STD KDL+FS K
Sbjct  62   IIFDAANVPILTLKSKHFTWHSRWECFKGDSTDEKDLIFSAK  103



>ref|XP_011032780.1| PREDICTED: protein LURP-one-related 10-like [Populus euphratica]
 ref|XP_011009974.1| PREDICTED: protein LURP-one-related 10-like [Populus euphratica]
Length=217

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R L D   + +V+ + K+ TAH RW+ FRGES + KDLLFSVK
Sbjct  77   RYLQDAYGNILVSLKHKLMTAHGRWEVFRGESIEQKDLLFSVK  119



>ref|XP_002323040.1| hypothetical protein POPTR_0016s13810g [Populus trichocarpa]
 gb|EEF04801.1| hypothetical protein POPTR_0016s13810g [Populus trichocarpa]
Length=217

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R L D   + +V+ + K+ TAH RW+ FRGES + KDLLFSVK
Sbjct  77   RYLQDAYGNILVSLKHKLMTAHGRWEVFRGESIEQKDLLFSVK  119



>ref|XP_007140154.1| hypothetical protein PHAVU_008G088400g [Phaseolus vulgaris]
 gb|ESW12148.1| hypothetical protein PHAVU_008G088400g [Phaseolus vulgaris]
Length=144

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D  ++PIVT   K  + H R   F+GESTD  +LLFSVK
Sbjct  50   RRVLYDDAENPIVTLYSKTVSLHGRCNVFKGESTDSSELLFSVK  93



>ref|XP_009130626.1| PREDICTED: protein LURP-one-related 15 [Brassica rapa]
 emb|CDX80752.1| BnaC03g00060D [Brassica napus]
Length=221

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D    P++T ++K+ + H RWQ FRG ST+ +DLL++VK
Sbjct  77   KRILLDGSGSPVLTLREKMVSLHDRWQVFRGGSTEQRDLLYTVK  120



>ref|XP_004514892.1| PREDICTED: protein LURP-one-related 15-like isoform X2 [Cicer 
arietinum]
Length=204

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +2

Query  5    RVLVDTLDHPIV-TFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+L+D     +V T Q+K+ T H RW+AFRGEST+ KDL+FSVK
Sbjct  62   RLLLDAAGKTVVLTLQRKVKTRHDRWEAFRGESTELKDLIFSVK  105



>ref|XP_006299992.1| hypothetical protein CARUB_v10016206mg [Capsella rubella]
 gb|EOA32890.1| hypothetical protein CARUB_v10016206mg [Capsella rubella]
Length=194

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D  D PI+T ++   + H RWQ FRG+STD  DL++++K
Sbjct  53   KRILLDASDTPILTLRENKVSLHDRWQVFRGKSTDQSDLVYTLK  96



>ref|XP_002461710.1| hypothetical protein SORBIDRAFT_02g006890 [Sorghum bicolor]
 gb|EER98231.1| hypothetical protein SORBIDRAFT_02g006890 [Sorghum bicolor]
Length=214

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L+D   +P+++ ++K+ + H  W+A+RG+ST   DLLF+ K
Sbjct  74   RRLLLDAAGNPLLSLREKVISMHNTWEAYRGDSTRSSDLLFTAK  117



>ref|XP_010416367.1| PREDICTED: protein LURP-one-related 15-like isoform X1 [Camelina 
sativa]
Length=210

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + K+ + H RWQ FRG ST+P DLL++VK
Sbjct  76   KRILLDASGAKVMTLKGKMVSMHDRWQVFRGGSTEPGDLLYTVK  119



>ref|XP_003522135.1| PREDICTED: protein LURP-one-related 15 [Glycine max]
 gb|KHN33240.1| Protein LURP-one-related 15 [Glycine soja]
Length=201

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R ++    +PIVT ++K  TAH RWQ FRG+S   +DLLFSVK
Sbjct  65   KRCILLHQGNPIVTLRRKRMTAHNRWQVFRGKSDQIRDLLFSVK  108



>ref|XP_010498057.1| PREDICTED: protein LURP-one-related 10 [Camelina sativa]
Length=194

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL+D  D+PI+T ++   + H RWQ FRG+ST   DL++++K
Sbjct  53   KRVLLDASDNPILTLRENKVSLHDRWQVFRGKSTSQSDLVYTLK  96



>ref|XP_010471605.1| PREDICTED: protein LURP-one-related 15-like isoform X1 [Camelina 
sativa]
Length=210

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + K+ + H RWQ FRG ST+P DLL++VK
Sbjct  76   KRILLDASGAKVMTLKGKMVSMHDRWQVFRGGSTEPGDLLYTVK  119



>ref|XP_011016240.1| PREDICTED: protein LURP-one-related 15-like, partial [Populus 
euphratica]
Length=137

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  ++KI T H RW+AFRGES +  DLLF+ K
Sbjct  68   RRFLKDAAGNTLVNLRKKIMTMHGRWEAFRGESKEKNDLLFTAK  111



>ref|XP_010416368.1| PREDICTED: protein LURP-one-related 15-like isoform X2 [Camelina 
sativa]
Length=189

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + K+ + H RWQ FRG ST+P DLL++VK
Sbjct  76   KRILLDASGAKVMTLKGKMVSMHDRWQVFRGGSTEPGDLLYTVK  119



>ref|XP_003605353.1| hypothetical protein MTR_4g029430 [Medicago truncatula]
 gb|AES87550.1| tubby C 2 protein [Medicago truncatula]
Length=199

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    RRVLVDTLDHPIV-TFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            + +L+D     +V T ++K  T H RWQAFRGEST+ KDL+FSVK
Sbjct  60   QSLLLDAAGKSVVMTLRRKAMTGHDRWQAFRGESTEVKDLIFSVK  104



>ref|XP_011042664.1| PREDICTED: protein LURP-one-related 15-like isoform X2 [Populus 
euphratica]
Length=213

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QK+ T H RW+AFRGES +  DLLF+ K
Sbjct  67   RRFLKDAAGNTLVNLRQKLRTMHGRWEAFRGESKEKNDLLFTAK  110



>ref|XP_010471606.1| PREDICTED: protein LURP-one-related 15-like isoform X2 [Camelina 
sativa]
Length=188

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + K+ + H RWQ FRG ST+P DLL++VK
Sbjct  76   KRILLDASGAKVMTLKGKMVSMHDRWQVFRGGSTEPGDLLYTVK  119



>ref|XP_006407416.1| hypothetical protein EUTSA_v10022341mg [Eutrema salsugineum]
 gb|ESQ48869.1| hypothetical protein EUTSA_v10022341mg [Eutrema salsugineum]
Length=194

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D  D PI+T ++   + H RWQ FRG+STD  DL++++K
Sbjct  53   KRILLDASDTPILTLRENRVSLHDRWQVFRGKSTDQSDLVYTLK  96



>ref|XP_010464895.1| PREDICTED: protein LURP-one-related 10-like [Camelina sativa]
Length=194

 Score = 50.1 bits (118),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL+D  D+PI+T ++   + H RWQ FRG+ST   DL++++K
Sbjct  53   KRVLMDASDNPILTLRENRVSLHDRWQVFRGKSTSQSDLVYTLK  96



>ref|XP_011042663.1| PREDICTED: protein LURP-one-related 15-like isoform X1 [Populus 
euphratica]
Length=214

 Score = 50.4 bits (119),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QK+ T H RW+AFRGES +  DLLF+ K
Sbjct  68   RRFLKDAAGNTLVNLRQKLRTMHGRWEAFRGESKEKNDLLFTAK  111



>gb|EAZ39190.1| hypothetical protein OsJ_23616 [Oryza sativa Japonica Group]
Length=201

 Score = 50.1 bits (118),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D +  P+++ Q+KI + H RW+ +RG+S    D LF+VK
Sbjct  61   RRVLHDAVGQPLLSMQEKILSMHNRWEVYRGDSAHSCDKLFTVK  104



>ref|XP_006429527.1| hypothetical protein CICLE_v10012729mg [Citrus clementina]
 ref|XP_006481141.1| PREDICTED: protein LURP-one-related 15-like [Citrus sinensis]
 gb|ESR42767.1| hypothetical protein CICLE_v10012729mg [Citrus clementina]
Length=215

 Score = 50.1 bits (118),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSV  130
            +R L+D   +P+VT  +K+F+AH +   FRG STD KDLLF+V
Sbjct  76   KRTLLDPAGNPVVTITEKLFSAHVKHFVFRGASTDAKDLLFTV  118



>ref|XP_011042665.1| PREDICTED: protein LURP-one-related 15-like isoform X3 [Populus 
euphratica]
Length=191

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QK+ T H RW+AFRGES +  DLLF+ K
Sbjct  68   RRFLKDAAGNTLVNLRQKLRTMHGRWEAFRGESKEKNDLLFTAK  111



>ref|XP_006413512.1| hypothetical protein EUTSA_v10026215mg [Eutrema salsugineum]
 gb|ESQ54965.1| hypothetical protein EUTSA_v10026215mg [Eutrema salsugineum]
Length=216

 Score = 50.1 bits (118),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R L+D+   P++T + K+ T H RW+ FRG ST+  DLL++VK
Sbjct  62   QRTLLDSSGSPVLTLRDKMMTMHNRWKVFRGGSTEESDLLYTVK  105



>ref|XP_009125396.1| PREDICTED: protein LURP-one-related 15 [Brassica rapa]
Length=224

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D    P++T ++K+ + H RWQ FRG ST+  DLL++VK
Sbjct  80   KRILLDGSGSPVLTLREKMVSLHDRWQVFRGGSTEQCDLLYTVK  123



>emb|CDY04830.1| BnaAnng00120D [Brassica napus]
Length=224

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D    P++T ++K+ + H RWQ FRG ST+  DLL++VK
Sbjct  80   KRILLDGSGSPVLTLREKMVSLHDRWQVFRGGSTEQCDLLYTVK  123



>gb|EAZ03288.1| hypothetical protein OsI_25434 [Oryza sativa Indica Group]
Length=201

 Score = 49.7 bits (117),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D +  P+++ Q+KI + H RW+ +RG+S    D LF+VK
Sbjct  61   RRVLHDAVGQPLLSMQEKILSMHNRWEVYRGDSAHSCDKLFTVK  104



>ref|XP_006300551.1| hypothetical protein CARUB_v10020946mg [Capsella rubella]
 gb|EOA33449.1| hypothetical protein CARUB_v10020946mg [Capsella rubella]
Length=212

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     I+T + KI + H RWQ FRG ST P DLL++VK
Sbjct  78   KRILLDGSGAQIMTLKGKIVSMHDRWQVFRGGSTAPGDLLYTVK  121



>ref|XP_011009971.1| PREDICTED: protein LURP-one-related 15-like isoform X3 [Populus 
euphratica]
Length=208

 Score = 49.7 bits (117),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T H RW+AFRGES +  DLLF+ K
Sbjct  68   RRFLKDAAGNTLVNLRQKIRTMHGRWEAFRGESKEKSDLLFTAK  111



>ref|XP_010428507.1| PREDICTED: protein LURP-one-related 15-like [Camelina sativa]
Length=210

 Score = 49.7 bits (117),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + K+ + H RWQ FRG ST+P DLL++VK
Sbjct  76   KRILLDASGAKVMTLKGKMVSMHDRWQVFRGGSTEPGDLLYTVK  119



>ref|NP_001059232.1| Os07g0230700 [Oryza sativa Japonica Group]
 dbj|BAC55839.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21146.1| Os07g0230700 [Oryza sativa Japonica Group]
 dbj|BAG91695.1| unnamed protein product [Oryza sativa Japonica Group]
Length=214

 Score = 49.7 bits (117),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D +  P+++ Q+KI + H RW+ +RG+S    D LF+VK
Sbjct  74   RRVLHDAVGQPLLSMQEKILSMHNRWEVYRGDSAHSCDKLFTVK  117



>ref|XP_006429526.1| hypothetical protein CICLE_v10012456mg [Citrus clementina]
 gb|ESR42766.1| hypothetical protein CICLE_v10012456mg [Citrus clementina]
Length=272

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R L+D   +PIVT  +K+F+ H +   FRG STD KDLLF+V+
Sbjct  129  KRTLLDPAGNPIVTITEKVFSLHEKHFVFRGASTDTKDLLFTVE  172



>gb|KFK38540.1| hypothetical protein AALP_AA3G127300 [Arabis alpina]
Length=193

 Score = 49.3 bits (116),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D  + PI+T ++   + H RWQ FRG+STD  DL++++K
Sbjct  53   KRILLDASNTPILTLKENKVSLHDRWQVFRGKSTDHSDLVYTLK  96



>ref|XP_009135182.1| PREDICTED: protein LURP-one-related 10-like [Brassica rapa]
 emb|CDX73854.1| BnaA03g31930D [Brassica napus]
Length=194

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R L+D  D+PI+T ++   + H RWQ FRG+ST+  DL++++K
Sbjct  53   KRFLLDASDNPILTLRENKVSLHDRWQVFRGKSTNQNDLVYTLK  96



>ref|XP_006481140.1| PREDICTED: protein LURP-one-related 15-like [Citrus sinensis]
Length=311

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R L+D   +PIVT  +K+F+ H +   FRG STD KDLLF+V+
Sbjct  168  KRTLLDPAGNPIVTITEKVFSLHEKHFVFRGASTDTKDLLFTVE  211



>ref|NP_187780.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SF24.2|LOR10_ARATH RecName: Full=Protein LURP-one-related 10 [Arabidopsis thaliana]
 gb|AEE75091.1| uncharacterized protein AT3G11740 [Arabidopsis thaliana]
Length=194

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D  D PI+T ++   + H RW  +RG+STD  DLL+++K
Sbjct  53   KRILLDAYDTPILTLRENKVSLHDRWLVYRGKSTDQSDLLYTLK  96



>ref|XP_010923017.1| PREDICTED: protein LURP-one-related 15-like [Elaeis guineensis]
Length=188

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+++  + +V+ Q+K+ + + RW+ +RG+S++ KDLLFSVK
Sbjct  62   RRVLLESPGNSLVSMQKKMMSVNSRWRVYRGDSSNSKDLLFSVK  105



>ref|XP_010474343.1| PREDICTED: protein LURP-one-related 15-like [Camelina sativa]
Length=188

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+L+D  +  ++T Q+K+ + H RWQ FRG STD  DLL+ VK
Sbjct  79   RILLDGSETQVLTLQRKMMSRHDRWQVFRGGSTDQGDLLYRVK  121



>ref|XP_011009972.1| PREDICTED: protein LURP-one-related 15-like, partial [Populus 
euphratica]
Length=140

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T H RW+AFRGES +  DLL + K
Sbjct  68   RRFLKDAAGNTLVNLRQKIMTMHGRWEAFRGESKEKNDLLSTAK  111



>ref|XP_002323043.1| hypothetical protein POPTR_0016s13870g [Populus trichocarpa]
 gb|EEF04804.1| hypothetical protein POPTR_0016s13870g [Populus trichocarpa]
Length=171

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T H RW+AFRG+S +  DLLF+ K
Sbjct  69   RRFLKDAAGNTLVNLRQKIRTMHGRWEAFRGKSKEKNDLLFTAK  112



>ref|XP_010416365.1| PREDICTED: protein LURP-one-related 15-like [Camelina sativa]
Length=215

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+L+D  +  ++T Q+K+ + H RWQ FRG STD  DLL+ VK
Sbjct  79   RILLDGSETQVLTLQRKMMSRHDRWQVFRGGSTDQGDLLYRVK  121



>ref|XP_002323044.2| hypothetical protein POPTR_0016s13880g [Populus trichocarpa]
 gb|EEF04805.2| hypothetical protein POPTR_0016s13880g [Populus trichocarpa]
Length=176

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  + KI T H RW+AFRGES +  DL+F+ K
Sbjct  67   RRFLKDAAGNTLVNLRHKIRTMHGRWEAFRGESKEQSDLIFTAK  110



>ref|XP_011042736.1| PREDICTED: protein LURP-one-related 15-like [Populus euphratica]
Length=200

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  +QKI T H RW+AFRG+S    DLLF+ K
Sbjct  76   RRFLKDAAGNTLVNLRQKIMTMHGRWEAFRGKSKKKNDLLFTAK  119



>ref|XP_009629283.1| PREDICTED: protein LURP-one-related 15-like [Nicotiana tomentosiformis]
Length=196

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +2

Query  5    RVLV-DTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +VLV D    P+VT + K FT H R QAF+G+STD KDL+FS K
Sbjct  58   KVLVFDAAGVPLVTLKSKKFTWHSRKQAFKGDSTDKKDLIFSAK  101



>ref|XP_004959100.1| PREDICTED: protein LURP-one-related 15-like [Setaria italica]
Length=213

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L+D   +P++  ++K+ + H  W+A+RG+ST   DLLF+ K
Sbjct  73   RRLLLDANGNPLLCMREKVISMHYTWEAYRGDSTKSSDLLFTAK  116



>ref|XP_006413514.1| hypothetical protein EUTSA_v10026191mg [Eutrema salsugineum]
 gb|ESQ54967.1| hypothetical protein EUTSA_v10026191mg [Eutrema salsugineum]
Length=222

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R L+DT   P++T ++KI T H +W+ FRG ST+  D L++VK
Sbjct  68   KRTLLDTSGSPVLTLREKIRTMHNKWKVFRGGSTEESDHLYTVK  111



>gb|KCW88262.1| hypothetical protein EUGRSUZ_A00646, partial [Eucalyptus grandis]
Length=147

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    P++T +++I   H  W+AF+G+S+D +DL+F+ K
Sbjct  58   RRVLIDATGQPVLTLRREIRADHGPWRAFKGKSSDMRDLVFTAK  101



>ref|XP_008652198.1| PREDICTED: protein LURP-one-related 10-like [Zea mays]
 tpg|DAA60081.1| TPA: hypothetical protein ZEAMMB73_875707 [Zea mays]
Length=217

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L+D   +P++  ++K+ + H  W+A+RG+ST   DLLF+ K
Sbjct  75   RRRLLDAAGNPLLCLREKVISMHNTWEAYRGDSTRSSDLLFTAK  118



>ref|XP_006481428.1| PREDICTED: protein LURP-one-related 15-like [Citrus sinensis]
Length=74

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D   + ++   +K  TAH RWQ FRG ST P+D +F+  
Sbjct  31   RRVLLDGAGNSMLLSDEKTRTAHYRWQVFRGGSTKPRDFIFTAN  74



>gb|KFK24637.1| hypothetical protein AALP_AA8G005400 [Arabis alpina]
Length=847

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+  D    P++T ++K  + H RWQ FRG+ST+  DLL+SVK
Sbjct  686  RIFSDGSGSPVLTVKEKTMSMHDRWQVFRGQSTEQSDLLYSVK  728



>ref|XP_009122395.1| PREDICTED: protein LURP-one-related 10-like [Brassica rapa]
Length=212

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL D   +P++T ++K+ + H  W   RGE +DP++L+F+VK
Sbjct  80   KRVLCDPAGYPLLTMREKLTSLHDGWTVHRGEGSDPRELMFTVK  123



>gb|KFK24636.1| hypothetical protein AALP_AA8G005300 [Arabis alpina]
Length=191

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R+  D    P++T ++K  + H RWQ FRG ST+ +DLL++VK
Sbjct  53   RIFTDGSGSPVLTVKEKTVSMHDRWQVFRGRSTEQRDLLYTVK  95



>ref|XP_002865648.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41907.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=138

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 5/44 (11%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D   +PIVT ++KI     RWQ FRG ST+ +DLL++VK
Sbjct  11   KRILLDGSGNPIVTLREKI-----RWQVFRGGSTEQRDLLYTVK  49



>gb|KDO39837.1| hypothetical protein CISIN_1g047297mg [Citrus sinensis]
Length=195

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+  + + IVT +    T H RWQ FRGEST+ + L+FS K
Sbjct  59   RRVLLGGVGNRIVTLRLNTITQHNRWQVFRGESTERRHLIFSAK  102



>ref|XP_010486843.1| PREDICTED: protein LURP-one-related 10 [Camelina sativa]
Length=194

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL+D  D+PI+T ++   + H RWQ F G+ST   DL++++K
Sbjct  53   KRVLLDASDNPILTLRENRVSLHDRWQVFSGKSTSQSDLVYTLK  96



>ref|XP_010066196.1| PREDICTED: protein LURP-one-related 15-like [Eucalyptus grandis]
Length=194

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL+D    P++T +++I   H  W+AF+G+S+D +DL+F+ K
Sbjct  58   RRVLIDATGQPVLTLRREIRADHGPWRAFKGKSSDMRDLVFTAK  101



>gb|KHN29540.1| Protein LURP-one-related 15 [Glycine soja]
Length=122

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  59   FTAHRRWQAFRGESTDPKDLLFSVK  133
             TAH RWQAFRGESTD KDL+F++K
Sbjct  1    MTAHDRWQAFRGESTDAKDLIFTLK  25



>ref|XP_006413513.1| hypothetical protein EUTSA_v10025938mg [Eutrema salsugineum]
 gb|ESQ54966.1| hypothetical protein EUTSA_v10025938mg [Eutrema salsugineum]
Length=281

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D    P++T ++KI T H RW+ FRG ST+  D L++VK
Sbjct  62   KRILLDGSGSPVLTLREKIRTMHNRWKVFRGGSTEESDHLYTVK  105



>ref|XP_010256970.1| PREDICTED: protein LURP-one-related 14 isoform X2 [Nelumbo nucifera]
Length=203

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RV+ D+   PI+T ++K+ TA  RW   RG+S+D  +LLFSV+
Sbjct  69   KRVMRDSAGFPILTMREKVLTARHRWTVHRGDSSDGSNLLFSVQ  112



>ref|XP_010091106.1| hypothetical protein L484_021991 [Morus notabilis]
 gb|EXB42396.1| hypothetical protein L484_021991 [Morus notabilis]
Length=207

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+LVD  +       Q I TAHRRW+ +RG+S++ KDLLFS K
Sbjct  67   RRLLVDAAERNCFRVIQ-ILTAHRRWEVYRGDSSNSKDLLFSAK  109



>ref|XP_010256969.1| PREDICTED: protein LURP-one-related 14 isoform X1 [Nelumbo nucifera]
Length=210

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RV+ D+   PI+T ++K+ TA  RW   RG+S+D  +LLFSV+
Sbjct  69   KRVMRDSAGFPILTMREKVLTARHRWTVHRGDSSDGSNLLFSVQ  112



>ref|XP_002893791.1| hypothetical protein ARALYDRAFT_473540 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70050.1| hypothetical protein ARALYDRAFT_473540 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + KI T H RW  FRG ST+  DLL++VK
Sbjct  53   KRILLDGFGTKVLTLKGKIMTMHDRWLVFRGGSTEEGDLLYTVK  96



>ref|XP_011014020.1| PREDICTED: protein LURP-one-related 15-like [Populus euphratica]
Length=198

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR+L D   + +V  +QKI    RRW+AFRGES +  DL+ + K
Sbjct  58   RRLLKDAAGNTLVNLRQKIMAMRRRWEAFRGESKEKSDLIITAK  101



>emb|CDY59000.1| BnaC08g49520D [Brassica napus]
Length=216

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            + +L+D+   P++T ++K  T H RWQ F+G ST+  D+L++VK
Sbjct  56   KMILLDSSGSPVLTMKEKSMTLHNRWQVFKGGSTEECDMLYTVK  99



>gb|AAL49886.1| unknown protein [Arabidopsis thaliana]
Length=207

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T ++K+ T H RWQ FRG ST+   LL++VK
Sbjct  57   KRILLDCSGAKVLTLREKMMTMHDRWQVFRGGSTEEGALLYTVK  100



>ref|XP_002323047.2| hypothetical protein POPTR_0016s13910g [Populus trichocarpa]
 gb|EEF04808.2| hypothetical protein POPTR_0016s13910g [Populus trichocarpa]
Length=143

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R  L D   + +V  ++K  T H RW+AFRGES +  DLLF+ K
Sbjct  8    RLFLNDAAGNTLVNLRKKTMTMHGRWEAFRGESKEENDLLFTAK  51



>ref|XP_003533673.1| PREDICTED: protein LURP-one-related 15-like isoform X1 [Glycine 
max]
Length=195

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D   + IVT  +K  T H R Q F+G+S D  +LLFSVK
Sbjct  50   RRVLYDNQGNSIVTLYKKNMTLHGRCQVFKGKSNDSSELLFSVK  93



>ref|XP_006587937.1| PREDICTED: protein LURP-one-related 15-like isoform X2 [Glycine 
max]
 gb|KHN29538.1| Protein LURP-one-related 15 [Glycine soja]
Length=197

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D   + IVT  +K  T H R Q F+G+S D  +LLFSVK
Sbjct  50   RRVLYDNQGNSIVTLYKKNMTLHGRCQVFKGKSNDSSELLFSVK  93



>ref|XP_002323045.1| hypothetical protein POPTR_0016s13890g [Populus trichocarpa]
 gb|EEF04806.1| hypothetical protein POPTR_0016s13890g [Populus trichocarpa]
Length=178

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  + KI T H +W+AFRGES +  DL+F+ K
Sbjct  67   RRFLKDAAGNTLVNLRHKIRTMHGKWEAFRGESEEQSDLIFTAK  110



>gb|AAG52207.1|AC022288_6 hypothetical protein; 65513-66156 [Arabidopsis thaliana]
Length=182

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + KI T H RW  FRG ST+  DLL++VK
Sbjct  77   KRILMDGFGTKVLTLKGKIMTMHDRWLVFRGGSTEEVDLLYTVK  120



>emb|CDX69996.1| BnaA10g23450D [Brassica napus]
Length=211

 Score = 46.6 bits (109),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL D   +P++T ++K+ + H  W   RGE +DP++L+F+VK
Sbjct  80   KRVLRDPAGYPLLTMREKLTSLHDGWTVHRGEGSDPRELMFTVK  123



>ref|XP_009117588.1| PREDICTED: protein LURP-one-related 15-like [Brassica rapa]
Length=216

 Score = 47.0 bits (110),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            + +L+D+   P++T ++K  T H RWQ F+G ST+  D+L++VK
Sbjct  56   KMILLDSSGSPVLTMKEKSMTLHNRWQVFKGGSTEECDMLYTVK  99



>emb|CDY66599.1| BnaAnng22510D [Brassica napus]
Length=216

 Score = 47.0 bits (110),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            + +L+D+   P++T ++K  T H RWQ F+G ST+  D+L++VK
Sbjct  56   KMILLDSSGSPVLTMKEKSMTLHNRWQVFKGGSTEECDMLYTVK  99



>gb|EEC76413.1| hypothetical protein OsI_14068 [Oryza sativa Indica Group]
Length=196

 Score = 46.2 bits (108),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSV  130
            R +L D    P++T Q+     +RRW+ FRGEST  +DLLF+V
Sbjct  61   RCLLADADRRPVLTVQESAMVMNRRWKVFRGESTSRRDLLFTV  103



>ref|NP_001051696.1| Os03g0816800 [Oryza sativa Japonica Group]
 gb|ABF99552.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13610.1| Os03g0816800 [Oryza sativa Japonica Group]
 dbj|BAG92585.1| unnamed protein product [Oryza sativa Japonica Group]
Length=200

 Score = 46.6 bits (109),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSV  130
            R +L D    P++T Q+     +RRW+ FRGEST  +DLLF+V
Sbjct  61   RCLLADADRRPVLTVQESAMVMNRRWKVFRGESTSRRDLLFTV  103



>ref|XP_006650795.1| PREDICTED: protein LURP-one-related 15-like [Oryza brachyantha]
Length=200

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSV  130
            R +LVD    P++T Q+     + RW+ FRGEST  +DLLF+V
Sbjct  61   RCLLVDADRRPVLTVQESAMVMNTRWKVFRGESTSRRDLLFTV  103



>gb|KFK39031.1| hypothetical protein AALP_AA3G191800 [Arabis alpina]
Length=184

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 29/44 (66%), Gaps = 2/44 (5%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+LVD  D PIVT + K+ + H RWQ +RG   D  D +F+VK
Sbjct  55   KRILVDPNDSPIVTMKMKVTSKHDRWQVYRGSDLD--DKIFTVK  96



>gb|KHN40667.1| Protein LURP-one-related 15 [Glycine soja]
Length=122

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  59   FTAHRRWQAFRGESTDPKDLLFSVK  133
             TAH RWQAFRGEST+ KDL+F++K
Sbjct  1    MTAHDRWQAFRGESTEAKDLIFTLK  25



>ref|NP_973456.1| protein LURP1 [Arabidopsis thaliana]
 dbj|BAH19736.1| AT2G14560 [Arabidopsis thaliana]
 gb|AEC06311.1| LURP1 protein [Arabidopsis thaliana]
Length=179

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + K+ T H RWQ FRG ST+   LL++VK
Sbjct  57   KRILLDCSGAKVLTLRGKMMTMHDRWQVFRGGSTEEGALLYTVK  100



>sp|Q9LQ36.2|LOR1_ARATH RecName: Full=Protein LURP-one-related 1 [Arabidopsis thaliana]
Length=224

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + KI T H RW  FRG ST+  DLL++VK
Sbjct  77   KRILMDGFGTKVLTLKGKIMTMHDRWLVFRGGSTEEVDLLYTVK  120



>ref|XP_011009968.1| PREDICTED: uncharacterized protein LOC105114932 [Populus euphratica]
Length=414

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  ++K  T H RW+AFRGE  + +DLLF+ K
Sbjct  67   RRFLKDAAGNTVVNLRKKARTMHGRWEAFRGEGKEKQDLLFTAK  110


 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RR L D   + +V  ++K  T H RW+AFRGE  + +DLLF+ K
Sbjct  266  RRFLKDAAGNTLVNLRKKARTMHGRWEAFRGEGKEKQDLLFTAK  309



>ref|XP_002883033.1| hypothetical protein ARALYDRAFT_341828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59292.1| hypothetical protein ARALYDRAFT_341828 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 29/44 (66%), Gaps = 2/44 (5%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+LVD  D PIVT + K+ + H RWQ +RG   D K  +F+VK
Sbjct  57   KRILVDPNDSPIVTMKMKVTSKHDRWQVYRGSDLDDK--IFTVK  98



>ref|XP_004514891.1| PREDICTED: protein LURP-one-related 15-like isoform X1 [Cicer 
arietinum]
Length=209

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 6/49 (12%)
 Frame = +2

Query  5    RVLVDTLDHPIV-TFQQKIF-----TAHRRWQAFRGESTDPKDLLFSVK  133
            R+L+D     +V T Q+K+      T H RW+AFRGEST+ KDL+FSVK
Sbjct  62   RLLLDAAGKTVVLTLQRKVIFFMVKTRHDRWEAFRGESTELKDLIFSVK  110



>gb|KHN27556.1| Protein LURP-one-related 15 [Glycine soja]
Length=262

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D    PIVT  +K  T H + + FRG S  P +LLFSVK
Sbjct  50   RRVLCDDKGSPIVTLYKKNVTLHGQCKVFRGNSNGPSELLFSVK  93



>ref|XP_006599086.1| PREDICTED: protein LURP-one-related 15-like [Glycine max]
Length=265

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D    PIVT  +K  T H + + FRG S  P +LLFSVK
Sbjct  53   RRVLCDDKGSPIVTLYKKNVTLHGQCKVFRGNSNGPSELLFSVK  96



>ref|NP_188315.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LSQ1.1|LOR13_ARATH RecName: Full=Protein LURP-one-related 13 [Arabidopsis thaliana]
 dbj|BAA94974.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE75882.1| uncharacterized protein AT3G16900 [Arabidopsis thaliana]
Length=185

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 29/44 (66%), Gaps = 2/44 (5%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+LVD  D PIVT + K+ + H RWQ +RG   D  D +F+VK
Sbjct  56   KRILVDPNDSPIVTMKMKVTSKHDRWQVYRGSDLD--DKIFTVK  97



>ref|NP_174646.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE31631.1| uncharacterized protein AT1G33840 [Arabidopsis thaliana]
Length=230

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + KI T H RW  FRG ST+  DLL++VK
Sbjct  77   KRILMDGFGTKVLTLKGKIMTMHDRWLVFRGGSTEEVDLLYTVK  120



>ref|XP_010428508.1| PREDICTED: protein LURP-one-related 15-like [Camelina sativa]
Length=231

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    RVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            R L+D     ++T Q+K+ + H RWQ FRG STD  DLL+ VK
Sbjct  95   RNLLDGSGTQVLTLQRKMMSRHERWQVFRGGSTDQDDLLYRVK  137



>ref|NP_179062.1| protein LURP1 [Arabidopsis thaliana]
 sp|Q9ZQR8.1|LURP1_ARATH RecName: Full=Protein LURP1; AltName: Full=Protein LATE UPREGULATED 
IN RESPONSE TO HYALOPERONOSPORA PARASITICA 1 [Arabidopsis 
thaliana]
 gb|AAD15461.1| unknown protein [Arabidopsis thaliana]
 gb|AAU15179.1| At2g14560 [Arabidopsis thaliana]
 gb|AEC06312.1| LURP1 protein [Arabidopsis thaliana]
Length=207

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + K+ T H RWQ FRG ST+   LL++VK
Sbjct  57   KRILLDCSGAKVLTLRGKMMTMHDRWQVFRGGSTEEGALLYTVK  100



>gb|KHN44839.1| Protein LURP-one-related 15 [Glycine soja]
Length=122

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  62   TAHRRWQAFRGESTDPKDLLFSVK  133
            TAH RW+ FRG ST+PKDL+FSVK
Sbjct  2    TAHDRWEVFRGGSTEPKDLIFSVK  25



>gb|EEE60176.1| hypothetical protein OsJ_13108 [Oryza sativa Japonica Group]
Length=237

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSV  130
            R +L D    P++T Q+     +RRW+ FRGEST  +DLLF+V
Sbjct  61   RCLLADADRRPVLTVQESAMVMNRRWKVFRGESTSRRDLLFTV  103



>ref|XP_010491289.1| PREDICTED: protein LURP-one-related 14-like isoform X2 [Camelina 
sativa]
 ref|XP_010491290.1| PREDICTED: protein LURP-one-related 14-like isoform X2 [Camelina 
sativa]
Length=213

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL D   +P++T ++K+ + + RW   RGE +DP +L+F+V+
Sbjct  80   KRVLRDPAGYPLLTMREKLTSLNHRWTVHRGEGSDPTELMFTVQ  123



>ref|XP_010491288.1| PREDICTED: protein LURP-one-related 14-like isoform X1 [Camelina 
sativa]
Length=227

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +RVL D   +P++T ++K+ + + RW   RGE +DP +L+F+V+
Sbjct  94   KRVLRDPAGYPLLTMREKLTSLNHRWTVHRGEGSDPTELMFTVQ  137



>gb|AAF97296.1|AC010164_18 Hypothetical protein [Arabidopsis thaliana]
Length=254

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            +R+L+D     ++T + KI T H RW  FRG ST+  DLL++VK
Sbjct  77   KRILMDGFGTKVLTLKGKIMTMHDRWLVFRGGSTEEVDLLYTVK  120



>ref|XP_009117597.1| PREDICTED: protein LURP-one-related 15-like isoform X1 [Brassica 
rapa]
Length=208

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  11   LVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            L+D    P++T ++K  T H RW+ +RG ST+  DLL+SVK
Sbjct  68   LLDGSGSPVLTMKEKTMTMHGRWKVYRGGSTEECDLLYSVK  108



>ref|XP_007140158.1| hypothetical protein PHAVU_008G088800g, partial [Phaseolus vulgaris]
 ref|XP_007140159.1| hypothetical protein PHAVU_008G088800g, partial [Phaseolus vulgaris]
 gb|ESW12152.1| hypothetical protein PHAVU_008G088800g, partial [Phaseolus vulgaris]
 gb|ESW12153.1| hypothetical protein PHAVU_008G088800g, partial [Phaseolus vulgaris]
Length=128

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSVK  133
            RRVL D  ++PIVT   K  + H + + FRG ST   +LLFSV+
Sbjct  59   RRVLYDDEENPIVTLYSKTVSLHGKCKVFRGASTHSSELLFSVE  102



>ref|XP_006602691.1| PREDICTED: protein LURP-one-related 15-like [Glycine max]
Length=197

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRG-ESTDPKDLLFSVK  133
            RRVL D   +PIVT  +K  T H R Q FRG +S D   LLFSVK
Sbjct  50   RRVLCDNQGNPIVTLYKKRMTLHGRCQVFRGYKSKDFSQLLFSVK  94



>ref|XP_003563792.2| PREDICTED: protein LURP-one-related 15-like [Brachypodium distachyon]
Length=201

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RRVLVDTLDHPIVTFQQKIFTAHRRWQAFRGESTDPKDLLFSV  130
            R +L D L  P++T Q+     + RW+ FRG+ST  +DLLF+V
Sbjct  63   RCLLADALRRPVLTVQESAMVMNTRWKVFRGDSTRRRDLLFTV  105



Lambda      K        H        a         alpha
   0.307    0.115    0.295    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512165903184