BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c36878_g1_i1 len=624 path=[602:0-623]

Length=624
                                                                      Score     E

emb|CDP09552.1|  unnamed protein product                                234   8e-75   
gb|EYU20800.1|  hypothetical protein MIMGU_mgv1a019143mg                228   5e-72   
ref|XP_006477499.1|  PREDICTED: uncharacterized protein LOC102615...    209   7e-65   
ref|XP_006421101.1|  hypothetical protein CICLE_v10006109mg             208   1e-64   
gb|KDP29266.1|  hypothetical protein JCGZ_16655                         202   3e-62   
ref|XP_011102110.1|  PREDICTED: uncharacterized protein LOC105180148    202   4e-62   
ref|XP_010056091.1|  PREDICTED: uncharacterized protein LOC104444162    185   3e-55   
ref|XP_008243121.1|  PREDICTED: uncharacterized protein LOC103341...    184   5e-55   
ref|XP_002526917.1|  conserved hypothetical protein                     184   5e-55   Ricinus communis
ref|XP_010673015.1|  PREDICTED: uncharacterized protein LOC104889...    184   6e-55   
ref|XP_009603161.1|  PREDICTED: uncharacterized protein LOC104098192    183   1e-54   
ref|XP_009780252.1|  PREDICTED: uncharacterized protein LOC104229326    181   9e-54   
ref|XP_009611699.1|  PREDICTED: uncharacterized protein LOC104105150    180   2e-53   
ref|XP_004234852.1|  PREDICTED: uncharacterized protein LOC101256163    179   3e-53   
ref|XP_009777208.1|  PREDICTED: uncharacterized protein LOC104226829    179   4e-53   
ref|XP_006349587.1|  PREDICTED: uncharacterized protein LOC102579...    178   6e-53   
ref|XP_010089733.1|  hypothetical protein L484_013927                   178   1e-52   
ref|XP_009348275.1|  PREDICTED: uncharacterized protein LOC103939894    177   1e-52   
ref|XP_010673016.1|  PREDICTED: uncharacterized protein LOC104889...    173   7e-51   
ref|XP_008243120.1|  PREDICTED: uncharacterized protein LOC103341...    171   6e-50   
ref|XP_006349588.1|  PREDICTED: uncharacterized protein LOC102579...    169   2e-49   
ref|XP_007028460.1|  Uncharacterized protein TCM_024261                 166   3e-48   
ref|XP_010269533.1|  PREDICTED: uncharacterized protein LOC104606159    164   3e-47   
gb|KFK36967.1|  hypothetical protein AALP_AA4G195700                    163   4e-47   
ref|XP_004493405.1|  PREDICTED: uncharacterized protein LOC101505647    163   7e-47   
gb|ACJ83873.1|  unknown                                                 161   3e-46   Medicago truncatula
ref|XP_003625004.1|  hypothetical protein MTR_7g089940                  161   3e-46   
ref|XP_002879914.1|  hypothetical protein ARALYDRAFT_483189             161   3e-46   
ref|XP_010517608.1|  PREDICTED: uncharacterized protein LOC104793029    158   4e-45   
ref|XP_010508747.1|  PREDICTED: uncharacterized protein LOC104785268    157   1e-44   
ref|XP_007203513.1|  hypothetical protein PRUPE_ppa024895mg             157   2e-44   
ref|XP_006411386.1|  hypothetical protein EUTSA_v10017345mg             156   3e-44   
ref|XP_009133473.1|  PREDICTED: uncharacterized protein LOC103857970    156   3e-44   
ref|XP_010505885.1|  PREDICTED: uncharacterized protein LOC104782607    155   5e-44   
emb|CDY22510.1|  BnaC03g23200D                                          151   2e-42   
ref|XP_011027232.1|  PREDICTED: uncharacterized protein LOC105127...    147   1e-40   
ref|XP_010525473.1|  PREDICTED: uncharacterized protein LOC104803261    146   2e-40   
ref|XP_002308885.2|  hypothetical protein POPTR_0006s03690g             147   3e-40   Populus trichocarpa [western balsam poplar]
ref|NP_030665.1|  uncharacterized protein                               145   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011027231.1|  PREDICTED: uncharacterized protein LOC105127...    137   3e-36   
ref|XP_006603626.1|  PREDICTED: uncharacterized protein LOC100305...    135   6e-36   
ref|NP_001235645.1|  uncharacterized protein LOC100305712               134   7e-36   
ref|XP_006295949.1|  hypothetical protein CARUB_v10025091mg             129   5e-34   
ref|XP_010312050.1|  PREDICTED: uncharacterized protein LOC104644355    129   8e-34   
ref|XP_007162097.1|  hypothetical protein PHAVU_001G123700g             130   2e-33   
ref|XP_003521131.1|  PREDICTED: uncharacterized protein LOC100780601    128   2e-33   
ref|XP_010653970.1|  PREDICTED: uncharacterized protein LOC104880136    103   5e-24   
emb|CDY23867.1|  BnaC04g01700D                                        98.2    2e-22   
dbj|BAF01549.1|  hypothetical protein                                 97.8    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403152.1|  PREDICTED: uncharacterized protein LOC103986784  97.8    1e-21   
ref|XP_003568551.2|  PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D...  87.8    1e-16   
ref|XP_010926994.1|  PREDICTED: uncharacterized protein LOC105049130  83.2    2e-16   
emb|CDX79950.1|  BnaA05g02060D                                        80.5    4e-16   
gb|AFW81585.1|  hypothetical protein ZEAMMB73_443698                  82.8    5e-16   
ref|XP_002439725.1|  hypothetical protein SORBIDRAFT_09g019080        79.0    9e-15   Sorghum bicolor [broomcorn]
ref|NP_001143546.1|  uncharacterized protein LOC100276236             79.0    1e-14   Zea mays [maize]
gb|EEE56023.1|  hypothetical protein OsJ_04805                        76.3    1e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72182.1|  hypothetical protein OsI_05251                        76.3    1e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_008803355.1|  PREDICTED: uncharacterized protein LOC103716929  74.3    4e-13   
ref|XP_004962240.1|  PREDICTED: uncharacterized protein LOC101770256  73.6    6e-13   
dbj|BAD88269.1|  hypothetical protein                                 76.3    6e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EMS47763.1|  hypothetical protein TRIUR3_23306                     67.4    1e-10   
gb|EAY97882.1|  hypothetical protein OsI_19801                        66.6    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_006654346.1|  PREDICTED: uncharacterized protein LOC102712909  66.2    2e-10   
gb|AAV31335.1|  unknown protein                                       65.9    3e-10   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ92066.1|  predicted protein                                    64.7    8e-10   
ref|XP_004971310.1|  PREDICTED: uncharacterized protein LOC101757594  64.3    1e-09   
emb|CDM86593.1|  unnamed protein product                              63.5    2e-09   
ref|XP_002456954.1|  hypothetical protein SORBIDRAFT_03g046250        60.1    3e-08   Sorghum bicolor [broomcorn]
gb|AFW83927.1|  hypothetical protein ZEAMMB73_014299                  58.5    6e-08   
ref|NP_001144000.1|  uncharacterized protein LOC100276819             59.3    7e-08   Zea mays [maize]
dbj|BAK02859.1|  predicted protein                                    57.0    3e-07   
gb|EMT28264.1|  hypothetical protein F775_11895                       57.4    4e-07   



>emb|CDP09552.1| unnamed protein product [Coffea canephora]
Length=156

 Score =   234 bits (597),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 2/158 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MGQ LKK G D+   K +DI P+I++CYDK+FV+TENW+ ADF HA+C TVEEIN  + S
Sbjct  1    MGQVLKKFGGDEK--KDKDIVPVIQECYDKFFVDTENWSRADFYHAVCLTVEEINKKLGS  58

Query  419  TQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVP  240
            TQ RVPK  TL +A+  HH+GKGK L++EEFQKILQ++I+DTGVTGIGAKD LF++ GVP
Sbjct  59   TQFRVPKASTLQQAYDKHHQGKGKALTKEEFQKILQDVILDTGVTGIGAKDTLFYMLGVP  118

Query  239  VTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            VT LFFKQRL PTA+PNE+FIP VTSATVFLLAKLNKI
Sbjct  119  VTALFFKQRLIPTAIPNEIFIPGVTSATVFLLAKLNKI  156



>gb|EYU20800.1| hypothetical protein MIMGU_mgv1a019143mg [Erythranthe guttata]
Length=165

 Score =   228 bits (580),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 130/165 (79%), Gaps = 7/165 (4%)
 Frame = -2

Query  599  MGQSLKKMG-------NdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEE  441
            MGQSL K G       +  ++ KG +I P+IE+CYD+YFVNT +W  ADFCHA+CQTVE+
Sbjct  1    MGQSLNKFGTSFLPYLHTKEEKKGMEIGPVIEECYDRYFVNTNDWNSADFCHAVCQTVED  60

Query  440  INTSVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDIL  261
            IN ++ STQ RVPKT TL+ A+  HH+GKGK L++EEFQKILQ++I+DTGVT +GAKD+L
Sbjct  61   INKTLGSTQFRVPKTSTLEHAYKKHHQGKGKSLTKEEFQKILQQVILDTGVTNVGAKDML  120

Query  260  FFLFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            F+L+GVP T LF KQRL P  +PN+ FIP VTSATVFLLAK NKI
Sbjct  121  FYLYGVPATALFIKQRLVPNLIPNKAFIPLVTSATVFLLAKFNKI  165



>ref|XP_006477499.1| PREDICTED: uncharacterized protein LOC102615906 isoform X1 [Citrus 
sinensis]
 ref|XP_006477500.1| PREDICTED: uncharacterized protein LOC102615906 isoform X2 [Citrus 
sinensis]
Length=159

 Score =   209 bits (532),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTEN-WTCADFCHAICQTVEEINTSVR  423
            MGQ+LK + +  ++ K ++I PI+E CY+ Y   +    T ADF  A+CQT+EEIN S+ 
Sbjct  1    MGQALKTLASGSEEKKVKEISPIVEQCYEVYIAGSRKALTSADFYQAVCQTIEEINKSLG  60

Query  422  STQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGV  243
            S+Q RVP+TETL  A+  HHKGKGK L+++EF+KI++E+I+DTG+TG GAKDI+F++FGV
Sbjct  61   SSQFRVPQTETLQEAYEKHHKGKGKSLTKDEFEKIIKELIVDTGLTGFGAKDIIFYMFGV  120

Query  242  PVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            P+T LF KQR+ P AVPN++FIP VTSATVFLLAKLNKI
Sbjct  121  PITALFIKQRVAPKAVPNDIFIPVVTSATVFLLAKLNKI  159



>ref|XP_006421101.1| hypothetical protein CICLE_v10006109mg [Citrus clementina]
 gb|ESR34341.1| hypothetical protein CICLE_v10006109mg [Citrus clementina]
Length=159

 Score =   208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTEN-WTCADFCHAICQTVEEINTSVR  423
            MGQ+LK + +  ++ K ++I PI+E CY+ Y   +    T ADF  A+CQT+EEIN S+ 
Sbjct  1    MGQALKTLASGSEEKKVKEIGPIVEQCYEVYIAGSRKALTSADFYQAVCQTIEEINKSLG  60

Query  422  STQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGV  243
            S+Q RVP+TETL  A+  HHKGKGK L+++EF+KI++E+I+DTG+TG GAKDI+F++FGV
Sbjct  61   SSQFRVPQTETLQEAYEKHHKGKGKSLTKDEFEKIIKELIVDTGLTGFGAKDIIFYMFGV  120

Query  242  PVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            P+T LF KQR+ P AVPN++FIP VTSATVFLLAKLNKI
Sbjct  121  PITALFIKQRVAPKAVPNDIFIPVVTSATVFLLAKLNKI  159



>gb|KDP29266.1| hypothetical protein JCGZ_16655 [Jatropha curcas]
Length=160

 Score =   202 bits (515),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 121/160 (76%), Gaps = 2/160 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNT-ENWTCADFCHAICQTVEEINTSVR  423
            MGQSL K+    +  K ++I P IE+CY+KYF +T + WT ADF HAICQTVEEIN  + 
Sbjct  1    MGQSLMKLAPGSEQNKEKEIGPTIEECYNKYFSDTTKEWTLADFYHAICQTVEEINKKLN  60

Query  422  STQIRVPKTETLDRAFHNHHKGKGK-KLSREEFQKILQEIIMDTGVTGIGAKDILFFLFG  246
            STQ R+P  E L   +  H+KGKG+ ++++EEFQKILQEII+ +G TG G+KDIL FLFG
Sbjct  61   STQFRIPDVEKLTEVYEKHYKGKGRDQVTKEEFQKILQEIIIHSGFTGFGSKDILLFLFG  120

Query  245  VPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            +P   LF KQR+ P AVPN+VFIP VTSATV+LLAKLNKI
Sbjct  121  IPAAALFIKQRVAPKAVPNDVFIPGVTSATVYLLAKLNKI  160



>ref|XP_011102110.1| PREDICTED: uncharacterized protein LOC105180148 [Sesamum indicum]
Length=156

 Score =   202 bits (513),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 125/158 (79%), Gaps = 2/158 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MGQSL K GN++   K ++I P+IE CYD YFV TE+W+ AD  HA+CQTVEEIN ++ S
Sbjct  1    MGQSLNKFGNEEK--KVKEIGPVIELCYDAYFVKTEDWSSADLYHAVCQTVEEINKAIGS  58

Query  419  TQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVP  240
            TQ RVP+T TL  A+  HHKGKGK L++EEFQ+ILQE+I+DTG+T I +KD+LF+LFGVP
Sbjct  59   TQFRVPQTSTLLEAYKKHHKGKGKSLTKEEFQEILQEVILDTGLTSIASKDMLFYLFGVP  118

Query  239  VTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
             T LF KQRL P  VPNE FIP VTSATVFLLAKL KI
Sbjct  119  ATALFVKQRLAPKLVPNEAFIPVVTSATVFLLAKLKKI  156



>ref|XP_010056091.1| PREDICTED: uncharacterized protein LOC104444162 [Eucalyptus grandis]
 gb|KCW90043.1| hypothetical protein EUGRSUZ_A02247 [Eucalyptus grandis]
Length=165

 Score =   185 bits (469),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 113/169 (67%), Gaps = 15/169 (9%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYF-----------VNTENWTCADFCHAICQ  453
            MG +L   G        ++ +PIIE CY+KY               E    ADF H +C+
Sbjct  1    MGNTLGGTGEKS----AKEFEPIIEKCYEKYVDEKEKVEAGNKEKAEELGLADFYHLVCE  56

Query  452  TVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA  273
            TVEEIN  + +TQ  VPK  TLD  +  HH+GKGK L++EEFQ I+QE+I+DTGVTG GA
Sbjct  57   TVEEINKKLGNTQFCVPKVSTLDHVYLTHHQGKGKSLTKEEFQTIMQEVIVDTGVTGFGA  116

Query  272  KDILFFLFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            KDI F+LFGVPVT LF KQR+ P AVPNE+FIP +TS TVF+LAK+NKI
Sbjct  117  KDIFFYLFGVPVTALFIKQRVAPDAVPNEIFIPGITSLTVFVLAKINKI  165



>ref|XP_008243121.1| PREDICTED: uncharacterized protein LOC103341387 isoform X2 [Prunus 
mume]
Length=160

 Score =   184 bits (467),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 119/160 (74%), Gaps = 2/160 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNT-ENWTCADFCHAICQTVEEINTSVR  423
            MGQ+LKK+    ++ + ++I+PIIE CY+ +F  T E  T  DF  AIC+TVEEIN  + 
Sbjct  1    MGQTLKKLAPGTEENQIKEIRPIIEKCYETHFAGTFEEPTLTDFYRAICETVEEINKQLG  60

Query  422  STQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGI-GAKDILFFLFG  246
            +TQ  +P    L +A+ NHH+GKG+ L+REEFQ+I Q++I+ TG TG+ GAKD L ++FG
Sbjct  61   NTQFCLPTESKLRQAYENHHQGKGRSLTREEFQRIFQDVILGTGFTGVGGAKDTLIYIFG  120

Query  245  VPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            VP+T LF KQRL P  +PNE+FIP VTSATVF+LAKLNKI
Sbjct  121  VPLTALFVKQRLMPRVIPNEIFIPCVTSATVFVLAKLNKI  160



>ref|XP_002526917.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35470.1| conserved hypothetical protein [Ricinus communis]
Length=151

 Score =   184 bits (466),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  554  KGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAF  375
            K ++I   I +CYDK+FV+TE W  ADF  A+CQTV+EIN  ++STQ R P  E L   +
Sbjct  9    KEKEIGCTIGECYDKFFVDTEVWELADFYRAVCQTVDEINKKIKSTQFRTPDAEKLKEVY  68

Query  374  HNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTAV  195
              H+K KGK L++EEFQKILQE+I+ TG TG G+KDI  FLFGVP    F KQR+ P AV
Sbjct  69   QIHYKDKGKHLTKEEFQKILQEVIIHTGFTGFGSKDIFLFLFGVPAAAFFIKQRVAPKAV  128

Query  194  PNEVFIPAVTSATVFLLAKLNKI  126
            PN+V IP VTSATV+LLAKLNKI
Sbjct  129  PNDVLIPTVTSATVYLLAKLNKI  151



>ref|XP_010673015.1| PREDICTED: uncharacterized protein LOC104889487 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=159

 Score =   184 bits (466),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVN-TENWTCADFCHAICQTVEEINTSVR  423
            MGQSL+K+   ++    + +    +  Y+++F + T++WT  DF  A+C+ VEEIN  + 
Sbjct  1    MGQSLQKLAPGNEVKMTKLMGETAQRYYEEHFSDVTKDWTSVDFYRAVCEAVEEINRILG  60

Query  422  STQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGV  243
            +TQ RVPK E L +A+  HHKGKGK L++EEFQKILQ+ I++TG TGIGAKDIL ++FGV
Sbjct  61   NTQFRVPKEEALQQAYDRHHKGKGKSLTKEEFQKILQDAIVETGFTGIGAKDILLYIFGV  120

Query  242  PVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            P T L  KQ L P A+PNE+FIP VTSATVF+LAKLNKI
Sbjct  121  PATALLIKQGLIPKALPNEIFIPVVTSATVFVLAKLNKI  159



>ref|XP_009603161.1| PREDICTED: uncharacterized protein LOC104098192 [Nicotiana tomentosiformis]
Length=168

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 119/161 (74%), Gaps = 10/161 (6%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQ---PIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTS  429
            MGQ++ K+G      +GRD +    IIE CYDKYF      T ADF HAICQTVEEIN  
Sbjct  15   MGQAISKIGQS---FQGRDEKIDDEIIEICYDKYF----RRTSADFYHAICQTVEEINRR  67

Query  428  VRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLF  249
              STQI++P T TL R +  +HK +G+KL+++EF+KI+ ++I ++GVTG GAKD LF+LF
Sbjct  68   QGSTQIKIPSTTTLVRVYKKYHKVEGRKLTKDEFRKIVGDLIRESGVTGFGAKDTLFYLF  127

Query  248  GVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            GVPVTTLF KQR+ P A+ +E+FIPAVTSATV +LAK NK+
Sbjct  128  GVPVTTLFIKQRIKPQAISDEIFIPAVTSATVLVLAKFNKV  168



>ref|XP_009780252.1| PREDICTED: uncharacterized protein LOC104229326 [Nicotiana sylvestris]
Length=171

 Score =   181 bits (459),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 118/162 (73%), Gaps = 4/162 (2%)
 Frame = -2

Query  608  SVNMGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTS  429
            +++MGQSLKK  ND+   +  ++ P+I + Y+ +F N ENW    FC A+C TVE+IN  
Sbjct  13   TISMGQSLKKFANDE---QKDNVGPMINEFYESHFKNMENWKFDQFCRAVCLTVEDINEK  69

Query  428  VRSTQIRVPKTETLDRAFHNHHKGKGKK-LSREEFQKILQEIIMDTGVTGIGAKDILFFL  252
            + STQ +VPK E L R +  +H  KG K L+ EE+Q +L+EII+DT VTG GAKD+L +L
Sbjct  70   LGSTQFKVPKIEELHRLYDKYHIDKGSKSLTPEEYQNMLKEIILDTKVTGSGAKDVLLYL  129

Query  251  FGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            FGVPVT LF KQ + P A+PNE+FIP +TSATVFLLAKL+KI
Sbjct  130  FGVPVTALFIKQSIIPQAIPNEIFIPGITSATVFLLAKLHKI  171



>ref|XP_009611699.1| PREDICTED: uncharacterized protein LOC104105150 [Nicotiana tomentosiformis]
Length=171

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 120/162 (74%), Gaps = 4/162 (2%)
 Frame = -2

Query  608  SVNMGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTS  429
            +++MG SLKK  ND+   +  ++ P+I++ Y+ +F NTE W+ A FC A+C TVE+IN  
Sbjct  13   TISMGLSLKKFANDE---QKDNVGPMIKEFYESHFKNTEKWSFAQFCRAVCLTVEDINGK  69

Query  428  VRSTQIRVPKTETLDRAFHNHHKGKGKK-LSREEFQKILQEIIMDTGVTGIGAKDILFFL  252
            + STQ RVPK E L R +  +H  KG K L++EE++ +L+EII+DT VTG GAKDIL +L
Sbjct  70   LGSTQFRVPKIEELQRLYDKYHIHKGSKSLTKEEYENMLKEIILDTEVTGSGAKDILLYL  129

Query  251  FGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            FGVPVT LF KQ + P A+ NE+FIP +TSATVFLLAKL+KI
Sbjct  130  FGVPVTALFIKQSIIPRAISNEIFIPGITSATVFLLAKLHKI  171



>ref|XP_004234852.1| PREDICTED: uncharacterized protein LOC101256163 [Solanum lycopersicum]
Length=155

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 112/158 (71%), Gaps = 3/158 (2%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MGQSL+K  N +   +  +I PII++CY  +F NTE W  A FC A+CQTVE+IN  +  
Sbjct  1    MGQSLEKFANGE---QSDNIGPIIDNCYLTHFNNTEKWNLAQFCRAVCQTVEDINKKLGC  57

Query  419  TQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVP  240
            TQ+RVP+  TL+R    +    GK L REE+ K+L EII +T +TG+GAKD+L +LFGVP
Sbjct  58   TQLRVPEIATLERLHQEYEICSGKSLKREEYHKMLVEIIRETKITGLGAKDVLLYLFGVP  117

Query  239  VTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
              TLF KQ + P A+PN +F+PAVTSATVFLLAKL+ I
Sbjct  118  FITLFIKQSVIPQAIPNYIFVPAVTSATVFLLAKLHMI  155



>ref|XP_009777208.1| PREDICTED: uncharacterized protein LOC104226829 [Nicotiana sylvestris]
Length=168

 Score =   179 bits (455),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 114/161 (71%), Gaps = 10/161 (6%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQ---PIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTS  429
            MG ++ K+G      +GRD +    IIE CYDKYF     WT ADF HAICQTVEEIN  
Sbjct  15   MGHAISKIGQS---FQGRDEKIDNEIIEICYDKYF----RWTSADFYHAICQTVEEINRR  67

Query  428  VRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLF  249
              STQI++P T TL   +  +HK KG KL+ +EF+KIL+E+I ++ V G GAKD LF+LF
Sbjct  68   QGSTQIKIPSTTTLMEVYKKYHKVKGTKLTEDEFRKILRELIHESEVIGYGAKDTLFYLF  127

Query  248  GVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            GVPVT LF KQR+ P A+ +E+FIPAVTSATV +LAK NK+
Sbjct  128  GVPVTALFIKQRIKPQAISDEIFIPAVTSATVLVLAKFNKV  168



>ref|XP_006349587.1| PREDICTED: uncharacterized protein LOC102579865 isoform X1 [Solanum 
tuberosum]
Length=155

 Score =   178 bits (452),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 112/158 (71%), Gaps = 3/158 (2%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MGQSLKK  N +   +  +I PII++CY  +F NT+ W+ A FC A+CQTVE+IN  +  
Sbjct  1    MGQSLKKFANGE---QSDNIGPIIDNCYITHFNNTKKWSLAQFCRAVCQTVEDINKELGC  57

Query  419  TQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVP  240
            TQ+RVP   TL+R    +    GK L REE+ K+L EII +T +TG+GAKD+L +LFGVP
Sbjct  58   TQLRVPGIATLERLHQEYEICSGKSLKREEYHKMLVEIIGETKITGLGAKDVLLYLFGVP  117

Query  239  VTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            + TLF KQ + P A+PN +FIP VTSATVFLLAKL+ I
Sbjct  118  LITLFIKQSVIPQAIPNYIFIPGVTSATVFLLAKLHMI  155



>ref|XP_010089733.1| hypothetical protein L484_013927 [Morus notabilis]
 gb|EXB38294.1| hypothetical protein L484_013927 [Morus notabilis]
Length=160

 Score =   178 bits (451),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYF-VNTENWTCADFCHAICQTVEEINTSVR  423
            MGQSLKK     ++ K +DI PIIE  Y K+F   +     ADF  A+C+TVEEIN +  
Sbjct  1    MGQSLKKFAPGSEENKMKDIVPIIEKRYTKHFGKGSSEPNLADFYGAVCETVEEINKTFG  60

Query  422  STQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEI-IMDTGVTGIGAKDILFFLFG  246
            +TQ +VP    +  A+  HH+ K + ++REEFQKILQEI I D+G TG+GAKD L ++FG
Sbjct  61   NTQFKVPSARAIREAYQTHHEHKKEPVTREEFQKILQEILITDSGFTGLGAKDTLVYIFG  120

Query  245  VPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            VP+  LF KQ+LFP AVPNEVFIP VTSATVF+LAKLNKI
Sbjct  121  VPLAALFVKQKLFPRAVPNEVFIPGVTSATVFVLAKLNKI  160



>ref|XP_009348275.1| PREDICTED: uncharacterized protein LOC103939894 [Pyrus x bretschneideri]
Length=161

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 110/161 (68%), Gaps = 3/161 (2%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFV---NTENWTCADFCHAICQTVEEINTS  429
            MGQ+LK +    ++ K ++I PIIE  YD +F     T   T  +F  A+C+ VE+IN  
Sbjct  1    MGQTLKTLAPRTEENKIKEISPIIEKFYDTHFAADSGTGEPTAIEFYRAVCEAVEKINKQ  60

Query  428  VRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLF  249
            + STQ  VP+   L +A+  HHKGKG  L REEFQKILQEIIM TG TG+GAKD L ++F
Sbjct  61   LGSTQFCVPEESKLKKAYEQHHKGKGSSLKREEFQKILQEIIMGTGFTGVGAKDTLIYMF  120

Query  248  GVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            GVP+T    KQR+ P A+PN  FIPA+TSAT F+LAKLNK+
Sbjct  121  GVPLTAFLIKQRIMPRAIPNTFFIPAITSATAFVLAKLNKV  161



>ref|XP_010673016.1| PREDICTED: uncharacterized protein LOC104889487 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=155

 Score =   173 bits (438),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 114/159 (72%), Gaps = 5/159 (3%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVN-TENWTCADFCHAICQTVEEINTSVR  423
            MGQSL+K+   ++    + +    +  Y+++F + T++WT  DF  A+C+ VE +     
Sbjct  1    MGQSLQKLAPGNEVKMTKLMGETAQRYYEEHFSDVTKDWTSVDFYRAVCEAVEILG----  56

Query  422  STQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGV  243
            +TQ RVPK E L +A+  HHKGKGK L++EEFQKILQ+ I++TG TGIGAKDIL ++FGV
Sbjct  57   NTQFRVPKEEALQQAYDRHHKGKGKSLTKEEFQKILQDAIVETGFTGIGAKDILLYIFGV  116

Query  242  PVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            P T L  KQ L P A+PNE+FIP VTSATVF+LAKLNKI
Sbjct  117  PATALLIKQGLIPKALPNEIFIPVVTSATVFVLAKLNKI  155



>ref|XP_008243120.1| PREDICTED: uncharacterized protein LOC103341387 isoform X1 [Prunus 
mume]
Length=182

 Score =   171 bits (434),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 119/182 (65%), Gaps = 24/182 (13%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNT-ENWTCADFCHAICQTVEEINTSVR  423
            MGQ+LKK+    ++ + ++I+PIIE CY+ +F  T E  T  DF  AIC+TVEEIN  + 
Sbjct  1    MGQTLKKLAPGTEENQIKEIRPIIEKCYETHFAGTFEEPTLTDFYRAICETVEEINKQLG  60

Query  422  STQIRVPKTETLDRAFH----------------------NHHKGKGKKLSREEFQKILQE  309
            +TQ  +P    L +A+                       NHH+GKG+ L+REEFQ+I Q+
Sbjct  61   NTQFCLPTESKLRQAYEENFPVRMPNVNQMGLYFRMGMKNHHQGKGRSLTREEFQRIFQD  120

Query  308  IIMDTGVTGIG-AKDILFFLFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLN  132
            +I+ TG TG+G AKD L ++FGVP+T LF KQRL P  +PNE+FIP VTSATVF+LAKLN
Sbjct  121  VILGTGFTGVGGAKDTLIYIFGVPLTALFVKQRLMPRVIPNEIFIPCVTSATVFVLAKLN  180

Query  131  KI  126
            KI
Sbjct  181  KI  182



>ref|XP_006349588.1| PREDICTED: uncharacterized protein LOC102579865 isoform X2 [Solanum 
tuberosum]
Length=150

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -2

Query  545  DIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNH  366
            +I PII++CY  +F NT+ W+ A FC A+CQTVE+IN  +  TQ+RVP   TL+R    +
Sbjct  11   NIGPIIDNCYITHFNNTKKWSLAQFCRAVCQTVEDINKELGCTQLRVPGIATLERLHQEY  70

Query  365  HKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTAVPNE  186
                GK L REE+ K+L EII +T +TG+GAKD+L +LFGVP+ TLF KQ + P A+PN 
Sbjct  71   EICSGKSLKREEYHKMLVEIIGETKITGLGAKDVLLYLFGVPLITLFIKQSVIPQAIPNY  130

Query  185  VFIPAVTSATVFLLAKLNKI  126
            +FIP VTSATVFLLAKL+ I
Sbjct  131  IFIPGVTSATVFLLAKLHMI  150



>ref|XP_007028460.1| Uncharacterized protein TCM_024261 [Theobroma cacao]
 gb|EOY08962.1| Uncharacterized protein TCM_024261 [Theobroma cacao]
Length=152

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = -2

Query  554  KGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAF  375
            KG++I  +IE CY  YF + ++WT A F  A+C+TVEEIN  + STQ+ VPKT TL+ A+
Sbjct  11   KGKEIDAVIEKCYQTYFKDKKDWTSAKFYGAVCETVEEINKKLGSTQLSVPKTTTLELAY  70

Query  374  HNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTAV  195
              + +    +LS+EEFQ ILQE++++TG TGIGAKDIL +LFG+PVT L  K+R     +
Sbjct  71   GRYKEAAEGELSKEEFQGILQEVLIETGFTGIGAKDILLYLFGIPVTGLMIKKRA-ALKI  129

Query  194  PNEVFIPAVTSATVFLLAKLNKI  126
             +++FIPA+TSATVFLLAKL KI
Sbjct  130  HDDLFIPAITSATVFLLAKLKKI  152



>ref|XP_010269533.1| PREDICTED: uncharacterized protein LOC104606159 [Nelumbo nucifera]
Length=159

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 115/161 (71%), Gaps = 5/161 (3%)
 Frame = -2

Query  599  MGQSLKKM--GNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSV  426
            MGQ + K+  G++D++ K + I+PII++CY+   V+ +++  A F  A+CQ VEEIN  +
Sbjct  1    MGQVMIKLANGSEDEEKKAKRIEPIIDECYNNITVDAKDY--AGFYRAVCQAVEEINKQL  58

Query  425  RSTQIRVPKTETLDRAFHNHHKGK-GKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLF  249
             +TQ  VP T  L  AF  HHKGK    L++EEF KILQ++I   G+TG GAK +L  +F
Sbjct  59   GNTQFSVPSTTKLQEAFEKHHKGKESGSLTKEEFGKILQDVIYGAGLTGTGAKAMLLSIF  118

Query  248  GVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            GVP+ ++F KQR+ P A+PNE+F+P +TSATVF+LAKLNKI
Sbjct  119  GVPIMSMFIKQRIIPKAIPNELFLPCITSATVFILAKLNKI  159



>gb|KFK36967.1| hypothetical protein AALP_AA4G195700 [Arabis alpina]
Length=161

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 114/163 (70%), Gaps = 7/163 (4%)
 Frame = -2

Query  599  MGQSLKKM-GNdddDMKGRDIQPIIEDCYDKYFV---NTENWTCADFCHAICQTVEEINT  432
            MGQ+L    GN +  +KG+D++ + E+CY K F    + ++W+  DF   + + VEEIN 
Sbjct  1    MGQALNTAKGNLE--IKGKDLEAMAENCYLKRFEEKNDDQDWSFGDFYRIVAEAVEEINR  58

Query  431  SVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA-KDILFF  255
             +  TQI+VP  + L  A+  H+ G GKK+S+EEFQK+LQE+++  G TG+G  K+ L F
Sbjct  59   RLGGTQIKVPSVDKLQEAYERHNLGDGKKISKEEFQKLLQEVLIGAGFTGVGGVKEFLLF  118

Query  254  LFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            +FGVP   +F K R+ P+++PN++FIPAVTSATVFLLAKLNKI
Sbjct  119  IFGVPAFAVFLKNRIAPSSIPNDLFIPAVTSATVFLLAKLNKI  161



>ref|XP_004493405.1| PREDICTED: uncharacterized protein LOC101505647 [Cicer arietinum]
Length=157

 Score =   163 bits (412),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 110/158 (70%), Gaps = 1/158 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MGQSLKK+    D+ K +++ PII+  Y+    N  N    +F   +C+ VEE+N  +  
Sbjct  1    MGQSLKKLTPGTDEKKAKELGPIIDKFYENNLKNPSN-NFPEFYRGVCEIVEELNKKLGY  59

Query  419  TQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVP  240
            TQ ++PKTE L +A+  HH+GK K+L++ EF+ I++E+I ++G TG+GAK+ L ++FGVP
Sbjct  60   TQFKLPKTEDLRKAYQEHHQGKDKELTKAEFEDIMREVIKESGFTGVGAKEALLYIFGVP  119

Query  239  VTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            VT LF KQR+ P A+PNE FIP +TS TV +LA LNKI
Sbjct  120  VTALFVKQRVMPQAIPNEFFIPGITSLTVLVLAALNKI  157



>gb|ACJ83873.1| unknown [Medicago truncatula]
 gb|AFK49240.1| unknown [Medicago truncatula]
Length=157

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 112/158 (71%), Gaps = 1/158 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MGQSLKK+    D+ K +++ PII+  Y+K   N  +    +F   +C+ VEE+N     
Sbjct  1    MGQSLKKLTPGTDEKKAKELGPIIDKFYEKDIKNA-SRDFPEFYRGVCEIVEELNKKFGY  59

Query  419  TQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVP  240
            TQ ++P T+ L++A++ HHKGK K+L++ EFQ+I++E+I ++G TG+GAK+ L ++FGVP
Sbjct  60   TQFKLPGTKELEKAYNEHHKGKNKELAKAEFQEIMKEMIKESGFTGVGAKEALLYIFGVP  119

Query  239  VTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            VT LF KQR+ P A+PNE FIP +TS TV +LA LNKI
Sbjct  120  VTALFVKQRVGPQAIPNEFFIPGITSVTVLILAALNKI  157



>ref|XP_003625004.1| hypothetical protein MTR_7g089940 [Medicago truncatula]
 gb|ABD28332.2| hypothetical protein MtrDRAFT_AC147961g27v2 [Medicago truncatula]
 gb|AES81222.1| transmembrane protein, putative [Medicago truncatula]
Length=157

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 112/158 (71%), Gaps = 1/158 (1%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MGQSLKK+    D+ K +++ PII+  Y+K   N  +    +F   +C+ VEE+N     
Sbjct  1    MGQSLKKLTPGTDEKKAKELGPIIDKFYEKDIKNA-SRDFPEFYRGVCEIVEELNKKFGY  59

Query  419  TQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVP  240
            TQ ++P T+ L++A++ HHKGK K+L++ EFQ+I++E+I ++G TG+GAK+ L ++FGVP
Sbjct  60   TQFKLPGTKELEKAYNEHHKGKNKELTKAEFQEIMKEMIKESGFTGVGAKEALLYIFGVP  119

Query  239  VTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            VT LF KQR+ P A+PNE FIP +TS TV +LA LNKI
Sbjct  120  VTALFVKQRVGPQAIPNEFFIPGITSVTVLILAALNKI  157



>ref|XP_002879914.1| hypothetical protein ARALYDRAFT_483189 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56173.1| hypothetical protein ARALYDRAFT_483189 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 112/162 (69%), Gaps = 5/162 (3%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFV---NTENWTCADFCHAICQTVEEINTS  429
            MGQ+L        ++ G+D++ ++E+CY K      + + W+  DF   + + VEEIN  
Sbjct  1    MGQALD-TAKGKGEVDGKDLEAMVENCYRKRLEEQNDDQEWSFGDFYRIVAEAVEEINRR  59

Query  428  VRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA-KDILFFL  252
            +  TQ++VP  E L +A+  H+ G+GKKLS++EFQK+LQE+++  G TG+G  K+ L F+
Sbjct  60   LGGTQLKVPSVEKLQQAYEIHNLGEGKKLSKDEFQKLLQEVLIGAGFTGVGGVKEFLLFI  119

Query  251  FGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            FGVP   +F K R+ PT++PN++FIPA+TSATVFLLAKLNKI
Sbjct  120  FGVPAIAVFIKNRIAPTSIPNDLFIPAITSATVFLLAKLNKI  161



>ref|XP_010517608.1| PREDICTED: uncharacterized protein LOC104793029 [Camelina sativa]
Length=161

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 108/161 (67%), Gaps = 10/161 (6%)
 Frame = -2

Query  578  MGNdddDMKGR------DIQPIIEDCYDKYFV---NTENWTCADFCHAICQTVEEINTSV  426
            MG   +  KG+      D++ + E+CY K F    + ++W+  DF   + + VEEIN  +
Sbjct  1    MGQALNTAKGKGEVDVKDLEAMAENCYRKRFEEQNDDQDWSFGDFYRIVAEAVEEINRRL  60

Query  425  RSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA-KDILFFLF  249
              TQ++VP  + L  A+  H+ GKGKKLS++EFQK+LQE+++  G TG+G  K+ L F+F
Sbjct  61   GGTQLQVPSVDKLQEAYERHNLGKGKKLSKDEFQKLLQEVLIGAGFTGVGGVKEFLLFIF  120

Query  248  GVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            GVP   +F K RL PT++ N++FIPAVTSATVFLLAKLNKI
Sbjct  121  GVPALAVFLKNRLAPTSLSNDIFIPAVTSATVFLLAKLNKI  161



>ref|XP_010508747.1| PREDICTED: uncharacterized protein LOC104785268 [Camelina sativa]
Length=172

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 110/163 (67%), Gaps = 5/163 (3%)
 Frame = -2

Query  602  NMGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFV---NTENWTCADFCHAICQTVEEINT  432
            NMGQ+L        ++  +D++ + E+CY K F    + + W+  DF   + + VEEIN 
Sbjct  11   NMGQALN-TAKGKGEVDVKDLEAMAENCYRKRFEEQNDDQEWSFGDFYRIVAEAVEEINR  69

Query  431  SVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA-KDILFF  255
             +  TQ++VP  + L  A+  H+ G+GKKLS++EFQK+LQE+++  G TG+G  K+ L F
Sbjct  70   RLGGTQLKVPSVDKLQEAYERHNLGEGKKLSKDEFQKLLQEVLIGAGFTGVGGVKEFLLF  129

Query  254  LFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            +FGVP   +F K R+ PT++ N++FIPAVTSATVFLLAKLNKI
Sbjct  130  IFGVPALAVFIKNRIAPTSLSNDIFIPAVTSATVFLLAKLNKI  172



>ref|XP_007203513.1| hypothetical protein PRUPE_ppa024895mg [Prunus persica]
 gb|EMJ04712.1| hypothetical protein PRUPE_ppa024895mg [Prunus persica]
Length=161

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 3/161 (2%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNT-ENWTCADFCHAICQTVEEINTSVR  423
            MGQ+LKK+    ++ K ++I PIIE+CY  +F  T E  T  +F  AIC+TVEEIN  + 
Sbjct  1    MGQTLKKLAPGTEENKIKEIGPIIENCYKTHFAGTVEKPTFTNFYRAICETVEEINKQLG  60

Query  422  STQIRVPKTETLDRAFHNHH-KGKGKKLSREEFQKILQEIIMDTGVTGIG-AKDILFFLF  249
            +TQ  +P    L + + +HH +GKG+ L+REEFQ+I Q++I  TG TG+G AKD L ++F
Sbjct  61   NTQFCLPTESKLKQKYEDHHDQGKGRSLTREEFQRIFQDVIFGTGFTGVGGAKDTLIYIF  120

Query  248  GVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            GVP+T LF KQRL P  +PNE+FIP +TSATVF+LAKLNKI
Sbjct  121  GVPLTALFVKQRLMPRVIPNEIFIPCITSATVFVLAKLNKI  161



>ref|XP_006411386.1| hypothetical protein EUTSA_v10017345mg [Eutrema salsugineum]
 gb|ESQ52839.1| hypothetical protein EUTSA_v10017345mg [Eutrema salsugineum]
Length=161

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 112/163 (69%), Gaps = 7/163 (4%)
 Frame = -2

Query  599  MGQSLKKM-GNdddDMKGRDIQPIIEDCYDKYFV---NTENWTCADFCHAICQTVEEINT  432
            MGQ+L    GN +  + G+D++ + E+CY K      + + W+  DF   + + V+EIN 
Sbjct  1    MGQALNTAKGNGE--VNGKDLEAMAENCYRKRLEEKNDDQEWSFGDFYCIVAEAVQEINK  58

Query  431  SVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA-KDILFF  255
             +  TQ++VP  E L  A+  H+ G+GKKLS++EFQK+LQE+++  G TG+G  K+ L F
Sbjct  59   RLGGTQLKVPSVEKLRGAYERHNLGEGKKLSKDEFQKLLQEVLIGAGFTGVGGVKEFLLF  118

Query  254  LFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            +FGVP   +F K R+ PT++PN++FIPAVTSATVFLLAKLNKI
Sbjct  119  IFGVPAFAVFLKNRIAPTSMPNDLFIPAVTSATVFLLAKLNKI  161



>ref|XP_009133473.1| PREDICTED: uncharacterized protein LOC103857970 [Brassica rapa]
 emb|CDY35424.1| BnaA03g19360D [Brassica napus]
Length=161

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 111/163 (68%), Gaps = 7/163 (4%)
 Frame = -2

Query  599  MGQSLKKM-GNdddDMKGRDIQPIIEDCYDKYFVNTEN---WTCADFCHAICQTVEEINT  432
            MGQ+L    GN +  + G+D++ + E+CY K     ++   W+  DF   + + VEEIN 
Sbjct  1    MGQALNTAKGNGE--LNGKDLETMAENCYRKRLEEQDDDQEWSFGDFYRIVDEAVEEINR  58

Query  431  SVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA-KDILFF  255
             +  TQ++VP  + L  A+  H+ G+GKK+S++EFQK+LQE+++  G TG+G  K+ L F
Sbjct  59   RLGGTQLKVPSVDKLQEAYERHNLGEGKKISKDEFQKLLQEVLIGAGFTGVGGVKEFLLF  118

Query  254  LFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            +FGVP  T+F K R+ PT+ PN++ IPAVTSATVFLLAKLNKI
Sbjct  119  IFGVPALTVFLKNRIAPTSFPNDLLIPAVTSATVFLLAKLNKI  161



>ref|XP_010505885.1| PREDICTED: uncharacterized protein LOC104782607 [Camelina sativa]
Length=161

 Score =   155 bits (393),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 107/161 (66%), Gaps = 10/161 (6%)
 Frame = -2

Query  578  MGNdddDMKGR------DIQPIIEDCYDKYFV---NTENWTCADFCHAICQTVEEINTSV  426
            MG   +  KG+      D++ + E+CY K F    + + W+  DF   + + VEEIN  +
Sbjct  1    MGQALNTAKGKGEVDVKDLEAMAENCYRKRFEEQNDDQEWSFGDFYRIVAEAVEEINRRL  60

Query  425  RSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA-KDILFFLF  249
              TQ++VP  + L  A+  H+ G+GKKLS++EFQK+LQE+++  G TG+G  K+ L F+F
Sbjct  61   GGTQLKVPSVDKLQEAYERHNLGEGKKLSKDEFQKLLQEVLIGAGFTGVGGVKEFLLFIF  120

Query  248  GVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            GVP   +F K R+ PT++ N++FIPAVTSATVFLLAKLNKI
Sbjct  121  GVPALAVFLKNRIAPTSLSNDIFIPAVTSATVFLLAKLNKI  161



>emb|CDY22510.1| BnaC03g23200D [Brassica napus]
Length=161

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 110/163 (67%), Gaps = 7/163 (4%)
 Frame = -2

Query  599  MGQSLKKM-GNdddDMKGRDIQPIIEDCYDKYFVNTEN---WTCADFCHAICQTVEEINT  432
            MGQ+L    GN + + K  D++ + ++CY K     ++   W+  DF   + + VEEIN 
Sbjct  1    MGQALNTAKGNGELNRK--DLETMADNCYRKRLEEQDDDQEWSFGDFYRIVDEAVEEINR  58

Query  431  SVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA-KDILFF  255
             +  TQ++VP  + L  A+  H+ G+GKK+S++EFQK+LQE+++  G TG+G  K+ L F
Sbjct  59   RLGGTQLKVPSVDKLQEAYERHNLGEGKKISKDEFQKLLQEVLIGAGFTGVGGVKEFLLF  118

Query  254  LFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            +FGVP  T+F K R+ PT+ PN++ IPAVTSATVFLLAKLNKI
Sbjct  119  IFGVPALTVFLKNRIAPTSFPNDLLIPAVTSATVFLLAKLNKI  161



>ref|XP_011027232.1| PREDICTED: uncharacterized protein LOC105127579 isoform X2 [Populus 
euphratica]
Length=167

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 115/167 (69%), Gaps = 9/167 (5%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYF---------VNTENWTCADFCHAICQTV  447
            MGQSLKK+    ++ K R+I  IIE  Y+KYF            +  +   F  A+C+ V
Sbjct  1    MGQSLKKLAPGSEENKEREIGHIIESNYEKYFGEEAFKKLAAQEKIISAPYFFRAVCEIV  60

Query  446  EEINTSVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKD  267
            +EIN S++STQI +P  ETL   + ++ +G+GK+L +++FQKI+Q+II+ +G TG G+KD
Sbjct  61   QEINRSLKSTQILLPDDETLREIYRDNFQGQGKRLGKDDFQKIIQQIIIKSGFTGSGSKD  120

Query  266  ILFFLFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
               F+FG+P+ T F KQR+ P ++PNEVFIP VTSA+V+LLAKLNKI
Sbjct  121  TFLFIFGIPLITYFIKQRVAPKSIPNEVFIPGVTSASVYLLAKLNKI  167



>ref|XP_010525473.1| PREDICTED: uncharacterized protein LOC104803261 [Tarenaya hassleriana]
Length=163

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = -2

Query  599  MGQSLK--KMGNdddDMKGRDIQPIIEDCYDKYFVN--TENWTCADFCHAICQTVEEINT  432
            MGQ+L     GN +   K  D++ ++++CY+ +F     + WT  DF  A+ +TVE+IN 
Sbjct  1    MGQALNVNATGNGEKKKKEADLETLLKNCYETHFGGGGEKEWTFGDFYRAVAETVEDIND  60

Query  431  SVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIM-DTGVTGIGAKDILFF  255
            ++  TQ+RVP TE L  A+  H  G+G+KLS+EEFQK+L E+++        G K+ L F
Sbjct  61   NLGGTQLRVPSTEKLREAYERHKIGEGEKLSKEEFQKLLSEVVIGTGFTGVGGVKEFLLF  120

Query  254  LFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            +FGVPV  +F K R+ P +V N++FIPAVTSATVF LAK NKI
Sbjct  121  IFGVPVFAVFLKNRVAPKSVSNDLFIPAVTSATVFFLAKFNKI  163



>ref|XP_002308885.2| hypothetical protein POPTR_0006s03690g [Populus trichocarpa]
 gb|EEE92408.2| hypothetical protein POPTR_0006s03690g [Populus trichocarpa]
Length=214

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 102/164 (62%), Gaps = 21/164 (13%)
 Frame = -2

Query  554  KGRDIQPIIEDCYDKYF---VNTENWTCAD------------------FCHAICQTVEEI  438
            K R+I  IIE  Y+KYF    N +  +  D                  F  A+C+ V+EI
Sbjct  51   KEREIGHIIESKYEKYFGEEANKKMHSAHDPQSSSHEPSKEEITSAPYFIRAVCEIVQEI  110

Query  437  NTSVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILF  258
            N S++STQ+R+P  E L   +  H   KG  L +++FQKI+QE+I+ +G TG G+KD   
Sbjct  111  NISLKSTQLRLPDAENLREIYIKHSLDKGTHLEKDDFQKIIQEVIIHSGFTGFGSKDTFL  170

Query  257  FLFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            F+FG+P+ T F KQR+ P ++PNEVFIP VTSA+V+LLAKLNKI
Sbjct  171  FIFGIPLITYFIKQRVAPKSIPNEVFIPGVTSASVYLLAKLNKI  214



>ref|NP_030665.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD11992.2| expressed protein [Arabidopsis thaliana]
 gb|AAM66052.1| unknown [Arabidopsis thaliana]
 gb|AEC09943.1| uncharacterized protein AT2G41200 [Arabidopsis thaliana]
Length=161

 Score =   145 bits (365),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 105/162 (65%), Gaps = 5/162 (3%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFV---NTENWTCADFCHAICQTVEEINTS  429
            MGQ+L        ++  +D++ + E+CY K      + + W+  DF   + + VEEIN  
Sbjct  1    MGQALN-TAKGKGEVDAKDLEAMAENCYRKRLEEKNDDQEWSFGDFYRIVAEAVEEINRR  59

Query  428  VRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEI-IMDTGVTGIGAKDILFFL  252
            +  TQ++VP  E L +A+  H+ G+GKKLS++EFQK+LQE+ I        G K+ L F+
Sbjct  60   LGGTQLKVPSVEKLQQAYEIHNLGQGKKLSKDEFQKLLQEVLIGVGFTGVGGVKEFLLFI  119

Query  251  FGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            FGVP   +F K R+ PT+VPN++FIPA+TSATVFLLAKLNKI
Sbjct  120  FGVPAIAVFIKNRIAPTSVPNDLFIPAITSATVFLLAKLNKI  161



>ref|XP_011027231.1| PREDICTED: uncharacterized protein LOC105127579 isoform X1 [Populus 
euphratica]
Length=202

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 105/152 (69%), Gaps = 9/152 (6%)
 Frame = -2

Query  554  KGRDIQPIIEDCYDKYF---------VNTENWTCADFCHAICQTVEEINTSVRSTQIRVP  402
            K R+I  IIE  Y+KYF            +  +   F  A+C+ V+EIN S++STQI +P
Sbjct  51   KEREIGHIIESNYEKYFGEEAFKKLAAQEKIISAPYFFRAVCEIVQEINRSLKSTQILLP  110

Query  401  KTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVPVTTLFF  222
              ETL   + ++ +G+GK+L +++FQKI+Q+II+ +G TG G+KD   F+FG+P+ T F 
Sbjct  111  DDETLREIYRDNFQGQGKRLGKDDFQKIIQQIIIKSGFTGSGSKDTFLFIFGIPLITYFI  170

Query  221  KQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            KQR+ P ++PNEVFIP VTSA+V+LLAKLNKI
Sbjct  171  KQRVAPKSIPNEVFIPGVTSASVYLLAKLNKI  202



>ref|XP_006603626.1| PREDICTED: uncharacterized protein LOC100305712 isoform X1 [Glycine 
max]
Length=158

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 105/160 (66%), Gaps = 4/160 (3%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MG SL K+    D  K  ++ PIIE+ Y +   N + ++  +F HA+C+ VE++N  + +
Sbjct  1    MGLSLPKLAPGADKKKHEELVPIIEEIYKEKVKNAKEFS--EFYHAVCEIVEQLNEKLGN  58

Query  419  TQIRVPKTETLDRAFHNH--HKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFG  246
            TQI++P+T+ +++ +     +    K L++ EFQ+I+Q ++  +G TGIGAK+ +  +FG
Sbjct  59   TQIKLPETKAIEKEYRRRGDNDTDKKPLTKAEFQEIMQNLVKTSGFTGIGAKEAILCIFG  118

Query  245  VPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            VP+  LF KQR+ P AV +E FIP VTSATVF LA LNKI
Sbjct  119  VPLAALFIKQRVMPEAVRDEFFIPGVTSATVFTLAALNKI  158



>ref|NP_001235645.1| uncharacterized protein LOC100305712 [Glycine max]
 gb|ACU13538.1| unknown [Glycine max]
 gb|KHN08875.1| hypothetical protein glysoja_029452 [Glycine soja]
Length=159

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 104/161 (65%), Gaps = 5/161 (3%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MG SL K+    D  K  ++ PIIE+ Y +   N + ++  +F HA+C+ VE++N  + +
Sbjct  1    MGLSLPKLAPGADKKKHEELVPIIEEIYKEKVKNAKEFS--EFYHAVCEIVEQLNEKLGN  58

Query  419  TQIRVPKTETLDRAFHNHHKGKG---KKLSREEFQKILQEIIMDTGVTGIGAKDILFFLF  249
            TQI++P+T+ +++ +           K L++ EFQ+I+Q ++  +G TGIGAK+ +  +F
Sbjct  59   TQIKLPETKAIEKEYRKRRGDNDTDKKPLTKAEFQEIMQNLVKTSGFTGIGAKEAILCIF  118

Query  248  GVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            GVP+  LF KQR+ P AV +E FIP VTSATVF LA LNKI
Sbjct  119  GVPLAALFIKQRVMPEAVRDEFFIPGVTSATVFTLAALNKI  159



>ref|XP_006295949.1| hypothetical protein CARUB_v10025091mg, partial [Capsella rubella]
 gb|EOA28847.1| hypothetical protein CARUB_v10025091mg, partial [Capsella rubella]
Length=140

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = -2

Query  446  EEINTSVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA-K  270
            EEIN  +  TQI+VP  + L  A+  H+ G+GKKLS++EFQK+LQE+++  G TG+G  K
Sbjct  33   EEINRRLGGTQIKVPSVDQLQDAYKIHNLGEGKKLSKDEFQKLLQEVLIGAGFTGVGGIK  92

Query  269  DILFFLFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            + L F+FGVPV  +F K R+ PT++ N+VFIPAVTSATVFLLAKLNKI
Sbjct  93   EFLLFIFGVPVLAVFLKNRIAPTSITNDVFIPAVTSATVFLLAKLNKI  140



>ref|XP_010312050.1| PREDICTED: uncharacterized protein LOC104644355 [Solanum lycopersicum]
Length=166

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 86/132 (65%), Gaps = 5/132 (4%)
 Frame = -2

Query  521  CYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKGKKL  342
            CYDKYF      T ADF H+IC  VEEIN     TQ ++P T  + R +  H   KGKK+
Sbjct  40   CYDKYF----RTTMADFYHSICDAVEEINRRKGRTQFKIPSTAAIRRVYLKHSV-KGKKM  94

Query  341  SREEFQKILQEIIMDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTAVPNEVFIPAVTS  162
            ++E+F   + E+  ++G+TG GAK+ L++LFGVP T LF K ++ P A+ +  FIP VTS
Sbjct  95   TKEKFGLCMHELYGESGITGFGAKETLYYLFGVPATALFIKNKIKPQAISDNDFIPGVTS  154

Query  161  ATVFLLAKLNKI  126
            ATV +L+K NKI
Sbjct  155  ATVLILSKFNKI  166



>ref|XP_007162097.1| hypothetical protein PHAVU_001G123700g [Phaseolus vulgaris]
 gb|ESW34091.1| hypothetical protein PHAVU_001G123700g [Phaseolus vulgaris]
Length=208

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = -2

Query  602  NMGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVR  423
             MG SL+K+    D  K ++++PII++ Y + F +  +     F  A+C+ VE++N  + 
Sbjct  45   KMGLSLQKLAPGADQKKLKELEPIIDEGYKELFQDKGSIEFPVFYRAVCEIVEKLNEKLG  104

Query  422  STQIRVPKTETLDRAFHNHHK-----GKGKKLSREEFQKILQEIIMDTGVTGIGAKDILF  258
            +TQI++P T+ L+  F+         GK K L++ EFQ+I++ ++  +G TGIGAK+ + 
Sbjct  105  NTQIKLPATKDLETEFNKRENEKSKTGKNKALTKTEFQEIMKNLVKTSGFTGIGAKEAIL  164

Query  257  FLFGVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
             +FGVP+  L  KQ++ P A+ +E FIP VTSATVF LA LNKI
Sbjct  165  CIFGVPLAALLIKQKVMPEAIRDEYFIPGVTSATVFTLAALNKI  208



>ref|XP_003521131.1| PREDICTED: uncharacterized protein LOC100780601 [Glycine max]
 gb|KHN30366.1| hypothetical protein glysoja_025857 [Glycine soja]
Length=159

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 103/161 (64%), Gaps = 5/161 (3%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MG SL K+    D  K  ++ PII++ Y++   + + ++  +F HA+C+ VE++N  + +
Sbjct  1    MGLSLPKLAPGADKKKLEELGPIIDEIYEEKVKDAKKFS--EFYHAVCEIVEQLNEKLGN  58

Query  419  TQIRVPKTETLDRAFHNHHKGKG---KKLSREEFQKILQEIIMDTGVTGIGAKDILFFLF  249
            TQI++P+T+ +++ +           K L++ EFQ+I+Q ++  +G TGIGAK+ +  +F
Sbjct  59   TQIKLPETKAIEKEYRKRRGDDDTNKKPLAKAEFQEIMQNLVKTSGFTGIGAKEAILCIF  118

Query  248  GVPVTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            GVP+  L  KQR+ P  V +E FIP VTSATVF LA LNKI
Sbjct  119  GVPLAALLIKQRVMPEVVRDEFFIPGVTSATVFTLAALNKI  159



>ref|XP_010653970.1| PREDICTED: uncharacterized protein LOC104880136 [Vitis vinifera]
 emb|CBI30122.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 91/158 (58%), Gaps = 4/158 (3%)
 Frame = -2

Query  599  MGQSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRS  420
            MG SL K+       +  + + +I++ Y+++  + +     +F  A+C+TVE+IN     
Sbjct  1    MGASLMKL---TPAGRNEEKKRLIQEYYNEHCKDIDINKPNEFYQAVCKTVEKINREFGY  57

Query  419  TQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVP  240
            TQIR+P T+ ++R F+ H +  G  LS + F++IL+ ++   G T  GA D  F++   P
Sbjct  58   TQIRIPDTDEMERLFNAHVESSGT-LSPDSFREILRSLVFKAGFTNAGALDSFFYILIAP  116

Query  239  VTTLFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
             T L  K  + P A+ N+V +P VTSATV LLA L KI
Sbjct  117  GTALLIKNAVNPKAISNQVLVPGVTSATVLLLALLKKI  154



>emb|CDY23867.1| BnaC04g01700D [Brassica napus]
Length=99

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 66/95 (69%), Gaps = 7/95 (7%)
 Frame = -2

Query  407  VPKTETLDRAFHNHHKGKGKKLSREEFQKILQEIIMDTGVTGIGA-KDILFFLFGVPVTT  231
            VP  + L  A+       GKK+ +EEFQK+LQ++++  G TG+G  K+ L F+FGVP   
Sbjct  11   VPSVDNLQEAYE------GKKIPKEEFQKLLQDVLIGAGFTGVGGIKEFLLFIFGVPAFA  64

Query  230  LFFKQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            +F K R+ PT +PN++F PAVTSATVFLLAKL KI
Sbjct  65   VFLKNRIGPTFIPNDLFTPAVTSATVFLLAKLKKI  99



>dbj|BAF01549.1| hypothetical protein [Arabidopsis thaliana]
Length=86

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = -2

Query  368  HHKGKGKKLSREEFQKILQEI-IMDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTAVP  192
            H+ G+GKKLS++EFQK+LQE+ I        G K+ L F+FGVP   +F K R+ PT+VP
Sbjct  5    HNLGQGKKLSKDEFQKLLQEVLIGVGFTGVGGVKEFLLFIFGVPAIAVFIKNRIAPTSVP  64

Query  191  NEVFIPAVTSATVFLLAKLNKI  126
            N++FIPA+TSATVFLLAKLNKI
Sbjct  65   NDLFIPAITSATVFLLAKLNKI  86



>ref|XP_009403152.1| PREDICTED: uncharacterized protein LOC103986784 [Musa acuminata 
subsp. malaccensis]
Length=164

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 86/143 (60%), Gaps = 6/143 (4%)
 Frame = -2

Query  545  DIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNH  366
            D+  +I   YD  F N   +   DF  A+ + +E+++ S  + Q+++P ++ L  AF  H
Sbjct  25   DLVELINQHYDSCFKNVTEFD--DFYRALHEIMEKLSESKGAIQLKLPSSDALKSAFEKH  82

Query  365  HKGKGKKLSREEFQKILQEII-MDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTA--V  195
            H  + K L +EEF+ I++++I  ++   G GA + +FF+FGVP+ T F K R  P    V
Sbjct  83   HPRENKALLKEEFKNIIKDVITFESFSMGKGALETIFFIFGVPICTFFLK-RFIPGGARV  141

Query  194  PNEVFIPAVTSATVFLLAKLNKI  126
             +++ IPAVTS TV LLAK NK+
Sbjct  142  SDDILIPAVTSGTVILLAKTNKL  164



>ref|XP_003568551.2| PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase 
MGP4-like [Brachypodium distachyon]
Length=585

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 68/120 (57%), Gaps = 4/120 (3%)
 Frame = -2

Query  476  DFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEII-M  300
            DF HAI   VE+        Q ++P  E L+RA+ N H+  GK L+REEF KI + II +
Sbjct  467  DFYHAIHDMVEKFCEERGQLQYKIPPREELERAYKNVHRKDGKNLTREEFMKITENIIKV  526

Query  299  DTGVTGIGAKDILFFLFGVPVTTLFFKQRLFP--TAVPNEVFIPAVTSATVFLLAKLNKI  126
            D+   G  A D+L  LFG PV  LF K R+ P   +  ++V IP  TS  V  LAK NK+
Sbjct  527  DSFTFGKAAIDVLMVLFGAPVCALFIK-RVIPGLKSFSDDVVIPVATSGAVVYLAKTNKL  585



>ref|XP_010926994.1| PREDICTED: uncharacterized protein LOC105049130 [Elaeis guineensis]
Length=159

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 94/165 (57%), Gaps = 13/165 (8%)
 Frame = -2

Query  599  MGQSLKKM----GNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINT  432
            MGQ++ K     G +    K  D+  I E+ Y+K+ +   +    +F H     +E++N 
Sbjct  1    MGQAIPKFRKGDGKEQTSTKPPDLSAIWEEEYNKFTLEKFD----EFYHQFYSIIEKLNE  56

Query  431  SVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEII-MDTGVTGIGAKDILFF  255
               + Q ++PK + L +AF  +H GKG  L++EEF+KI+ E+I +++   G  A D+L F
Sbjct  57   KGGAMQFKLPKKDDLKKAFERYHPGKGT-LTKEEFKKIMGEVIQLESFHVGKRAVDVLLF  115

Query  254  LFGVPVTTLFFKQRLFPTA--VPNEVFIPAVTSATVFLLAKLNKI  126
            LFGVPV +L  K R+ P A  +P ++ IP  TS TV  L K +++
Sbjct  116  LFGVPVVSLLAK-RVIPGAESIPEDILIPVATSGTVVFLTKTHRL  159



>emb|CDX79950.1| BnaA05g02060D [Brassica napus]
Length=87

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 59/92 (64%), Gaps = 15/92 (16%)
 Frame = -2

Query  398  TETLDRAFH-NHHKGKGKKLSREEFQKILQEIIMDTGVTGIGAKDILFFLFGVPVTTLFF  222
             + L  A+   H+ G+G K+ +EEFQK+LQ+               LFF+FGVP   +F 
Sbjct  10   VDNLQEAYEVKHNLGEGNKIPKEEFQKLLQKF--------------LFFIFGVPSFAVFL  55

Query  221  KQRLFPTAVPNEVFIPAVTSATVFLLAKLNKI  126
            K R+  T++PN++FIPAVTSAT FLLAKLNKI
Sbjct  56   KNRIALTSIPNDLFIPAVTSATAFLLAKLNKI  87



>gb|AFW81585.1| hypothetical protein ZEAMMB73_443698 [Zea mays]
Length=179

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 83/162 (51%), Gaps = 9/162 (6%)
 Frame = -2

Query  593  QSLKKMGNdddDMKGRDIQPIIE---DCYDKYFVNTENWTCADFCHAICQTVEEINTSVR  423
            +S +K  +    +K  D   +IE     YD    + + +   DF HAI + +E+      
Sbjct  21   KSPEKKNDGKKALKSSDADALIEFMRKNYDSKVKDVKEFD--DFYHAIYELIEKFCEERG  78

Query  422  STQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEII-MDTGVTGIGAKDILFFLFG  246
              Q R+P  + L   +   H GKG+ ++ +EF+ I + I+ +D+   G  A DIL  LFG
Sbjct  79   QLQYRIPPKDELKEKYERFHTGKGRNVTAQEFESIARAILKIDSFTFGKAAIDILVVLFG  138

Query  245  VPVTTLFFKQRLFP--TAVPNEVFIPAVTSATVFLLAKLNKI  126
            VPV  L  K R+ P   A+ +++ IPA TS  V  LAK NK+
Sbjct  139  VPVCALLTK-RIVPGLNAISDDIVIPAATSGAVVYLAKSNKL  179



>ref|XP_002439725.1| hypothetical protein SORBIDRAFT_09g019080 [Sorghum bicolor]
 gb|EES18155.1| hypothetical protein SORBIDRAFT_09g019080 [Sorghum bicolor]
Length=174

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 76/147 (52%), Gaps = 6/147 (4%)
 Frame = -2

Query  554  KGRDIQPIIEDCYDKYFVNTENWTCAD-FCHAICQTVEEINTSVRSTQIRVPKTETLDRA  378
            K  D   +IE     Y    +N T  D F HAI   +E+        Q R+P  + L + 
Sbjct  30   KSSDANALIEFMKKNYDAKVKNVTEFDEFYHAIYDLIEKFCEQRGQLQYRIPSKDDLKKK  89

Query  377  FHNHHKGKGKKLSREEFQKILQEII-MDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFP-  204
            + + H+ +G  ++ EEF+KI +EI+ +D+   G  A D+L  LFG PV  L  K R+ P 
Sbjct  90   YQDFHRARGN-VTAEEFEKIAREILKIDSFTFGKAAIDMLVILFGAPVCALLAK-RVVPG  147

Query  203  -TAVPNEVFIPAVTSATVFLLAKLNKI  126
              A+ +++ IPA TS  V  L K NKI
Sbjct  148  LKAISDDIVIPAATSGAVVYLVKSNKI  174



>ref|NP_001143546.1| uncharacterized protein LOC100276236 [Zea mays]
 gb|ACG32960.1| hypothetical protein [Zea mays]
Length=179

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 81/162 (50%), Gaps = 9/162 (6%)
 Frame = -2

Query  593  QSLKKMGNdddDMKGRDIQPIIE---DCYDKYFVNTENWTCADFCHAICQTVEEINTSVR  423
            +S +K  +    +K  D   +IE     YD    + + +   DF HAI + +E+      
Sbjct  21   KSPEKKNDGKKALKSSDADALIEFMRKNYDSKVKDVKEFD--DFYHAIYELIEKFCEERG  78

Query  422  STQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEII-MDTGVTGIGAKDILFFLFG  246
              Q R+P  + L   +   H GKG+ ++ +EF+ I + I+ +D+   G    D L  LFG
Sbjct  79   QLQYRIPPKDELKEKYERFHTGKGRNVTAQEFENIARAILKIDSFTFGKATIDTLVILFG  138

Query  245  VPVTTLFFKQRLFP--TAVPNEVFIPAVTSATVFLLAKLNKI  126
            VPV  L  K R+ P   A+ +++ IPA TS  V  LAK NK+
Sbjct  139  VPVCALLTK-RIVPGLNAISDDIVIPAATSGAVVYLAKSNKL  179



>gb|EEE56023.1| hypothetical protein OsJ_04805 [Oryza sativa Japonica Group]
Length=194

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 74/138 (54%), Gaps = 7/138 (5%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKG  351
            +E  Y+KY  N +++   DF HAI + +E+        Q ++P  + L  A+  HH  +G
Sbjct  61   MEANYEKYVANVDSFE--DFYHAIVELIEKFCEERGQVQYKIPSKKALKEAYEKHHTEQG  118

Query  350  KKLSREEFQKILQEIIM-DTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTA--VPNEVF  180
            + L REEF KI +E+I  D+   G    D + +LFG P+  L  K R+ P    + ++V 
Sbjct  119  Q-LKREEFIKIGKEVIRRDSFTLGKATMDFIMYLFGAPLCALAAK-RILPGLRWISDDVA  176

Query  179  IPAVTSATVFLLAKLNKI  126
            IP  TSA+V  L +  ++
Sbjct  177  IPLATSASVAYLIRTKQL  194



>gb|EEC72182.1| hypothetical protein OsI_05251 [Oryza sativa Indica Group]
Length=194

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 74/138 (54%), Gaps = 7/138 (5%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKG  351
            +E  Y+KY  N +++   DF HAI + +E+        Q ++P  + L  A+  HH  +G
Sbjct  61   MEANYEKYVANVDSFE--DFYHAIVELIEKFCEERGQVQYKIPSKKALKEAYEKHHTEQG  118

Query  350  KKLSREEFQKILQEIIM-DTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTA--VPNEVF  180
            + L REEF KI +E+I  D+   G    D + +LFG P+  L  K R+ P    + ++V 
Sbjct  119  Q-LKREEFIKIGKEVIRRDSFTLGKATMDFIMYLFGAPLCALAAK-RILPGLRWISDDVA  176

Query  179  IPAVTSATVFLLAKLNKI  126
            IP  TSA+V  L +  ++
Sbjct  177  IPLATSASVAYLIRTKQL  194



>ref|XP_008803355.1| PREDICTED: uncharacterized protein LOC103716929 [Phoenix dactylifera]
Length=163

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 76/136 (56%), Gaps = 6/136 (4%)
 Frame = -2

Query  524  DCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKGKK  345
            + + K+    E     DF H +   +E++N    + Q ++P+   L++ F +H K     
Sbjct  31   EDFKKFEDGQELKVFEDFYHQLYMVIEKLNEKGGAMQFKLPEKTELEKKFRSHWKTG--T  88

Query  344  LSREEFQKILQEII-MDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFP--TAVPNEVFIP  174
            L +EEF+KI++E+  +++   G GA++ + FLFG+P+  L F +RL P   ++  +V IP
Sbjct  89   LGKEEFKKIMEELFQLESFTIGSGAREGIAFLFGIPIVAL-FARRLVPGFQSISEDVVIP  147

Query  173  AVTSATVFLLAKLNKI  126
              T+ T  +L K+ ++
Sbjct  148  VATAGTAVILTKIGRL  163



>ref|XP_004962240.1| PREDICTED: uncharacterized protein LOC101770256 [Setaria italica]
Length=175

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 64/119 (54%), Gaps = 4/119 (3%)
 Frame = -2

Query  473  FCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKGKKLSREEFQKILQEII-MD  297
            F HAI + +E         Q R+P    L++ ++  H      L+ E+F+KI   I+ MD
Sbjct  58   FYHAIYELIERFCEERGQLQYRIPTKAELEKQYYKAHPSGTANLTPEQFEKIATGILKMD  117

Query  296  TGVTGIGAKDILFFLFGVPVTTLFFKQRLFP--TAVPNEVFIPAVTSATVFLLAKLNKI  126
            +   G  A DIL FLFG+PV  L  K R+ P   ++ +++ IPA TS  V  LAK NK+
Sbjct  118  SFTFGRAAVDILAFLFGLPVCALLAK-RVVPGLKSISDDIVIPAATSGAVIYLAKSNKL  175



>dbj|BAD88269.1| hypothetical protein [Oryza sativa Japonica Group]
Length=391

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 74/138 (54%), Gaps = 7/138 (5%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKG  351
            +E  Y+KY  N +++   DF HAI + +E+        Q ++P  + L  A+  HH  +G
Sbjct  258  MEANYEKYVANVDSFE--DFYHAIVELIEKFCEERGQVQYKIPSKKALKEAYEKHHTEQG  315

Query  350  KKLSREEFQKILQEIIM-DTGVTGIGAKDILFFLFGVPVTTLFFKQRLFP--TAVPNEVF  180
            + L REEF KI +E+I  D+   G    D + +LFG P+  L  K R+ P    + ++V 
Sbjct  316  Q-LKREEFIKIGKEVIRRDSFTLGKATMDFIMYLFGAPLCALAAK-RILPGLRWISDDVA  373

Query  179  IPAVTSATVFLLAKLNKI  126
            IP  TSA+V  L +  ++
Sbjct  374  IPLATSASVAYLIRTKQL  391



>gb|EMS47763.1| hypothetical protein TRIUR3_23306 [Triticum urartu]
Length=176

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 67/138 (49%), Gaps = 6/138 (4%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKG  351
            +E  YD++    +++   DF HAI + +++        Q R+P  E L   +  HHK   
Sbjct  42   MESKYDEHVAKVDSFD--DFYHAIYELIQKFCEERGQVQYRIPPREKLQEVYTKHHKAGS  99

Query  350  KKLSREEFQKILQEII-MDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTA--VPNEVF  180
             ++ REEF K+  E++  D+   G    ++L FLFG P+  L  K R+ P    + ++  
Sbjct  100  GEVKREEFAKMSGELVKRDSFSFGKATTELLMFLFGAPMCALVAK-RVLPGLGWLSDDTV  158

Query  179  IPAVTSATVFLLAKLNKI  126
            IP  TS  V  L    K+
Sbjct  159  IPLATSGAVAFLVHTKKL  176



>gb|EAY97882.1| hypothetical protein OsI_19801 [Oryza sativa Indica Group]
Length=173

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 77/161 (48%), Gaps = 6/161 (4%)
 Frame = -2

Query  593  QSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQ  414
            Q+  K G D+   K +D + + +     Y +  +  +  DF HA  + +E+        Q
Sbjct  14   QAENKTGKDEKVAKPKDAKDLTDFMEKNYHLIKDVTSFEDFYHAFYELIEKFCEERGQLQ  73

Query  413  IRVPKTETLDRAFH--NHHKGKGKKLSREEFQKILQEIIMDTGVT-GIGAKDILFFLFGV  243
             R+P+   L + +   N    KG+ LSR++F ++  ++I     T G    D+L  LFG 
Sbjct  74   YRIPEKAELQKQYERVNKSPQKGQNLSRKQFMELAGQVIKVNSFTFGKATMDVLVVLFGA  133

Query  242  PVTTLFFKQRLFP--TAVPNEVFIPAVTSATVFLLAKLNKI  126
            PV  L  K R+ P   +  ++V IP  TS  V  LAK NK+
Sbjct  134  PVCALLAK-RVVPGLKSFSDDVVIPVATSGAVVYLAKTNKL  173



>ref|XP_006654346.1| PREDICTED: uncharacterized protein LOC102712909 [Oryza brachyantha]
Length=173

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 65/122 (53%), Gaps = 6/122 (5%)
 Frame = -2

Query  476  DFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHK-GK-GKKLSREEFQKILQEII  303
            DF H   + +E         Q R+PK + L+R +   +K GK G  LSR++F +I  ++I
Sbjct  53   DFYHVFYELIENFCEERGQLQYRIPKKDELERQYEKVNKNGKPGVNLSRKQFMEIAGQVI  112

Query  302  -MDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFP--TAVPNEVFIPAVTSATVFLLAKLN  132
             +++   G    D+L  LFG PV  L  K R+ P   +  ++V IPA TS  V  LAK N
Sbjct  113  KVNSFAFGKATMDVLVVLFGAPVCALLAK-RVVPGLKSFSDDVVIPAATSGAVVYLAKAN  171

Query  131  KI  126
            K+
Sbjct  172  KL  173



>gb|AAV31335.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG86961.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63578.1| hypothetical protein OsJ_18395 [Oryza sativa Japonica Group]
Length=173

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 80/162 (49%), Gaps = 8/162 (5%)
 Frame = -2

Query  593  QSLKKMGNdddDMKGRDIQPIIEDCYDKYFVNTENWTC-ADFCHAICQTVEEINTSVRST  417
            Q+  K G D+   K +D + +  D  +K + + ++ T   DF HA  + +E+        
Sbjct  14   QAENKTGKDEKVAKPKDAKDLT-DFMEKNYDSIKDVTSFEDFYHAFYELIEKFCEERGQL  72

Query  416  QIRVPKTETLDRAFH--NHHKGKGKKLSREEFQKILQEIIMDTGVT-GIGAKDILFFLFG  246
            Q R+P+   L + +   N    KG+ LSR++F ++  ++I     T G    D+L  LFG
Sbjct  73   QYRIPEKAELQKQYERVNKSPQKGQNLSRKQFMELAGQVIKVNSFTFGKATMDVLVVLFG  132

Query  245  VPVTTLFFKQRLFP--TAVPNEVFIPAVTSATVFLLAKLNKI  126
             PV  L  K R+ P   +  ++V IP  TS  V  LAK NK+
Sbjct  133  APVCALLAK-RVVPGLKSFSDDVVIPVATSGAVVYLAKTNKL  173



>dbj|BAJ92066.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=181

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 65/138 (47%), Gaps = 6/138 (4%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKG  351
            +E  Y+ +    +++   DF HAI + ++         Q R+P    L   +  HHK   
Sbjct  47   MEKKYEDHVAKVDSFE--DFYHAIYELIQMFCEERGQVQYRIPAKAKLQEVYARHHKAGS  104

Query  350  KKLSREEFQKILQEII-MDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTA--VPNEVF  180
             ++ REEF ++  E++  D+   G    ++L FLFGVPV  L  K R+ P    V ++  
Sbjct  105  GEVKREEFARMSGELVRRDSFSFGKATTELLMFLFGVPVCALVAK-RVLPGLGWVSDDTV  163

Query  179  IPAVTSATVFLLAKLNKI  126
            IP  TS  V  L    K+
Sbjct  164  IPLATSGAVAYLVHSKKL  181



>ref|XP_004971310.1| PREDICTED: uncharacterized protein LOC101757594 [Setaria italica]
Length=174

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 71/138 (51%), Gaps = 7/138 (5%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKG  351
            +E  YD++    +  T  +F HAI + +E         Q R+P+   L+ A+  HH+ +G
Sbjct  41   MESHYDEFVARVQ--TFDEFYHAIFELIEMFCEERGQLQYRIPEKRILEDAYKKHHRSEG  98

Query  350  KKLSREEFQKILQEII-MDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTA--VPNEVF  180
             +L ++EF +I +E++ M++   G    +   FLFG P    F  +R+ P    + +++ 
Sbjct  99   -ELKKDEFVEISKEVLKMESFTFGKATMEFAMFLFGAPACA-FLAKRILPGLGWLSDDIV  156

Query  179  IPAVTSATVFLLAKLNKI  126
            IP  TS +V  L K  ++
Sbjct  157  IPLATSGSVAYLIKSKRL  174



>emb|CDM86593.1| unnamed protein product [Triticum aestivum]
Length=180

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 65/134 (49%), Gaps = 7/134 (5%)
 Frame = -2

Query  518  YDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKGKKLS  339
            YD++    +++   DF HAI + +++        Q R+P  E L   +  HH   G+ + 
Sbjct  51   YDEHVAKVDSFD--DFYHAIYELIQKFCEERGQVQYRIPPREKLQEVYKKHHTSGGE-VK  107

Query  338  REEFQKILQEII-MDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFPTA--VPNEVFIPAV  168
            REEF K+  E++  D+   G    ++L FLFG P+  L  K R+ P    V ++  IP  
Sbjct  108  REEFAKMSGELVKRDSFSFGKATTELLMFLFGAPMCALVAK-RVLPGLGWVSDDTVIPLA  166

Query  167  TSATVFLLAKLNKI  126
            TS  V  L    K+
Sbjct  167  TSGAVAYLVHSKKL  180



>ref|XP_002456954.1| hypothetical protein SORBIDRAFT_03g046250 [Sorghum bicolor]
 gb|EES02074.1| hypothetical protein SORBIDRAFT_03g046250 [Sorghum bicolor]
Length=186

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 72/140 (51%), Gaps = 11/140 (8%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKG  351
            +ED YD      +++   +F HAI + +E         Q R+ + +TL+ A++ HH+  G
Sbjct  53   MEDHYDDVVARVQSFD--EFYHAIFELIEMFCEERGQLQYRIAEKKTLEEAYNKHHRSDG  110

Query  350  KKLSREEFQKILQEIIMDTGVT---GIGAKDILFFLFGVPVTTLFFKQRLFPTA--VPNE  186
              +++EEF  + +E++  TG +   G  + ++   LFG P   L  K R+ P    + ++
Sbjct  111  -NVTKEEFDAMSREVV--TGGSFRVGKASVELGMLLFGAPACALLAK-RILPGLGWLSDD  166

Query  185  VFIPAVTSATVFLLAKLNKI  126
            V +P  TS +V  L K  ++
Sbjct  167  VVVPLATSGSVAYLIKSKRL  186



>gb|AFW83927.1| hypothetical protein ZEAMMB73_014299 [Zea mays]
Length=134

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/138 (27%), Positives = 70/138 (51%), Gaps = 7/138 (5%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKG  351
            +ED YD      +++   +F HAI + +E         Q R+ + + L+ A++ HH+  G
Sbjct  1    MEDHYDDVVARVQSFD--EFYHAIFELIEMFCEERGQLQYRLAEKKALEEAYNKHHRSDG  58

Query  350  KKLSREEFQKILQEIIMDTGV-TGIGAKDILFFLFGVPVTTLFFKQRLFPTA--VPNEVF  180
             K+++EEF+ + +E++       G  + ++   LFG P   L  K R+ P    + ++V 
Sbjct  59   -KVTKEEFEAMSREVVKAGSFRVGKASLELGALLFGAPACALLAK-RILPGLGWLSDDVV  116

Query  179  IPAVTSATVFLLAKLNKI  126
            +P  TS +V  L K  ++
Sbjct  117  VPLATSGSVAYLIKSKRL  134



>ref|NP_001144000.1| uncharacterized protein LOC100276819 [Zea mays]
 gb|ACG37077.1| hypothetical protein [Zea mays]
Length=194

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/138 (27%), Positives = 70/138 (51%), Gaps = 7/138 (5%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHNHHKGKG  351
            +ED YD      +++   +F HAI + +E         Q R+ + + L+ A++ HH+  G
Sbjct  61   MEDHYDDVVARVQSFD--EFYHAIFELIEMFCEERGQLQYRLAEKKALEEAYNKHHRSDG  118

Query  350  KKLSREEFQKILQEIIMDTGV-TGIGAKDILFFLFGVPVTTLFFKQRLFPTA--VPNEVF  180
             K+++EEF+ + +E++       G  + ++   LFG P   L  K R+ P    + ++V 
Sbjct  119  -KVTKEEFEAMSREVVKAGSFRVGKASLELGALLFGAPACALLAK-RILPGLGWLSDDVV  176

Query  179  IPAVTSATVFLLAKLNKI  126
            +P  TS +V  L K  ++
Sbjct  177  VPLATSGSVAYLIKSKRL  194



>dbj|BAK02859.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=175

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 71/139 (51%), Gaps = 7/139 (5%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVRSTQIRVPKTETLDRAFHN-HHKGK  354
            +++ YD    + E +    F HAI + +E+        Q R+P    L+R +    +K  
Sbjct  40   MDNHYDDIVKSAETFD--QFYHAIFELIEKFCEEQGQLQYRMPSKVDLEREYKALKNKKD  97

Query  353  GKKLSREEFQKILQEII-MDTGVTGIGAKDILFFLFGVPVTTLFFKQRLFP--TAVPNEV  183
            G  L++++F +I  +++ +++   G  A D+L  LFG P+  L  K R+ P   +  ++V
Sbjct  98   GVDLTKDQFHEITSKLVTVNSFSFGKAAFDVLVVLFGAPMCALLVK-RVVPGLKSFSDDV  156

Query  182  FIPAVTSATVFLLAKLNKI  126
             IP  TS  V  LA+ NK+
Sbjct  157  VIPVATSGAVVYLARANKL  175



>gb|EMT28264.1| hypothetical protein F775_11895 [Aegilops tauschii]
Length=195

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 66/155 (43%), Gaps = 23/155 (15%)
 Frame = -2

Query  530  IEDCYDKYFVNTENWTCADFCHAICQTVEEINTSVR-----------------STQIRVP  402
            +E  YD +    +++   DF HAI + +    + +                    Q R+P
Sbjct  44   MEKKYDDHVAKVDSFD--DFYHAIYELIHSFPSFIHFIITAEPSFRKFCEERGQVQYRIP  101

Query  401  KTETLDRAFHNHHKGKGKKLSREEFQKILQEII-MDTGVTGIGAKDILFFLFGVPVTTLF  225
              E L   +  HHK    ++ REEF K+  E++  D+   G    ++L FLFG P+  L 
Sbjct  102  PREKLQEVYTKHHKAGSGEVKREEFAKMSGELVKRDSFSFGKATTELLMFLFGAPMCALV  161

Query  224  FKQRLFPTA--VPNEVFIPAVTSATVFLLAKLNKI  126
             K R+ P    + ++  IP  TS  V  L    K+
Sbjct  162  AK-RVLPGLGWLSDDTVIPLATSGAVAFLVHTKKL  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 826660453344