BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c36637_g1_i1 len=609 path=[1:0-608]

Length=609
                                                                      Score     E

ref|XP_009601197.1|  PREDICTED: 18 kDa seed maturation protein-like     101   1e-23   
ref|XP_009757567.1|  PREDICTED: 18 kDa seed maturation protein-like   91.3    1e-19   
ref|NP_001234942.1|  seed maturation protein                          85.1    2e-17   
gb|ABB72407.1|  seed maturation protein                               84.0    5e-17   Glycine latifolia
gb|ABB72406.1|  seed maturation protein                               84.0    6e-17   Glycine canescens
gb|ABB72405.1|  seed maturation protein                               84.0    6e-17   Glycine canescens
gb|ABB72412.1|  seed maturation protein                               83.6    8e-17   Glycine tabacina
gb|ABB72418.1|  seed maturation protein                               83.2    1e-16   Glycine tomentella [wooly glycine]
gb|ABB72414.1|  seed maturation protein                               83.2    1e-16   Glycine tomentella [wooly glycine]
gb|ABB72413.1|  seed maturation protein                               83.2    1e-16   Glycine tabacina
gb|ABB72415.1|  seed maturation protein                               82.8    2e-16   Glycine tomentella [wooly glycine]
gb|ABB72427.1|  seed maturation protein                               82.0    3e-16   Glycine tomentella [wooly glycine]
gb|ABB72430.1|  seed maturation protein                               82.0    3e-16   Glycine tomentella [wooly glycine]
gb|ABB72420.1|  seed maturation protein                               80.5    1e-15   Glycine tomentella [wooly glycine]
gb|ABW91070.1|  LEA                                                   76.6    3e-14   Dorcoceras hygrometricum
gb|ABB72375.1|  seed maturation protein                               76.3    4e-14   Glycine tomentella [wooly glycine]
gb|ABB72372.1|  seed maturation protein                               75.9    5e-14   Glycine tomentella [wooly glycine]
gb|AAZ20279.1|  lea protein 2                                         75.5    5e-14   Arachis hypogaea [goober]
gb|ABB72382.1|  seed maturation protein                               74.7    1e-13   Glycine tomentella [wooly glycine]
gb|ABB72383.1|  seed maturation protein                               74.7    1e-13   Glycine tomentella [wooly glycine]
gb|ABB72370.1|  seed maturation protein                               74.3    2e-13   Glycine tomentella [wooly glycine]
gb|ABB72376.1|  seed maturation protein                               74.3    2e-13   Glycine tomentella [wooly glycine]
ref|XP_006361178.1|  PREDICTED: uncharacterized protein LOC102606032  73.9    2e-13   
gb|ABB72377.1|  seed maturation protein                               73.9    2e-13   Glycine tomentella [wooly glycine]
gb|ABB72369.1|  seed maturation protein                               73.9    3e-13   Glycine tabacina
gb|ABB72368.1|  seed maturation protein                               73.9    3e-13   Glycine tabacina
gb|KFK44995.1|  hypothetical protein AALP_AA1G330500                  73.9    4e-13   
gb|ABB72379.1|  seed maturation protein                               72.4    9e-13   Glycine tomentella [wooly glycine]
gb|ABB72366.1|  seed maturation protein                               71.6    2e-12   Glycine soja [wild soybean]
ref|NP_001237410.1|  seed maturation protein                          71.2    2e-12   
gb|ABB72363.1|  seed maturation protein                               71.2    2e-12   Glycine canescens
gb|ABB72362.1|  seed maturation protein                               71.2    2e-12   Glycine canescens
gb|ABB72371.1|  seed maturation protein                               70.9    3e-12   Glycine tomentella [wooly glycine]
emb|CDP13001.1|  unnamed protein product                              70.5    4e-12   
ref|XP_006415174.1|  hypothetical protein EUTSA_v10009848mg           70.9    5e-12   
ref|XP_007210854.1|  hypothetical protein PRUPE_ppa015214mg           67.4    2e-11   
gb|ABB72364.1|  seed maturation protein                               68.2    3e-11   Glycine latifolia
ref|XP_004241969.1|  PREDICTED: protein LE25                          67.8    3e-11   
emb|CDY66058.1|  BnaA08g30040D                                        67.4    5e-11   
ref|XP_002519834.1|  conserved hypothetical protein                   67.0    6e-11   Ricinus communis
gb|KDP29011.1|  hypothetical protein JCGZ_19500                       66.6    8e-11   
ref|XP_009107977.1|  PREDICTED: 18 kDa seed maturation protein-like   66.2    1e-10   
ref|XP_002890996.1|  predicted protein                                66.2    1e-10   
ref|NP_174534.1|  Late embryogenesis abundant protein, group 1 pr...  65.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114872.1|  PREDICTED: histone-lysine N-methyltransferas...  65.1    5e-10   
gb|EYU29133.1|  hypothetical protein MIMGU_mgv1a019354mg              63.9    6e-10   
emb|CDX93824.1|  BnaA09g24240D                                        63.5    1e-09   
gb|AES90817.2|  late embryogenesis abundant protein                   64.3    1e-09   
gb|AFK37818.1|  unknown                                               63.9    1e-09   
ref|XP_008448704.1|  PREDICTED: uncharacterized protein LOC103490795  62.8    2e-09   
ref|XP_010478678.1|  PREDICTED: uncharacterized protein LOC104757625  62.0    3e-09   
ref|XP_010531724.1|  PREDICTED: 18 kDa seed maturation protein        61.2    4e-09   
ref|XP_010677257.1|  PREDICTED: protein LE25-like                     61.6    6e-09   
emb|CDX84072.1|  BnaC08g07490D                                        61.2    6e-09   
ref|XP_009377068.1|  PREDICTED: uncharacterized protein LOC103965726  60.1    1e-08   
ref|XP_004148757.1|  PREDICTED: uncharacterized protein LOC101209639  60.1    2e-08   
ref|XP_010499805.1|  PREDICTED: uncharacterized protein LOC104777288  60.1    2e-08   
ref|XP_007039530.1|  Late embryogenesis abundant protein, putative    59.7    3e-08   
emb|CBI33913.3|  unnamed protein product                              58.9    3e-08   
ref|XP_006436734.1|  hypothetical protein CICLE_v10033018mg           58.9    5e-08   
ref|XP_010270023.1|  PREDICTED: uncharacterized protein LOC104606491  58.5    6e-08   
ref|XP_006368417.1|  late embryogenesis abundant group 1 domain-c...  58.2    7e-08   
ref|XP_002281237.1|  PREDICTED: 18 kDa seed maturation protein        58.2    8e-08   Vitis vinifera
ref|XP_011073373.1|  PREDICTED: protein LE25                          57.8    9e-08   
ref|XP_003608620.1|  Seed maturation protein                          58.5    1e-07   
ref|XP_007155772.1|  hypothetical protein PHAVU_003G230300g           57.4    1e-07   
ref|XP_008373561.1|  PREDICTED: protein LE25                          57.8    1e-07   
ref|XP_008238275.1|  PREDICTED: 11 kDa late embryogenesis abundan...  55.8    4e-07   
gb|EPS71698.1|  hypothetical protein M569_03063                       54.7    6e-07   
ref|XP_004509025.1|  PREDICTED: protein LE25-like                     55.1    7e-07   
emb|CDY01256.1|  BnaC05g24760D                                        55.5    8e-07   
ref|XP_011014156.1|  PREDICTED: protein LE25-like                     54.3    8e-07   
ref|XP_008366362.1|  PREDICTED: protein LE25-like                     54.7    9e-07   
gb|KDO37929.1|  hypothetical protein CISIN_1g0456912mg                54.7    1e-06   
ref|XP_010275352.1|  PREDICTED: uncharacterized protein LOC104610435  54.3    1e-06   
ref|XP_004300250.1|  PREDICTED: uncharacterized protein LOC101311966  53.5    3e-06   
gb|ACJ04785.1|  LEA-1 protein                                         51.6    1e-05   Bupleurum chinense
ref|XP_004300249.1|  PREDICTED: uncharacterized protein LOC101311674  50.4    3e-05   
ref|XP_006847722.1|  hypothetical protein AMTR_s00149p00083390        50.8    3e-05   
gb|ACF93400.1|  late embryogenesis abundant protein 2                 50.8    3e-05   Dorcoceras hygrometricum
ref|XP_010055333.1|  PREDICTED: 18 kDa seed maturation protein        50.8    4e-05   
ref|XP_010505032.1|  PREDICTED: uncharacterized protein LOC104781930  49.7    5e-05   
gb|KDO37210.1|  hypothetical protein CISIN_1g043021mg                 49.3    9e-05   
ref|XP_010104330.1|  hypothetical protein L484_023281                 49.3    2e-04   
ref|NP_181073.1|  late embryogenesis abundant protein 4-2             48.5    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295968.1|  hypothetical protein CARUB_v10025118mg           48.5    2e-04   
ref|XP_010516704.1|  PREDICTED: uncharacterized protein LOC104792285  48.5    2e-04   
gb|KHG28474.1|  hypothetical protein F383_13534                       47.8    4e-04   
ref|XP_006410689.1|  hypothetical protein EUTSA_v10017485mg           47.0    5e-04   
gb|KFK36427.1|  hypothetical protein AALP_AA4G122900                  47.4    5e-04   
emb|CDX84220.1|  BnaC04g09820D                                        46.6    7e-04   
ref|XP_002881387.1|  late embryogenesis abundant group 1 domain-c...  46.6    9e-04   



>ref|XP_009601197.1| PREDICTED: 18 kDa seed maturation protein-like [Nicotiana tomentosiformis]
Length=126

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 88/111 (79%), Gaps = 6/111 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M S K+KVS+AAAA KEH+DIL AK +EKVEKAAAR+KEEK IA ERRKAKE EAKM LH
Sbjct  1    MHSVKEKVSNAAAAGKEHVDILKAKAEEKVEKAAARTKEEKTIAEERRKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAHL-----YHGANPVVGGQVGHHEPVGTVAPTTGAV  250
            +AKARHAAEKLQAKQAHL     +H     VGGQ GHH+PVGT  PTTG V
Sbjct  61   QAKARHAAEKLQAKQAHLGIGGHHHIGPTTVGGQ-GHHDPVGTTIPTTGTV  110



>ref|XP_009757567.1| PREDICTED: 18 kDa seed maturation protein-like [Nicotiana sylvestris]
Length=126

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M S K+KVS+AAAA KEH+DI  AK +EK EKAAAR+KEEK IA ERRKAKE EAKM LH
Sbjct  1    MHSVKEKVSNAAAAGKEHVDIFKAKAEEKAEKAAARTKEEKTIAEERRKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGAN-----PVVGGQVGHHEPVGTVAPTTGAV  250
            +AKARHAAEKLQAKQAH           P VGGQ GHH+PVGT  PTTG V
Sbjct  61   QAKARHAAEKLQAKQAHHLGIGGHHHIPPTVGGQ-GHHDPVGTTIPTTGTV  110



>ref|NP_001234942.1| seed maturation protein [Glycine max]
 gb|AAD30428.1|AF117725_1 seed maturation protein PM29 [Glycine max]
 gb|ABB72408.1| seed maturation protein [Glycine max]
 gb|ABB72409.1| seed maturation protein [Glycine soja]
 gb|ABB72410.1| seed maturation protein [Glycine soja]
 gb|ABB72411.1| seed maturation protein [Glycine soja]
 gb|KHN45968.1| hypothetical protein glysoja_030705 [Glycine soja]
Length=131

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ +  +AAKE +DI  AK DEK EKA AR++EE+ I  ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMTSAAKEQVDIYKAKIDEKTEKATARTEEERVITHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GHH+P+G V P  GA+
Sbjct  61   EAKARHAAEKLSTNQSHYGLHHGHNPPLVGTTETHYQQGHHQPLGAV-PMPGAI  113



>gb|ABB72407.1| seed maturation protein [Glycine latifolia]
Length=131

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A AAKE +DI  AK DEK EKA AR+KEE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMAGAAKEQVDIYKAKIDEKAEKATARTKEERVIAHERAKAKEAEAKMKLH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP++ G      Q GHH+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSTNQSHYALHHGHNPLLVGTTETHYQQGHHQPLGAV-PMPGAT  113



>gb|ABB72406.1| seed maturation protein [Glycine canescens]
Length=131

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMASAAKEQVDIYKAKVDEKAEKATARTEEERVIAHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GHH+P+G V P  GA 
Sbjct  61   EAKARHAAEKLNTNQSHYGLHHGHNPPLVGTTETHYQQGHHQPLGAV-PMPGAT  113



>gb|ABB72405.1| seed maturation protein [Glycine canescens]
Length=131

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GHH+P+G V P  GA 
Sbjct  61   EAKARHAAEKLNTNQSHYGLHHGHNPPLVGTTETHYQQGHHQPLGAV-PMPGAT  113



>gb|ABB72412.1| seed maturation protein [Glycine tabacina]
 gb|ABB72423.1| seed maturation protein [Glycine tomentella]
 gb|ABB72425.1| seed maturation protein [Glycine tomentella]
Length=131

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GHH+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSTNQSHYGLHHGHNPPLVGTTETHYQQGHHQPLGAV-PIPGAT  113



>gb|ABB72418.1| seed maturation protein [Glycine tomentella]
 gb|ABB72429.1| seed maturation protein [Glycine tomentella]
Length=128

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMASAAKEKVDIYKAKIDEKAEKATARTEEERVIAHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GHH+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSTNQSHYGLHHGHNPPLVGTTETHYQQGHHQPLGAV-PMPGAT  113



>gb|ABB72414.1| seed maturation protein [Glycine tomentella]
 gb|ABB72417.1| seed maturation protein [Glycine tomentella]
 gb|ABB72428.1| seed maturation protein [Glycine tomentella]
Length=128

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMASAAKEKVDIYKAKMDEKAEKATARTEEERVIAHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GHH+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSTNQSHYDLHHGHNPPLVGTTETHYQQGHHQPLGEV-PMPGAT  113



>gb|ABB72413.1| seed maturation protein [Glycine tabacina]
 gb|ABB72416.1| seed maturation protein [Glycine tomentella]
 gb|ABB72419.1| seed maturation protein [Glycine tomentella]
 gb|ABB72421.1| seed maturation protein [Glycine tomentella]
 gb|ABB72424.1| seed maturation protein [Glycine tomentella]
 gb|ABB72426.1| seed maturation protein [Glycine tomentella]
Length=128

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMASAAKEKVDIYKAKIDEKAEKATARTEEERVIAHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GHH+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSTNQSHYGLHHGHNPPLVGTTETHYQQGHHQPLGAV-PMPGAT  113



>gb|ABB72415.1| seed maturation protein [Glycine tomentella]
Length=128

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMASAAKEKVDIYKAKIDEKAEKATARTEEERVIAHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GHH+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSTDQSHYGLHHGHNPPLVGTTETHYQQGHHQPLGAV-PMPGAT  113



>gb|ABB72427.1| seed maturation protein [Glycine tomentella]
Length=128

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLLNMASAAKEKVDIYKAKMDEKAEKATARTEEERVIAHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GHH+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSTNQSHYDLHHGHNPPLVGTTETHYQQGHHQPLGEV-PMPGAT  113



>gb|ABB72430.1| seed maturation protein [Glycine tomentella]
Length=128

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMASAAKEKVDIYKAKIDEKAEKATARTEEERVIAHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GHH+P G V P  GA 
Sbjct  61   EAKARHAAEKLSTNQSHYGLHHGHNPPLVGTTETHYQQGHHQPPGAV-PMPGAT  113



>gb|ABB72420.1| seed maturation protein [Glycine tomentella]
 gb|ABB72422.1| seed maturation protein [Glycine tomentella]
Length=131

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 80/114 (70%), Gaps = 9/114 (8%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA ER KAKE EAKM LH
Sbjct  1    MQSSKEKLKNMASAAKEKVDIYKAKIDEKAEKATARTEEERVIAHERAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGANPVVGG------QVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL   Q+H  L+HG NP + G      Q GH +P+G V P  GA 
Sbjct  61   EAKARHAAEKLSTNQSHYGLHHGHNPPLVGTTETHYQQGHQQPLGAV-PMPGAT  113



>gb|ABW91070.1| LEA [Boea hygrometrica]
Length=141

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 73/105 (70%), Gaps = 5/105 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ+ KQKVS+AAAAAKEH+D++ AK +EK E + AR+KEE+ IA ERRKAKE EA M LH
Sbjct  1    MQAVKQKVSNAAAAAKEHVDVMKAKAEEKRELSMARTKEEEAIATERRKAKEAEANMRLH  60

Query  387  EAKARHAAEKLQAKQAHLY----HGANPVVGGQVGHHEPVGTVAP  265
              KA +AA KLQ KQ  L+    HG      GQ G+H P GT AP
Sbjct  61   ATKADNAAVKLQGKQKGLFGNRHHGTGAATVGQ-GNHYPTGTTAP  104



>gb|ABB72375.1| seed maturation protein [Glycine tomentella]
Length=133

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 82/116 (71%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR+KEE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTKEERAIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L+HG N  P+VG      Q GH H+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPGAT  115



>gb|ABB72372.1| seed maturation protein [Glycine tomentella]
 gb|ABB72373.1| seed maturation protein [Glycine tomentella]
 gb|ABB72374.1| seed maturation protein [Glycine tomentella]
 gb|ABB72380.1| seed maturation protein [Glycine tomentella]
 gb|ABB72381.1| seed maturation protein [Glycine tomentella]
 gb|ABB72384.1| seed maturation protein [Glycine tomentella]
 gb|ABB72385.1| seed maturation protein [Glycine tomentella]
Length=133

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 82/116 (71%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L+HG N  P+VG      Q GH H+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPGAT  115



>gb|AAZ20279.1| lea protein 2 [Arachis hypogaea]
Length=126

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 3/109 (3%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M+S+K+K+S+  +AAKEH+DI  AK DEK EKA AR++EEK IA ER KA+E +AKM LH
Sbjct  1    MKSSKEKLSNMVSAAKEHVDICGAKIDEKTEKARARTEEEKVIAHERAKAREAKAKMELH  60

Query  387  EAKARHAAEKLQAKQAHL---YHGANPVVGGQVGHHEPVGTVAPTTGAV  250
            EAKARHAAEKL  KQAHL     GA+        H +P+G++A   G V
Sbjct  61   EAKARHAAEKLSTKQAHLDPSSFGAHHQQPPTTTHQQPLGSLATPAGGV  109



>gb|ABB72382.1| seed maturation protein [Glycine tomentella]
Length=133

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 81/116 (70%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            EAKARHA EKL A Q+H  L+HG N  P+VG      Q GH H+P+G V P  GA 
Sbjct  61   EAKARHATEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPGAT  115



>gb|ABB72383.1| seed maturation protein [Glycine tomentella]
Length=133

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 82/116 (71%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEEVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            +AKARHAAEKL A Q+H  L+HG N  P+VG      Q GH H+P+G V P  GA 
Sbjct  61   QAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPGAT  115



>gb|ABB72370.1| seed maturation protein [Glycine tomentella]
Length=133

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 82/116 (71%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEEVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            +AKARHAAEKL A Q+H  L+HG N  P+VG      Q GH H+P+G V P  GA 
Sbjct  61   QAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPGAT  115



>gb|ABB72376.1| seed maturation protein [Glycine tomentella]
Length=133

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 81/116 (70%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L HG N  P+VG      Q GH H+P+G V P  GA 
Sbjct  61   EAKARHAAEKLNANQSHYGLDHGHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPGAT  115



>ref|XP_006361178.1| PREDICTED: uncharacterized protein LOC102606032 [Solanum tuberosum]
Length=123

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M S K+KVS+AAAA KEH+DIL AK +EK EKA AR++EEK IA E RKAKE EAKM LH
Sbjct  1    MHSVKEKVSNAAAAGKEHVDILKAKAEEKAEKAVARTREEKRIAEEVRKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEP-VGTVAPTTGAV  250
            +AKARHAAE LQ+KQ+HL  G +  VG   G   P VG+  PTT  V
Sbjct  61   QAKARHAAETLQSKQSHLI-GHHHAVGVHQGQQNPVVGSTIPTTATV  106



>gb|ABB72377.1| seed maturation protein [Glycine tomentella]
 gb|ABB72378.1| seed maturation protein [Glycine tomentella]
Length=133

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 81/116 (70%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDEKGEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L HG N  P+VG      Q GH H+P+G V P  GA 
Sbjct  61   EAKARHAAEKLNANQSHYGLDHGHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPGAT  115



>gb|ABB72369.1| seed maturation protein [Glycine tabacina]
Length=133

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 80/116 (69%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  +K DEK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKSKIDEKAEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGGQVGH------HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L+HG N  P+VG    H      H+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHHQQGYQHQPLGAV-PMPGAT  115



>gb|ABB72368.1| seed maturation protein [Glycine tabacina]
Length=133

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 79/116 (68%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+A KE +DI  +K DEK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAVKEQVDIYKSKIDEKAEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGGQVGH------HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L+HG N  P+VG    H      H+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGYQHQPLGAV-PMPGAT  115



>gb|KFK44995.1| hypothetical protein AALP_AA1G330500 [Arabis alpina]
Length=156

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAKQK+SD A+ AKE + I  AK DEK EKA AR+KEEKEIA +RRKAKE EA M++H
Sbjct  1    MQSAKQKISDMASVAKEKMVICRAKADEKAEKAMARTKEEKEIAHQRRKAKEAEANMDMH  60

Query  387  EAKARHAAEKLQAKQAHLY---HGANPVVGGQVGHHEPVGTVAPT  262
             AKA HA EKL AKQ+H +   HG + V  G + HH P+   APT
Sbjct  61   MAKAAHAEEKLLAKQSHYHVTDHGVSHVDHGHLPHHVPMAAPAPT  105



>gb|ABB72379.1| seed maturation protein [Glycine tomentella]
Length=133

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 81/116 (70%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAK  EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDEKGEKATARTEEERVIAHEHAKAKGAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L+HG N  P+VG      Q GH H+P+G V P  GA 
Sbjct  61   EAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPGAT  115



>gb|ABB72366.1| seed maturation protein [Glycine soja]
 gb|ABB72367.1| seed maturation protein [Glycine soja]
Length=133

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 80/116 (69%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAKE  AKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDEKTEKATARTEEERVIAHEHAKAKEAGAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L+HG N  P+VG      Q GH H+P+G V P  G  
Sbjct  61   EAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPGTT  115



>ref|NP_001237410.1| seed maturation protein [Glycine max]
 gb|AAD01541.1| late-embryogenesis abundant protein [Glycine max]
 gb|ABB72365.1| seed maturation protein [Glycine max]
 gb|ACU13375.1| unknown [Glycine max]
 gb|KHN01691.1| hypothetical protein glysoja_013002 [Glycine soja]
Length=133

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 80/116 (69%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAKE  AKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAGAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L+HG N  P+VG      Q GH H+P+G V P  G  
Sbjct  61   EAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPGTT  115



>gb|ABB72363.1| seed maturation protein [Glycine canescens]
Length=133

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 80/114 (70%), Gaps = 11/114 (10%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTG  256
            EAKARHAAEKL A Q+H  L+H  N  P+VG      Q GH H+P+G V P  G
Sbjct  61   EAKARHAAEKLSANQSHYGLHHDHNNPPLVGTTQTHYQQGHQHQPLGAV-PMPG  113



>gb|ABB72362.1| seed maturation protein [Glycine canescens]
Length=133

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 80/114 (70%), Gaps = 11/114 (10%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK DEK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAEAKMGLH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTG  256
            EAKARHAAEKL A Q+H  L+H  N  P+VG      Q GH H+P+G V P  G
Sbjct  61   EAKARHAAEKLSANQSHYGLHHDHNNPPLVGTAQTHYQQGHQHQPLGAV-PMPG  113



>gb|ABB72371.1| seed maturation protein [Glycine tomentella]
Length=133

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 80/116 (69%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +DI  AK D K EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDIYKAKIDGKAEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L+HG N  P+VG      Q GH H+ +G V P  GA 
Sbjct  61   EAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQLLGAV-PMPGAT  115



>emb|CDP13001.1| unnamed protein product [Coffea canephora]
Length=125

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 78/105 (74%), Gaps = 4/105 (4%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M S K+KVS+AAAAA+E ++I+ AK +EK EKAAAR++ EK IA E RK KE EAKM LH
Sbjct  1    MHSVKEKVSNAAAAAQEKVEIMIAKGEEKAEKAAARTEAEKVIAKEGRKVKEAEAKMKLH  60

Query  387  EAKARHAAEKLQAKQAH-LYHGANPVVGGQVGHHEPVGTVA-PTT  259
            E KA +AAEKL  K +H +Y   +PVVGG  GHH PVGT A PTT
Sbjct  61   ETKAENAAEKL--KHSHPVYDHHDPVVGGGQGHHAPVGTAANPTT  103



>ref|XP_006415174.1| hypothetical protein EUTSA_v10009848mg [Eutrema salsugineum]
 gb|ESQ33527.1| hypothetical protein EUTSA_v10009848mg [Eutrema salsugineum]
Length=157

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 72/104 (69%), Gaps = 5/104 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS K+K+SD A+ AK+ + I  AK DEK E+A AR+KEEK+IA ERRKAKE EAKM++H
Sbjct  1    MQSVKKKLSDMASTAKKKMVICQAKADEKAEQAMARTKEEKQIAHERRKAKEAEAKMDMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             AK  HA EKL AKQ+H YH    V  G V HH PV   AP  G
Sbjct  61   MAKEAHAEEKLMAKQSH-YH----VSQGDVPHHTPVPAPAPVMG  99



>ref|XP_007210854.1| hypothetical protein PRUPE_ppa015214mg [Prunus persica]
 gb|EMJ12053.1| hypothetical protein PRUPE_ppa015214mg [Prunus persica]
Length=98

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAK+K+S+ A AAKEH +I  AK +EKVEKA AR++E++EIA E RKAKE +AKM LH
Sbjct  1    MQSAKEKLSNKACAAKEHANIYKAKAEEKVEKATARTEEQREIASEVRKAKEAKAKMELH  60

Query  387  EAKARHAAEKL--QAKQAHLYHG-ANPVVGGQVG  295
            EAKA HAAEKL   AK++H+ HG ++P VG +  
Sbjct  61   EAKAEHAAEKLTASAKKSHVIHGQSDPAVGDRAS  94



>gb|ABB72364.1| seed maturation protein [Glycine latifolia]
Length=133

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 80/116 (69%), Gaps = 11/116 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +D+  ++  EK EKA AR++EE+ IA E  KAKE EAKM LH
Sbjct  1    MQSSKEKMKNMASAAKEQVDLYKSEIGEKAEKATARTEEERVIAHEHAKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAH--LYHGAN--PVVGG-----QVGH-HEPVGTVAPTTGAV  250
            EAKARHAAEKL A Q+H  L+HG N  P+VG      Q GH H+P G V P  GA 
Sbjct  61   EAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQPPGAV-PMPGAT  115



>ref|XP_004241969.1| PREDICTED: protein LE25 [Solanum lycopersicum]
Length=126

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 77/115 (67%), Gaps = 16/115 (14%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M S K+KVS+AAAA KEH+DIL AK +EK EKA AR++EEK IA E RKAKE EAKM LH
Sbjct  1    MHSVKEKVSNAAAAGKEHVDILKAKAEEKAEKAVARTREEKRIAEEVRKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGA-------------NPVVGGQVGHHEPVGTVAPT  262
            +AKARHAAE LQ+KQ+HL                 NPVVG  V      GTVAPT
Sbjct  61   QAKARHAAETLQSKQSHLIGRHGHGHHHHAVGGQQNPVVGSTV---PTTGTVAPT  112



>emb|CDY66058.1| BnaA08g30040D [Brassica napus]
Length=132

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 72/104 (69%), Gaps = 5/104 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAKQK+SD A+ AK+ + I  AK +EK +KA AR+KEEK+IA ERRKA+E EAK+++H
Sbjct  1    MQSAKQKLSDLASTAKKKMVICRAKVEEKADKARARTKEEKKIAHERRKAREAEAKLDMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             AK  HA EKL AKQ+H YH    V    V HH PV T  P  G
Sbjct  61   VAKEAHAEEKLMAKQSH-YH----VSQSHVPHHTPVTTPQPVVG  99



>ref|XP_002519834.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42438.1| conserved hypothetical protein [Ricinus communis]
Length=124

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%), Gaps = 6/111 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M+SAK+K+S+ A+AAKEH+ I  AK DEKVEKAAAR+ E+K+IA ERRKA+E +AKM LH
Sbjct  1    MKSAKEKISNMASAAKEHITICRAKVDEKVEKAAARTPEQKQIAKERRKAREAQAKMELH  60

Query  387  EAKARHAAEKLQ----AKQAHLYHGANPVVGGQVGHHEPVGTVAPTTGAVM  247
            +AKA+HAA+K +          Y    PVVG QV +  PVG+ A   G  +
Sbjct  61   QAKAKHAAQKSRHHHPPTVGTQYGPTQPVVGTQVNN--PVGSTATMAGTTV  109



>gb|KDP29011.1| hypothetical protein JCGZ_19500 [Jatropha curcas]
Length=131

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 6/104 (6%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M SAK+K+S+ A+AAK+H+ I  AK DEKVE+A+AR+ E+K+IA ERRKAKE +AKM LH
Sbjct  1    MLSAKEKISNMASAAKKHVTICRAKVDEKVERASARTHEQKQIAKERRKAKEAQAKMKLH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
            + KA+HAAEKL  ++AH   GA         HH P  TV P  G
Sbjct  61   QEKAKHAAEKLSGRRAHHLSGAT-----HTNHHYPT-TVDPVVG  98



>ref|XP_009107977.1| PREDICTED: 18 kDa seed maturation protein-like [Brassica rapa]
Length=132

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 72/104 (69%), Gaps = 5/104 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAKQK+SD A+ AK+ + I  AK +EK EKA AR+KEEK+IA ERRKA++ EAK+++H
Sbjct  1    MQSAKQKLSDLASTAKKKMVICRAKVEEKAEKARARTKEEKKIAHERRKARQAEAKLDMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             AK  HA EKL AKQ+H YH    V    V HH PV T  P  G
Sbjct  61   VAKEAHAEEKLMAKQSH-YH----VSQSHVPHHTPVTTPQPVVG  99



>ref|XP_002890996.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67255.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=141

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 70/104 (67%), Gaps = 4/104 (4%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAKQK+SD A+ AKE + +  AK DEK E+A AR+KEEKEIA +RRKAKE EA M++H
Sbjct  1    MQSAKQKISDMASTAKEKIVMCQAKADEKAEQAMARTKEEKEIAHQRRKAKEAEANMDMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             AKA HA +KL  KQ+H + G  P     V  H P+   AP  G
Sbjct  61   MAKAAHAEDKLMTKQSHYHVGHGP----HVPQHGPIPAPAPVMG  100



>ref|NP_174534.1| Late embryogenesis abundant protein, group 1 protein [Arabidopsis 
thaliana]
 gb|AAG51244.1|AC055769_3 late-embryogenesis abundant protein, putative; 13528-14032 [Arabidopsis 
thaliana]
 emb|CAA61676.1| LEA protein Le25 homolog [Arabidopsis thaliana]
 gb|AAL36182.1| putative late-embryogenesis abundant protein [Arabidopsis thaliana]
 gb|AAM20064.1| putative late-embryogenesis abundant protein [Arabidopsis thaliana]
 gb|AEE31503.1| Late embryogenesis abundant protein, group 1 protein [Arabidopsis 
thaliana]
Length=134

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAKQK+SD A+ AKE + I  AK DEK E+A AR+KEEKEIA +RRKAKE EA M++H
Sbjct  1    MQSAKQKISDMASTAKEKMVICQAKADEKAERAMARTKEEKEIAHQRRKAKEAEANMDMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             AKA HA +KL AKQ+H YH  +   G  V    PV   AP  G
Sbjct  61   MAKAAHAEDKLMAKQSH-YHVTD--HGPHVPQQAPVPAPAPVMG  101



>ref|XP_009114872.1| PREDICTED: histone-lysine N-methyltransferase 2B-like [Brassica 
rapa]
Length=152

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 72/109 (66%), Gaps = 5/109 (5%)
 Frame = -1

Query  582  SFELKMQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEA  403
            S   KMQSAKQK+SD A+ AKE + +  AK  EK E+A AR+KEEKEIA +RRKAKE EA
Sbjct  15   SLTRKMQSAKQKLSDMASTAKERMVVCEAKAAEKAEQAMARTKEEKEIAHQRRKAKEAEA  74

Query  402  KMNLHEAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             M++H AKA HA EKL AKQ+H YH    +  G V H  PV    P  G
Sbjct  75   NMDMHMAKAAHAEEKLMAKQSH-YH----LPQGHVTHGAPVPAPTPVIG  118



>gb|EYU29133.1| hypothetical protein MIMGU_mgv1a019354mg [Erythranthe guttata]
Length=116

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 9/105 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M SAKQ+ +DAAA AKEH +I  A+ +EK EKA AR+KEE+EIA E RKAKE EAKM +H
Sbjct  1    MHSAKQRAADAAAVAKEHAEIFKAQAEEKAEKAVARTKEEREIAHEIRKAKEAEAKMKMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQV-GHHEPVGTVAPTTG  256
            E+KA+HA EKL  K    +H    VVGG + GHHEPVG   P TG
Sbjct  61   ESKAQHAEEKLLGK----HH----VVGGGLHGHHEPVGAAFPPTG  97



>emb|CDX93824.1| BnaA09g24240D [Brassica napus]
Length=133

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 71/104 (68%), Gaps = 5/104 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAKQK+SD A+ AKE + +  AK  EK E+A AR+KEEKEIA +RRKAKE EA M++H
Sbjct  1    MQSAKQKLSDMASTAKERMVVCEAKAAEKAEQAMARTKEEKEIAHQRRKAKEAEANMDMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             AKA HA EKL AKQ+H YH    +  G V H  PV   AP  G
Sbjct  61   MAKATHAEEKLMAKQSH-YH----LSQGHVTHGAPVPAPAPVIG  99



>gb|AES90817.2| late embryogenesis abundant protein [Medicago truncatula]
Length=169

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+ +K+ + A+AAKE  DI  AK DEK EK  AR+KEEK IA ER KAKE +AKM LH
Sbjct  1    MQSSMEKLKNKASAAKEQADIYKAKIDEKAEKRMARTKEEKVIAHERAKAKEHKAKMELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGT  274
            EAKARHAAEKL  K+ H Y    PV G Q    + VGT
Sbjct  61   EAKARHAAEKLHTKKPHYYGHHGPVEGVQQPQPQVVGT  98



>gb|AFK37818.1| unknown [Medicago truncatula]
Length=169

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+ +K+ + A AAKE  DI  AK DEK EK  AR+KEEK IA ER KAKE +AKM LH
Sbjct  1    MQSSMEKLKNKANAAKEQADIYKAKIDEKAEKRMARTKEEKVIAHERAKAKEHKAKMELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGT  274
            EAKARHAAEKL  K+ H Y    PV G Q    + VGT
Sbjct  61   EAKARHAAEKLHTKKPHYYGHHGPVEGVQQPQPQVVGT  98



>ref|XP_008448704.1| PREDICTED: uncharacterized protein LOC103490795 [Cucumis melo]
Length=121

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 69/102 (68%), Gaps = 6/102 (6%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSA +K+S+  + AKE L I  AK DEKVEKA+ ++ EE++I  ERRKA   EAK  LH
Sbjct  1    MQSAMEKLSNMGSVAKEKLKICRAKLDEKVEKASVKTAEERKIVEERRKAATAEAKRELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPT  262
            EAKARHAA+KL+ +++H+      + GG + HH PV   A T
Sbjct  61   EAKARHAAQKLRNRKSHV------LGGGHLHHHSPVEGGAAT  96



>ref|XP_010478678.1| PREDICTED: uncharacterized protein LOC104757625 [Camelina sativa]
Length=126

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 69/104 (66%), Gaps = 4/104 (4%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M+S KQK+SD A+ AKE + I  AK DEK E+A AR+KEEKEIA +RRK KE EA M++H
Sbjct  1    MKSVKQKISDMASTAKEKMVICQAKADEKAEQAMARTKEEKEIAHQRRKVKEAEANMDMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             AKA HA +KL AKQ+H YH  +   G  V    PV   AP  G
Sbjct  61   MAKAAHAEDKLIAKQSH-YHVTH---GTHVAQPAPVSAPAPVMG  100



>ref|XP_010531724.1| PREDICTED: 18 kDa seed maturation protein [Tarenaya hassleriana]
Length=112

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 66/95 (69%), Gaps = 5/95 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ+AKQK+SD A+ AKE + I  AKTDEK EKA ARSKEEK+IA ER+KA+E EAKM  H
Sbjct  1    MQAAKQKISDMASTAKEKIAICQAKTDEKAEKAVARSKEEKQIAKERKKAREAEAKMEKH  60

Query  387  EAKARHAAEKLQAKQAHLYH-----GANPVVGGQV  298
             A A HA EKL++KQ H +H      A P  G  V
Sbjct  61   IAMAAHAEEKLRSKQTHAHHLGRGLHAPPTAGTTV  95



>ref|XP_010677257.1| PREDICTED: protein LE25-like [Beta vulgaris subsp. vulgaris]
Length=147

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAK+KVS+ A+AAKE + I  AK +++ E+A AR+KEEK IA E RK KE EAK +LH
Sbjct  1    MQSAKEKVSNMASAAKEKIQIAKAKVEQEAEQATARTKEEKVIAKEARKVKEAEAKADLH  60

Query  387  EAKARHAAEKLQAKQA-HLYHGANPVVGGQVGHHEP  283
             +KARHAAE L++KQA H YH     +    GHH P
Sbjct  61   ASKARHAAETLESKQAGHHYHIPGTGIVSGTGHHVP  96



>emb|CDX84072.1| BnaC08g07490D [Brassica napus]
Length=137

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 71/104 (68%), Gaps = 5/104 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAKQK+SD A+ AK+ + I  AK +EK EKA A++KEEK++A ERRKA+E EAK+++H
Sbjct  1    MQSAKQKLSDLASTAKKKMVICRAKAEEKAEKARAQTKEEKKVAHERRKAREAEAKLDMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             AK  HA EKL  KQ+H YH    V    V HH PV T  P  G
Sbjct  61   VAKEAHAEEKLMDKQSH-YH----VSQSHVPHHTPVTTPQPVVG  99



>ref|XP_009377068.1| PREDICTED: uncharacterized protein LOC103965726 [Pyrus x bretschneideri]
Length=109

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ AK+K+S+ A++AKEH++I  AK +EK++ AAAR+KE+K++A ERRK KE  AK  L 
Sbjct  1    MQYAKEKLSNMASSAKEHVNIYKAKVEEKIQAAAARTKEQKKMAKERRKVKEARAKTELR  60

Query  387  EAKARHAAEKL-QAKQAHLYHGANPVVGGQ  301
            +AKARHA +KL  +KQ+H +HG  P+V  +
Sbjct  61   KAKARHAEKKLISSKQSHAHHGHQPLVATR  90



>ref|XP_004148757.1| PREDICTED: uncharacterized protein LOC101209639 [Cucumis sativus]
 ref|XP_004164418.1| PREDICTED: uncharacterized LOC101209639 [Cucumis sativus]
Length=120

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSA +K+S+  + AKE L I  AK DEKVEKA+ ++ EE++I  ERRKA   EAK  LH
Sbjct  1    MQSAMEKLSNMGSVAKEKLKICRAKLDEKVEKASVKTAEERKIIEERRKAATAEAKRELH  60

Query  387  EAKARHAAEKLQAKQAHLYHG----ANPVVGGQVGH  292
            EAKARHAA+KL+ +++H+  G     +P+ GG   H
Sbjct  61   EAKARHAAQKLRNRKSHVLGGHRHHQSPMEGGAATH  96



>ref|XP_010499805.1| PREDICTED: uncharacterized protein LOC104777288 [Camelina sativa]
Length=126

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 68/104 (65%), Gaps = 4/104 (4%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M+S KQK+SD A+ AKE + I  AK DEK E+A AR+KEEKEIA +RRK KE EA M++H
Sbjct  1    MKSVKQKISDMASTAKEKMVICQAKADEKAEQAMARTKEEKEIAHQRRKVKEAEANMDMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             AKA HA +KL AKQ+H YH  +   G  V    PV    P  G
Sbjct  61   MAKAAHAEDKLIAKQSH-YHVTH---GTHVAQPAPVSAPVPVMG  100



>ref|XP_007039530.1| Late embryogenesis abundant protein, putative [Theobroma cacao]
 gb|EOY24031.1| Late embryogenesis abundant protein, putative [Theobroma cacao]
Length=128

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 6/109 (6%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekei-AVERRKAKEGEAKMNL  391
            MQS K+K+S+ A +AKEH++I  AK +E   + AA    E++  A E +KAKE  AKM L
Sbjct  1    MQSVKEKISNMAGSAKEHMNIGKAKVEEDQMEKAAARTAEEKRLATESKKAKEARAKMEL  60

Query  390  HEAKARHAAEKLQAKQAHLYHGAN----PVVGGQVGHHEPVGTVAPTTG  256
             + K RHA E+L++KQ    HG      P V G  G H+ VG+ AP  G
Sbjct  61   QQDKVRHAKERLRSKQPQYLHGYGYDHAPPVSGTHG-HQTVGSAAPVGG  108



>emb|CBI33913.3| unnamed protein product [Vitis vinifera]
Length=123

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 66/120 (55%), Gaps = 20/120 (17%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS K+K+S+ A+ AKEH+ I  A+  EK EKA AR+KEEKEIA ERRKAKE +AKM LH
Sbjct  1    MQSYKEKISNMASVAKEHITICKARAQEKAEKAMARTKEEKEIAKERRKAKEAQAKMQLH  60

Query  387  EAKARHAAEKLQAKQ--------------------AHLYHGANPVVGGQVGHHEPVGTVA  268
              KA HAA KL AK                     A +Y    PVVG       P  T+ 
Sbjct  61   AEKAEHAARKLNAKHSHLHSTHTHQGYNQPAAGATAPMYPQPQPVVGATTAPTYPPSTIC  120



>ref|XP_006436734.1| hypothetical protein CICLE_v10033018mg [Citrus clementina]
 ref|XP_006485446.1| PREDICTED: 18 kDa seed maturation protein-like [Citrus sinensis]
 gb|ESR49974.1| hypothetical protein CICLE_v10033018mg [Citrus clementina]
Length=142

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ+ K+KVS+AA+  K H+DI  AK DEK EKAAAR+KEEKEIA + RKAKE +AKM +H
Sbjct  1    MQNIKEKVSNAASTGKAHVDIYKAKADEKAEKAAARTKEEKEIAHQCRKAKEAKAKMEMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTGAV  250
            +AKA HA EKL+AKQ+HLY G N   G    HH  +G   P   A 
Sbjct  61   QAKAIHAVEKLRAKQSHLY-GPNLAAGTDDHHH--LGQNEPPPAAT  103



>ref|XP_010270023.1| PREDICTED: uncharacterized protein LOC104606491 [Nelumbo nucifera]
Length=133

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ+AK+K+S+ A+AAKE   I  AK +EKVEKAAAR+KEEKEIA ERRKAKE +AKM LH
Sbjct  1    MQAAKEKLSNMASAAKERACIYKAKAEEKVEKAAARTKEEKEIARERRKAKEAQAKMELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGAN-PVVGGQVGH----HEPV-GTVAPTTG  256
            + KA+H  E+L A+    +H  N PV    V      H P+ GT AP+TG
Sbjct  61   QEKAKHKEERLNAEPHTHHHVENVPVPAASVYDNQHVHRPILGTAAPSTG  110



>ref|XP_006368417.1| late embryogenesis abundant group 1 domain-containing family 
protein [Populus trichocarpa]
 gb|ERP64986.1| late embryogenesis abundant group 1 domain-containing family 
protein [Populus trichocarpa]
Length=124

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 66/95 (69%), Gaps = 4/95 (4%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ+AK+K+++ A+ AKE + I  AK +E+ E   AR+ EEKE+A ERRK K  +AKM LH
Sbjct  1    MQAAKEKITNLASVAKERMTICKAKVEEQAELTTARTAEEKELARERRKVKGAQAKMELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQ--VGHH  289
            +AKA+HAAEKL +K  H +    PVVG Q  VG H
Sbjct  61   QAKAKHAAEKLSSKHHHHHQ--PPVVGTQPVVGTH  93



>ref|XP_002281237.1| PREDICTED: 18 kDa seed maturation protein [Vitis vinifera]
Length=128

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 66/121 (55%), Gaps = 20/121 (17%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS K+K+S+ A+ AKEH+ I  A+  EK EKA AR+KEEKEIA ERRKAKE +AKM LH
Sbjct  2    MQSYKEKISNMASVAKEHITICKARAQEKAEKAMARTKEEKEIAKERRKAKEAQAKMQLH  61

Query  387  EAKARHAAEKLQAKQ--------------------AHLYHGANPVVGGQVGHHEPVGTVA  268
              KA HAA KL AK                     A +Y    PVVG       P  T  
Sbjct  62   AEKAEHAARKLNAKHSHLHSTHTHQGYNQPAAGATAPMYPQPQPVVGATTAPTYPPSTHP  121

Query  267  P  265
            P
Sbjct  122  P  122



>ref|XP_011073373.1| PREDICTED: protein LE25 [Sesamum indicum]
Length=112

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M SAKQKV+DAAA  KEH +IL AK  EK EKA AR+KEEKEIA ERRK KE EAKM +H
Sbjct  1    MHSAKQKVNDAAAVVKEHAEILEAKAQEKAEKAVARTKEEKEIAHERRKVKEAEAKMKMH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPT  262
             AKA+H  +KL+    HL+H   P VG  V    P G  APT
Sbjct  61   AAKAQHIEDKLRHGTHHLHHQHQP-VGTAV---PPTGVAAPT  98



>ref|XP_003608620.1| Seed maturation protein [Medicago truncatula]
Length=165

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  552  QKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLHEAKAR  373
            +K+ + A+AAKE  DI  AK DEK EK  AR+KEEK IA ER KAKE +AKM LHEAKAR
Sbjct  2    EKLKNKASAAKEQADIYKAKIDEKAEKRMARTKEEKVIAHERAKAKEHKAKMELHEAKAR  61

Query  372  HAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGT  274
            HAAEKL  K+ H Y    PV G Q    + VGT
Sbjct  62   HAAEKLHTKKPHYYGHHGPVEGVQQPQPQVVGT  94



>ref|XP_007155772.1| hypothetical protein PHAVU_003G230300g [Phaseolus vulgaris]
 gb|ESW27766.1| hypothetical protein PHAVU_003G230300g [Phaseolus vulgaris]
Length=111

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 11/106 (10%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS+K+K+ + A+AAKE +D+  AK DEK EKA AR++EE+ IA ER +A E +AKM LH
Sbjct  1    MQSSKEKLKNMASAAKEQVDVYKAKIDEKAEKATARTEEERVIAHERARANEAKAKMELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTGAV  250
            EAK RHAAEKL+          +P+VG    H+   G V P  GA 
Sbjct  61   EAKGRHAAEKLE----------HPLVGTHQTHYHAPGAV-PMPGAT  95



>ref|XP_008373561.1| PREDICTED: protein LE25 [Malus domestica]
 ref|XP_008373562.1| PREDICTED: protein LE25 [Malus domestica]
 ref|XP_008346493.1| PREDICTED: protein LE25-like [Malus domestica]
 ref|XP_008346494.1| PREDICTED: protein LE25-like [Malus domestica]
Length=131

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 75/113 (66%), Gaps = 10/113 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAK+K+S+ A+AAKEH+DI  AK  EKV KA A++ EE+EIA + R+AKE +AKM  H
Sbjct  1    MQSAKEKLSNMASAAKEHVDIYKAKAQEKVVKATAKTDEEREIASQIRRAKEAKAKMEFH  60

Query  387  EAKARHAAEKLQA---KQAHLYHGAN--PVVGGQVGH---HEP--VGTVAPTT  259
            EAK +H+AEK  A    ++HL HG +  PV     GH   H+P   G +  TT
Sbjct  61   EAKTKHSAEKSTASAENKSHLLHGQDDQPVARVGDGHGNDHQPHDAGPLPKTT  113



>ref|XP_008238275.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Prunus 
mume]
 ref|XP_008238276.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Prunus 
mume]
Length=114

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ AK+K+S+ A++AKEH++I  AK +EK+E  AAR++EEK++A ERRK KE  AKM LH
Sbjct  1    MQYAKEKLSNMASSAKEHVNIYKAKVEEKLEAVAARTEEEKKMAKERRKVKEARAKMELH  60

Query  387  EAKARHAAEKLQAKQ  343
             AKARHA +KL ++Q
Sbjct  61   RAKARHAEKKLSSRQ  75



>gb|EPS71698.1| hypothetical protein M569_03063, partial [Genlisea aurea]
Length=73

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M SAKQKV DAAA A+EH +IL AK +EK EKA A +  EKEIA ERRKAKE  AKM +H
Sbjct  1    MHSAKQKVKDAAAVAREHAEILQAKYEEKAEKAVATTVAEKEIATERRKAKEAVAKMKMH  60

Query  387  EAKARHAAEKL  355
            EAKA HA +KL
Sbjct  61   EAKADHAEDKL  71



>ref|XP_004509025.1| PREDICTED: protein LE25-like [Cicer arietinum]
Length=116

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 72/104 (69%), Gaps = 12/104 (12%)
 Frame = -1

Query  573  LKMQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMN  394
            ++  S  +K+ + A+AAKEH DI  AK DEK EKA AR++EEK IA ER KAKE +AKM 
Sbjct  1    MQSTSTMEKLKNTASAAKEHADIYKAKIDEKTEKAMARTEEEKVIAHERAKAKEAKAKME  60

Query  393  LHEAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHE--PVGTVA  268
            LHEAKA+HAAEKL AKQ+H Y           GHHE  PVG+++
Sbjct  61   LHEAKAKHAAEKLSAKQSHYY----------GGHHEAQPVGSIS  94



>emb|CDY01256.1| BnaC05g24760D [Brassica napus]
 emb|CDY01266.1| BnaC05g24660D [Brassica napus]
Length=130

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 58/104 (56%), Gaps = 9/104 (9%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAKQK+SD A+ AKE +    A  ++ + +     +       +RRKAKE EA M++ 
Sbjct  1    MQSAKQKLSDMASTAKERICEAKAAGEQAMARTKEEKEIAH----QRRKAKEAEANMDIP  56

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTG  256
             AKA HA EKL AKQ+H YH    +  G V H  PV   AP  G
Sbjct  57   MAKAAHAEEKLMAKQSH-YH----LSQGHVTHGAPVPAPAPVIG  95



>ref|XP_011014156.1| PREDICTED: protein LE25-like [Populus euphratica]
Length=73

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ+AK+K+S+ A+ AKE L I  AK +E+ E   AR+ EEKE+A ERRK KE + +M LH
Sbjct  1    MQAAKEKISNLASVAKERLTICKAKVEEQAELTTARTAEEKELARERRKVKEAQVRMELH  60

Query  387  EAKARHAAEKL  355
            +AKA+HAAEKL
Sbjct  61   QAKAKHAAEKL  71



>ref|XP_008366362.1| PREDICTED: protein LE25-like [Malus domestica]
Length=109

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ AK+K+S+ A++ KEH++I  AK +EK E AAA +KE+K++A ERRK KE  A+M  H
Sbjct  1    MQYAKEKLSNMASSTKEHVNIYKAKVEEKAEAAAATTKEQKKMAKERRKVKEARARMERH  60

Query  387  EAKARHAAEKL-QAKQAHLYHGANPVVGGQVGHHEP  283
            +AKARHA +KL  +KQ+H +H   P+V  +  H+ P
Sbjct  61   KAKARHAEKKLISSKQSHAHHAHQPLVATR--HNNP  94



>gb|KDO37929.1| hypothetical protein CISIN_1g0456912mg, partial [Citrus sinensis]
Length=113

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 47/79 (59%), Gaps = 17/79 (22%)
 Frame = -1

Query  432  ERRKAKEGEAKMNLHEAKARHAAEKLQAKQAHLYH-------------GAN--PVVGGQV  298
            +RRKAKE +AKM +H+AKA HAAEKL+AKQ+HLY              G N  P+     
Sbjct  17   QRRKAKEAKAKMEMHQAKAIHAAEKLRAKQSHLYCPNLAAGTDDHHHLGQNEPPLAATTH  76

Query  297  GH-HEPVGTVA-PTTGAVM  247
            GH H+PVG  A P TG  +
Sbjct  77   GHIHQPVGLAADPMTGTAI  95



>ref|XP_010275352.1| PREDICTED: uncharacterized protein LOC104610435 [Nelumbo nucifera]
Length=95

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 69/98 (70%), Gaps = 6/98 (6%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ+ K+K+S+ A+ AKE + I +A+ +EKV+KA AR++ E+E+A ERRKAKE  AK  LH
Sbjct  1    MQAVKEKLSNLASVAKEKITICSAQAEEKVKKATARTEGEREMAHERRKAKEARAKTELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGAN-PVVG--GQVGHHEP  283
            +AKA H AE+L    AH + G + PVVG  GQ G H P
Sbjct  61   QAKAEHKAERL---NAHGFGGHHAPVVGAQGQGGQHHP  95



>ref|XP_004300250.1| PREDICTED: uncharacterized protein LOC101311966 [Fragaria vesca 
subsp. vesca]
Length=117

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ AK+K+S+ A++AKEH++I  AK  EK+E+A AR+KEEK++A ERRK KE   KM LH
Sbjct  1    MQVAKEKLSNLASSAKEHINIYKAKVVEKLERARARTKEEKKMAKERRKVKEASEKMELH  60

Query  387  EAKARHAAEKLQAKQAH  337
            +AKARHA +KL AK  H
Sbjct  61   KAKARHAEKKLGAKLTH  77



>gb|ACJ04785.1| LEA-1 protein [Bupleurum chinense]
Length=102

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 65/104 (63%), Gaps = 14/104 (13%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M+SAK+++S+AA+AA+ H+DI  A   EK  KA A +  EK IA ER KAKE EAKM LH
Sbjct  1    MRSAKERISNAASAAQHHVDISKAHAQEKASKATAITSHEKVIAHERMKAKEAEAKMKLH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGT---VAP  265
             AKA HAAEKL  K A       P   G+ G H P G+   VAP
Sbjct  61   SAKAEHAAEKLYGKHA-------P---GKTG-HVPAGSTTAVAP  93



>ref|XP_004300249.1| PREDICTED: uncharacterized protein LOC101311674 [Fragaria vesca 
subsp. vesca]
Length=100

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 61/101 (60%), Gaps = 14/101 (14%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS K+K+S+ A+AAKE  ++  +K +EKVEK    ++EEK IA E+R AKE EAKM LH
Sbjct  1    MQSGKEKMSNMASAAKEKAEVYKSKAEEKVEKMTTSTEEEKRIAEEKRGAKEAEAKMKLH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAP  265
            E+KA HAA KL          A P  G       P+GT  P
Sbjct  61   ESKAEHAAGKLAT--------AGPATGA------PIGTGVP  87



>ref|XP_006847722.1| hypothetical protein AMTR_s00149p00083390 [Amborella trichopoda]
 gb|ERN09303.1| hypothetical protein AMTR_s00149p00083390 [Amborella trichopoda]
Length=118

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 68/111 (61%), Gaps = 6/111 (5%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M SAK+KVS+  ++AKEH DI  AK +EK EKA AR+KEEKEIA ER KAK  EAKM  H
Sbjct  1    MASAKEKVSNMVSSAKEHADIYKAKAEEKAEKARARNKEEKEIADEREKAKVAEAKMQHH  60

Query  387  EAKARHAAEKLQAKQAHLYH----GANPVVGGQVGHHE--PVGTVAPTTGA  253
             AKA H AEK  AK +H  H    G      G   HHE     TV PT GA
Sbjct  61   GAKAEHKAEKEHAKHSHSLHVPEAGIRTHAHGLGLHHEVDTCDTVYPTAGA  111



>gb|ACF93400.1| late embryogenesis abundant protein 2 [Boea hygrometrica]
Length=129

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQ+AKQK+SDAAA+AKE +D+L AK + K +K  A SKE+KE+A E++KAKE EAK+  H
Sbjct  1    MQTAKQKMSDAAASAKERVDVLKAKAEGKADKTMASSKEDKEVAKEQKKAKEAEAKVRKH  60

Query  387  EAKARHAAEKLQAKQAHLY-----HGANPVVGGQVGHHEPVG  277
            E KA +A   LQAK    +     HGA      Q G+  P G
Sbjct  61   EEKADNATGHLQAKHQGQFGQQDLHGAGAAPATQ-GNQYPAG  101



>ref|XP_010055333.1| PREDICTED: 18 kDa seed maturation protein [Eucalyptus grandis]
 gb|KCW71801.1| hypothetical protein EUGRSUZ_E00290 [Eucalyptus grandis]
Length=138

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 79/119 (66%), Gaps = 12/119 (10%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSA +K+ + A++AKEH+DI  AK +EKVEKA AR+ EEKE+A +RRKAKE EAKM LH
Sbjct  1    MQSAGEKLKNVASSAKEHIDIAKAKLEEKVEKATARTPEEKEMAHQRRKAKEAEAKMELH  60

Query  387  EAKARHAAEKLQAKQAHL---YHG-------ANPVVG--GQVGHHEPVGTVAPTTGAVM  247
            +AKA HAAEKL AK   L    HG         PVVG  G    H PVGTV P +G  +
Sbjct  61   QAKAAHAAEKLAAKHPTLPGHVHGPADHHTTTQPVVGAPGHQTRHRPVGTVDPISGTTV  119



>ref|XP_010505032.1| PREDICTED: uncharacterized protein LOC104781930 [Camelina sativa]
Length=97

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 64/108 (59%), Gaps = 19/108 (18%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAK+K+SD A+ AKE L+I  AK     EK  AR+K+EK++A ER K+KE +AK +LH
Sbjct  1    MQSAKEKISDMASTAKEKLNIGGAKAQGHAEKTMARTKKEKKLAEEREKSKEAQAKADLH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPT--TGAV  250
            E+KA HAA+     Q H             GHH P  +  PT  TGA 
Sbjct  61   ESKAEHAAD----AQVH-------------GHHLPGHSTYPTRSTGAA  91



>gb|KDO37210.1| hypothetical protein CISIN_1g043021mg, partial [Citrus sinensis]
Length=113

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 3/59 (5%)
 Frame = -1

Query  426  RKAKEGEAKMNLHEAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPTTGAV  250
            RKAKE +AKM +H+AKA HA EKL+AKQ+HLY G N   G    HH  +G   P   A 
Sbjct  19   RKAKEAKAKMEMHQAKAIHAVEKLRAKQSHLY-GPNLAAGTDDHHH--LGQNEPPPAAT  74



>ref|XP_010104330.1| hypothetical protein L484_023281 [Morus notabilis]
 gb|EXB99750.1| hypothetical protein L484_023281 [Morus notabilis]
Length=142

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQS K+K+S+ A+AAKEH+++  AK +EK+EKAAAR++EEK+IA ER+KAKE EAK  LH
Sbjct  1    MQSGKEKISNMASAAKEHVEVYKAKVEEKLEKAAARTEEEKKIAEERKKAKEAEAKKELH  60

Query  387  EAKARHAAEKLQAKQAHLYH  328
            EAKARHAAEKL  KQAHL H
Sbjct  61   EAKARHAAEKLSHKQAHLRH  80



>ref|NP_181073.1| late embryogenesis abundant protein 4-2 [Arabidopsis thaliana]
 emb|CAA63010.1| LEA D113 homologue type2 [Arabidopsis thaliana]
 gb|AAC61808.1| similar to late embryogenesis abundant proteins [Arabidopsis 
thaliana]
 gb|AAL62375.1| similar to late embryogenesis abundant proteins [Arabidopsis 
thaliana]
 gb|AAM47941.1| late embryogenesis-abundant protein-like protein [Arabidopsis 
thaliana]
 gb|AEC09091.1| late embryogenesis abundant 4-2 [Arabidopsis thaliana]
Length=97

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 64/107 (60%), Gaps = 19/107 (18%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAK+K+SD A+ AKE L+I  AK     EK  AR+K+EK++A ER K+KE +AK +LH
Sbjct  1    MQSAKEKISDMASTAKEKLNIGGAKAQGHAEKTMARTKKEKKLAQEREKSKEAQAKADLH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPT--TGA  253
            ++KA HAA+     Q H             GHH P  +  PT  TGA
Sbjct  61   QSKAEHAAD----AQVH-------------GHHLPGHSTYPTRATGA  90



>ref|XP_006295968.1| hypothetical protein CARUB_v10025118mg [Capsella rubella]
 gb|EOA28866.1| hypothetical protein CARUB_v10025118mg [Capsella rubella]
Length=97

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 62/108 (57%), Gaps = 19/108 (18%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAK+K+SD A+ AKE L+I  AK     EK  AR+ +EK++A ER K+KE +AK  LH
Sbjct  1    MQSAKEKISDMASTAKEKLNIGGAKAQGHAEKTMARTHKEKKLAEEREKSKEAQAKAELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPT--TGAV  250
            E+KA HAA+     Q H             GHH P  +  PT  TGA 
Sbjct  61   ESKAEHAAD----AQVH-------------GHHLPGHSTYPTRATGAA  91



>ref|XP_010516704.1| PREDICTED: uncharacterized protein LOC104792285 [Camelina sativa]
Length=97

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 64/108 (59%), Gaps = 19/108 (18%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAK+KVSD A+ AKE L+I  AK     EK  AR+K+EK++A E+ K+KE +AK +LH
Sbjct  1    MQSAKEKVSDMASTAKEKLNIGGAKAQGHAEKTMARTKKEKKLAEEQEKSKEAQAKADLH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPT--TGAV  250
            E+KA HAA+     Q H             GHH P  +  PT  TGA 
Sbjct  61   ESKAEHAAD----AQVH-------------GHHLPGHSTYPTRSTGAA  91



>gb|KHG28474.1| hypothetical protein F383_13534 [Gossypium arboreum]
Length=115

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M + K+K+S+ A++AKEH++I  A+ +EK+EKA A ++EEKE+A ER+KAKE  AKM LH
Sbjct  2    MHTMKEKISNMASSAKEHVNIGKAQLEEKLEKAPASTEEEKELAHERKKAKEARAKMELH  61

Query  387  EAKARHAAEKLQAKQAHLYHG  325
            +   +H  EK++AKQ    HG
Sbjct  62   QDMVKHIQEKMRAKQPQYLHG  82



>ref|XP_006410689.1| hypothetical protein EUTSA_v10017485mg [Eutrema salsugineum]
 gb|ESQ52142.1| hypothetical protein EUTSA_v10017485mg [Eutrema salsugineum]
Length=87

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 60/102 (59%), Gaps = 17/102 (17%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M SAK+K+SD A+ AKE L+I  AK     EK  AR+ +EK++A ER K+KE +AK NLH
Sbjct  1    MHSAKEKISDMASTAKEKLNISEAKAQGHAEKTMARTSKEKKMAHEREKSKEAQAKANLH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAPT  262
            ++KA HAA+      A L+           GHH P  +  PT
Sbjct  61   QSKADHAAD------AQLH-----------GHHLPGHSTYPT  85



>gb|KFK36427.1| hypothetical protein AALP_AA4G122900 [Arabis alpina]
Length=97

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 62/108 (57%), Gaps = 19/108 (18%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAK+K+SD A+ AKE L+I  AK     EK  AR+ +EK++A ER K+KE +AK  LH
Sbjct  1    MQSAKEKISDMASTAKEKLNIGGAKAQGHAEKTMARTTKEKKMAKEREKSKEAQAKAELH  60

Query  387  EAKARHAAEKLQAKQAHLYHGANPVVGGQVGHHEPVGTVAP--TTGAV  250
            ++KA HAA+     Q H             GHH P  +  P  TTGA 
Sbjct  61   QSKADHAAD----AQVH-------------GHHLPGHSSYPIRTTGAT  91



>emb|CDX84220.1| BnaC04g09820D [Brassica napus]
Length=98

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            M SAK+K+SD A+ AKE L+I +AK     EK  AR+ EEK++A ER K+KE +AK  LH
Sbjct  1    MHSAKEKISDMASTAKEKLNIGSAKAQGHAEKTMARTSEEKKMAHEREKSKEAQAKAELH  60

Query  387  EAKARHAAEKLQAKQAHLY-HGANPVVGGQVGHHEP  283
            E+KA HAA+  Q  + HL  H A P       H+ P
Sbjct  61   ESKAEHAAD-AQVHRHHLPGHTAYPSRTKGAAHYPP  95



>ref|XP_002881387.1| late embryogenesis abundant group 1 domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH57646.1| late embryogenesis abundant group 1 domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=97

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  567  MQSAKQKVSDaaaaAKEHLDILAAKTDekvekaaarskeekeiAVERRKAKEGEAKMNLH  388
            MQSAK+K+SD A+ AKE L I  AK     EK  AR+K+EK++A ER K+KE +AK +LH
Sbjct  1    MQSAKEKISDMASTAKEKLHIGGAKAQGHAEKTMARTKKEKKLAQEREKSKEAQAKADLH  60

Query  387  EAKARHAAE  361
            ++KA HAA+
Sbjct  61   QSKAEHAAD  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 780146584908