BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c36597_g1_i1 len=999 path=[977:0-998]

Length=999
                                                                      Score     E

ref|XP_009758138.1|  PREDICTED: glutathione S-transferase PARB          302   9e-99   
sp|P30109.1|GSTF1_TOBAC  RecName: Full=Glutathione S-transferase ...    300   5e-98   Nicotiana tabacum [American tobacco]
ref|XP_009600539.1|  PREDICTED: glutathione S-transferase APIC          298   3e-97   
emb|CAA96431.1|  glutathione S-transferase                              297   5e-97   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011079702.1|  PREDICTED: glutathione S-transferase-like          298   5e-97   
ref|XP_006359403.1|  PREDICTED: glutathione S-transferase APIC-like     296   3e-96   
ref|XP_011079699.1|  PREDICTED: glutathione S-transferase-like          294   1e-95   
ref|XP_010259660.1|  PREDICTED: glutathione S-transferase-like          293   3e-95   
sp|P46423.1|GSTF_HYOMU  RecName: Full=Glutathione S-transferase; ...    293   4e-95   Hyoscyamus muticus
gb|EYU46696.1|  hypothetical protein MIMGU_mgv1a013633mg                292   1e-94   
ref|XP_004240536.1|  PREDICTED: glutathione S-transferase               291   3e-94   
ref|XP_008235033.1|  PREDICTED: glutathione S-transferase-like          291   7e-94   
ref|XP_004247442.2|  PREDICTED: glutathione S-transferase PARB-like     290   7e-94   
gb|ABQ96853.1|  glutathione S-transferase                               290   9e-94   Solanum tuberosum [potatoes]
ref|XP_009789274.1|  PREDICTED: glutathione S-transferase               290   1e-93   
ref|XP_007200490.1|  hypothetical protein PRUPE_ppa011383mg             289   1e-93   
ref|XP_008235026.1|  PREDICTED: glutathione S-transferase-like          289   2e-93   
gb|AAB65163.1|  glutathione S-transferase, class-phi                    289   2e-93   Solanum commersonii
ref|XP_011079698.1|  PREDICTED: glutathione S-transferase-like          286   2e-92   
ref|XP_006355799.1|  PREDICTED: glutathione S-transferase-like          286   2e-92   
gb|ABQ96852.1|  glutathione S-transferase                               286   3e-92   Solanum commersonii
ref|XP_010259659.1|  PREDICTED: glutathione S-transferase-like          288   3e-92   
ref|XP_008368964.1|  PREDICTED: glutathione S-transferase-like          285   7e-92   
ref|XP_008363706.1|  PREDICTED: glutathione S-transferase-like          284   1e-91   
ref|XP_006355800.1|  PREDICTED: glutathione S-transferase-like          283   2e-91   
emb|CAI51314.2|  glutathione S-transferase GST1                         283   4e-91   Capsicum chinense [bonnet pepper]
ref|XP_006386753.1|  Glutathione S-transferase 1 family protein         282   7e-91   
ref|XP_008363707.1|  PREDICTED: glutathione S-transferase-like          282   8e-91   
gb|EYU46695.1|  hypothetical protein MIMGU_mgv1a013389mg                281   2e-90   
ref|XP_009586784.1|  PREDICTED: glutathione S-transferase               281   2e-90   
gb|ABK96715.1|  unknown                                                 281   2e-90   Populus trichocarpa x Populus deltoides
ref|XP_004290763.1|  PREDICTED: glutathione S-transferase-like          280   3e-90   
ref|XP_002262604.1|  PREDICTED: glutathione S-transferase               279   9e-90   Vitis vinifera
gb|ABK81651.1|  glutathione S-transferase                               278   2e-89   Vitis vinifera
ref|XP_010665785.1|  PREDICTED: glutathione S-transferase-like          276   1e-88   
ref|XP_011082484.1|  PREDICTED: glutathione S-transferase-like          278   2e-88   
ref|XP_004240537.1|  PREDICTED: glutathione S-transferase-like          275   7e-88   
ref|XP_010069958.1|  PREDICTED: glutathione S-transferase-like          275   8e-88   
ref|XP_010069960.1|  PREDICTED: glutathione S-transferase-like          274   2e-87   
ref|XP_007050852.1|  Glutathione S-transferase 7 isoform 1              274   5e-87   
gb|AFK35043.1|  unknown                                                 272   5e-87   
ref|XP_002262842.1|  PREDICTED: glutathione S-transferase               272   6e-87   Vitis vinifera
gb|KEH43230.1|  glutathione S-transferase, amino-terminal domain ...    272   6e-87   
ref|XP_010069964.1|  PREDICTED: glutathione S-transferase-like          271   2e-86   
gb|KCW58500.1|  hypothetical protein EUGRSUZ_H01176                     271   2e-86   
gb|AFK43695.1|  unknown                                                 271   2e-86   
dbj|BAM14582.1|  putative glutathione S-transferase                     271   2e-86   
gb|KEH43226.1|  glutathione S-transferase, amino-terminal domain ...    271   2e-86   
ref|XP_011010221.1|  PREDICTED: glutathione S-transferase-like          270   5e-86   
gb|AFK40227.1|  unknown                                                 269   8e-86   
ref|XP_010069956.1|  PREDICTED: glutathione S-transferase-like          268   2e-85   
ref|XP_010069963.1|  PREDICTED: glutathione S-transferase-like          268   3e-85   
gb|KCW58499.1|  hypothetical protein EUGRSUZ_H01176                     268   4e-85   
dbj|BAB70616.1|  glutathione S-transferase                              267   7e-85   Medicago sativa [alfalfa]
ref|XP_008368965.1|  PREDICTED: glutathione S-transferase-like          266   1e-84   
ref|XP_009785538.1|  PREDICTED: glutathione S-transferase-like          266   2e-84   
ref|XP_010667331.1|  PREDICTED: glutathione S-transferase-like          265   4e-84   
gb|AEB77871.1|  phi class glutathione S-transferase protein             264   7e-84   
gb|KCW58492.1|  hypothetical protein EUGRSUZ_H01167                     264   8e-84   
ref|XP_009628525.1|  PREDICTED: glutathione S-transferase-like          265   8e-84   
ref|XP_010069961.1|  PREDICTED: glutathione S-transferase-like          264   9e-84   
ref|XP_004136044.1|  PREDICTED: glutathione S-transferase PARB-like     264   1e-83   
ref|XP_010090797.1|  Glutathione S-transferase                          263   2e-83   
ref|XP_011079697.1|  PREDICTED: glutathione S-transferase-like          263   2e-83   
ref|XP_010667052.1|  PREDICTED: glutathione S-transferase-like          263   3e-83   
gb|AEB77873.1|  phi class glutathione S-transferase protein             261   8e-83   
gb|KHN46580.1|  Glutathione S-transferase                               261   1e-82   
gb|EYU46697.1|  hypothetical protein MIMGU_mgv1a013771mg                261   2e-82   
ref|XP_008451608.1|  PREDICTED: glutathione S-transferase PARB-like     261   2e-82   
ref|XP_007143851.1|  hypothetical protein PHAVU_007G107200g             260   3e-82   
dbj|BAM14583.1|  putative glutathione S-transferase                     260   3e-82   
ref|XP_010684078.1|  PREDICTED: glutathione S-transferase-like          260   4e-82   
ref|XP_010069959.1|  PREDICTED: glutathione S-transferase-like          259   5e-82   
ref|XP_004495977.1|  PREDICTED: glutathione S-transferase PARB-like     259   6e-82   
ref|XP_010689209.1|  PREDICTED: glutathione S-transferase-like          259   1e-81   
ref|XP_008451606.1|  PREDICTED: glutathione S-transferase-like          256   1e-80   
gb|KHG13026.1|  Glutathione S-transferase F6 -like protein              255   2e-80   
ref|XP_004136042.1|  PREDICTED: glutathione S-transferase-like          255   2e-80   
ref|XP_004160544.1|  PREDICTED: glutathione S-transferase-like          255   3e-80   
ref|XP_002531868.1|  glutathione-s-transferase theta, gst, putative     255   3e-80   Ricinus communis
ref|XP_010069962.1|  PREDICTED: glutathione S-transferase-like          255   3e-80   
gb|EPS69720.1|  hypothetical protein M569_05047                         254   4e-80   
ref|XP_010069957.1|  PREDICTED: glutathione S-transferase-like          253   2e-79   
gb|AAF65767.1|AF242309_1  glutathione S-transferase                     253   3e-79   Euphorbia esula [wolf's milk]
ref|XP_010684411.1|  PREDICTED: glutathione S-transferase-like          252   4e-79   
dbj|BAM21532.1|  glutathione S-transferase-like protein                 252   5e-79   
gb|KDO87317.1|  hypothetical protein CISIN_1g038052mg                   252   5e-79   
gb|EPS58503.1|  hypothetical protein M569_16312                         251   9e-79   
ref|XP_006444272.1|  hypothetical protein CICLE_v10024356mg             251   1e-78   
ref|XP_007050853.1|  Glutathione S-transferase 7 isoform 2              250   2e-78   
gb|KHG05656.1|  Glutathione S-transferase F6 -like protein              250   3e-78   
prf||1906389A  glutathione S-transferase                                249   6e-78
gb|KCW58502.1|  hypothetical protein EUGRSUZ_H01176                     249   7e-78   
gb|ABK32074.1|  glutathione-S-transferase                               249   7e-78   Acanthus ebracteatus
ref|XP_006444273.1|  hypothetical protein CICLE_v10022212mg             249   8e-78   
sp|Q04522.3|GSTF_SILVU  RecName: Full=Glutathione S-transferase; ...    249   8e-78   Silene vulgaris [maiden's-tears]
emb|CDP03518.1|  unnamed protein product                                248   2e-77   
ref|XP_010667053.1|  PREDICTED: glutathione S-transferase-like          248   2e-77   
ref|XP_010522774.1|  PREDICTED: glutathione S-transferase F7-like       249   3e-77   
gb|AAC63629.2|  glutathione S-transferase (GST6)                        247   4e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010723.1|  PREDICTED: glutathione S-transferase F6-like       247   4e-77   
emb|CDX80129.1|  BnaA05g00270D                                          246   6e-77   
ref|XP_010522776.1|  PREDICTED: glutathione S-transferase F6-like       246   1e-76   
gb|AAY84147.1|  glutathione S-transferase                               246   1e-76   Catharanthus roseus [chatas]
ref|XP_009142506.1|  PREDICTED: glutathione S-transferase F8, chl...    245   2e-76   
ref|XP_002880321.1|  glutathione S-transferase                          245   2e-76   
ref|XP_010041099.1|  PREDICTED: glutathione S-transferase-like          244   8e-76   
dbj|BAJ33833.1|  unnamed protein product                                243   9e-76   
ref|XP_006387912.1|  hypothetical protein POPTR_0483s00220g             243   1e-75   
ref|XP_006386754.1|  glutathione S-transferase family protein           243   1e-75   
gb|KFK42653.1|  hypothetical protein AALP_AA1G022700                    243   3e-75   
ref|XP_010507859.1|  PREDICTED: glutathione S-transferase F8, chl...    242   3e-75   
ref|XP_006397969.1|  hypothetical protein EUTSA_v10001585mg             244   5e-75   
ref|XP_011079696.1|  PREDICTED: glutathione S-transferase-like          241   5e-75   
gb|KFK42654.1|  hypothetical protein AALP_AA1G022700                    242   6e-75   
pir||JC7899  glutathione transferase (EC 2.5.1.18) F1, Pugf - pum...    241   7e-75
ref|XP_008451607.1|  PREDICTED: glutathione S-transferase-like          241   7e-75   
gb|KDP28124.1|  hypothetical protein JCGZ_13895                         241   1e-74   
ref|XP_010518489.1|  PREDICTED: glutathione S-transferase F8, chl...    241   1e-74   
gb|ADB93065.1|  putative glutathione-s-transferase theta                241   1e-74   
ref|NP_850479.1|  glutathione S-transferase phi 8                       243   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004160543.1|  PREDICTED: glutathione S-transferase PARB-like     239   5e-74   
ref|XP_004136043.1|  PREDICTED: glutathione S-transferase PARB-like     238   9e-74   
ref|NP_171791.1|  glutathione S-transferase F7                          238   1e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAG30126.1|AF288177_1  glutathione S-transferase                     238   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480110.1|  PREDICTED: dentin sialophosphoprotein-like         249   2e-73   
ref|XP_002892136.1|  glutathione S-transferase 11                       237   2e-73   
ref|XP_007035561.1|  Phi class glutathione transferase GSTF7            237   2e-73   
emb|CDX95731.1|  BnaC03g26120D                                          236   5e-73   
emb|CDY71513.1|  BnaAnng37730D                                          238   7e-73   
ref|XP_010090798.1|  Glutathione S-transferase                          238   8e-73   
emb|CAA64613.1|  gst6                                                   235   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519349.1|  PREDICTED: glutathione S-transferase F8, chl...    235   2e-72   
ref|XP_009133827.1|  PREDICTED: glutathione S-transferase F8, chl...    236   2e-72   
gb|KFK37514.1|  hypothetical protein AALP_AA4G267100                    235   3e-72   
ref|XP_006855529.1|  hypothetical protein AMTR_s00057p00211420          234   4e-72   
ref|XP_002892139.1|  glutathione S-transferase 31                       235   5e-72   
gb|AAF61392.1|AF133894_1  glutathione S-transferase                     232   9e-72   Persea americana
ref|NP_171792.1|  glutathione S-transferase F6                          233   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305617.1|  hypothetical protein CARUB_v10010300mg             233   1e-71   
ref|XP_010545024.1|  PREDICTED: glutathione S-transferase F8, chl...    232   2e-71   
gb|AFP86475.1|  glutathione-S-transferase                               232   3e-71   
ref|XP_006294807.1|  hypothetical protein CARUB_v10023858mg             234   3e-71   
ref|XP_002892137.1|  ATGSTF6                                            231   3e-71   
emb|CDY37454.1|  BnaC08g45920D                                          233   4e-71   
ref|XP_006294806.1|  hypothetical protein CARUB_v10023858mg             233   5e-71   
gb|KFK42650.1|  hypothetical protein AALP_AA1G022400                    231   6e-71   
emb|CDY50374.1|  BnaCnng19060D                                          231   8e-71   
ref|XP_010474884.1|  PREDICTED: glutathione S-transferase F6-like       231   8e-71   
ref|XP_006306479.1|  hypothetical protein CARUB_v10012455mg             231   8e-71   
ref|XP_010545022.1|  PREDICTED: glutathione S-transferase F13           231   8e-71   
emb|CDY53015.1|  BnaC04g00150D                                          230   9e-71   
ref|XP_002872833.1|  hypothetical protein ARALYDRAFT_490313             231   1e-70   
ref|XP_009111176.1|  PREDICTED: glutathione S-transferase F6-like       230   1e-70   
dbj|BAA04553.1|  glutathione S-transferase                              230   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118738.1|  PREDICTED: glutathione S-transferase F4-like       231   1e-70   
ref|XP_009111278.1|  PREDICTED: glutathione S-transferase F3            230   1e-70   
ref|XP_010259661.1|  PREDICTED: glutathione S-transferase F13           230   2e-70   
emb|CDY32486.1|  BnaA09g51100D                                          231   2e-70   
ref|XP_010457292.1|  PREDICTED: glutathione S-transferase F6-like       230   2e-70   
ref|XP_010481374.1|  PREDICTED: glutathione S-transferase F6            229   2e-70   
emb|CDY18131.1|  BnaC05g01540D                                          229   3e-70   
ref|XP_010269471.1|  PREDICTED: glutathione S-transferase F13-like      229   3e-70   
ref|XP_006304809.1|  hypothetical protein CARUB_v10012427mg             229   4e-70   
emb|CDY07850.1|  BnaC03g47720D                                          233   6e-70   
ref|XP_009144554.1|  PREDICTED: glutathione S-transferase F3-like       228   9e-70   
emb|CDY22058.1|  BnaA09g00870D                                          228   9e-70   
ref|XP_006418284.1|  hypothetical protein EUTSA_v10008570mg             229   9e-70   
gb|KFK30848.1|  hypothetical protein AALP_AA6G033400                    228   1e-69   
ref|XP_002876850.1|  glutathione S-transferase 16                       228   1e-69   
ref|XP_002531867.1|  glutathione-s-transferase theta, gst, putative     228   1e-69   Ricinus communis
gb|AAF02871.1|AC009525_5  Similar to glutathione S-transferases         228   2e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAP58391.1|  glutathione S-transferase 1                             228   2e-69   Brassica juncea [brown mustard]
ref|XP_006288647.1|  hypothetical protein CARUB_v10001952mg             227   2e-69   
ref|XP_010542861.1|  PREDICTED: glutathione S-transferase F4-like       229   2e-69   
emb|CDX97273.1|  BnaA02g20640D                                          227   3e-69   
ref|NP_563670.1|  glutathione S-transferase F4                          228   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111277.1|  PREDICTED: glutathione S-transferase F3-like       226   5e-69   
ref|XP_007050849.1|  Glutathione S-transferase phi 8                    226   5e-69   
ref|XP_009119597.1|  PREDICTED: glutathione S-transferase F6-like       226   5e-69   
ref|NP_849581.1|  glutathione S-transferase F4                          227   6e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119591.1|  PREDICTED: glutathione S-transferase F4 isof...    227   7e-69   
gb|KCW44647.1|  hypothetical protein EUGRSUZ_L01827                     227   7e-69   
ref|XP_009119590.1|  PREDICTED: glutathione S-transferase F4 isof...    226   1e-68   
gb|KFK42651.1|  hypothetical protein AALP_AA1G022500                    225   2e-68   
ref|XP_006396463.1|  hypothetical protein EUTSA_v10028957mg             225   2e-68   
ref|XP_010457291.1|  PREDICTED: glutathione S-transferase F6-like       224   2e-68   
ref|NP_192161.1|  glutathione S-transferase F2                          224   2e-68   Arabidopsis thaliana [mouse-ear cress]
pdb|1GNW|A  Chain A, Structure Of Glutathione S-Transferase             224   2e-68   
ref|XP_011010721.1|  PREDICTED: glutathione S-transferase F13-like      224   4e-68   
ref|XP_006386755.1|  glutathione S-transferase family protein           224   4e-68   
gb|AAM63854.1|  Atpm24.1 glutathione S transferase                      223   9e-68   Arabidopsis thaliana [mouse-ear cress]
gb|ADB11335.1|  phi class glutathione transferase GSTF7                 223   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010938431.1|  PREDICTED: glutathione S-transferase 3             223   1e-67   
ref|XP_006418286.1|  hypothetical protein EUTSA_v10008776mg             222   1e-67   
emb|CDY18136.1|  BnaC05g01590D                                          226   2e-67   
ref|XP_010481364.1|  PREDICTED: glutathione S-transferase F6-like       222   2e-67   
gb|KFK30854.1|  hypothetical protein AALP_AA6G033900                    222   2e-67   
ref|XP_010474883.1|  PREDICTED: glutathione S-transferase F6-like       221   3e-67   
gb|KFK30847.1|  hypothetical protein AALP_AA6G033300                    222   3e-67   
dbj|BAF01093.1|  putative glutathione S-transferase                     221   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481385.1|  PREDICTED: glutathione S-transferase F4-like       223   5e-67   
ref|XP_006575109.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    220   5e-67   
ref|NP_178394.1|  glutathione S-transferase F3                          221   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010269470.1|  PREDICTED: glutathione S-transferase F13-like      221   6e-67   
gb|ABM53759.1|  glutathione S-transferase                               221   7e-67   Brassica juncea [brown mustard]
ref|XP_010090796.1|  Glutathione S-transferase F13                      220   1e-66   
ref|XP_010521004.1|  PREDICTED: glutathione S-transferase F8, chl...    220   1e-66   
ref|XP_010474885.1|  PREDICTED: glutathione S-transferase F4 isof...    221   1e-66   
gb|AAP58395.1|  glutathione S-transferase 5                             220   1e-66   Brassica juncea [brown mustard]
ref|XP_006855528.1|  hypothetical protein AMTR_s00057p00211000          220   2e-66   
emb|CDY50375.1|  BnaCnng19070D                                          219   2e-66   
ref|XP_010026139.1|  PREDICTED: glutathione S-transferase-like          223   2e-66   
ref|XP_011033572.1|  PREDICTED: glutathione S-transferase F13-like      220   2e-66   
gb|AAP58393.1|  glutathione S-transferase 3                             219   2e-66   Brassica juncea [brown mustard]
ref|XP_002321020.2|  glutathione S-transferase family protein           219   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_009384404.1|  PREDICTED: glutathione S-transferase 3-like        219   2e-66   
gb|AHA33630.1|  glutathione S-transferase 6 protein                     219   3e-66   
ref|XP_010522773.1|  PREDICTED: glutathione S-transferase F4-like       219   1e-65   
ref|XP_002263386.1|  PREDICTED: glutathione S-transferase F13           217   2e-65   Vitis vinifera
gb|KFK30855.1|  hypothetical protein AALP_AA6G034000                    226   2e-65   
ref|NP_191835.1|  glutathione S-transferase F13                         217   2e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AAP58394.1|  glutathione S-transferase 4                             217   2e-65   Brassica juncea [brown mustard]
ref|XP_009150837.1|  PREDICTED: glutathione S-transferase F4-like       218   2e-65   
ref|XP_002263424.1|  PREDICTED: glutathione S-transferase F13           216   4e-65   Vitis vinifera
gb|KDP28123.1|  hypothetical protein JCGZ_13894                         216   4e-65   
ref|XP_006305553.1|  hypothetical protein CARUB_v10010097mg             217   5e-65   
gb|AAP58396.1|  glutathione S-transferase 6                             216   6e-65   Brassica juncea [brown mustard]
emb|CDX90934.1|  BnaA03g26140D                                          215   9e-65   
ref|XP_010457293.1|  PREDICTED: glutathione S-transferase F4-like...    216   1e-64   
emb|CDX89147.1|  BnaA04g00390D                                          215   1e-64   
ref|XP_009134426.1|  PREDICTED: glutathione S-transferase F3-like       214   1e-64   
ref|XP_009138718.1|  PREDICTED: glutathione S-transferase F13           215   1e-64   
gb|KEH43227.1|  glutathione S-transferase, amino-terminal domain ...    213   2e-64   
ref|XP_010456018.1|  PREDICTED: glutathione S-transferase F3            214   3e-64   
emb|CDY18016.1|  BnaC03g30880D                                          214   4e-64   
ref|XP_002878475.1|  hypothetical protein ARALYDRAFT_486776             213   5e-64   
ref|XP_010904820.1|  PREDICTED: probable glutathione S-transferas...    213   6e-64   
gb|KCW58510.1|  hypothetical protein EUGRSUZ_H01183                     214   7e-64   
ref|XP_009134427.1|  PREDICTED: glutathione S-transferase F2-like       213   1e-63   
ref|XP_008789932.1|  PREDICTED: glutathione S-transferase 3             212   1e-63   
emb|CDX93963.1|  BnaC04g21220D                                          212   2e-63   
gb|AFK38141.1|  unknown                                                 211   2e-63   
ref|XP_007050850.1|  Glutathione S-transferase 7, putative isoform 1    212   2e-63   
ref|XP_006444271.1|  hypothetical protein CICLE_v10022160mg             212   2e-63   
gb|ACT82511.1|  glutathione S-transferase                               211   3e-63   Arachis hypogaea [goober]
ref|XP_010429797.1|  PREDICTED: glutathione S-transferase F3-like       211   3e-63   
ref|XP_008373435.1|  PREDICTED: glutathione S-transferase F13-like      211   3e-63   
gb|KDO87318.1|  hypothetical protein CISIN_1g036627mg                   211   4e-63   
ref|XP_007050848.1|  Phi class glutathione transferase GSTF3            213   4e-63   
ref|XP_007223949.1|  hypothetical protein PRUPE_ppa011153mg             211   5e-63   
emb|CDY07846.1|  BnaC03g47760D                                          211   5e-63   
ref|XP_006480109.1|  PREDICTED: glutathione S-transferase F13-like      211   6e-63   
ref|XP_007209587.1|  hypothetical protein PRUPE_ppa011249mg             210   7e-63   
gb|AAY86772.1|  glutathione S-transferase                               210   8e-63   Noccaea caerulescens
ref|XP_004495978.1|  PREDICTED: glutathione S-transferase F13-like      210   1e-62   
ref|XP_002263462.2|  PREDICTED: glutathione S-transferase               209   1e-62   Vitis vinifera
gb|KHN46581.1|  Glutathione S-transferase F13                           209   2e-62   
gb|KFK35448.1|  hypothetical protein AALP_AA5G285500                    209   2e-62   
ref|XP_009365718.1|  PREDICTED: glutathione S-transferase F13           209   3e-62   
ref|XP_010921802.1|  PREDICTED: glutathione S-transferase 3-like        209   3e-62   
ref|NP_001242039.1|  uncharacterized protein LOC100815147               208   4e-62   
gb|AGC13155.1|  phi class glutathione S-transferase                     208   5e-62   
ref|XP_007201125.1|  hypothetical protein PRUPE_ppa017385mg             207   9e-62   
gb|KHG13410.1|  Glutathione S-transferase F13 -like protein             207   1e-61   
ref|XP_009381929.1|  PREDICTED: probable glutathione S-transferas...    207   1e-61   
ref|XP_007144545.1|  hypothetical protein PHAVU_007G164900g             207   2e-61   
gb|AAK64009.1|  At2g47730/F17A22.12                                     206   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402344.1|  hypothetical protein EUTSA_v10006426mg             206   3e-61   
ref|XP_006393208.1|  hypothetical protein EUTSA_v10011727mg             207   3e-61   
gb|AAP04394.1|  glutathione S-transferase F1                            204   3e-61   Nicotiana benthamiana
ref|XP_008368966.1|  PREDICTED: glutathione S-transferase F13-like      206   5e-61   
gb|AHA46521.1|  phi class glutathione S-transferase                     206   5e-61   
ref|XP_008235025.1|  PREDICTED: glutathione S-transferase F13-like      205   1e-60   
ref|XP_006435273.1|  hypothetical protein CICLE_v10002119mg             207   1e-60   
ref|XP_007050851.1|  Glutathione S-transferase 7, putative isoform 2    204   1e-60   
gb|AFF18815.2|  glutathione S-transferase                               204   2e-60   
gb|AHA46522.1|  phi class glutathione S-transferase                     204   2e-60   
dbj|BAM14585.1|  putative glutathione S-transferase                     204   2e-60   
ref|XP_009401217.1|  PREDICTED: glutathione S-transferase PARB-like     204   2e-60   
ref|XP_006473732.1|  PREDICTED: glutathione S-transferase-like          204   2e-60   
ref|XP_010424657.1|  PREDICTED: glutathione S-transferase F3-like       204   3e-60   
ref|XP_008445310.1|  PREDICTED: glutathione S-transferase F11-like      204   3e-60   
ref|XP_010062332.1|  PREDICTED: glutathione S-transferase F12           203   5e-60   
ref|XP_004290762.1|  PREDICTED: glutathione S-transferase F13-lik...    203   6e-60   
ref|XP_002510614.1|  glutathione-s-transferase theta, gst, putative     203   6e-60   
ref|XP_002892138.1|  hypothetical protein ARALYDRAFT_333621             204   6e-60   
ref|XP_006342558.1|  PREDICTED: glutathione S-transferase-like          203   7e-60   
ref|XP_010904819.1|  PREDICTED: probable glutathione S-transferas...    202   7e-60   
gb|ABD35818.1|  putative glutathione S-transferase                      200   8e-60   
gb|AGC13154.1|  phi class glutathione S-transferase                     202   8e-60   
emb|CBI32221.3|  unnamed protein product                                209   9e-60   
ref|XP_003536214.1|  PREDICTED: glutathione S-transferase F13           202   9e-60   
ref|XP_002268146.1|  PREDICTED: glutathione S-transferase PARB          202   1e-59   
gb|AGH14254.1|  glutathione S-transferase                               202   1e-59   
gb|KHG23493.1|  Glutathione S-transferase F8, chloroplastic -like...    202   1e-59   
gb|KDO84982.1|  hypothetical protein CISIN_1g027634mg                   202   1e-59   
emb|CAN69111.1|  hypothetical protein VITISV_031837                     202   1e-59   
gb|KGN62277.1|  hypothetical protein Csa_2G348150                       202   2e-59   
ref|XP_004161070.1|  PREDICTED: glutathione S-transferase F8, chl...    202   2e-59   
ref|XP_009624108.1|  PREDICTED: glutathione S-transferase-like          202   2e-59   
ref|XP_008805760.1|  PREDICTED: probable glutathione S-transferas...    201   3e-59   
gb|AGC13151.1|  phi class glutathione S-transferase                     201   4e-59   
ref|XP_004253135.1|  PREDICTED: glutathione S-transferase               201   4e-59   
ref|XP_008805761.1|  PREDICTED: probable glutathione S-transferas...    201   5e-59   
ref|XP_009803671.1|  PREDICTED: glutathione S-transferase-like          200   6e-59   
gb|AIC33066.1|  glutathione s-transferase                               200   8e-59   
ref|XP_008366579.1|  PREDICTED: glutathione S-transferase F13-like      199   9e-59   
ref|NP_175408.1|  glutathione S-transferase (class phi) 14              201   1e-58   
gb|ABK23015.1|  unknown                                                 199   1e-58   
gb|ADE76351.1|  unknown                                                 199   2e-58   
ref|XP_010038186.1|  PREDICTED: glutathione S-transferase F13           199   2e-58   
ref|XP_008238004.1|  PREDICTED: glutathione S-transferase F13-like      199   2e-58   
ref|XP_007160612.1|  hypothetical protein PHAVU_001G002000g             199   3e-58   
gb|AAL61612.1|AF401623_1  glutathione S-transferase                     198   4e-58   
dbj|BAF56180.1|  glutathione S-transferase                              197   5e-58   
gb|KFK42652.1|  hypothetical protein AALP_AA1G022600                    200   6e-58   
ref|XP_010462541.1|  PREDICTED: glutathione S-transferase F6-like       196   7e-58   
ref|XP_006853524.1|  hypothetical protein AMTR_s00032p00224770          198   9e-58   
gb|ACF85374.1|  unknown                                                 197   9e-58   
gb|EYU34184.1|  hypothetical protein MIMGU_mgv1a013345mg                197   1e-57   
ref|XP_007017931.1|  Ubiquitin-like superfamily protein isoform 3       197   1e-57   
ref|NP_001105111.1|  Glutathione transferase III(b)                     197   1e-57   
ref|XP_008386643.1|  PREDICTED: glutathione S-transferase F13-like      197   1e-57   
ref|XP_008451662.1|  PREDICTED: glutathione S-transferase F13           198   2e-57   
gb|KCW70494.1|  hypothetical protein EUGRSUZ_F03703                     196   2e-57   
gb|KEH43231.1|  glutathione S-transferase                               196   3e-57   
gb|ADE76600.1|  unknown                                                 196   3e-57   
ref|NP_171793.1|  glutathione S-transferase F5                          197   4e-57   
gb|AAF02872.1|AC009525_6  Similar to glutathione S-transferases         197   5e-57   
ref|XP_010101286.1|  Glutathione S-transferase F8                       195   5e-57   
ref|XP_004499313.1|  PREDICTED: glutathione S-transferase F8, chl...    195   6e-57   
ref|XP_009119594.1|  PREDICTED: glutathione S-transferase F5-like...    196   6e-57   
ref|XP_009119593.1|  PREDICTED: glutathione S-transferase F5-like...    196   7e-57   
ref|XP_009370587.1|  PREDICTED: glutathione S-transferase F12           195   8e-57   
ref|XP_006303611.1|  hypothetical protein CARUB_v10011289mg             196   9e-57   
pdb|1AW9|A  Chain A, Structure Of Glutathione S-Transferase Iii I...    194   9e-57   
gb|ACJ84570.1|  unknown                                                 195   1e-56   
emb|CAB38118.1|  Glutathione transferase III(a)                         194   1e-56   
gb|AGC13153.1|  phi class glutathione S-transferase                     194   1e-56   
gb|ACF82527.1|  unknown                                                 194   1e-56   
ref|XP_004291321.1|  PREDICTED: glutathione S-transferase F8, chl...    194   1e-56   
ref|XP_008368725.1|  PREDICTED: glutathione S-transferase F12-like      194   2e-56   
ref|NP_001045306.1|  Os01g0933900                                       194   2e-56   
emb|CDP07334.1|  unnamed protein product                                194   2e-56   
gb|AAL38022.1|AF443177_1  glutathionine S-transferase                   191   2e-56   
ref|XP_004971178.1|  PREDICTED: glutathione S-transferase 3-like        194   2e-56   
ref|XP_003589566.1|  Glutathione S-transferase                          194   3e-56   
gb|EYU33954.1|  hypothetical protein MIMGU_mgv1a013692mg                193   4e-56   
gb|ADM74484.1|  glutathione S-transferase-like protein                  192   4e-56   
gb|AHA46527.1|  phi class glutathione S-transferase                     192   5e-56   
gb|ADP95085.1|  glutathione S-transferase-like protein                  192   6e-56   
gb|EPS74341.1|  hypothetical protein M569_00413                         192   7e-56   
gb|ADP95094.1|  glutathione S-transferase-like protein                  192   9e-56   
gb|ADP95078.1|  glutathione S-transferase-like protein                  192   9e-56   
gb|ADP95071.1|  glutathione S-transferase-like protein                  192   9e-56   
gb|AGC13150.1|  phi class glutathione S-transferase                     192   1e-55   
ref|XP_006430394.1|  hypothetical protein CICLE_v10012739mg             192   1e-55   
emb|CDP21282.1|  unnamed protein product                                191   1e-55   
ref|XP_009336611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    198   1e-55   
gb|ABK21297.1|  unknown                                                 192   1e-55   
gb|ADM74486.1|  glutathione S-transferase-like protein                  191   1e-55   
gb|ACN40286.1|  unknown                                                 191   1e-55   
gb|ADM74477.1|  glutathione S-transferase-like protein                  191   2e-55   
gb|ADM74493.1|  glutathione S-transferase-like protein                  191   2e-55   
gb|AAG32476.1|AF309383_1  putative glutathione S-transferase OsGSTF4    191   2e-55   
gb|AAG34811.1|AF243376_1  glutathione S-transferase GST 21              191   2e-55   
ref|XP_006828869.1|  hypothetical protein AMTR_s00001p00173570          191   2e-55   
ref|XP_009112248.1|  PREDICTED: glutathione S-transferase F14           192   2e-55   
gb|KDP36862.1|  hypothetical protein JCGZ_08153                         191   2e-55   
gb|ADM74498.1|  glutathione S-transferase-like protein                  191   3e-55   
ref|XP_003600650.1|  Glutathione S-transferase                          191   3e-55   
gb|ADP95100.1|  glutathione S-transferase-like protein                  191   3e-55   
ref|XP_004300542.1|  PREDICTED: glutathione S-transferase F13-like      191   3e-55   
gb|ADM74482.1|  glutathione S-transferase-like protein                  191   3e-55   
dbj|BAJ85232.1|  predicted protein                                      191   3e-55   
gb|ADP95082.1|  glutathione S-transferase-like protein                  190   4e-55   
gb|ADP95089.1|  glutathione S-transferase-like protein                  190   4e-55   
gb|ADP95068.1|  glutathione S-transferase-like protein                  190   4e-55   
gb|AHA46524.1|  phi class glutathione S-transferase                     190   4e-55   
ref|XP_003565017.1|  PREDICTED: glutathione S-transferase 3-like        191   4e-55   
ref|NP_001106075.1|  glutathione S-transferase 3                        190   5e-55   
gb|ADP95072.1|  glutathione S-transferase-like protein                  189   6e-55   
ref|XP_003567436.2|  PREDICTED: glutathione S-transferase 3             190   7e-55   
ref|XP_002882279.1|  glutathione S-transferase F11                      190   7e-55   
gb|ADM74495.1|  glutathione S-transferase-like protein                  189   7e-55   
gb|ACL37469.1|  phi class glutathione transferase                       189   9e-55   
gb|AHA46525.1|  phi class glutathione S-transferase                     189   1e-54   
gb|ADM74485.1|  glutathione S-transferase-like protein                  189   1e-54   
dbj|BAM21533.1|  glutathione S-transferase like protein                 189   2e-54   
ref|XP_007146992.1|  hypothetical protein PHAVU_006G087500g             189   2e-54   
ref|XP_007215953.1|  hypothetical protein PRUPE_ppa011307mg             189   2e-54   
ref|XP_007141437.1|  hypothetical protein PHAVU_008G195500g             189   2e-54   
gb|EMT08743.1|  hypothetical protein F775_32323                         189   2e-54   
gb|AHA46526.1|  phi class glutathione S-transferase                     189   2e-54   
ref|XP_002301942.1|  hypothetical protein POPTR_0002s01660g             188   2e-54   
ref|XP_007141436.1|  hypothetical protein PHAVU_008G195400g             188   2e-54   
ref|XP_010270817.1|  PREDICTED: glutathione S-transferase F12-like      188   2e-54   
gb|ADM74517.1|  glutathione S-transferase-like protein                  188   3e-54   
gb|KEH33682.1|  glutathione S-transferase                               188   3e-54   
gb|ADM74487.1|  glutathione S-transferase-like protein                  188   3e-54   
ref|XP_009119592.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    189   3e-54   
ref|XP_010035935.1|  PREDICTED: glutathione S-transferase F9-like       188   3e-54   
gb|ACJ86198.1|  unknown                                                 188   4e-54   
gb|ADB11336.1|  phi class glutathione transferase GSTF8                 187   4e-54   
emb|CDM86048.1|  unnamed protein product                                187   4e-54   
gb|ADE76841.1|  unknown                                                 187   4e-54   
gb|ADM74481.1|  glutathione S-transferase-like protein                  187   5e-54   
ref|XP_006646651.1|  PREDICTED: glutathione S-transferase 3-like        188   5e-54   
ref|XP_006393207.1|  hypothetical protein EUTSA_v10012273mg             189   5e-54   
ref|XP_004503099.1|  PREDICTED: glutathione S-transferase F11-like      187   7e-54   
ref|NP_001275781.1|  uncharacterized protein LOC102625825               187   8e-54   
ref|XP_009389188.1|  PREDICTED: glutathione S-transferase-like          188   9e-54   
gb|AAL47688.1|  glutathione-S-transferase 19E50                         187   1e-53   
ref|XP_007141438.1|  hypothetical protein PHAVU_008G195600g             187   1e-53   
ref|XP_006298522.1|  hypothetical protein CARUB_v10014608mg             187   1e-53   
ref|NP_001043061.1|  Os01g0371500                                       187   1e-53   
ref|XP_006372485.1|  putative glutathione S-transferase family pr...    186   1e-53   
gb|KDP22743.1|  hypothetical protein JCGZ_02402                         186   2e-53   
gb|KEH33687.1|  glutathione S-transferase, amino-terminal domain ...    186   2e-53   
gb|KHG21992.1|  Glutathione S-transferase F9 -like protein              186   2e-53   
ref|XP_004288578.1|  PREDICTED: glutathione S-transferase F11-like      186   2e-53   
ref|XP_010272271.1|  PREDICTED: glutathione S-transferase F10-like      186   2e-53   
gb|ABX65441.1|  glutathione S-transferase                               186   2e-53   
gb|AHA46523.1|  phi class glutathione S-transferase                     186   2e-53   
ref|XP_010935200.1|  PREDICTED: glutathione S-transferase F8, chl...    186   3e-53   
ref|XP_002891537.1|  hypothetical protein ARALYDRAFT_474117             187   3e-53   
ref|XP_004499970.1|  PREDICTED: glutathione S-transferase F9-like       186   3e-53   
ref|XP_003558871.1|  PREDICTED: glutathione S-transferase F11-like      186   3e-53   
ref|XP_008227889.1|  PREDICTED: glutathione S-transferase F11-like      186   3e-53   
gb|AFK48920.1|  unknown                                                 185   3e-53   
gb|AEX37999.1|  glutathione transferase                                 185   3e-53   
ref|XP_009631630.1|  PREDICTED: glutathione S-transferase F11           186   3e-53   
ref|XP_011038319.1|  PREDICTED: glutathione S-transferase F12-like      185   4e-53   
ref|XP_011034942.1|  PREDICTED: glutathione S-transferase F11-like      185   4e-53   
ref|XP_002465909.1|  hypothetical protein SORBIDRAFT_01g047970          185   5e-53   
gb|ABY84869.1|  glutathione S transferase 1                             185   5e-53   
ref|XP_004985806.1|  PREDICTED: glutathione S-transferase F11-like      185   5e-53   
ref|XP_007146198.1|  hypothetical protein PHAVU_006G020800g             185   7e-53   
ref|XP_010549805.1|  PREDICTED: glutathione S-transferase F11-like      184   7e-53   
emb|CAD29478.1|  glutathione transferase F5                             184   8e-53   
gb|ABR25713.1|  glutathione s-transferase gstf2                         184   8e-53   
ref|XP_008648145.1|  PREDICTED: glutathione transferase10 isoform X1    184   9e-53   
gb|KFK37760.1|  hypothetical protein AALP_AA3G026300                    184   9e-53   
dbj|BAJ90031.1|  predicted protein                                      184   1e-52   
ref|XP_003538377.1|  PREDICTED: glutathione S-transferase F11-like      184   1e-52   
ref|XP_007146224.1|  hypothetical protein PHAVU_006G022600g             184   1e-52   
ref|XP_010501295.1|  PREDICTED: glutathione S-transferase F6-like       182   1e-52   
ref|XP_011097023.1|  PREDICTED: glutathione S-transferase F12           184   1e-52   
ref|XP_010035942.1|  PREDICTED: glutathione S-transferase F9-like       183   2e-52   
ref|XP_004303893.1|  PREDICTED: glutathione S-transferase F9-like...    183   2e-52   
gb|KDO57306.1|  hypothetical protein CISIN_1g041226mg                   183   2e-52   
gb|KCW47449.1|  hypothetical protein EUGRSUZ_K01234                     183   3e-52   
ref|XP_010549801.1|  PREDICTED: glutathione S-transferase F12-like      183   3e-52   
gb|ABY84871.1|  glutathione S transferase 2                             182   4e-52   
gb|EMT15915.1|  hypothetical protein F775_26054                         182   5e-52   
gb|KDP20539.1|  hypothetical protein JCGZ_04912                         182   5e-52   
gb|AFK48087.1|  unknown                                                 182   5e-52   
ref|XP_006484981.1|  PREDICTED: glutathione S-transferase F9-like       182   5e-52   
ref|XP_007146234.1|  hypothetical protein PHAVU_006G023500g             182   5e-52   
ref|XP_006649352.1|  PREDICTED: glutathione S-transferase F11-like      182   5e-52   
emb|CAD29476.1|  glutathione transferase F3                             182   7e-52   
ref|XP_004290761.1|  PREDICTED: glutathione S-transferase F13-lik...    183   8e-52   
gb|AAL73394.1|AF430069_1  glutathione transferase                       182   8e-52   
ref|XP_004968765.1|  PREDICTED: probable glutathione S-transferas...    182   8e-52   
ref|XP_002989538.1|  hypothetical protein SELMODRAFT_184606             182   8e-52   
gb|ACN38271.1|  glutathione S-transferase                               181   9e-52   
gb|KFK37761.1|  hypothetical protein AALP_AA3G026400                    182   9e-52   
ref|NP_001267869.1|  glutathione S-transferase                          181   9e-52   
gb|AAG32477.1|AF309384_1  putative glutathione S-transferase OsGSTF3    181   1e-51   
gb|KFK37762.1|  hypothetical protein AALP_AA3G026500                    181   1e-51   
dbj|BAM14584.1|  glutathione S-transferase for anthocyanin accumu...    181   1e-51   
ref|XP_010485656.1|  PREDICTED: glutathione S-transferase F11 iso...    181   1e-51   
gb|AGC13149.1|  phi class glutathione S-transferase                     181   2e-51   
ref|XP_008380180.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    181   2e-51   
ref|NP_001048886.1|  Os03g0135300                                       181   2e-51   
ref|XP_009377092.1|  PREDICTED: glutathione S-transferase F9-like       181   2e-51   
dbj|BAJ98413.1|  predicted protein                                      181   2e-51   
ref|XP_007032197.1|  Glutathione S-transferase F11                      181   2e-51   
gb|EMT17166.1|  hypothetical protein F775_30918                         181   2e-51   
ref|XP_010035938.1|  PREDICTED: glutathione S-transferase F9-like...    183   2e-51   
ref|XP_010035939.1|  PREDICTED: glutathione S-transferase F9-like...    182   2e-51   
gb|AAO61853.1|  glutathione S-transferase F1                            179   3e-51   
ref|XP_002448534.1|  hypothetical protein SORBIDRAFT_06g028630          181   3e-51   
ref|XP_007215944.1|  hypothetical protein PRUPE_ppa011246mg             180   3e-51   
ref|XP_010457294.1|  PREDICTED: glutathione S-transferase F4-like...    181   3e-51   
ref|XP_002272053.1|  PREDICTED: glutathione S-transferase F11           180   3e-51   
gb|EAY88429.1|  hypothetical protein OsI_09893                          180   4e-51   
gb|EAY96557.1|  hypothetical protein OsI_18462                          180   4e-51   
gb|EMS47979.1|  putative glutathione S-transferase GSTF1                180   4e-51   
gb|KHN13182.1|  Glutathione S-transferase F9                            180   4e-51   
ref|NP_001239642.1|  glutathione S-transferase GST 22                   180   5e-51   
ref|XP_006484982.1|  PREDICTED: glutathione S-transferase F9-like       179   6e-51   
ref|XP_010270745.1|  PREDICTED: glutathione S-transferase F11-like      179   6e-51   
gb|EPS73710.1|  hypothetical protein M569_01048                         179   6e-51   
gb|EYU33332.1|  hypothetical protein MIMGU_mgv1a013599mg                179   7e-51   
ref|XP_010453905.1|  PREDICTED: glutathione S-transferase F12-like      179   7e-51   
ref|XP_006644754.1|  PREDICTED: probable glutathione S-transferas...    179   7e-51   
ref|XP_010035940.1|  PREDICTED: glutathione S-transferase F9-like       179   7e-51   
gb|KHG09927.1|  Glutathione S-transferase F12 -like protein             179   8e-51   



>ref|XP_009758138.1| PREDICTED: glutathione S-transferase PARB [Nicotiana sylvestris]
Length=213

 Score =   302 bits (774),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG+ MSTATMRV ACL+EK LDF+FV +DM +  HK+ P+LSLNPFGQVPAFEDG
Sbjct  1    MAIKVHGSPMSTATMRVAACLIEKELDFEFVPVDMASGEHKKHPYLSLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+  A+ G  L+ +DPKKM + SVWMEVE   F+P A+ LTWELGI
Sbjct  61   DLKLFESRAITQYIAHVYADNGYQLILQDPKKMPSMSVWMEVEGQKFEPPATKLTWELGI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+IGM TD+  V++++ +LSKVLD+YE RL  SKYLGGD F+L DLHH+PNI+ LM ++
Sbjct  121  KPIIGMTTDDAAVKESEAQLSKVLDIYETRLAESKYLGGDSFTLVDLHHIPNIYYLMSSK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K +F SRP VSAW  DI +RPAW+K +E L++
Sbjct  181  VKEVFDSRPRVSAWCADILARPAWVKGLEKLQK  213



>sp|P30109.1|GSTF1_TOBAC RecName: Full=Glutathione S-transferase PARB; AltName: Full=GST 
class-phi [Nicotiana tabacum]
 dbj|BAA01394.1| glutathione S-transferase [Nicotiana tabacum]
Length=213

 Score =   300 bits (769),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG+ MSTATMRV ACL+EK LDF+FV +DM +  HK+ P+LSLNPFGQVPAFEDG
Sbjct  1    MAIKVHGSPMSTATMRVAACLIEKELDFEFVPVDMASGEHKKHPYLSLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+  A+ G  L+ +DPKKM + SVWMEVE   F+P A+ LTWELGI
Sbjct  61   DLKLFESRAITQYIAHVYADNGYQLILQDPKKMPSMSVWMEVEGQKFEPPATKLTWELGI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+IGM TD+  V++++ +LSKVLD+YE +L  SKYLGGD F+L DLHH+PNI+ LM ++
Sbjct  121  KPIIGMTTDDAAVKESEAQLSKVLDIYETQLAESKYLGGDSFTLVDLHHIPNIYYLMSSK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K +F SRP VSAW  DI +RPAW+K +E L++
Sbjct  181  VKEVFDSRPRVSAWCADILARPAWVKGLEKLQK  213



>ref|XP_009600539.1| PREDICTED: glutathione S-transferase APIC [Nicotiana tomentosiformis]
 sp|P46440.1|GSTF2_TOBAC RecName: Full=Glutathione S-transferase APIC; AltName: Full=GST 
class-phi [Nicotiana tabacum]
 dbj|BAA06150.1| api2 [Nicotiana tabacum]
 prf||2106387B Al-induced protein
Length=213

 Score =   298 bits (764),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG+ MSTATMRV ACL+EK LDF+ V +DM +  HK+ P+LSLNPFGQVPAFEDG
Sbjct  1    MAIKVHGSPMSTATMRVAACLIEKDLDFELVPVDMVSGEHKKHPYLSLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+  A+ G  L+ +DPKKM   SVWMEVE   F+P AS LTWELGI
Sbjct  61   DLKLFESRAITQYIAHVYADNGYQLILQDPKKMPIMSVWMEVEGQKFEPHASKLTWELGI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+IGM TD+  V++++ +LSKVLD+YE RL  SKYLGGD F+L DLHH+PNI+ LM T+
Sbjct  121  KPIIGMTTDDDAVKESEVQLSKVLDIYETRLAESKYLGGDSFTLVDLHHIPNIYYLMSTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K +F SRP VSAW  DI +RPAW+K +E L++
Sbjct  181  VKEVFDSRPRVSAWCADILARPAWVKGLEKLQK  213



>emb|CAA96431.1| glutathione S-transferase [Nicotiana plumbaginifolia]
Length=203

 Score =   297 bits (761),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG+ MSTATMRV ACL+EK LDF+FV +DM +  HK+ P+LSLNPFGQVPAFEDG
Sbjct  1    MAIKVHGSPMSTATMRVAACLIEKDLDFEFVPVDMASGEHKKLPYLSLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+  A+ G  L+ +DPKKM   SVWMEVE   FDP AS LT+ELGI
Sbjct  61   DLKLFESRAITQYIAHVYADNGYQLILQDPKKMPIMSVWMEVEGQKFDPPASKLTFELGI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+IGM TD+  V++++E+LSKVLD+YE RL  SKYLGGD F+L DLHH+PNI+ LM T+
Sbjct  121  KPIIGMTTDDAAVKESEEQLSKVLDIYETRLAESKYLGGDSFTLVDLHHIPNIYYLMSTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPA  348
            +K +F SRP VSAW  DI +RPA
Sbjct  181  VKEVFDSRPRVSAWCADILARPA  203



>ref|XP_011079702.1| PREDICTED: glutathione S-transferase-like [Sesamum indicum]
Length=214

 Score =   298 bits (762),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG+  STA MRV ACL EKGL+++FV +DM A  HK+EPFLSLNPFGQVPAFEDG
Sbjct  1    MAIKVHGSAFSTAAMRVFACLNEKGLEYEFVPVDMRAGEHKKEPFLSLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRA+ QYIA+  A+KGN L+C+DP+KMA  S+WMEVE   +D +A+ LTWEL I
Sbjct  61   DLKLFESRAVNQYIAHAYADKGNPLICQDPRKMAIVSLWMEVEAQKYDASAAKLTWELII  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM+TD+ IVE+ + +L+KVLDVYE RL +SKYLGGD FSLADLHHLP ++ LMGT+
Sbjct  121  KPLLGMSTDDAIVEEQEVQLAKVLDVYEARLAQSKYLGGDNFSLADLHHLPTMNYLMGTR  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K  F +RP+VS+W  DI +RPAW K+V
Sbjct  181  VKETFDARPHVSSWCADILARPAWQKVV  208



>ref|XP_006359403.1| PREDICTED: glutathione S-transferase APIC-like [Solanum tuberosum]
Length=214

 Score =   296 bits (757),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 174/214 (81%), Gaps = 1/214 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  +STATMRVV+CL+EK LDF+FV +DM  + HK+ PFLSLNPF QVPAFEDG
Sbjct  1    MAIKVHGIPLSTATMRVVSCLIEKDLDFEFVFVDMANEEHKKHPFLSLNPFAQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+ G  L+ +DPKKMA  S+WMEVE   F+P AS LTWEL I
Sbjct  61   DLKLFESRAITQYIAHTYASNGIQLILQDPKKMAIMSIWMEVEGQKFEPLASKLTWELVI  120

Query  596  KPVIGM-ATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            KP+IGM +T++ IV++++E+LSKVLD+YE RL  SKYLGGD F+L DLHH+PNI+ LM T
Sbjct  121  KPMIGMGSTNDDIVKESEEQLSKVLDIYETRLTESKYLGGDSFTLVDLHHIPNIYHLMNT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            + K LF SRP VSAW  DI +RPAW+K +E L++
Sbjct  181  KAKALFDSRPRVSAWCADILARPAWMKGLEKLQK  214



>ref|XP_011079699.1| PREDICTED: glutathione S-transferase-like [Sesamum indicum]
Length=214

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHGN +STA MRV ACL EKGL+++FV +DM A  HK+EPFLSLNPFGQVPAFEDG
Sbjct  1    MAIKVHGNAISTAVMRVFACLNEKGLEYEFVPVDMRAGEHKKEPFLSLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRA+ QYIA+  A+KGN L+C+DPKKMA  S+WMEVE   +D  A+ L  E  I
Sbjct  61   DLKLFESRAVNQYIAHAYADKGNPLICQDPKKMAIVSLWMEVEAQKYDVPAAKLVREFII  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM+TD+ IVE+ + +L+KVLDVYE RL +SKYLGGD FSLADLHHLP ++ LMGT+
Sbjct  121  KPLLGMSTDDAIVEEQEVQLAKVLDVYEARLAQSKYLGGDSFSLADLHHLPTMNYLMGTR  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            IK +F +RP+VS+W  DI  RPAW K+V
Sbjct  181  IKAVFDARPHVSSWCADIMGRPAWQKVV  208



>ref|XP_010259660.1| PREDICTED: glutathione S-transferase-like [Nelumbo nucifera]
Length=215

 Score =   293 bits (751),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 170/215 (79%), Gaps = 1/215 (0%)
 Frame = -2

Query  956  MAI-KVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFED  780
            MA+ KVHG+  STAT RVVACL EKG+ F+F  +DM +  HK+EPFLSLNPFGQVPAFE+
Sbjct  1    MAVPKVHGSVFSTATNRVVACLHEKGIAFEFSPVDMRSGAHKKEPFLSLNPFGQVPAFEE  60

Query  779  GDLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            GDL+LFESRAIT+YIA+     G  L+ ++PKKMA  +VWMEVE H FDPA+SAL WEL 
Sbjct  61   GDLKLFESRAITKYIAHEYQESGTELIYKEPKKMAILAVWMEVEAHQFDPASSALAWELV  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
             KP+ GM TD   VEQN+ +LSKVLDVYE RL  SKYL GD F+LADLHHLPNI+CLMGT
Sbjct  121  FKPMFGMTTDAATVEQNEAKLSKVLDVYEARLSESKYLAGDCFTLADLHHLPNINCLMGT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKET  315
             +K LF+SRP+V+AW  DI SRPAW K++E  K++
Sbjct  181  PVKKLFESRPHVNAWCSDILSRPAWSKVLETQKQS  215



>sp|P46423.1|GSTF_HYOMU RecName: Full=Glutathione S-transferase; AltName: Full=25 kDa 
auxin-binding protein; AltName: Full=GST class-phi [Hyoscyamus 
muticus]
 emb|CAA55039.1| glutathione transferase [Hyoscyamus muticus]
Length=212

 Score =   293 bits (750),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +K+HG  MS A MRV+A L EK LDF+ V ++M A  HK+EPF++LNPFGQVPAFEDG
Sbjct  1    MGMKLHGPAMSPAVMRVIATLKEKDLDFELVPVNMQAGDHKKEPFITLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KGN L+  DPKKMA  SVWMEVE+  FDP AS LT+E+ I
Sbjct  61   DLKLFESRAITQYIAHTYADKGNQLLANDPKKMAIMSVWMEVESQKFDPVASKLTFEIVI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM TD+  V +N+E+L KVLDVYE+RL  SKYLGGD F+LADLHH P ++ LMGT+
Sbjct  121  KPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPAMNYLMGTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEW  327
            +K+LF SRP+VSAW  DI +RPAW K +E+
Sbjct  181  VKSLFDSRPHVSAWCADILARPAWSKAIEY  210



>gb|EYU46696.1| hypothetical protein MIMGU_mgv1a013633mg [Erythranthe guttata]
Length=214

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG+  STA MRV ACL EKGLDF+FV +DM +  HK+E FLSLNPFGQVPAFEDG
Sbjct  1    MAIKVHGSTFSTAAMRVFACLNEKGLDFEFVPVDMRSGAHKKESFLSLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL LFESRAI QYIA+T A+ G  L+  DPKKMA A+VW EVE   FD  AS LTWELG+
Sbjct  61   DLNLFESRAINQYIAHTYADNGTPLLYLDPKKMAIATVWAEVEAQKFDGPASKLTWELGL  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GMATD+ +VEQ +  L KVLDVYE RL  SKYLGGD F+LADLHHLP +  LM T+
Sbjct  121  KPLLGMATDDAVVEQQEALLCKVLDVYEARLAESKYLGGDRFTLADLHHLPTMSYLMATR  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K  F SRP+VSAW  DIS+RPAW K+V
Sbjct  181  VKACFDSRPHVSAWCADISARPAWEKVV  208



>ref|XP_004240536.1| PREDICTED: glutathione S-transferase [Solanum lycopersicum]
Length=213

 Score =   291 bits (744),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  MS A MRVVA L EK LDF+ V ++M A  HK+EPF+SLNPFGQVPAFEDG
Sbjct  1    MAIKVHGPMMSPAVMRVVATLKEKDLDFELVPVNMQAGDHKKEPFISLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KGN L+  DPKKMA  SVWMEVE   FDP  S L +E+ I
Sbjct  61   DLKLFESRAITQYIAHTYADKGNQLLPNDPKKMAVMSVWMEVEAQKFDPIGSKLGFEIVI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM TD+ +V +N+E+L K+LDVYE+RL  SKYLGG+ F+LADLHH P++H L G++
Sbjct  121  KPMLGMVTDDAVVAENEEKLGKLLDVYESRLKESKYLGGESFTLADLHHAPSLHYLSGSK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K+LF +RP+VSAW  DI +RPAW K +E  K+
Sbjct  181  VKSLFDARPHVSAWVADILARPAWSKTIELSKQ  213



>ref|XP_008235033.1| PREDICTED: glutathione S-transferase-like [Prunus mume]
Length=252

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 169/218 (78%), Gaps = 2/218 (1%)
 Frame = -2

Query  980  IIVSQH--IFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNP  807
            ++V  H  +   IKV+GN +STA MRV A L EK ++F+FV +DM A  HK+EP +SLNP
Sbjct  31   LLVPNHNTVMATIKVYGNTVSTAAMRVFAALYEKDIEFEFVPVDMRAGEHKKEPIISLNP  90

Query  806  FGQVPAFEDGDLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPA  627
            FGQ+PAFEDGDL+LFESRAITQYIA+   +KG  LV  D KKMA  SVW EVE   FDPA
Sbjct  91   FGQIPAFEDGDLKLFESRAITQYIAHEYFDKGTQLVIRDSKKMAILSVWTEVEGQKFDPA  150

Query  626  ASALTWELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHL  447
            AS LTWELGIKP++GM TD  +VE+ + +L+ VLDVYE RL +SKYLGGD F+LADLHHL
Sbjct  151  ASKLTWELGIKPLLGMPTDSAVVEEYEAKLAAVLDVYEARLAQSKYLGGDSFTLADLHHL  210

Query  446  PNIHCLMGTQIKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            P IH L+GTQ K LF+SRP+VSAW  +I++RPAW K++
Sbjct  211  PTIHYLIGTQSKKLFESRPHVSAWVANITARPAWNKVI  248



>ref|XP_004247442.2| PREDICTED: glutathione S-transferase PARB-like [Solanum lycopersicum]
Length=214

 Score =   290 bits (742),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 170/214 (79%), Gaps = 1/214 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  +STATMRV++CL+EK LDF+FV +DM  + HK+ PFLSLNPF QVPAFEDG
Sbjct  1    MAIKVHGIPLSTATMRVISCLIEKDLDFEFVFVDMAKEEHKRHPFLSLNPFAQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA   A+ G  L+ +DP KMA  SVWMEVE   F+P AS LTWEL I
Sbjct  61   DLKLFESRAITQYIAQVYASNGIQLILQDPMKMAIMSVWMEVEGQKFEPPASKLTWELVI  120

Query  596  KPVIGM-ATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            KP+IG+ +TD+ IV++++E+LSKVLD+YE RL  SKYLGGD F+L DLHH+PNI+ LM T
Sbjct  121  KPMIGLGSTDDVIVKESEEQLSKVLDIYETRLTESKYLGGDSFTLVDLHHIPNIYHLMNT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            + K LF SRP VS W  DI +RPAW+K +E +++
Sbjct  181  KAKALFDSRPRVSVWCADILARPAWVKGLEKMQK  214



>gb|ABQ96853.1| glutathione S-transferase [Solanum tuberosum]
Length=213

 Score =   290 bits (741),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  MS A +RVVA L EK LDF+F+ +D+    HK+EPF+SLNPFGQ PAFEDG
Sbjct  1    MAIKVHGPMMSPAVVRVVATLNEKNLDFEFIHVDLQKGDHKKEPFISLNPFGQAPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KGN L+  DPKKMA  SVW+EVE   FDP  S L++E+ I
Sbjct  61   DLKLFESRAITQYIAHTYADKGNQLLPNDPKKMAIMSVWIEVEAQKFDPVGSKLSYEIVI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM +D+ IV +N+E+LSK+LDVYE+R   SKYLGGD F+LADLHH P +H L+GT+
Sbjct  121  KPMLGMVSDDAIVTENEEKLSKLLDVYESRFKNSKYLGGDSFTLADLHHAPVLHYLIGTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K+LF SRP+VSAW  DI +RPAW K +E  K+
Sbjct  181  MKSLFNSRPHVSAWVADILARPAWSKTLELSKQ  213



>ref|XP_009789274.1| PREDICTED: glutathione S-transferase [Nicotiana sylvestris]
Length=213

 Score =   290 bits (741),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 168/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  MS A MRV+A L EK LDF+ + ++M    HK+EPF+SLNPFGQVPAFEDG
Sbjct  1    MAIKVHGPVMSPAVMRVIATLKEKELDFELLPVNMQTGDHKKEPFISLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KGN L+  DPKKMA  SVWMEVE+  FDP AS L++EL +
Sbjct  61   DLKLFESRAITQYIAHTYADKGNQLLANDPKKMAIMSVWMEVESTKFDPIASKLSFELAV  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM TD+  V +N+E+L K+LDVYE+RL  SKYLGG+ F+LADLHH P +H LMGT+
Sbjct  121  KPMLGMVTDDAAVAENEEKLGKILDVYESRLKESKYLGGESFTLADLHHAPVVHYLMGTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K LF +RP+V AW  DI +RPAW K +E  K+
Sbjct  181  VKNLFDARPHVKAWCADILARPAWSKALELHKQ  213



>ref|XP_007200490.1| hypothetical protein PRUPE_ppa011383mg [Prunus persica]
 gb|EMJ01689.1| hypothetical protein PRUPE_ppa011383mg [Prunus persica]
Length=213

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 163/206 (79%), Gaps = 0/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKV+G+  STA MRV A L EK ++F+FV +DM A  HK+EP +SLNPFGQ+PAFEDGDL
Sbjct  4    IKVYGSTYSTAAMRVFAALYEKDIEFEFVPVDMRAGEHKKEPIISLNPFGQIPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYIA+   +KG  LV  D KKMA  SVW EVE   FDPAAS LTWELGIKP
Sbjct  64   KLFESRAITQYIAHEYFDKGTQLVIRDSKKMAILSVWTEVEGQKFDPAASKLTWELGIKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            ++GM TD  +VE+ + +L+ VLDVYE RL +SKYLGGD F+LADLHHLP I+ LMGTQ K
Sbjct  124  LLGMPTDSAVVEEYEAKLAAVLDVYEARLAQSKYLGGDSFTLADLHHLPTINYLMGTQSK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             LF+SRP+VSAW  DI++RPAW K++
Sbjct  184  KLFESRPHVSAWVADITARPAWNKVI  209



>ref|XP_008235026.1| PREDICTED: glutathione S-transferase-like [Prunus mume]
Length=213

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 161/206 (78%), Gaps = 0/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKV+GN +STA MRV A L EK L+F F  +DM A  HK+EP +SLNPFGQ+PAFEDGDL
Sbjct  4    IKVYGNTISTAAMRVFAALYEKDLEFDFAPVDMRAGEHKKEPVISLNPFGQIPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYIA+   +KG  LV  D KKMA  SVW EVE   FDPAAS LTWELGIKP
Sbjct  64   KLFESRAITQYIAHEYFDKGTQLVIRDSKKMAILSVWTEVEGQKFDPAASKLTWELGIKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + GM TD  +VE+ + +L+ VLDVYE RL +SKYLGGD F+LADLHHLP I+ LMGTQ K
Sbjct  124  LFGMPTDSAVVEEYEAKLAAVLDVYEARLAQSKYLGGDSFTLADLHHLPTINYLMGTQSK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             LF+SRP+VSAW  DI++RPAW K++
Sbjct  184  KLFESRPHVSAWVADITARPAWNKVI  209



>gb|AAB65163.1| glutathione S-transferase, class-phi [Solanum commersonii]
Length=213

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  MS A MRVVA L EK LDF+ + ++M A  HK+EPF+SLNPFGQVPAFEDG
Sbjct  1    MAIKVHGPMMSPAVMRVVATLKEKDLDFELIPVNMQAGDHKKEPFISLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL LFESRAITQYIA+T A+KGN L+  DPKKMA  SVW+EVE   FDP  S L +E+ I
Sbjct  61   DLNLFESRAITQYIAHTYADKGNQLLPNDPKKMAIMSVWIEVEAQKFDPIGSKLGFEIVI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM TD+ +V +N+E+L K+LDVYE+RL  SKYLGG+ F+LADLHH P++H LMG++
Sbjct  121  KPMLGMVTDDAVVAENEEKLGKLLDVYESRLKESKYLGGESFTLADLHHAPSLHYLMGSK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K+LF +RP+VSAW  DI +RPAW K +E  K+
Sbjct  181  VKSLFDARPHVSAWCADILARPAWSKTLELSKQ  213



>ref|XP_011079698.1| PREDICTED: glutathione S-transferase-like [Sesamum indicum]
Length=216

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG+  S A MRV ACL EKGL+++FV +DM A  H +EPFLSLNPFGQVPAFEDG
Sbjct  1    MAIKVHGSAFSIAVMRVFACLNEKGLEYEFVRVDMRAGEHTKEPFLSLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRA+ QYIA+  A+KGN L+C+DP+KMA  S+WMEVE   +D  A+ LT EL I
Sbjct  61   DLKLFESRAVNQYIAHAYADKGNPLICQDPRKMAIVSLWMEVEAQKYDAPAAKLTRELII  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM+TD+ IVE+ + +L+KVLDVYE RL +SKYLGGD FSLADLHHLP ++ L+GT+
Sbjct  121  KPLLGMSTDDAIVEEQEVQLAKVLDVYEARLAQSKYLGGDSFSLADLHHLPTMNYLIGTR  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K +F + P+VS+W  DI +RPAW K+V
Sbjct  181  VKAVFDAHPHVSSWCADILARPAWQKVV  208



>ref|XP_006355799.1| PREDICTED: glutathione S-transferase-like [Solanum tuberosum]
Length=213

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 168/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IKVHG  MS A MRVVA L EK LDF+ V ++M +  HK+EPF+SLNPFGQVPAFEDG
Sbjct  1    MVIKVHGPMMSPAVMRVVATLKEKDLDFELVPVNMQSGDHKKEPFISLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KG  L+  DPKKMA  SVWMEVE   FDP  S L +E+ I
Sbjct  61   DLKLFESRAITQYIAHTYADKGTQLLPNDPKKMAIMSVWMEVEAQKFDPIGSKLGFEIVI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM TD+ +V +N+E+L K+LDVYE+RL  SKYLGG+ F+LADLHH P++H LMG++
Sbjct  121  KPMLGMVTDDAVVAENEEKLGKLLDVYESRLKESKYLGGESFTLADLHHAPSLHYLMGSK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K+LF +RP+VSAW  DI +RPAW K +E  K+
Sbjct  181  VKSLFDARPHVSAWCADILARPAWCKTLELSKQ  213



>gb|ABQ96852.1| glutathione S-transferase [Solanum commersonii]
Length=213

 Score =   286 bits (731),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 167/213 (78%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  MS A MRVVA L EK LDF+ + ++M    HK+EPF+SLNPFGQVPAFEDG
Sbjct  1    MAIKVHGPMMSPAVMRVVATLKEKDLDFELIPVNMQTGDHKREPFISLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KG  L+  DPKKMA  SVWMEVE   FDP  S L +E+ I
Sbjct  61   DLKLFESRAITQYIAHTYADKGTQLLPNDPKKMAIMSVWMEVEAQKFDPVGSKLGFEIVI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM TD+ +V +N+E+L K+LDVYE+RL  SKYLGG+ F+LADLHH P++H LMG++
Sbjct  121  KPMLGMVTDDAVVAENEEKLGKLLDVYESRLKESKYLGGESFTLADLHHAPSLHYLMGSK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K+LF +RP+VS W  DI +RPAW K +E  K+
Sbjct  181  VKSLFDARPHVSVWCADILARPAWSKTLELSKQ  213



>ref|XP_010259659.1| PREDICTED: glutathione S-transferase-like [Nelumbo nucifera]
Length=297

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 165/219 (75%), Gaps = 0/219 (0%)
 Frame = -2

Query  974  VSQHIFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQV  795
            +SQ     +KVHG+ +STA  RV+ACL EKGLDF+FV +DM    HK+EPFL+LNPFGQV
Sbjct  78   LSQTAMAVLKVHGSVISTAARRVLACLYEKGLDFEFVTVDMRVGDHKKEPFLALNPFGQV  137

Query  794  PAFEDGDLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASAL  615
            PAFEDGDL+LFESRAIT+Y+A+     G  L+ +D KKMA  +VWMEVE H +DPAAS L
Sbjct  138  PAFEDGDLKLFESRAITKYLAHEYQESGTELIYKDSKKMAIQAVWMEVEAHQYDPAASKL  197

Query  614  TWELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIH  435
             WEL  KP  GM TD  +VE+N+ +L+KVLDVYE RL  SKYL GD F+LADLHHLP + 
Sbjct  198  VWELAAKPAFGMTTDAAVVEENEAKLNKVLDVYEARLSESKYLAGDCFTLADLHHLPTVT  257

Query  434  CLMGTQIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             LMGT  K LF+SRP+V+AW  DI SRPAW K+VE  K+
Sbjct  258  YLMGTPAKKLFESRPHVNAWCTDIMSRPAWTKVVEMQKQ  296



>ref|XP_008368964.1| PREDICTED: glutathione S-transferase-like [Malus domestica]
Length=213

 Score =   285 bits (728),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKVHGN +STA MRV A L EK ++F+ V IDM A  HK+EPF+SLNPFGQVPAFEDGD
Sbjct  3    AIKVHGNVISTAAMRVFATLYEKDIEFELVPIDMRAGEHKKEPFISLNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYIA+  A+KG  LV  D KKMA  S+W EVE   FDP A+ LT+EL IK
Sbjct  63   LKLFESRAITQYIAHEYADKGTPLVIRDSKKMAIJSLWSEVEAQKFDPXATKLTYELAIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+  M TD  +VE+N+ +L+ VLDVYE RL +SKYL G+ F+LADLHHLP IH LMGTQ 
Sbjct  123  PMFKMTTDAAVVEENEAKLAVVLDVYETRLAQSKYLAGESFTLADLHHLPTIHYLMGTQS  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF+SRP+V AW  DI++RPAW K+V
Sbjct  183  KKLFESRPHVLAWVADITARPAWNKVV  209



>ref|XP_008363706.1| PREDICTED: glutathione S-transferase-like [Malus domestica]
Length=213

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKVHGN +STA MRV A L EK ++F+ V IDM A  HK+EPF+SLNPFGQVPAFEDGD
Sbjct  3    AIKVHGNVISTAAMRVFATLYEKDIEFELVPIDMRAGEHKKEPFISLNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYIA+  A+KG  LV  D KKMA  S+W EVE   FDP A+ LT+EL IK
Sbjct  63   LKLFESRAITQYIAHEYADKGTPLVIRDSKKMAIJSLWSEVEAQKFDPXATKLTYELAIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+  M TD  +VE+N+ +L+ VLDVYE RL +SKYL G+ F+LADLHHLP IH LMGTQ 
Sbjct  123  PMFKMTTDAAVVEENEAKLAVVLDVYETRLAQSKYLAGESFTLADLHHLPTIHYLMGTQS  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF+SRP+V AW  DI++RPAW K+V
Sbjct  183  KKLFESRPHVLAWVXDITARPAWNKVV  209



>ref|XP_006355800.1| PREDICTED: glutathione S-transferase-like [Solanum tuberosum]
Length=212

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 167/212 (79%), Gaps = 0/212 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  +S A +RVVA L EK LDF+ + +D+    HK+EPF+SLNPFGQVPAFEDG
Sbjct  1    MAIKVHGPMLSPAVVRVVATLKEKNLDFELIHVDLQNGDHKREPFISLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KGN L+  DPKKMA   VW+EVE   F+P  S L++E+ I
Sbjct  61   DLKLFESRAITQYIAHTYADKGNQLLPNDPKKMAIMYVWIEVEAQKFEPVGSKLSYEIVI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM TD+ IV +N+E+LSK+LDVYE+RL  SKYL GD F+LADLHH P +H L+GT+
Sbjct  121  KPMLGMVTDDAIVAENEEKLSKLLDVYESRLKNSKYLSGDSFTLADLHHAPVLHYLIGTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
            +K+LF +RP+VSAW  DI +RPAW K +E  K
Sbjct  181  VKSLFNARPHVSAWVADILARPAWAKSLELTK  212



>emb|CAI51314.2| glutathione S-transferase GST1 [Capsicum chinense]
Length=213

 Score =   283 bits (723),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 165/213 (77%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  MS A MRVVA L EK L+F+ V ++M    HK+EPF++LNPFGQVPAFEDG
Sbjct  1    MAIKVHGPIMSPAVMRVVAALKEKNLEFELVPVNMQNGDHKKEPFITLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KG+ L+  DPKKMA  SVWMEVE   FDP  S L +E+ I
Sbjct  61   DLKLFESRAITQYIAHTYADKGSQLLPNDPKKMAIMSVWMEVEAQKFDPVGSKLAYEIAI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++G  TD+ IV +N+E++ K+LDVYE RL  SKYLGGD F+LADLHH P +H L GT+
Sbjct  121  KPMMGKVTDDAIVAENEEKMGKLLDVYEARLKESKYLGGDSFTLADLHHAPGLHYLFGTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K+LF +RP+VSAW  D+ +RPAW K +E  K+
Sbjct  181  VKSLFDARPHVSAWCADVLARPAWSKTLELNKQ  213



>ref|XP_006386753.1| Glutathione S-transferase 1 family protein [Populus trichocarpa]
 gb|ABK95075.1| unknown [Populus trichocarpa]
 gb|ADB11332.1| phi class glutathione transferase GSTF4 [Populus trichocarpa]
 gb|ERP64550.1| Glutathione S-transferase 1 family protein [Populus trichocarpa]
Length=213

 Score =   282 bits (722),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKVHG+ +STA  RV ACL EK L+F+F+ ++M    HK+EPFL+LNPFGQVPAFE GDL
Sbjct  5    IKVHGSTLSTAAQRVFACLYEKELEFEFIPVNMAVGEHKKEPFLALNPFGQVPAFEQGDL  64

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYIA+  A+KG  LV    K+MAT SVWMEVE H FDP AS L WEL  KP
Sbjct  65   KLFESRAITQYIAHGYADKGTPLVIPG-KQMATLSVWMEVEAHQFDPVASKLNWELVFKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G+ TD   VE+N+ +L KVLDVYE+RL +SKYLGGD F+LADLHHLPNI C M T +K
Sbjct  124  MFGIPTDNAAVEENEAKLGKVLDVYESRLAQSKYLGGDIFTLADLHHLPNISCAMRTHVK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             LF SRP+VSAW  DI+SRPAW K+V
Sbjct  184  KLFDSRPHVSAWVADITSRPAWSKVV  209



>ref|XP_008363707.1| PREDICTED: glutathione S-transferase-like [Malus domestica]
Length=213

 Score =   282 bits (721),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 160/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKVHGN +STA MRV A L EK ++F+ V IDM A  HK+EPF+SLNPFGQVPAFEDGD
Sbjct  3    AIKVHGNVISTAAMRVFATLYEKDIEFELVPIDMRAGEHKKEPFISLNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYIA+  A+KG  LV  D KKMA  S+W EVE   FDP A+ LT+EL IK
Sbjct  63   LKLFESRAITQYIAHEYADKGTPLVIRDSKKMAIJSLWSEVEAQKFDPPATKLTYELAIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+  M TD  +VE+N+ +L+ VLDVYE RL +SKYL G+ F+LADLHHLP IH LMGTQ 
Sbjct  123  PMFKMTTDAAVVEENEAKLAVVLDVYETRLAQSKYLAGESFTLADLHHLPTIHYLMGTQS  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF+SRP+V AW   I++RPAW K+V
Sbjct  183  KKLFESRPHVRAWVAYITARPAWNKVV  209



>gb|EYU46695.1| hypothetical protein MIMGU_mgv1a013389mg [Erythranthe guttata]
Length=221

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 160/208 (77%), Gaps = 0/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVH   +STA M+V+ACL EKGLD++ V IDM A  HK+E FL LNPFGQVPA+EDG
Sbjct  1    MAIKVHCTVLSTAAMKVIACLNEKGLDYEIVSIDMRAGEHKKEAFLLLNPFGQVPAYEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL++FESRAITQYIA+T A+KG  L+  DPK+MA ASVW EVE   FDP AS LTWEL  
Sbjct  61   DLKMFESRAITQYIAHTYADKGTPLIFRDPKQMAVASVWAEVEAQKFDPVASKLTWELCT  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP +GM TD  +VE+ +  LSKVLDVYE RL  SKYLGG+ F+LADLHH+P +  LMGT+
Sbjct  121  KPFLGMVTDYAVVEEQEALLSKVLDVYEARLGASKYLGGERFTLADLHHIPTMSYLMGTR  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K  F S P VSAW+ DIS+RPA  K+V
Sbjct  181  VKASFDSHPRVSAWYADISARPASEKVV  208



>ref|XP_009586784.1| PREDICTED: glutathione S-transferase [Nicotiana tomentosiformis]
Length=213

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 167/213 (78%), Gaps = 0/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  MS A MRVVA L EK LDF+ + ++M    HK+EPF+SLNPFGQVPAFEDG
Sbjct  1    MAIKVHGPVMSPAVMRVVATLKEKELDFELLPVNMQTGDHKKEPFISLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KGN L+  + KKMA  SVWMEVE+  FDP AS L++EL +
Sbjct  61   DLKLFESRAITQYIAHTYADKGNQLLANETKKMAIMSVWMEVESTKFDPIASKLSFELVV  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM TD+  V +N+E+L K+LDVYE+RL  SKYLGG+ F+LADLHH P +H LMGT+
Sbjct  121  KPMLGMVTDDAAVTENEEKLGKILDVYESRLKDSKYLGGESFTLADLHHAPVVHYLMGTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            +K+LF +RP+V  W  DI +RPAW K +E  K+
Sbjct  181  VKSLFDARPHVKDWCADILARPAWSKALELHKQ  213



>gb|ABK96715.1| unknown [Populus trichocarpa x Populus deltoides]
Length=213

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +KVHG+ +STA  RV ACL EK L+F+F+ ++M    HK+EPFL+LNPFGQVPAFE GDL
Sbjct  5    MKVHGSALSTAAQRVFACLYEKELEFEFIPVNMAVGEHKKEPFLALNPFGQVPAFEQGDL  64

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYIA+  A+KG  LV    K+MAT SVWMEVE H FDP AS L WEL  KP
Sbjct  65   KLFESRAITQYIAHGYADKGTPLVIPG-KQMATLSVWMEVEAHQFDPVASKLNWELVFKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G+ TD   VE+N+ +L KVLDVYE+RL +SKYLGGD F+LADLHHLPNI C M T +K
Sbjct  124  MFGIPTDNAAVEENEAKLGKVLDVYESRLAQSKYLGGDIFTLADLHHLPNISCAMRTHVK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             LF SRP+VSAW  DI+SRPAW K+V
Sbjct  184  KLFDSRPHVSAWVADITSRPAWSKVV  209



>ref|XP_004290763.1| PREDICTED: glutathione S-transferase-like [Fragaria vesca subsp. 
vesca]
Length=214

 Score =   280 bits (717),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG  MSTA  RV+A L EK ++F+ V IDM A  HK++ FL+LNPFGQVPAFEDGD
Sbjct  3    GIKVHGTAMSTAAARVLATLYEKEVEFELVPIDMRAGEHKKDSFLALNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYIA+  A+KG  L+  D KKMA  SVW EVE H FDPAAS L++EL IK
Sbjct  63   LQLFESRAITQYIAHEYASKGTPLIVPDSKKMAILSVWTEVEAHKFDPAASKLSYELAIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P++GM TD  +VE+ + +L  VLDVYE RL +SKYLGGD FSLADLHHLP    LMGTQ 
Sbjct  123  PLLGMVTDFAVVEEFEAKLGTVLDVYEKRLGQSKYLGGDCFSLADLHHLPTTQYLMGTQA  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF+ RPNVSAW  DI++RPAW K++
Sbjct  183  KKLFECRPNVSAWVADITARPAWTKVL  209



>ref|XP_002262604.1| PREDICTED: glutathione S-transferase [Vitis vinifera]
 emb|CBI36818.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   279 bits (714),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 158/210 (75%), Gaps = 0/210 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +KVHG+  STATMRVV+ L EKGL F+FV IDM    HK E FL+LNPFGQVPAFEDGDL
Sbjct  4    LKVHGSPFSTATMRVVSALYEKGLQFEFVSIDMKVGQHKSEAFLALNPFGQVPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYIA+  A+ G  L+C D KKMA  SVWMEVE H +DP A+ L +EL IKP
Sbjct  64   KLFESRAITQYIAHEYASNGTQLICPDSKKMAIMSVWMEVEAHQYDPHAAKLCFELCIKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            ++G+ TD   VE  + +L KVLDVYE RL +SKYLGGD   LADLHHLP +H L+G+  K
Sbjct  124  MLGLTTDPAAVEDLEAKLGKVLDVYEARLTQSKYLGGDCLGLADLHHLPTLHYLLGSSAK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             LF SRP+VSAW  DI++RPAW K++   K
Sbjct  184  KLFDSRPHVSAWVADITARPAWAKVIAMQK  213



>gb|ABK81651.1| glutathione S-transferase [Vitis vinifera]
Length=214

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 157/210 (75%), Gaps = 0/210 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +KVHG+ +STA MRVVA L EKGL+F+FV IDM A  HK E FL+LNPFGQVPAFEDGDL
Sbjct  4    LKVHGSPISTAVMRVVAALYEKGLEFEFVTIDMKAGQHKSEAFLALNPFGQVPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYIA+  A+ G  L+C D KKMA  SVW+EVE H +DP A  L +EL  KP
Sbjct  64   KLFESRAITQYIAHEYASNGTQLICPDSKKMAIMSVWIEVEAHQYDPHAGKLGYELFYKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G  TD   VE  + +L KVLDVYE RL +SKYLGGD F LADLHHLP +H L+G+  K
Sbjct  124  MFGQTTDPAAVEDLEAKLGKVLDVYEARLTQSKYLGGDCFGLADLHHLPTLHYLLGSSAK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             LF SRP+VSAW  DI++RPAW K++   K
Sbjct  184  KLFDSRPHVSAWVADITARPAWAKVIAMQK  213



>ref|XP_010665785.1| PREDICTED: glutathione S-transferase-like [Beta vulgaris subsp. 
vulgaris]
Length=214

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 159/214 (74%), Gaps = 0/214 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IK+HG+  STAT+R VA + EKGLD++FV++DM +  HKQEPF+SLNPFGQVPA EDG
Sbjct  1    MGIKIHGSPFSTATLRAVAVVEEKGLDYEFVNVDMKSGAHKQEPFISLNPFGQVPALEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            D++LFESRAI+QYIAYT  + G  L   D K+ A  +VWMEVE H FDP AS L WEL  
Sbjct  61   DVKLFESRAISQYIAYTYESSGTPLTFNDGKQRAELAVWMEVEAHQFDPVASKLAWELVY  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K + G+ TD   VE+NK +L+KVLDVYE RL  SKYL GD FSLADLHHLP +H +MGTQ
Sbjct  121  KGMFGLETDNAAVEENKAKLAKVLDVYEARLANSKYLAGDSFSLADLHHLPPLHYVMGTQ  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKET  315
            +K LF  RP+VSAW  DI +RP+W K +   K+ 
Sbjct  181  VKQLFDERPHVSAWSKDILARPSWEKSLALQKQA  214



>ref|XP_011082484.1| PREDICTED: glutathione S-transferase-like [Sesamum indicum]
Length=265

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 167/221 (76%), Gaps = 0/221 (0%)
 Frame = -2

Query  983  SIIVSQHIFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPF  804
            S  +  +  M +K+HG+  S AT RV+ACL EKGL+++FV ID+    HK+EPFLSLNPF
Sbjct  44   SFPLGHNYSMVMKLHGHPFSPATHRVMACLEEKGLEYEFVHIDLSTGQHKKEPFLSLNPF  103

Query  803  GQVPAFEDGDLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAA  624
            GQVPA EDGDL+LFESRAITQY+A   A+KG  LV +DPK+ A   VWMEVE+H FD AA
Sbjct  104  GQVPALEDGDLKLFESRAITQYLANIYADKGTPLVPQDPKEKAIVYVWMEVESHKFDAAA  163

Query  623  SALTWELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLP  444
            + L++EL  KP++GM TD+ +VE+++E+L KVLDVYE+RL  SKYLGG+ FSLAD HHLP
Sbjct  164  AKLSYELVTKPMLGMTTDDAVVEEHQEKLGKVLDVYESRLTGSKYLGGEAFSLADFHHLP  223

Query  443  NIHCLMGTQIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             +  L GT+ K LF +RPNVS W   I +RPAW K+VE +K
Sbjct  224  IVSSLFGTKTKALFDARPNVSGWCAGILARPAWQKVVEKMK  264



>ref|XP_004240537.1| PREDICTED: glutathione S-transferase-like [Solanum lycopersicum]
Length=212

 Score =   275 bits (702),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 164/212 (77%), Gaps = 0/212 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG  +S A +RVVA L EK LDF+ V +D+     K+EPF+SLNPFGQVPAFEDG
Sbjct  1    MAIKVHGPMLSPAVVRVVAMLKEKNLDFELVHVDLQNGDQKKEPFISLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KGN L+  DPKKMA   VW+EVE   F+P  S L +E+ I
Sbjct  61   DLKLFESRAITQYIAHTYADKGNQLLPNDPKKMAIMYVWIEVEAQRFEPVVSKLCYEIVI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++ M TD+ IV +N+E+LSK+LDVYE+RL  SKYLGGD F+LADL+H P +H LMGT+
Sbjct  121  KPLLDMVTDDAIVAENEEKLSKLLDVYESRLKDSKYLGGDSFTLADLNHAPALHYLMGTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
            +K+LF +RP+V AW  +I +RPAW K +E  K
Sbjct  181  VKSLFNARPHVGAWVANILARPAWAKSLELTK  212



>ref|XP_010069958.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
 gb|KCW58495.1| hypothetical protein EUGRSUZ_H01172 [Eucalyptus grandis]
Length=213

 Score =   275 bits (702),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KV+GN MSTA MRV A L EK L+F+ V +DM A  HKQE FL+LNPFGQVPAFEDG
Sbjct  1    MVMKVYGNLMSTAAMRVFAALYEKDLEFELVTVDMKAGEHKQENFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+  A KG  LVCE  K MAT +VWMEVE H FDP AS L WEL  
Sbjct  61   DLKLFESRAITQYIAHEYAAKGAPLVCEG-KPMATVAVWMEVEAHQFDPVASKLQWELVF  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GMA D   V++N+ +L KVLDVYE RL +SKYLG D F+LADLHH+P +  LMGT 
Sbjct  120  KPLFGMAVDAAAVKENEAKLVKVLDVYEARLGQSKYLGCDCFTLADLHHIPTLTNLMGTP  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF++RP VSAW  DI +RPAW K++
Sbjct  180  LKELFEARPKVSAWVADIMARPAWAKVL  207



>ref|XP_010069960.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
 gb|KCW58494.1| hypothetical protein EUGRSUZ_H01169 [Eucalyptus grandis]
Length=213

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG   STATMRV A L EK L+F+FV +D+ A  HK+EPFL+LNPFGQVPAFEDG
Sbjct  1    MVMKVHGGVASTATMRVFATLYEKDLEFEFVPVDLRAGEHKKEPFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAIT YIA+  A+KG  LVCE  K MAT  VWMEVE H FD  AS L WEL  
Sbjct  61   DLKLFESRAITGYIAHAYADKGTPLVCEG-KPMATVGVWMEVEAHQFDTLASKLQWELVY  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GMA D  +VE+N+ +L+KVLDVYE RL +SKYLG D F+LADLHHLP +  LMGT 
Sbjct  120  KPMFGMAMDAAVVEENEPKLAKVLDVYEARLSQSKYLGCDCFTLADLHHLPTLTNLMGTP  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF +RP VSAW  DI +RPAW K++
Sbjct  180  LKKLFDARPKVSAWVADIMARPAWAKVL  207



>ref|XP_007050852.1| Glutathione S-transferase 7 isoform 1 [Theobroma cacao]
 gb|EOX95009.1| Glutathione S-transferase 7 isoform 1 [Theobroma cacao]
Length=268

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -2

Query  977  IVSQHIFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQ  798
            +V +     IK HG+ +STAT RV+ CL EK ++FQFV ++MGA  HK E +LSLNPFGQ
Sbjct  48   VVGRTTMAVIKAHGSLLSTATQRVLLCLYEKEVEFQFVPVNMGAGEHKSENYLSLNPFGQ  107

Query  797  VPAFEDGDLELFESRAITQYIAYTCANKGNHLVCEDP-KKMATASVWMEVENHHFDPAAS  621
            VPAFE+G+L+LFESRAIT+YIA+   +KG  L+     K MA  S+W EVE H FDPA+S
Sbjct  108  VPAFEEGNLKLFESRAITEYIAHEYTDKGTQLLLPGSNKSMAVLSLWKEVEAHQFDPASS  167

Query  620  ALTWELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPN  441
             L WEL IKP++GMATD  +VE+ + +L+KVLDVYE RL +SKYL  D+F+LADLHHLPN
Sbjct  168  KLAWELFIKPILGMATDSAVVEEYEPKLAKVLDVYETRLSQSKYLACDYFTLADLHHLPN  227

Query  440  IHCLMGTQIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            I CL+GT  K LF SRP+VSAW  DI +RPAW K++   K+
Sbjct  228  IQCLLGTPAKRLFDSRPHVSAWVADIIARPAWCKVLAMQKQ  268



>gb|AFK35043.1| unknown [Lotus japonicus]
Length=216

 Score =   272 bits (696),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 158/209 (76%), Gaps = 0/209 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKVHG+ +S ATMR +  L EK L+F+FV  DM    HK+EPFLSLNPFGQVPA EDGDL
Sbjct  4    IKVHGSPISNATMRALVALYEKQLEFEFVPTDMRNGEHKKEPFLSLNPFGQVPALEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAIT+YIAY  A+KG  L+ +D KKMA  +VW+EVE HHFD  +S L +EL  KP
Sbjct  64   KLFESRAITKYIAYEYADKGTELLSKDSKKMAVTTVWLEVEAHHFDQPSSKLAFELAFKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + GM TD  +VE+N+ +L+ VLDVYE RL  SKYL  + F+LADLHH+PNI  LM TQ K
Sbjct  124  MFGMTTDPAVVEENEAKLAGVLDVYEKRLSGSKYLAAECFTLADLHHIPNIFYLMNTQSK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMVEWL  324
             LF+SRP+V+AW  DI++RPAW K+V  L
Sbjct  184  KLFESRPHVNAWVADITARPAWSKVVAML  212



>ref|XP_002262842.1| PREDICTED: glutathione S-transferase [Vitis vinifera]
Length=214

 Score =   272 bits (696),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 155/210 (74%), Gaps = 0/210 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +KVHG+  STA MRVVA L EK L+F+FV IDM A  HK E FL+LNPFGQ+PAFEDGDL
Sbjct  4    LKVHGSPFSTAVMRVVAALYEKELEFEFVTIDMKAGQHKSEAFLALNPFGQIPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYIA+  A+ G  L+C D KKMA  SVW+EVE H +DP A+ L +EL  KP
Sbjct  64   KLFESRAITQYIAHEYASNGTQLICPDSKKMAIMSVWIEVEAHQYDPHAAKLCYELFYKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G  TD   VE  + +L KVLDVYE RL +SKYLGGD   LADLHHLP +H L+G+  K
Sbjct  124  MFGQTTDPAAVEDLEAKLGKVLDVYEARLTQSKYLGGDCLGLADLHHLPTLHYLLGSSAK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             LF SRP+VSAW  DI++RPAW K++   K
Sbjct  184  KLFDSRPHVSAWVADITARPAWAKVIAMQK  213



>gb|KEH43230.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=214

 Score =   272 bits (696),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG+ +STATMRV A L EK L+F+FV I+M    HK+EPF+SLNPFGQVPAFEDGD
Sbjct  3    TIKVHGSPISTATMRVTATLYEKELEFEFVSINMRNGEHKKEPFISLNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYI +  A+KG  L   D KKMA  SVW EVE+ H+D  AS L WELGIK
Sbjct  63   LKLFESRAITQYIDHEYADKGTKLTSSDSKKMAIMSVWSEVESLHYDQVASILVWELGIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
             + G+  D  +VE+N+ +L  +LDVYE RL +SKYLGGD F+L DLHHLP+++ LM +Q 
Sbjct  123  TLFGIPLDSNVVEENEAKLDIILDVYEKRLSKSKYLGGDSFTLVDLHHLPSLYYLMKSQS  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF+SRP VSAW  DI++RPAW K++
Sbjct  183  KKLFESRPYVSAWVADITARPAWSKVL  209



>ref|XP_010069964.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
 gb|KCW58503.1| hypothetical protein EUGRSUZ_H01176 [Eucalyptus grandis]
Length=213

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG+ +STA MRV+  L EKGL+F+FV +DM A  HK+E FL+LNPFGQVPAFEDG
Sbjct  1    MVMKVHGSVLSTAAMRVLIVLNEKGLEFEFVPVDMRAGEHKKEHFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA    +KG  LVCE  K MAT  VWMEVE H FDP  S L WEL  
Sbjct  61   DLKLFESRAITQYIANVYKDKGTPLVCEG-KPMATLGVWMEVEAHQFDPVGSKLQWELLF  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GMATD  +VE+N+ +L+KVLD+YE RL +SKYLG D F+LADLHHLP +  LMGT 
Sbjct  120  KPMFGMATDAAVVEENEAKLAKVLDIYEARLSQSKYLGCDCFTLADLHHLPVLTNLMGTH  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF +RP VSAW  DI +RPA  K++
Sbjct  180  VKKLFDARPKVSAWVADIMTRPALAKVL  207



>gb|KCW58500.1| hypothetical protein EUGRSUZ_H01176 [Eucalyptus grandis]
Length=213

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG+ +STA MRV+  L EKGL+F+FV +DM A  HK+E FL+LNPFGQVPAFEDG
Sbjct  1    MVMKVHGSVLSTAAMRVLIVLNEKGLEFEFVPVDMRAGEHKKEHFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA    +KG  LVCE  K MAT  VWMEVE H FDP  S L WEL  
Sbjct  61   DLKLFESRAITQYIANVYKDKGTPLVCEG-KPMATLGVWMEVEAHQFDPVGSKLQWELLF  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GMATD  +VE+N+ +L+KVLD+YE RL +SKYLG D F+LADLHHLP +  LMGT 
Sbjct  120  KPMFGMATDAAVVEENEAKLAKVLDIYEARLSQSKYLGCDCFTLADLHHLPVLTNLMGTH  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF +RP VSAW  DI +RPA  K++
Sbjct  180  VKKLFDARPKVSAWVADIMARPALAKVL  207



>gb|AFK43695.1| unknown [Medicago truncatula]
Length=206

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG+  STATMRV A L EK ++F+F +I+M    HK+EPF+SLNPFGQVPAFEDGD
Sbjct  3    TIKVHGSPYSTATMRVTATLYEKQIEFEFFNINMRNGEHKKEPFISLNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYI +  A+KG  L   D KK+A   VW EVE+HHFD  AS L WELGIK
Sbjct  63   LKLFESRAITQYINHEYADKGTKLTSSDSKKLAIMGVWSEVESHHFDQVASKLVWELGIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
             + G+  D  IVE+N+ +L  +LDVYE RL  SKY GGD F+L DLHHLP++H LM +Q 
Sbjct  123  TLFGIPLDPKIVEENEAKLDSILDVYEKRLSESKYFGGDSFTLVDLHHLPSLHYLMKSQS  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWL  342
            K LF+SRP+VSAW  DI++RPAW+
Sbjct  183  KKLFESRPHVSAWVADITARPAWV  206



>dbj|BAM14582.1| putative glutathione S-transferase [Cyclamen persicum x Cyclamen 
purpurascens]
Length=216

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 159/208 (76%), Gaps = 3/208 (1%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +KVHG+ MSTAT RV+ CL EK LDF+FV ++MG   HK+EPF+S NPFGQVPAFEDGDL
Sbjct  4    LKVHGSPMSTATQRVLVCLYEKDLDFEFVPVNMGTGDHKKEPFISRNPFGQVPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHL-VCEDP--KKMATASVWMEVENHHFDPAASALTWELG  600
             LFESRAITQYIA+T A+KG  L + EDP  KKMA  SVWMEVE H FD + S L WE+ 
Sbjct  64   TLFESRAITQYIAHTNADKGTQLLIMEDPIPKKMAIMSVWMEVEAHQFDRSTSKLAWEVV  123

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
             KP+ GM TD   V + + +L+K+LDVYE RL +SKY+GGD FSLAD+HHLPN+  LM T
Sbjct  124  FKPMFGMTTDTAAVSEEEAKLNKILDVYEARLAQSKYIGGDSFSLADMHHLPNLGYLMET  183

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKM  336
              K+ F+SRP+VSAW  DI +RPAW K+
Sbjct  184  PYKSYFESRPHVSAWCKDILARPAWAKV  211



>gb|KEH43226.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
 gb|KEH43229.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=214

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 153/203 (75%), Gaps = 0/203 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG+  STATMRV A L EK ++F+F +I+M    HK+EPF+SLNPFGQVPAFEDGD
Sbjct  3    TIKVHGSPYSTATMRVTATLYEKQIEFEFFNINMRNGEHKKEPFISLNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYI +  A+KG  L   D KK+A   VW EVE+HHFD  AS L WELGIK
Sbjct  63   LKLFESRAITQYINHEYADKGTKLTSSDSKKLAIMGVWSEVESHHFDQVASKLVWELGIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
             + G+  D  IVE+N+ +L  +LDVYE RL  SKY GGD F+L DLHHLP++H LM +Q 
Sbjct  123  TLFGIPLDPKIVEENEAKLDSILDVYEKRLSESKYFGGDSFTLVDLHHLPSLHYLMKSQS  182

Query  413  KTLFQSRPNVSAWWVDISSRPAW  345
            K LF+SRP+VSAW  DI++RPAW
Sbjct  183  KKLFESRPHVSAWVADITARPAW  205



>ref|XP_011010221.1| PREDICTED: glutathione S-transferase-like [Populus euphratica]
Length=213

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 158/206 (77%), Gaps = 1/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +KVHG+ +STA  RV ACL EK L+F+ + ++M A  HK+EPFL+LNPFGQVPAFE GDL
Sbjct  5    MKVHGSVLSTAAQRVFACLYEKELEFELIPVNMAAGEHKKEPFLALNPFGQVPAFEHGDL  64

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQ+IA+  A+KG  LV    K+MA  SVWME E H FDP AS L WEL  KP
Sbjct  65   KLFESRAITQHIAHGYADKGTPLVLPG-KQMAILSVWMEAEAHQFDPVASKLNWELIFKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G+ TD   VE+N+ +L KVLD+YE+RL +SKYLGGD F+LADLHH+PNI   M TQ+K
Sbjct  124  MFGIPTDNAAVEENEAKLGKVLDIYESRLAQSKYLGGDIFTLADLHHIPNISYAMRTQVK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             LF SRP+VSAW  DI+SRPAW K+V
Sbjct  184  KLFDSRPHVSAWVADITSRPAWSKVV  209



>gb|AFK40227.1| unknown [Medicago truncatula]
Length=214

 Score =   269 bits (688),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 152/203 (75%), Gaps = 0/203 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG+  STATMRV A L EK ++F+F +I+M    HK+EPF+SLNPFGQVPAFEDGD
Sbjct  3    TIKVHGSPYSTATMRVTATLYEKQIEFEFFNINMRNGEHKKEPFISLNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYI +  A+KG  L   D KK+A   VW EVE+HHFD  AS L WELGIK
Sbjct  63   LKLFESRAITQYINHEYADKGTKLTSSDSKKLAIMGVWSEVESHHFDQVASKLVWELGIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
             + G+  D  IVE+N+ +L  +LDVYE RL  SKY GGD F+L DLHHLP +H LM +Q 
Sbjct  123  TLFGIPLDPKIVEENEAKLDSILDVYEKRLSESKYFGGDSFTLVDLHHLPPLHYLMKSQS  182

Query  413  KTLFQSRPNVSAWWVDISSRPAW  345
            K LF+SRP+VSAW  DI++RPAW
Sbjct  183  KKLFESRPHVSAWVADITARPAW  205



>ref|XP_010069956.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
 gb|KCW58497.1| hypothetical protein EUGRSUZ_H01174 [Eucalyptus grandis]
Length=213

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG+ +STA MRV+  L EKGL+F+FV +DM A  HK+E FL+LNPFGQVPAFEDG
Sbjct  1    MVMKVHGSVLSTAAMRVLIALNEKGLEFEFVPVDMRAGEHKKEHFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA    +KG  LVCE  K MAT  VWMEVE H FDP  S L WEL  
Sbjct  61   DLKLFESRAITQYIANVYKDKGTPLVCEG-KPMATLGVWMEVEAHQFDPVGSKLQWELLF  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GMATD  +VE+N+ +L+KVLD+YE RL +SKYLG D F+LADLHHLP +  LM + 
Sbjct  120  KPMFGMATDAAVVEENEAKLAKVLDIYEARLSQSKYLGCDCFTLADLHHLPALTNLMASP  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF +RP VSAW  DI +RPA  K++
Sbjct  180  VKKLFDARPKVSAWVADIMARPALAKVL  207



>ref|XP_010069963.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
 gb|KCW58501.1| hypothetical protein EUGRSUZ_H01176 [Eucalyptus grandis]
Length=213

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG+ +STA MRV+  L EKGL+F+FV +DM A  HK+E FL+LNPFGQVPAFEDG
Sbjct  1    MVMKVHGSVLSTAAMRVLIALNEKGLEFEFVPVDMRAGEHKKEHFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+   +KG  LVCE  K MAT  VWMEVE H FDP AS L WEL  
Sbjct  61   DLKLFESRAITQYIAHVYEDKGTPLVCEG-KPMATVGVWMEVEAHQFDPVASKLQWELVF  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GMATD  +VE+N+ +L+KVLD+YE RL +SKYLG D F+LADLHHLP +  LM + 
Sbjct  120  KPMFGMATDAAVVEENEAKLAKVLDIYEARLSQSKYLGCDCFTLADLHHLPALTNLMASP  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF + P VSAW  DI +RPA  K++
Sbjct  180  VKKLFDACPKVSAWVADIMARPALAKVL  207



>gb|KCW58499.1| hypothetical protein EUGRSUZ_H01176 [Eucalyptus grandis]
Length=213

 Score =   268 bits (684),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG+ +STA MRV+  L EKGL+F+FV +DM A  HK+E FL+LNPFGQVPAFEDG
Sbjct  1    MVMKVHGSVLSTAAMRVLIVLNEKGLEFEFVPVDMRAGEHKKEHFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+   +KG  LVCE  K MAT  VWMEVE H FDP AS L WEL  
Sbjct  61   DLKLFESRAITQYIAHVYEDKGTPLVCEG-KPMATVGVWMEVEAHQFDPVASKLQWELVF  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GMATD  +VE+N+ +L+KVLD+YE RL +SKYLG D F+LADLHHLP +  LM + 
Sbjct  120  KPMFGMATDAAVVEENEAKLAKVLDIYEARLSQSKYLGCDCFTLADLHHLPALTNLMASP  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF + P VSAW  DI +RPA  K++
Sbjct  180  VKKLFDACPKVSAWVADIMARPALAKVL  207



>dbj|BAB70616.1| glutathione S-transferase [Medicago sativa]
Length=214

 Score =   267 bits (682),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG+ +STATMRV A L EK L+F+FV I+M    HK+EPF+S+NPFGQVPAFEDGD
Sbjct  3    TIKVHGSPISTATMRVTATLYEKELEFEFVSINMRNGEHKKEPFISINPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYI +  A+KG  L   D KKMA  SVW EVE+ H+D  AS L WELGIK
Sbjct  63   LKLFESRAITQYIDHEYADKGTKLTSSDSKKMAIMSVWSEVESLHYDKVASILVWELGIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
             + G+  D  +VE+N+ +L  +LDVYE RL  SKY+GG+ F+L DLHHLP++H LM +Q 
Sbjct  123  TLFGIPLDSKVVEENEAKLDSILDVYEKRLSESKYMGGECFTLVDLHHLPSLHYLMKSQS  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF+SRP V+AW  DI++RPAW K++
Sbjct  183  KKLFESRPYVNAWVDDITARPAWSKVL  209



>ref|XP_008368965.1| PREDICTED: glutathione S-transferase-like [Malus domestica]
Length=213

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 159/210 (76%), Gaps = 0/210 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +KVHGN +S  T RV+A L EK + F+ V ID+G   HK+EPF+SLNPFG+VPAFEDGDL
Sbjct  4    VKVHGNVLSVCTRRVIAALYEKDIKFELVPIDLGTGEHKKEPFISLNPFGEVPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYI +  A+KG  LV +D KKMA  +V  EVE   FDPAAS LT+E  IKP
Sbjct  64   KLFESRAITQYIVHEYADKGTPLVFQDSKKMAMIAVGCEVEGQKFDPAASKLTFEQVIKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            ++ M TD  +VE+ + +L+ VLDVYE RL +SKYL G+ F+LADLHH+P+IH LMGTQ K
Sbjct  124  MLKMPTDAAVVEEYEAKLAVVLDVYEIRLAQSKYLAGERFTLADLHHIPSIHYLMGTQSK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             LF SRP+VSAW  DI++RPAW K++   K
Sbjct  184  KLFVSRPHVSAWVADITARPAWKKVIALQK  213



>ref|XP_009785538.1| PREDICTED: glutathione S-transferase-like [Nicotiana sylvestris]
Length=236

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 163/212 (77%), Gaps = 1/212 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IKVHG   S A ++V+ACL EK LDF+ V +++ A  HK+EP +SLNPFGQVPAFEDG
Sbjct  1    MVIKVHGPVQSPAVLKVIACLKEKELDFELVHVNLPAGDHKKEPLISLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KGN L+  DPK+MA  SVWMEVE+  FD     LT+E+ +
Sbjct  61   DLKLFESRAITQYIAHTYADKGNQLLPNDPKEMAIMSVWMEVESTKFDTPGFNLTFEIAL  120

Query  596  KPV-IGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            KP+  G ATDE  V +N+E+L KVLDVYE+RL  SKYLGG+ F+LADLHH+P  + LMGT
Sbjct  121  KPLFFGAATDEAAVTENEEKLGKVLDVYESRLKESKYLGGESFTLADLHHIPIANYLMGT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWL  324
            ++K+LF  RP+VS W  DI +RPAW K +++L
Sbjct  181  KVKSLFDCRPHVSDWCADILARPAWSKALDYL  212



>ref|XP_010667331.1| PREDICTED: glutathione S-transferase-like [Beta vulgaris subsp. 
vulgaris]
Length=214

 Score =   265 bits (677),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IK+HG   S AT+RV+A   EK LDF+ V +D+ +  HKQ+PF+ LNPFGQ+PAFEDG
Sbjct  1    MGIKIHGIPHSGATLRVLAAAQEKELDFELVPVDLKSGAHKQQPFIYLNPFGQIPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            D++LFESRAIT+YIAYT  + G  LV  D K+MA   VWMEVE H FDPAAS L+WEL  
Sbjct  61   DVKLFESRAITKYIAYTYESNGTSLVHNDGKQMADIGVWMEVEAHQFDPAASKLSWELVY  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K   GM  +  +VE+N+ +L+KVLDVYE RL  SKYLGGD F+LADLHHLP +H L GT+
Sbjct  121  KSFFGMEINNVVVEENEAKLAKVLDVYEARLANSKYLGGDSFTLADLHHLPGLHYLSGTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKET  315
            +K LF  RP VSAW  DI +RPAW K+V   K+ 
Sbjct  181  VKHLFDERPLVSAWCKDILARPAWEKVVALQKQA  214



>gb|AEB77871.1| phi class glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=214

 Score =   264 bits (675),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 157/207 (76%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKV+G+ +STAT RV A L EK L+F+ V +++GA  HK++PFL+LNPFGQVPA E GD
Sbjct  3    AIKVYGSVISTATQRVFATLYEKELEFEVVAVNLGAGEHKKQPFLALNPFGQVPALEQGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYIA+  A+KG +L+C   K+MA  SVWMEVE H FDP  S L WEL  K
Sbjct  63   LKLFESRAITQYIAHEYADKGTNLICAG-KQMAILSVWMEVEAHQFDPVTSKLNWELIFK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD  +VE+N+ +L+K+LDVYE RL  SKYL    F+LADLHHLPNI  L  TQ 
Sbjct  122  PMFGMTTDTAVVEENEAKLAKILDVYEARLSVSKYLACGCFTLADLHHLPNIATLSRTQC  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF +RP+VSAW  DI++RPAW K+V
Sbjct  182  KKLFDARPHVSAWVADITARPAWAKVV  208



>gb|KCW58492.1| hypothetical protein EUGRSUZ_H01167 [Eucalyptus grandis]
Length=212

 Score =   264 bits (675),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 156/207 (75%), Gaps = 1/207 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG+ +S   +RV A L EK L+F+FV +++ A  HK+EPFL+LNPFGQ+PAFEDG
Sbjct  1    MVMKVHGSVLSPPVLRVFAALCEKDLEFEFVFVEVKAGEHKKEPFLALNPFGQIPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+   ++G  LVCE  K MAT SVWMEVE H F+P A  L WEL  
Sbjct  61   DLKLFESRAITQYIAHVYKDEGTPLVCEG-KPMATVSVWMEVEAHQFEPVAIKLQWELAY  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP +G  TD   VE+N+ +L+KVLD+YE RL +SKYLG D F+LADLHHLP +  LMGTQ
Sbjct  120  KPKLGKVTDAAEVEENEAKLAKVLDIYEARLSQSKYLGCDCFTLADLHHLPALTNLMGTQ  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKM  336
            +K LF +RP VSAW  DI +RPAW K+
Sbjct  180  VKKLFDTRPKVSAWAADIMARPAWAKV  206



>ref|XP_009628525.1| PREDICTED: glutathione S-transferase-like [Nicotiana tomentosiformis]
Length=234

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IKVHG   S A ++V+ACL EK LDF+ V +++ A  HK+EP +SLNPFGQVPAFEDG
Sbjct  1    MVIKVHGPVQSPAVLKVIACLKEKELDFELVHVNLPAGDHKKEPLISLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+T A+KGN L+  DPK+MA   VWMEVE+  FD     L++E+ +
Sbjct  61   DLKLFESRAITQYIAHTYADKGNKLLPNDPKEMAIMYVWMEVESTKFDTPGFNLSFEIAL  120

Query  596  KPV-IGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            KP+  G+ATDE  V +N+E+L KVLDVYE+RL  SKYLGG+ F+LADLHH+P ++ LMGT
Sbjct  121  KPLFFGVATDEAAVTENEEKLGKVLDVYESRLKESKYLGGESFTLADLHHIPVVNYLMGT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWL  324
            ++K+LF  RP+VS W  DI +RPAW K +++L
Sbjct  181  KVKSLFDCRPHVSDWCADILARPAWSKALDYL  212



>ref|XP_010069961.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
Length=213

 Score =   264 bits (675),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG+ +S   +RV A L EK L+F+FV +++ A  HK+EPFL+LNPFGQ+PAFEDG
Sbjct  1    MVMKVHGSVLSPPVLRVFAALCEKDLEFEFVFVEVKAGEHKKEPFLALNPFGQIPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+   ++G  LVCE  K MAT SVWMEVE H F+P A  L WEL  
Sbjct  61   DLKLFESRAITQYIAHVYKDEGTPLVCEG-KPMATVSVWMEVEAHQFEPVAIKLQWELAY  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP +G  TD   VE+N+ +L+KVLD+YE RL +SKYLG D F+LADLHHLP +  LMGTQ
Sbjct  120  KPKLGKVTDAAEVEENEAKLAKVLDIYEARLSQSKYLGCDCFTLADLHHLPALTNLMGTQ  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF +RP VSAW  DI +RPAW K++
Sbjct  180  VKKLFDTRPKVSAWAADIMARPAWAKVL  207



>ref|XP_004136044.1| PREDICTED: glutathione S-transferase PARB-like [Cucumis sativus]
 ref|XP_004160542.1| PREDICTED: glutathione S-transferase PARB-like [Cucumis sativus]
 gb|KGN44913.1| hypothetical protein Csa_7G395800 [Cucumis sativus]
Length=216

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKVHG+ +STAT RV+ CL EK LD++FV +DM  + HK+ PFLS+NPFGQVP F+DGD
Sbjct  3    SIKVHGSPISTATARVLVCLYEKDLDYEFVLVDMKNNEHKKHPFLSINPFGQVPGFQDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L +FESRAITQY+A T ANKGN L+  DPKK A  S W+EVE HH+DP   AL++E  +K
Sbjct  63   LTIFESRAITQYLAKTYANKGNQLIPNDPKKAAIVSTWIEVEGHHYDPPGVALSFEHLVK  122

Query  593  PVIGMA-TDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            P+ G+  TD   V +N+ +L KVLD+YEN+L ++K+L GD FSLADLHHLPN+  L+ T 
Sbjct  123  PLFGLGETDPAAVAENEAKLGKVLDIYENQLSKNKFLAGDEFSLADLHHLPNVSYLLATP  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
             K LF+SRP V+AW  +I +RP+W K+V
Sbjct  183  SKKLFESRPRVNAWVTEIIARPSWAKVV  210



>ref|XP_010090797.1| Glutathione S-transferase [Morus notabilis]
 gb|EXB40830.1| Glutathione S-transferase [Morus notabilis]
Length=223

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 157/209 (75%), Gaps = 1/209 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKV+G   STA  RV+A L EKGLD++ V +DM    HK+E ++S NPFGQVPAFEDGD
Sbjct  3    AIKVYGAAYSTAAARVLATLHEKGLDYELVHVDMITGEHKKESYISRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAIT+YI+   A+KG  L   DPKK A A++W+EVE HHFDP A  L +EL +K
Sbjct  63   LKLFESRAITRYISQQYADKGTSLEFSDPKKQAVANLWIEVEAHHFDPNAQKLNYELTVK  122

Query  593  PVI-GMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            PVI G+ TD ++V + + +  KVLDVYE RL +S+YLGGD F+LADLHHLP I  L+G+ 
Sbjct  123  PVILGLETDHSVVAEYEPKFEKVLDVYEERLSQSRYLGGDSFTLADLHHLPTIQYLLGSS  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
             K LF+SRP V+AW  DI+SRP+W K+VE
Sbjct  183  AKKLFESRPRVNAWVDDITSRPSWTKVVE  211



>ref|XP_011079697.1| PREDICTED: glutathione S-transferase-like [Sesamum indicum]
Length=218

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 160/206 (78%), Gaps = 0/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +K+HG+ +S A  RV ACL EKGL ++FV +D+     K+EPF+SLNPFGQVPA EDGDL
Sbjct  4    MKLHGHPISPAVRRVAACLEEKGLPYEFVFVDLSTGQQKKEPFISLNPFGQVPALEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYI  T A+KG  L+  DP K    SVW EVE+H FD AAS L++E+ IKP
Sbjct  64   KLFESRAITQYITRTYADKGTPLLPTDPLKQTMVSVWSEVESHAFDAAASKLSFEILIKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            ++GM+TDE  VE  + +L++VLDVYE+RL +SKYLGG+ FSLADLHHLP I+ L+GT+IK
Sbjct  124  ILGMSTDEGAVEVQQGKLAQVLDVYESRLGKSKYLGGEDFSLADLHHLPIINNLLGTKIK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             LF +RP+VSAW  DI +RPAW K++
Sbjct  184  ALFDARPHVSAWCADILARPAWQKVL  209



>ref|XP_010667052.1| PREDICTED: glutathione S-transferase-like [Beta vulgaris subsp. 
vulgaris]
Length=225

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 154/208 (74%), Gaps = 0/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIK+HG+  S AT+RVVA   EK +DF+FV +D+ +  HKQ PFL+LNPFGQVPAFEDG
Sbjct  1    MAIKIHGSPFSGATLRVVAAAHEKEVDFEFVPVDLRSGVHKQYPFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            D  LFESRAIT+YIA+    KG  LV  + K      VWMEVE H FDP+AS L WEL +
Sbjct  61   DFSLFESRAITKYIAFAYEGKGTALVGMELKPKVARGVWMEVEAHQFDPSASKLIWELVL  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K + GM TD+ IV++N+ +L+ VLDVYE RL  SKYLGG+ F+LADLHHLP +H LMGT+
Sbjct  121  KGMFGMQTDKAIVDENEAKLATVLDVYEARLGESKYLGGETFTLADLHHLPQLHMLMGTR  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K +F  RP+VSAW  DI +RPAW K V
Sbjct  181  VKKIFDERPHVSAWCKDILARPAWQKTV  208



>gb|AEB77873.1| phi class glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=214

 Score =   261 bits (668),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 156/207 (75%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKV+G+ +STAT RV A L EK L+F+ V +++GA  HK++PFL+LNPFGQVPA E GD
Sbjct  3    AIKVYGSVISTATQRVFATLYEKELEFEVVAVNLGAGEHKKQPFLALNPFGQVPALEQGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYIA+  A+KG +L+C   K+MA  SVW+EVE H FDP  S L WEL  K
Sbjct  63   LKLFESRAITQYIAHEYADKGTNLICAG-KQMAILSVWVEVEAHQFDPVTSKLNWELIFK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD  +VE+N+  L+K+LDVYE RL  SKYL    F+LADLHHLPNI  L  TQ 
Sbjct  122  PMFGMTTDTAVVEENEAELAKILDVYEARLSVSKYLACGCFTLADLHHLPNIATLSRTQC  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF +RP+VSAW  DI++RPAW K+V
Sbjct  182  KKLFDARPHVSAWVADITARPAWAKVV  208



>gb|KHN46580.1| Glutathione S-transferase [Glycine soja]
Length=218

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 154/206 (75%), Gaps = 0/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            I++HGN  STATMR  A L EK L+F+FV IDM    HK+EPF+SLNPFGQVPAFEDGDL
Sbjct  4    IRLHGNPFSTATMRAAASLHEKQLEFEFVLIDMKNGEHKKEPFISLNPFGQVPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYI +  A+KG  L+ ++ KKMA   +W+EVE+ H+D  AS L WEL +KP
Sbjct  64   KLFESRAITQYIVHEYADKGTQLISKESKKMAKLRLWLEVESQHYDQPASKLVWELMVKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G+ TD   VE+N+ +L  VLD YE  L +SKY+ G+ F+LADLHHLP IH LM TQ K
Sbjct  124  MYGLPTDPAAVEENEGKLGTVLDFYEKTLSQSKYVAGECFTLADLHHLPTIHYLMKTQSK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             LF+SRP+V AW  DI++R AW K++
Sbjct  184  KLFESRPHVGAWVADITARTAWSKVL  209



>gb|EYU46697.1| hypothetical protein MIMGU_mgv1a013771mg [Erythranthe guttata]
Length=211

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IKVHG+ +S A  RV+ CL EK LD++FV +D+    HK+EPF+S+NPFGQVP FEDG
Sbjct  1    MGIKVHGHPLSPAARRVLLCLAEKNLDYEFVLVDLSTGQHKKEPFISINPFGQVPGFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL LFESRAIT+YIA+  A+KG  L+  DPKKMA    W+EVE   FD A  AL++E+ I
Sbjct  61   DLTLFESRAITKYIAHAYADKGTPLLVADPKKMAIIGQWLEVEAQKFDAAGQALSFEILI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GMATDE++V++ + +LS VLD+YE RL +SKYLGG+ +SLADLHH+P I  L  T+
Sbjct  121  KPMKGMATDESVVDKLQAQLSAVLDIYEARLSKSKYLGGEEYSLADLHHIPIISNLFKTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKM  336
            +K LF +RP+VSAW  D+ +RPAWLK+
Sbjct  181  VKPLFDARPHVSAWCSDLLARPAWLKV  207



>ref|XP_008451608.1| PREDICTED: glutathione S-transferase PARB-like [Cucumis melo]
Length=216

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 156/208 (75%), Gaps = 1/208 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKVHG+ +STAT RV+ACL EK LD++FV +DM  + HK+ PFLS+NPFGQVP F+DGD
Sbjct  3    SIKVHGSPISTATSRVLACLYEKDLDYEFVLLDMKNNEHKKHPFLSINPFGQVPGFQDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L +FESRAITQY+A   ANKG  L+  DPKK A  S W+EVE HH+DP   AL++E  +K
Sbjct  63   LTIFESRAITQYLATAYANKGTQLIPNDPKKAAIVSTWIEVEGHHYDPPGVALSFEHLVK  122

Query  593  PVIGMA-TDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            P+ G+  TD   V +N+ +L KVLD+YEN+L ++K+L GD FSLADLHH+PNI  L+ T 
Sbjct  123  PLFGLGETDPAAVAENEAKLGKVLDIYENQLSKNKFLAGDEFSLADLHHIPNISYLLATP  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
             K LF+SRP V+AW  DI +RP+W K+ 
Sbjct  183  SKKLFESRPRVNAWVTDILARPSWAKVT  210



>ref|XP_007143851.1| hypothetical protein PHAVU_007G107200g [Phaseolus vulgaris]
 gb|ESW15845.1| hypothetical protein PHAVU_007G107200g [Phaseolus vulgaris]
Length=218

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 149/206 (72%), Gaps = 0/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IK+HGN  S ATMR  A L EK L+F+F+ IDM    HK+EPFL LNPFGQVPAFEDGDL
Sbjct  4    IKLHGNPFSAATMRATASLYEKQLEFEFIMIDMKNGEHKKEPFLLLNPFGQVPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAI+QYI +  A+KG  L+  D KKMAT  +WME+E+  +D AAS L WEL +KP
Sbjct  64   KLFESRAISQYIVHEYADKGTQLISSDSKKMATIRMWMEIESQRYDQAASKLVWELAVKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G+  D   VEQ +  L+  LD YE  L  SKYL GD F+LADLHHLP IH LM T  K
Sbjct  124  MYGLPMDPAAVEQAEGMLNTTLDFYEKTLSNSKYLAGDCFTLADLHHLPTIHYLMNTSSK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             LF+SRP+V+AW  DI++RPAW K++
Sbjct  184  KLFESRPHVTAWVADITARPAWSKVL  209



>dbj|BAM14583.1| putative glutathione S-transferase [Cyclamen persicum x Cyclamen 
purpurascens]
Length=216

 Score =   260 bits (664),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +KVHG+ +STAT RV+ CL EK LDF+FV ++M    HK+EPF+S NPFGQVPAFEDGDL
Sbjct  4    LKVHGSPLSTATQRVLVCLYEKDLDFEFVPVNMATGDHKKEPFVSRNPFGQVPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCED---PKKMATASVWMEVENHHFDPAASALTWELG  600
             LFESRAITQYIA+T A+KG  L+  +   PKKMA  SVWMEVE H FD +   L +E+ 
Sbjct  64   TLFESRAITQYIAHTNADKGTQLLIMEEPIPKKMAIMSVWMEVEAHQFDRSTGKLAFEVI  123

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
             KP+ GM TD   V + + +L+K+LDVYE RL +SKY+GGD FSLAD+HHLPN+  LM T
Sbjct  124  FKPMFGMTTDPAAVAEEEVKLNKILDVYEVRLAQSKYIGGDSFSLADMHHLPNLGYLMET  183

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKM  336
              K+ F+SRP+VSAW  DI +RPAW K+
Sbjct  184  PYKSYFESRPHVSAWCKDILARPAWAKV  211



>ref|XP_010684078.1| PREDICTED: glutathione S-transferase-like [Beta vulgaris subsp. 
vulgaris]
Length=213

 Score =   260 bits (664),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 155/214 (72%), Gaps = 1/214 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IK+HG   S AT+RV+A   EK LDF+ V +D+ +  HKQ+PFLSLNPFGQ+PAFEDG
Sbjct  1    MGIKIHGIPHSGATLRVLAAAEEKELDFELVPVDLKSGAHKQQPFLSLNPFGQIPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            D++LFESRAITQYIAYT  + G  L+ +  K+M    VWMEVE H FDPAAS L WEL  
Sbjct  61   DVKLFESRAITQYIAYTYESNGTSLIHKG-KQMIDVGVWMEVEAHQFDPAASKLLWELIY  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K   G+  D  +VE+N  +L+KVLDVYE RL  SKYLGGD F+LADLHHLP +H L  T+
Sbjct  120  KSFFGIEIDNAVVEENSAKLAKVLDVYEARLATSKYLGGDSFTLADLHHLPALHNLSNTK  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKET  315
            +K LF  RP+VSAW  DI +RPAW K+V  LK+ 
Sbjct  180  VKHLFDERPHVSAWCKDIMARPAWEKVVALLKQA  213



>ref|XP_010069959.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
Length=213

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 153/208 (74%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG  +STATMRV A L EK L+F FV ID+ A  HK+E FL LNPFGQVPAFED 
Sbjct  1    MVMKVHGAVISTATMRVFAALYEKDLEFLFVPIDLRAGEHKKEHFLGLNPFGQVPAFEDE  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+L ESRAITQYIA+  A+KG  LVCE  K MAT  VWMEVE   FDP A  L WEL  
Sbjct  61   DLKLLESRAITQYIAHVYADKGTPLVCEG-KPMATVGVWMEVEALQFDPLAVKLQWELVY  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
             P + MATD  +VE+N+ +L+KVLDVYE RL +SKYLG D F+LADLHHLP +  LMGT 
Sbjct  120  NPRLDMATDAAVVEENEAKLAKVLDVYEARLSQSKYLGCDCFTLADLHHLPALTNLMGTP  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF +RP VSAW  DI +RPAW K++
Sbjct  180  LKKLFDARPKVSAWVADIVARPAWAKVL  207



>ref|XP_004495977.1| PREDICTED: glutathione S-transferase PARB-like [Cicer arietinum]
Length=214

 Score =   259 bits (663),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 152/207 (73%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG+  STATMRV A L EK L F FV I++    HK++PF+SLNPFGQVPAFEDGD
Sbjct  3    TIKVHGSPFSTATMRVTATLYEKQLQFDFVYINLQNGEHKKQPFISLNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYI     +KG  L+  D KK A   +W EVE+ H+D  AS L WELGIK
Sbjct  63   LKLFESRAITQYIVDEYGDKGTKLISNDSKKKAIIGLWSEVESQHYDQVASKLVWELGIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+     D  +VE+N+ +L+ +LDVYE RL  SKYLGG+ F+L DLHHLP++H LM +Q 
Sbjct  123  PLFESPLDPKVVEENEAKLNTILDVYEKRLSESKYLGGECFTLVDLHHLPSLHYLMKSQS  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF+SRP+VSAW  DI++RPAW K++
Sbjct  183  KELFESRPHVSAWVADITARPAWSKVL  209



>ref|XP_010689209.1| PREDICTED: glutathione S-transferase-like [Beta vulgaris subsp. 
vulgaris]
Length=213

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 157/214 (73%), Gaps = 1/214 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IK+HG   S AT+RV+A   EK LDF+ V +D+ +  HKQ+PFLSLNPFGQ+PAFEDG
Sbjct  1    MGIKIHGIPHSGATLRVLAAAEEKELDFELVPVDLKSGAHKQQPFLSLNPFGQIPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            D +LFESRAITQYIA+T  +KG  L+ +  K++    +WMEVE H FDPAAS L WEL  
Sbjct  61   DNKLFESRAITQYIAHTYESKGTSLIHKG-KQIIDVGIWMEVEAHQFDPAASKLLWELIY  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K   G+  D  +VE+N+ +L+KVLDVYE RL  SKYLGGD F+LADLHHLP +H L GT+
Sbjct  120  KSFFGIEIDNAVVEENETKLAKVLDVYEARLATSKYLGGDSFTLADLHHLPALHNLSGTK  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKET  315
            +K LF  RP+VSAW  DI +RPAW K+V  LK+ 
Sbjct  180  VKHLFDERPHVSAWCKDILARPAWEKVVALLKQA  213



>ref|XP_008451606.1| PREDICTED: glutathione S-transferase-like [Cucumis melo]
Length=215

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKVHG   STAT RV+A L EKGL F+ V++ +    HK+EPFLSLNPFGQVPAF+DGD
Sbjct  4    AIKVHGIPTSTATGRVLAALYEKGLQFELVNVKLHEGEHKREPFLSLNPFGQVPAFQDGD  63

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L LFESRAITQYI+   A+ G  L+ +DPKK A    W+EVE+HHFDP A  L +EL +K
Sbjct  64   LNLFESRAITQYISGNYASNGTQLIPQDPKKAAVVLTWIEVESHHFDPVAMKLVFELCLK  123

Query  593  PVIGMA-TDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            PV G    D  +V Q++  L KVLD+YE RL  SKYLGG+ FSLADLHHLP +  L+ TQ
Sbjct  124  PVFGWGDADPAVVAQSETELGKVLDIYEKRLSESKYLGGESFSLADLHHLPVLGYLLATQ  183

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             K LF+SRP+V+AW  DI +RP+W K++E  K
Sbjct  184  SKKLFESRPHVNAWVADIIARPSWAKVLELRK  215



>gb|KHG13026.1| Glutathione S-transferase F6 -like protein [Gossypium arboreum]
Length=215

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKVHG+ +STAT RV+ACL EKG DFQFV I+M A  HK E +LSLNPFGQVPAFEDGD
Sbjct  3    AIKVHGSPLSTATQRVLACLYEKGTDFQFVPINMAAGEHKSENYLSLNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKK-MATASVWMEVENHHFDPAASALTWELGI  597
            L+LFESRA+T YIA+  ++KG  L+     K MA   +W EVE H FD   S + WE   
Sbjct  63   LKLFESRAVTHYIAHEYSDKGTQLLIPGSNKDMAVLQLWKEVEAHQFDSPCSKIAWEAFY  122

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM TD  +VE+N+ +L+KVLDVYE RL RSKYL  D F+LADLHHLP I  L+ T 
Sbjct  123  KPLMGMVTDSAVVEENEGKLAKVLDVYEARLTRSKYLASDCFTLADLHHLPTIQYLLATP  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K L  SRP+V AW  +I++RPAW K++   K+
Sbjct  183  SKKLIDSRPHVCAWVKEITARPAWSKVLAMQKQ  215



>ref|XP_004136042.1| PREDICTED: glutathione S-transferase-like [Cucumis sativus]
 gb|KGN44915.1| Glutathione S-transferase [Cucumis sativus]
Length=215

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKVHG   STAT RV+A L EK L F+ V++ +    HK+EPF+SLNPFGQVPAF+DGD
Sbjct  4    AIKVHGIPTSTATGRVLAALYEKDLHFELVNVKLHEGEHKREPFISLNPFGQVPAFQDGD  63

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L LFESRAITQYI+   A+ G  L+ +DPKK A    W+EVE+HHFDP A  L +EL +K
Sbjct  64   LNLFESRAITQYISGNYASNGTQLIPQDPKKAAVVLTWIEVESHHFDPVAMKLVFELCLK  123

Query  593  PVIGMA-TDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            PV G    D  +VEQ++  L KVLD+YE RL  SKYLGG+ FSLADLHHLP +  L+ TQ
Sbjct  124  PVFGWGDADPAVVEQSETELGKVLDIYEKRLTESKYLGGESFSLADLHHLPVLGYLLATQ  183

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             K LF+SRP+V+AW  DI +RP+W K+VE  K
Sbjct  184  SKKLFESRPHVNAWVADIIARPSWAKVVELRK  215



>ref|XP_004160544.1| PREDICTED: glutathione S-transferase-like [Cucumis sativus]
Length=215

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKVHG   STAT RV+A L EK L F+ V++ +    HK+EPF+SLNPFGQVPAF+DGD
Sbjct  4    AIKVHGIPTSTATGRVLAALYEKDLHFELVNVKLHEGEHKREPFISLNPFGQVPAFQDGD  63

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L LFESRAITQYI+   A+ G  L+ +DPKK A    W+EVE+HHFDP A  L +EL +K
Sbjct  64   LNLFESRAITQYISGNYASNGTQLIPQDPKKSAVVLTWIEVESHHFDPVAMKLVFELCLK  123

Query  593  PVIGMA-TDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            PV G    D  +VEQ++  L KVLD+YE RL  SKYLGG+ FSLADLHHLP +  L+ TQ
Sbjct  124  PVFGWGDADPAVVEQSETELGKVLDIYEKRLTESKYLGGESFSLADLHHLPVLGYLLATQ  183

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             K LF+SRP+V+AW  DI +RP+W K+VE  K
Sbjct  184  SKKLFESRPHVNAWVADIIARPSWAKVVELRK  215



>ref|XP_002531868.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF30505.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=213

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 153/207 (74%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            A+KVHG+ +STAT RV+ACL EK  +F+FV+I+M A  HKQEPF+SLNPFGQVP  E GD
Sbjct  3    AVKVHGSPLSTATQRVLACLYEKETEFEFVNINMAAGEHKQEPFISLNPFGQVPVLEHGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQY+A+  ++KG  L+C    K A  SVWME E H F+  AS L WE+  K
Sbjct  63   LKLFESRAITQYLAHEYSDKGTQLLCPG-MKTAILSVWMEAEAHQFEQPASKLNWEIVYK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P   + TD   V++N+  L+KVLDVYE+RL +SKYL    F+LADLHHLPN+  LMGT+ 
Sbjct  122  PFFKLTTDPAAVQENEATLTKVLDVYESRLAQSKYLACGCFTLADLHHLPNLQLLMGTEC  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K L  +RP+VSAW  DI++RPAW K++
Sbjct  182  KKLIDARPHVSAWATDITARPAWAKVL  208



>ref|XP_010069962.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
 gb|KCW58491.1| hypothetical protein EUGRSUZ_H01166 [Eucalyptus grandis]
Length=213

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 156/208 (75%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KV+G  +STATMR+ A L EK L+F+FV IDM A  HK+E FL+LNPFGQVPAFEDG
Sbjct  1    MVMKVYGTVLSTATMRIFAALYEKDLEFEFVPIDMPAGEHKKEHFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRA+TQ+IA+  A++G  L+CE  K MAT  VWMEVE   F+P A  L  E   
Sbjct  61   DLKLFESRAVTQHIAHVFADEGTPLICEG-KSMATVGVWMEVEAQQFEPLALKLRREFLY  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP  G+ATD  +VE+++ +L+KVLDVYE RL +SKYLG D F+LADLH LP +  LMGT 
Sbjct  120  KPRSGVATDAAVVEESEAKLAKVLDVYEARLSQSKYLGCDCFTLADLHPLPTMTTLMGTP  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            ++ LF +RP +SAW  DIS+RPAW K++
Sbjct  180  VRKLFDARPKLSAWLADISARPAWAKVL  207



>gb|EPS69720.1| hypothetical protein M569_05047 [Genlisea aurea]
Length=213

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 157/212 (74%), Gaps = 0/212 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIK+HGN  S AT RV+ CL EK ++ +FV ID+    HK + FL+LNPFGQVPA EDG
Sbjct  1    MAIKIHGNPFSPATQRVLVCLAEKEIEHEFVVIDLMKGEHKAQQFLTLNPFGQVPALEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAI QY+A    +KG  LV +D KK A  +VW EVE H FD AA  L+ EL +
Sbjct  61   DLKLFESRAINQYLANQYGSKGTELVPKDAKKQALTAVWSEVEAHPFDAAAIGLSKELIV  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ G A D+ +VE+NKE+L+KVLDVYE RL  SKYLGGD FSLADL+H+P+++ L  T+
Sbjct  121  KPMFGGAADKAVVEENKEKLAKVLDVYEARLSASKYLGGDSFSLADLNHIPSLNALFTTE  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
            IK +F++RP V+AW VDI  R +W K+++ LK
Sbjct  181  IKAVFEARPRVNAWAVDILGRASWKKVLQILK  212



>ref|XP_010069957.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
 gb|KCW58496.1| hypothetical protein EUGRSUZ_H01173 [Eucalyptus grandis]
Length=213

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 155/208 (75%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA KVHG+  S  TMR++  L EK L+F+FV +++ A  HK+E FL+LNPFGQVP FEDG
Sbjct  1    MATKVHGSVFSAPTMRLLIALHEKDLEFEFVFVNLRAGEHKKEHFLALNPFGQVPVFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA+   +KG  LVCE  + MAT SVWMEVE H FDPAAS L  EL  
Sbjct  61   DLKLFESRAITQYIAHVYEDKGTPLVCEG-EPMATVSVWMEVEAHQFDPAASKLHRELVY  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K  IGMATD  +VE+N+ +L+KVLD+YE RL +SKYLG D F+LADLHHLP +  LMGT 
Sbjct  120  KSKIGMATDAAVVEENEAKLAKVLDIYEVRLSQSKYLGCDCFTLADLHHLPALTSLMGTP  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF +RP VSAW  DI + PA  K++
Sbjct  180  VKKLFDARPKVSAWVADIMAWPALAKVL  207



>gb|AAF65767.1|AF242309_1 glutathione S-transferase [Euphorbia esula]
Length=213

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 150/207 (72%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG  MSTAT RV+ CL EKGLD++   ++M    HK++PFLS+NPFGQVP FE GD
Sbjct  3    GIKVHGAAMSTATQRVLVCLEEKGLDYELCPVNMATGEHKKQPFLSINPFGQVPGFEHGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYI +  A KG +L+C+  K+MA   VW+EVE   F+P AS L WE+  K
Sbjct  63   LKLFESRAITQYITHENAQKGTNLLCQG-KEMAILGVWLEVEAQKFEPVASKLNWEIVFK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD   VE+N+ +L+ VLDVYE RL +SKYLGGD F+LADLHHLPN+  L+  Q 
Sbjct  122  PMFGMQTDPAAVEENETKLAGVLDVYETRLSQSKYLGGDSFTLADLHHLPNLQLLLNHQS  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K +  +RP V+AW  DI++R  W K++
Sbjct  182  KKVIDARPKVAAWAADITARQTWAKVL  208



>ref|XP_010684411.1| PREDICTED: glutathione S-transferase-like [Beta vulgaris subsp. 
vulgaris]
Length=216

 Score =   252 bits (644),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 154/215 (72%), Gaps = 1/215 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG+  STAT+RVVA L EK LDF FV +++    HK++PFLSLNPFGQVPAFEDG
Sbjct  1    MGLKVHGSNTSTATLRVVATLHEKQLDFDFVFVNLRTGSHKEKPFLSLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAIT+YIA    + G  L+ +DPK+MA   VWMEVE   FD A SAL WEL  
Sbjct  61   DLQLFESRAITKYIASAYDDNGTPLIYKDPKQMAILGVWMEVEALQFDIAGSALVWELFY  120

Query  596  K-PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            K  + G   D  +VE+N++ L+ VLDVYE RL +SKYLGGD F+LADLHHLP +H LM T
Sbjct  121  KNSIYGQPPDAAVVEENEKSLANVLDVYEGRLGKSKYLGGDSFTLADLHHLPIVHLLMDT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKET  315
            + K  F  RP+VSAW  DI SRP+W K +   K+ 
Sbjct  181  KEKKHFDERPHVSAWSKDILSRPSWQKAIAMWKQV  215



>dbj|BAM21532.1| glutathione S-transferase-like protein [Dianthus caryophyllus]
Length=208

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 152/205 (74%), Gaps = 0/205 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKVHG+ +STAT+R +A L EK +DF+FV +DM +  HKQ  FLSLNPFGQVPA EDGD
Sbjct  3    SIKVHGSPISTATLRALAVLHEKNVDFEFVFVDMKSGAHKQPHFLSLNPFGQVPALEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            +++FESRAIT+Y+A    + G  LV +D K++A  ++W EVE H FDP AS L WEL  K
Sbjct  63   IKVFESRAITKYVATAYESSGTPLVVQDKKQLANFAIWSEVEAHQFDPVASKLAWELFYK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
             + GM TD  +VE+N+ +L+KV+DVYE  L +SKYL GD F+LADLHHLP +H L GT+ 
Sbjct  123  GLFGMETDTAVVEENEAKLAKVVDVYEAHLSQSKYLAGDSFTLADLHHLPALHYLSGTRA  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLK  339
            K +F +RP+VSAW  DI  RPAW K
Sbjct  183  KAVFDARPHVSAWVKDILGRPAWQK  207



>gb|KDO87317.1| hypothetical protein CISIN_1g038052mg [Citrus sinensis]
Length=225

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 147/206 (71%), Gaps = 1/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKVHG  MSTA  RV  CL EK L+F+FV +DM +  HK+E +LSLNPFGQVPA E G  
Sbjct  4    IKVHGAAMSTAAQRVFTCLYEKELNFEFVPVDMASGEHKKEAYLSLNPFGQVPALEHGGQ  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            ++FESRAITQYIA     KG  L   D K  ++  +W EVE H FDP AS LTWE+ +KP
Sbjct  64   KIFESRAITQYIAMEYPEKGTRLASAD-KPSSSFLIWKEVEAHQFDPVASKLTWEIVLKP  122

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + GM  D T+VE+ K +L+KVLDVYE RL +SKYL  D F+L D+HHLP I+ LM TQ+K
Sbjct  123  MFGMTIDPTMVEEYKAKLAKVLDVYEARLTKSKYLASDSFTLVDMHHLPTINLLMRTQVK  182

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             LF +RP VSAW  DI++RPAW K++
Sbjct  183  QLFNARPRVSAWVADITARPAWTKVL  208



>gb|EPS58503.1| hypothetical protein M569_16312, partial [Genlisea aurea]
Length=208

 Score =   251 bits (641),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 151/208 (73%), Gaps = 0/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIK+HGN  S A  RV+ CL EKGLD++F+ +D+    HK   FL LNPFGQVPA EDG
Sbjct  1    MAIKLHGNPFSPAAQRVLLCLGEKGLDYEFIVLDLMKGEHKTHSFLQLNPFGQVPALEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAI QY+A   A+KG  LV +D KK A  +VW EVE+H FD AA  L+ EL +
Sbjct  61   DLKLFESRAINQYLANNYADKGAALVSDDRKKQALIAVWSEVESHPFDAAAIGLSRELIV  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ G A D  +V + KE+L KVLDVYE RL  SKYLGG+ FSLADLHH+P+I+ L  T+
Sbjct  121  KPMFGGAADGAVVAEQKEKLEKVLDVYEGRLSVSKYLGGESFSLADLHHVPSINALFMTE  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            IK +F++RP V+AW  DI  RPAW K++
Sbjct  181  IKAVFEARPRVAAWCADILGRPAWKKVL  208



>ref|XP_006444272.1| hypothetical protein CICLE_v10024356mg, partial [Citrus clementina]
 gb|ESR57512.1| hypothetical protein CICLE_v10024356mg, partial [Citrus clementina]
Length=212

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 146/206 (71%), Gaps = 1/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKVHG  MSTA  RV  CL EK L+F+FV +DM +  HK+E +LSLNPFGQVPA E G  
Sbjct  4    IKVHGAAMSTAAQRVFTCLYEKELNFEFVPVDMASGEHKKEAYLSLNPFGQVPALEHGGQ  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            ++FESRAITQYIA     KG  L   D K  ++  +W EVE H FDP AS LTWE+ +KP
Sbjct  64   KIFESRAITQYIAMEYPEKGTRLASAD-KPSSSFLIWKEVEAHQFDPVASKLTWEIVLKP  122

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + GM  D  +VE+ K +L+KVLDVYE RL +SKYL  D F+L D+HHLP I+ LM TQ+K
Sbjct  123  MFGMTIDPAMVEEYKAKLAKVLDVYEARLTKSKYLASDSFTLVDMHHLPTINLLMRTQVK  182

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             LF +RP VSAW  DI++RPAW K++
Sbjct  183  QLFNARPRVSAWVADITARPAWTKVI  208



>ref|XP_007050853.1| Glutathione S-transferase 7 isoform 2 [Theobroma cacao]
 gb|EOX95010.1| Glutathione S-transferase 7 isoform 2 [Theobroma cacao]
Length=205

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IK HG+ +STAT RV+ CL EK ++FQFV ++MGA  HK E +LSLNPFGQVPAFE+G+L
Sbjct  4    IKAHGSLLSTATQRVLLCLYEKEVEFQFVPVNMGAGEHKSENYLSLNPFGQVPAFEEGNL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDP-KKMATASVWMEVENHHFDPAASALTWELGIK  594
            +LFESRAIT+YIA+   +KG  L+     K MA  S+W EVE H FDPA+S L WEL IK
Sbjct  64   KLFESRAITEYIAHEYTDKGTQLLLPGSNKSMAVLSLWKEVEAHQFDPASSKLAWELFIK  123

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P++GMATD  +VE+ + +L+KVLDVYE RL +SKYL  D+F+LADLHHLPNI CL+GT  
Sbjct  124  PILGMATDSAVVEEYEPKLAKVLDVYETRLSQSKYLACDYFTLADLHHLPNIQCLLGTPA  183

Query  413  KTLFQSRPNVSAWWVDI  363
            K LF SRP++   ++ +
Sbjct  184  KRLFDSRPHILGRYLTL  200



>gb|KHG05656.1| Glutathione S-transferase F6 -like protein [Gossypium arboreum]
Length=215

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 154/213 (72%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            A+KVHG  +STAT RV+ACL EK ++FQFV++DM A  HK   FL LNPFGQVPAFE+GD
Sbjct  3    AMKVHGYPLSTATQRVLACLYEKDVEFQFVNVDMIAGEHKSPNFLPLNPFGQVPAFEEGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKK-MATASVWMEVENHHFDPAASALTWELGI  597
            L+LFESRA T YIA+  A+KG  L+     K MA   +W EVE H FDP ++ L +EL  
Sbjct  63   LKLFESRATTHYIAHEYADKGTQLLLPGSNKTMAVFQLWKEVEAHQFDPPSTKLVFELRY  122

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP  GM TD  +VE+ +++L+KVLDVYE RL  SKYL  D F+LADLHHLP +  L+G+ 
Sbjct  123  KPHFGMTTDAAVVEEYEDKLAKVLDVYEARLAESKYLACDHFTLADLHHLPTVQYLLGSS  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K +F SRP+VSAW  DI++RPAW K++  LK+
Sbjct  183  AKKMFDSRPHVSAWVADITARPAWSKVMGMLKQ  215



>prf||1906389A glutathione S-transferase
Length=217

 Score =   249 bits (636),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 156/217 (72%), Gaps = 3/217 (1%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IKVHGN  STAT RV+  L EK L+F+FV IDMGA  HKQ  +L+LNPFGQVPA EDG
Sbjct  1    MTIKVHGNPRSTATQRVLVALYEKHLEFEFVPIDMGAGGHKQPSYLALNPFGQVPALEDG  60

Query  776  DLELFESRAITQYIAYT--CANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWEL  603
            +++LFESRAIT+Y+AYT    N+G  L+ ++  +MA   VW EVE H FDP AS L WEL
Sbjct  61   EIKLFESRAITKYLAYTHDHQNEGTSLIHKEKHEMAAQLVWEEVEAHQFDPVASKLAWEL  120

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGG-DWFSLADLHHLPNIHCLM  426
              K + GM TD T+VE+N+ +L+KVLDVYE RL  S+YLG  D F+L DLHHLP +  LM
Sbjct  121  VFKGIFGMQTDTTVVEENEAKLAKVLDVYEARLTESEYLGANDSFTLVDLHHLPLLGYLM  180

Query  425  GTQIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKET  315
            GTQ+K LF+ R +VSAW   I +RP+W K +   K++
Sbjct  181  GTQVKKLFEERAHVSAWCKKILARPSWEKTLALQKQS  217



>gb|KCW58502.1| hypothetical protein EUGRSUZ_H01176 [Eucalyptus grandis]
Length=204

 Score =   249 bits (635),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 151/208 (73%), Gaps = 10/208 (5%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG+ +STA MRV+  L EKGL+F+FV +DM A  HK+E FL+LNPFGQVPAFEDG
Sbjct  1    MVMKVHGSVLSTAAMRVLIVLNEKGLEFEFVPVDMRAGEHKKEHFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAITQYIA    +KG  LVCE  K MAT           FDP  S L WEL  
Sbjct  61   DLKLFESRAITQYIANVYKDKGTPLVCEG-KPMATLG---------FDPVGSKLQWELLF  110

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GMATD  +VE+N+ +L+KVLD+YE RL +SKYLG D F+LADLHHLP +  LMGT 
Sbjct  111  KPMFGMATDAAVVEENEAKLAKVLDIYEARLSQSKYLGCDCFTLADLHHLPVLTNLMGTH  170

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            +K LF +RP VSAW  DI +RPA  K++
Sbjct  171  VKKLFDARPKVSAWVADIMTRPALAKVL  198



>gb|ABK32074.1| glutathione-S-transferase [Acanthus ebracteatus]
Length=215

 Score =   249 bits (635),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 155/212 (73%), Gaps = 1/212 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             +KVHG+ +S A+ RVV CL EK LD+ F  +DM A  HKQ+ FLSLNPFGQVPAF+DGD
Sbjct  3    GLKVHGHPISPASRRVVLCLEEKALDYDFQFVDMAAGQHKQQQFLSLNPFGQVPAFQDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L LFESRAIT+YIA   A+KG  L+  D KK+  A  W EVE+H FD AA+ L++EL +K
Sbjct  63   LNLFESRAITEYIARAYADKGTPLIPSDVKKLGVALAWAEVESHTFDSAAAPLSFELVVK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT-Q  417
            P++GM  DE +V +N  +L KVLDVYE RL  SKYLGGD F+LADLHH+P ++ LM T +
Sbjct  123  PILGMPIDEAVVAENLAKLEKVLDVYEARLTTSKYLGGDDFTLADLHHIPIVNNLMHTDK  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
            +K LF  R +VSAW  DI +RPAW K ++ +K
Sbjct  183  VKPLFDGRLHVSAWSKDILARPAWQKTLDKMK  214



>ref|XP_006444273.1| hypothetical protein CICLE_v10022212mg [Citrus clementina]
 ref|XP_006479908.1| PREDICTED: glutathione S-transferase-like [Citrus sinensis]
 gb|ESR57513.1| hypothetical protein CICLE_v10022212mg [Citrus clementina]
 gb|KDO87315.1| hypothetical protein CISIN_1g046920mg [Citrus sinensis]
Length=213

 Score =   249 bits (635),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 149/211 (71%), Gaps = 1/211 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG+  STAT RV A L EK L+++ V +DM A  HK+E FLSLNPFGQVP  E GD
Sbjct  3    GIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEAFLSLNPFGQVPVLEHGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA    +KG  L C   K +A   VW EVE   FDP +S L WEL  K
Sbjct  63   QKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD   VE+N+ +L+K+LDVYE RL +SKYL  D F+L DLHHLPNI+ L+GT +
Sbjct  122  PMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPV  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
            K LF +RP+VSAW  DI+SRPAW K++  LK
Sbjct  182  KKLFDARPHVSAWAADITSRPAWAKVLALLK  212



>sp|Q04522.3|GSTF_SILVU RecName: Full=Glutathione S-transferase; AltName: Full=GST class-phi 
[Silene vulgaris]
 gb|AAA33930.1| glutathione-S-transferase [Silene vulgaris]
 gb|AAA33931.1| glutathione-S-transferase [Silene vulgaris]
 prf||1906385A glutathione S-transferase
Length=217

 Score =   249 bits (635),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 155/216 (72%), Gaps = 3/216 (1%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IKVHGN  STAT RV+  L EK L+F+FV IDMGA  HKQ  +L+LNPFGQVPA EDG
Sbjct  1    MTIKVHGNPRSTATQRVLVALYEKHLEFEFVPIDMGAGGHKQPSYLALNPFGQVPALEDG  60

Query  776  DLELFESRAITQYIAYT--CANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWEL  603
            +++LFESRAIT+Y+AYT    N+G  L+ ++  +MA   VW EVE H FDP AS L WEL
Sbjct  61   EIKLFESRAITKYLAYTHDHQNEGTSLIHKEKHEMAAQLVWEEVEAHQFDPVASKLAWEL  120

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGG-DWFSLADLHHLPNIHCLM  426
              K + GM TD T+VE+N+ +L+KVLDVYE RL  S+YLG  D F+L DLHHLP +  LM
Sbjct  121  VFKGIFGMQTDTTVVEENEAKLAKVLDVYEARLTESEYLGANDSFTLVDLHHLPLLGYLM  180

Query  425  GTQIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            GTQ+K LF+ R +VSAW   I +RP+W K +   K+
Sbjct  181  GTQVKKLFEERAHVSAWCKKILARPSWEKTLALQKQ  216



>emb|CDP03518.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG+  S A +RV ACL EK L+ ++V+I+M A  HK+E FL+LNPFGQVP FEDG
Sbjct  1    MAIKVHGSVFSPAVLRVFACLNEKDLESEYVEINMRAGEHKKESFLALNPFGQVPGFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLV--CEDPKKMATASVWMEVENHHFDPAASALTWEL  603
            DL+LFESRAI QYIA   A KGN  +   +D KKM    VWMEVE   FDP +S L +EL
Sbjct  61   DLKLFESRAINQYIAQAYAAKGNQQLTFVQDAKKMGPVYVWMEVEAQKFDPPSSKLVFEL  120

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
             IKP++GM TD+  V +++ +L +VLDVYE RL +SKYL GD F+LADL+HLP I+ LMG
Sbjct  121  AIKPLLGMNTDDAAVAEHEGKLGEVLDVYEARLGQSKYLAGDCFTLADLNHLPAINYLMG  180

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            T  + +F + P+VSAW  DI +RPAW K++   K+
Sbjct  181  TTARKVFDALPHVSAWCADILARPAWAKVLALQKQ  215



>ref|XP_010667053.1| PREDICTED: glutathione S-transferase-like [Beta vulgaris subsp. 
vulgaris]
Length=214

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 152/212 (72%), Gaps = 0/212 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M IKVHG+ +  AT+RVVA L EK LDF+FV +D+ +  HKQ+P LSLNPFGQVPAFEDG
Sbjct  1    MGIKVHGSPLCCATLRVVAALHEKELDFEFVLVDIRSGAHKQQPHLSLNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            D +L+ESRAIT+Y+ Y   +KG  LV +D K+ A  + WMEVE   FDP A+ L  EL  
Sbjct  61   DFKLYESRAITKYLTYVYKSKGTALVYQDLKQKAIRAAWMEVEALQFDPPATKLIEELVF  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K      TD  IVE+++ +L+KVLDVYE+RL  SKYLGG+ F+LADLHHLP +H L+GTQ
Sbjct  121  KGTTSTQTDMAIVEESEAKLAKVLDVYESRLGESKYLGGETFTLADLHHLPQLHMLIGTQ  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
            +K + + RP+V  W  DI +RPAW K +  LK
Sbjct  181  VKKVLEERPHVYVWCKDILARPAWEKTIALLK  212



>ref|XP_010522774.1| PREDICTED: glutathione S-transferase F7-like [Tarenaya hassleriana]
Length=257

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 150/203 (74%), Gaps = 0/203 (0%)
 Frame = -2

Query  947  KVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDLE  768
            KV G+  ST T RV+A L EKGL F+ V +++    HK+EPFLSLNPFGQVPAFEDGDL+
Sbjct  51   KVRGHPFSTNTRRVLAVLHEKGLTFESVHVELKDGEHKKEPFLSLNPFGQVPAFEDGDLK  110

Query  767  LFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKPV  588
            LFESRAITQYIA     +G  L+  + K++A   +WMEVE H FDP AS LTWE  IKP+
Sbjct  111  LFESRAITQYIAQKHMEEGTQLLSHEDKEIAIIRLWMEVEAHQFDPLASKLTWEQMIKPM  170

Query  587  IGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIKT  408
             G+ TD   V++++ +L+KVLDVYE+RL +SKYLG D F++ADLHHLPNI  L GT  K 
Sbjct  171  YGIPTDPEAVKESESKLAKVLDVYESRLAQSKYLGSDSFTMADLHHLPNIEYLSGTPTKK  230

Query  407  LFQSRPNVSAWWVDISSRPAWLK  339
            LF+ RP+VS+W  +I+ RPAW K
Sbjct  231  LFEERPHVSSWVAEITGRPAWKK  253



>gb|AAC63629.2| glutathione S-transferase (GST6) [Arabidopsis thaliana]
Length=215

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 152/213 (71%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKVHG  MSTATMRV+A L EK L F+ + +DM A  HKQE  L+LNPFGQ+PA EDGD
Sbjct  3    SIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGI  597
            L LFESRAITQY+A   + KG  L+ +D KK+ AT +VW++VE   FDP AS L +E   
Sbjct  63   LTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVF  122

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K + GM TD   V++ + +L KVLDVYE RL +S++L GD F+LADLHHLP IH L+GT 
Sbjct  123  KGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTD  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K LF SRP VS W   IS+RPAW K+++  K+
Sbjct  183  SKVLFDSRPKVSEWIKKISARPAWAKVIDLQKQ  215



>ref|XP_011010723.1| PREDICTED: glutathione S-transferase F6-like [Populus euphratica]
 ref|XP_011014104.1| PREDICTED: glutathione S-transferase F6-like [Populus euphratica]
Length=213

 Score =   247 bits (630),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 150/209 (72%), Gaps = 1/209 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +K+HG  +ST T RV+A L EK ++F+ V++++GA  HKQEP +SLNPFGQVPA  DGDL
Sbjct  4    LKLHGTPISTNTQRVLATLYEKEVEFELVNVNLGAGEHKQEPHISLNPFGQVPAAVDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAI+QY+A+  A+KG  L        AT  VW EVE+H FDP+AS L WEL  KP
Sbjct  64   KLFESRAISQYVAHQYASKGTQLGAAG-NGYATILVWQEVESHQFDPSASKLVWELVFKP  122

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G+ TD  +V + +  L KVLDVYE RL +SKYL GD F+LADLHHLPNI  L+GT  K
Sbjct  123  IFGLPTDAALVAETEVTLGKVLDVYEARLSQSKYLAGDCFTLADLHHLPNIQALLGTPSK  182

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMVEWL  324
             LF SRP+VSAW   I+ RPAW K++  L
Sbjct  183  KLFDSRPHVSAWVASITGRPAWGKVLALL  211



>emb|CDX80129.1| BnaA05g00270D [Brassica napus]
Length=216

 Score =   246 bits (629),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 151/213 (71%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG  +STATMRV+A L EKGLDF+ V +DM A  HKQEP +SLNPFGQ+PA  DGD
Sbjct  4    GIKVHGVPISTATMRVLATLYEKGLDFELVPVDMKAGAHKQEPLISLNPFGQIPALLDGD  63

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGI  597
            L LFESRAIT+YIA    NKG  L+C+  KK+ A   VW++VE   FDP AS L +E   
Sbjct  64   LTLFESRAITEYIADEYNNKGEKLLCQSCKKLKAITKVWLQVEGQQFDPIASKLAFERVF  123

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K ++GM TD   VE  + +L KVLD+YE RL +S +L GD F+LADLHHLP I+ LMGT 
Sbjct  124  KGMLGMTTDPAAVEDLEAKLVKVLDIYEARLSKSPFLAGDCFTLADLHHLPIIYYLMGTD  183

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K LF+SRP VS W   I++RP+W+K++   K+
Sbjct  184  SKKLFESRPKVSEWIKKITARPSWVKVLNLQKQ  216



>ref|XP_010522776.1| PREDICTED: glutathione S-transferase F6-like [Tarenaya hassleriana]
Length=210

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 152/208 (73%), Gaps = 0/208 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG   ST T RV+A L EKGL+F+FV++++    HK+EPF+SLNPFG+VPAFEDGD
Sbjct  3    GIKVHGKPSSTCTRRVLATLHEKGLEFEFVNVELKDGEHKKEPFISLNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+L+ESRAITQYIA+   +KG  L+C   K MA  S+WMEVE H FDP AS L +E   K
Sbjct  63   LQLYESRAITQYIAHEHPDKGTELLCPGSKNMAVLSLWMEVEAHQFDPVASKLAFEQVFK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
               G+ TD+  VE+ + +L+KVLDVY++RL +SKYL  D F+LADLHH+P I  LM T  
Sbjct  123  LFYGLPTDQAAVEEAEAKLAKVLDVYDDRLSKSKYLVCDCFTLADLHHIPVIQYLMTTPT  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            K LF+ RP VS+W  DI++RPA  K+++
Sbjct  183  KKLFEERPRVSSWVADITARPASQKILQ  210



>gb|AAY84147.1| glutathione S-transferase [Catharanthus roseus]
Length=220

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 158/214 (74%), Gaps = 2/214 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLD-FQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            AIKVHG+ +S A +RV ACL EK L   ++V ++M    HK+EPFL+LNPFGQVP FEDG
Sbjct  5    AIKVHGSVLSPAVLRVFACLYEKDLSSAEYVPVNMATGDHKKEPFLTLNPFGQVPGFEDG  64

Query  776  DLELFESRAITQYIAYTCANKGNHL-VCEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL+LFESRAI QYI     +KGN L   +DPKK A   VWMEVE   FDPAAS L +EL 
Sbjct  65   DLKLFESRAINQYIVQAYGDKGNQLNFHDDPKKNALVYVWMEVEAQRFDPAASKLLFELC  124

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP++GM T++ +V++ + +L ++LDVYE RL +S YL  D F+LADL+H+P I+ LMG+
Sbjct  125  IKPILGMTTNDAVVQEYEAKLGEILDVYEARLKQSNYLAADTFTLADLNHIPAINYLMGS  184

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            + K +F++RP+V+AW  DI +RPAW K++E  K+
Sbjct  185  KAKAVFEARPHVNAWCADILARPAWSKVLELQKK  218



>ref|XP_009142506.1| PREDICTED: glutathione S-transferase F8, chloroplastic [Brassica 
rapa]
Length=216

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 150/213 (70%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG  +STATMRV+A L EKGLDF+ V +DM A  HKQEP +SLNPFGQ+PA  DGD
Sbjct  4    GIKVHGVPISTATMRVLATLYEKGLDFELVPVDMKAGAHKQEPLISLNPFGQIPALLDGD  63

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGI  597
            L LFESRAIT+YIA    NKG  L+C+  KK+ A   VW++VE   FDP AS L +E   
Sbjct  64   LTLFESRAITEYIADEYNNKGEKLLCQSCKKLKAITKVWLQVEGQQFDPIASKLAFERVF  123

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K ++GM TD   VE  + +L KVLD+YE RL +S  L GD F+LADLHHLP I+ LMGT 
Sbjct  124  KGMLGMTTDPATVEDLEAKLVKVLDIYEARLSKSPILAGDCFTLADLHHLPIIYYLMGTD  183

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K LF+SRP VS W   I++RP+W+K++   K+
Sbjct  184  SKKLFESRPKVSEWIKKITARPSWVKVLNLQKQ  216



>ref|XP_002880321.1| glutathione S-transferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56580.1| glutathione S-transferase [Arabidopsis lyrata subsp. lyrata]
Length=215

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 149/212 (70%), Gaps = 1/212 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKVHG  MSTATMRV+A L EK L F+ + +DM A  HKQEP LSLNPFGQ+PA EDGDL
Sbjct  4    IKVHGVPMSTATMRVLAALYEKDLQFELIPVDMRAGAHKQEPHLSLNPFGQIPALEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGIK  594
             LFESRAITQYIA   + KG  L+C   KK+ AT +VW++VE   FDP AS L +E   K
Sbjct  64   SLFESRAITQYIAEEYSEKGEKLLCPGCKKVKATTNVWIQVEGQQFDPNASKLAFERVFK  123

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
             + GM TD   V++ + +L KVLD+YE RL +S +L  D F+LADLHHLP IH LMGT  
Sbjct  124  GMFGMTTDPAAVQELEGKLQKVLDIYEARLSKSDFLACDCFTLADLHHLPAIHYLMGTDS  183

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            K LF SRP VS W   I++RPAW K+++  K+
Sbjct  184  KVLFDSRPKVSEWVKKITARPAWAKVIDLQKQ  215



>ref|XP_010041099.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
Length=213

 Score =   244 bits (622),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 152/208 (73%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +K++G+  ST T RV A L EKGL F+FV +DM A  HK++ FL+LNPFGQVPAFEDG
Sbjct  1    MVMKIYGSVNSTETTRVFAALYEKGLPFEFVPVDMRAGEHKEDHFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAIT+YIA+  A KG  LV E  K MAT +VW EVE   FDP AS L  EL  
Sbjct  61   DLKLFESRAITRYIAHKYAEKGTPLVYEG-KMMATVNVWTEVEARQFDPVASKLQRELVH  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            + + G+A D  + E+N   L+KVLD+YE RL +SKYLG D+F++ADLHHLP +  LMGT 
Sbjct  120  RQMFGVAPDAAVFEENGTELTKVLDIYEARLSQSKYLGCDFFTVADLHHLPALTNLMGTP  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
             +TLF +RP VSAW  ++ +RPAWLK++
Sbjct  180  ARTLFDARPKVSAWVANLMARPAWLKVL  207



>dbj|BAJ33833.1| unnamed protein product [Thellungiella halophila]
Length=215

 Score =   243 bits (621),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 150/213 (70%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKVHG  MSTATMRV+A L EK LDF+ + +DM A  HKQEPFLSLNPFGQ+PA +DGD
Sbjct  3    SIKVHGVPMSTATMRVLAALYEKDLDFELIPVDMRAGAHKQEPFLSLNPFGQIPALQDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGI  597
            L LFESRAIT+YIA   + KG  L+C   KK+ AT +VW++VE   FDP AS + +E   
Sbjct  63   LTLFESRAITEYIAEEYSEKGEKLLCPGCKKVKATTNVWLQVEGQQFDPIASKIAFERIF  122

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K + GM TD   VE+ + +L KVLD+YE RL +S +L  D F+LADLHHLP IH LMGT 
Sbjct  123  KGMFGMTTDPAAVEELEGKLVKVLDIYEARLAKSDFLACDCFTLADLHHLPAIHYLMGTD  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K LF+SR  V  W   I++RPAW K+V   K+
Sbjct  183  SKKLFESRAKVCDWVKKITARPAWAKVVALQKQ  215



>ref|XP_006387912.1| hypothetical protein POPTR_0483s00220g [Populus trichocarpa]
 gb|ADB11333.1| phi class glutathione transferase GSTF5 [Populus trichocarpa]
 gb|ERP46826.1| hypothetical protein POPTR_0483s00220g [Populus trichocarpa]
Length=213

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 149/209 (71%), Gaps = 1/209 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +K+HG+ +ST T RV+A L EK ++F+ V++++GA  HKQEP +SLNPFGQVPA  DGDL
Sbjct  4    LKLHGSVLSTNTQRVLATLYEKEVEFELVNVNLGAGEHKQEPHISLNPFGQVPAAVDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAI+QY+A+  A+KG  L        AT  VW EVE+H FDP+AS L WE   KP
Sbjct  64   KLFESRAISQYVAHQYASKGTQLGAAG-NGYATILVWQEVESHQFDPSASKLVWEQVFKP  122

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            V G+ TD  +V + +  L KVLDVYE RL +SKYL  D F+LADLHHLPNI  L+GT  K
Sbjct  123  VFGLPTDAALVAETEVTLGKVLDVYEARLSQSKYLASDSFTLADLHHLPNIQALLGTPSK  182

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMVEWL  324
             LF SRP+VSAW   I+ RPAW K++  L
Sbjct  183  KLFDSRPHVSAWVASITGRPAWGKVLALL  211



>ref|XP_006386754.1| glutathione S-transferase family protein [Populus trichocarpa]
 gb|ABK93689.1| unknown [Populus trichocarpa]
 gb|ABK94667.1| unknown [Populus trichocarpa]
 gb|ADB11334.1| phi class glutathione transferase GSTF6 [Populus trichocarpa]
 gb|ERP64551.1| glutathione S-transferase family protein [Populus trichocarpa]
Length=213

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 148/209 (71%), Gaps = 1/209 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +K+HG  +ST T RV+A L EK ++F+ V++++GA  HKQEP +SLNPFGQVPA  DGDL
Sbjct  4    LKLHGTPISTNTQRVLATLYEKEVEFELVNVNLGAGEHKQEPHISLNPFGQVPAAVDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAI+QY+A+  A+KG  L        AT  VW EVE+H FDP+AS L WE   KP
Sbjct  64   KLFESRAISQYVAHQYASKGTQLGAAG-NGYATILVWQEVESHQFDPSASKLVWEQVFKP  122

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            V G+ TD  +V + +  L KVLDVYE RL +SKYL  D F+LADLHHLPNI  L+GT  K
Sbjct  123  VFGLPTDAALVAETEVTLGKVLDVYEARLSQSKYLASDSFTLADLHHLPNIQALLGTPSK  182

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMVEWL  324
             LF SRP+VSAW   I+ RPAW K++  L
Sbjct  183  KLFDSRPHVSAWVASITGRPAWGKVLALL  211



>gb|KFK42653.1| hypothetical protein AALP_AA1G022700 [Arabis alpina]
Length=238

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 151/205 (74%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHG+  ST T RV+A L EKGL ++ + +D+    HK+EPFLSLNPFGQVP FEDG
Sbjct  18   LGYKVHGHPFSTNTRRVLAVLFEKGLSYEPITVDLQTGEHKREPFLSLNPFGQVPVFEDG  77

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++L ESRAITQYIAY  +++G  L+  +  + MAT ++WME+E H FDP AS LTWEL 
Sbjct  78   NVKLCESRAITQYIAYVHSSRGTQLLNLQSHETMATLTMWMEIEAHQFDPPASKLTWELV  137

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD+TIV++ +  L KVL+VYE RL  SK+L  + F+L DLHHLPNI  L+GT
Sbjct  138  IKPLYGLKTDQTIVKEQEANLEKVLNVYEKRLGESKFLACNSFTLVDLHHLPNIQYLLGT  197

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
             I+ LF++RPNV  W  DI+SR AW
Sbjct  198  PIEKLFENRPNVRKWVGDITSREAW  222



>ref|XP_010507859.1| PREDICTED: glutathione S-transferase F8, chloroplastic-like [Camelina 
sativa]
Length=217

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 148/212 (70%), Gaps = 1/212 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKVHG  MSTATMRV+A L EK L F+ + +DM A  HKQEPFLSLNPFGQ+PA +DGDL
Sbjct  6    IKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEPFLSLNPFGQIPALQDGDL  65

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATAS-VWMEVENHHFDPAASALTWELGIK  594
             +FESRAITQYIA   + KG  L C   KK+  A+ +W++VE   FDP AS L +E   K
Sbjct  66   TIFESRAITQYIAEEYSEKGEKLFCPGCKKVKAATLIWLQVEGQQFDPIASKLAFERVFK  125

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
             + GM TD   V   + +L+KVLD+YE RL  S ++  D F+LADLHHLP IH LM T+ 
Sbjct  126  GMFGMTTDPAAVLDLESKLAKVLDIYEARLATSPFVACDCFTLADLHHLPAIHYLMSTES  185

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            K LF+SRP VS W   I++RPAW K+V+ LK+
Sbjct  186  KQLFESRPKVSEWVNKITARPAWAKVVDLLKQ  217



>ref|XP_006397969.1| hypothetical protein EUTSA_v10001585mg [Eutrema salsugineum]
 gb|ESQ39422.1| hypothetical protein EUTSA_v10001585mg [Eutrema salsugineum]
Length=269

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 150/213 (70%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKVHG  MSTATMRV+A L EK LDF+ + +DM A  HKQEPFLSLNPFGQ+PA +DGD
Sbjct  57   SIKVHGVPMSTATMRVLAALYEKDLDFELIPVDMRAGAHKQEPFLSLNPFGQIPALQDGD  116

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGI  597
            L LFESRAIT+YIA   + KG  L+C   KK+ AT +VW++VE   FDP AS + +E   
Sbjct  117  LTLFESRAITEYIAEEYSEKGEKLLCPGCKKVKATTNVWLQVEGQQFDPIASKIAFERIF  176

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K + GM TD   VE+ + +L KVLD+YE RL +S +L  D F+LADLHHLP IH LMGT 
Sbjct  177  KGMFGMTTDPAAVEELEGKLVKVLDIYEARLAKSDFLACDCFTLADLHHLPAIHYLMGTD  236

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K LF+SR  V  W   I++RPAW K+V   K+
Sbjct  237  SKKLFESRAKVCDWVKKITARPAWAKVVALQKQ  269



>ref|XP_011079696.1| PREDICTED: glutathione S-transferase-like [Sesamum indicum]
Length=213

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 151/212 (71%), Gaps = 0/212 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIKVHG+ +S A  RV+  L EK L+++F+ +D+ +   K+EPF+S+NPFGQVP FEDG
Sbjct  1    MAIKVHGSPLSPAAQRVLLALAEKDLEYEFILVDLRSGEQKKEPFISINPFGQVPGFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAIT+YI++  A+KG  L+ +DPKK A   VW+EVE H FD     L +EL I
Sbjct  61   DLKLFESRAITKYISHAYADKGTPLIDQDPKKQAIIGVWLEVEAHRFDAVGQKLNFELLI  120

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K   G+ TDE  VEQ +  L KVLDVYE RL +SKYL G+ ++LADLHHLP I+ L  T+
Sbjct  121  KGFKGLTTDEAAVEQLQGELGKVLDVYEGRLGKSKYLAGEEYTLADLHHLPLINNLFKTK  180

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
            +K LF  RP+V AW   + +RPAW K++E  K
Sbjct  181  VKALFDERPHVGAWCAHLLARPAWQKVLEACK  212



>gb|KFK42654.1| hypothetical protein AALP_AA1G022700 [Arabis alpina]
Length=240

 Score =   242 bits (618),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 152/209 (73%), Gaps = 1/209 (0%)
 Frame = -2

Query  968  QHIFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPA  789
            + +    KVHG+  ST T RV+A L EKGL ++ + +D+    HK+EPFLSLNPFGQVP 
Sbjct  16   KKLVAGYKVHGHPFSTNTRRVLAVLFEKGLSYEPITVDLQTGEHKREPFLSLNPFGQVPV  75

Query  788  FEDGDLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALT  612
            FEDG+++L ESRAITQYIAY  +++G  L+  +  + MAT ++WME+E H FDP AS LT
Sbjct  76   FEDGNVKLCESRAITQYIAYVHSSRGTQLLNLQSHETMATLTMWMEIEAHQFDPPASKLT  135

Query  611  WELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHC  432
            WEL IKP+ G+ TD+TIV++ +  L KVL+VYE RL  SK+L  + F+L DLHHLPNI  
Sbjct  136  WELVIKPLYGLKTDQTIVKEQEANLEKVLNVYEKRLGESKFLACNSFTLVDLHHLPNIQY  195

Query  431  LMGTQIKTLFQSRPNVSAWWVDISSRPAW  345
            L+GT I+ LF++RPNV  W  DI+SR AW
Sbjct  196  LLGTPIEKLFENRPNVRKWVGDITSREAW  224



>pir||JC7899 glutathione transferase (EC 2.5.1.18) F1, Pugf - pumpkin
 dbj|BAC15625.1| glutathione S-transferase [Cucurbita maxima]
Length=214

 Score =   241 bits (615),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 149/212 (70%), Gaps = 1/212 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG   STAT RV+A L EKGL F+ V++ +    HK+EPFLS+NPFGQVP F DGD
Sbjct  3    GIKVHGIPTSTATARVLAALYEKGLQFELVNVKLHEGEHKKEPFLSINPFGQVPGFNDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L LFESRAITQYI+   A+ G  L+ +D KK A    W+EVE+HHFDP A  L +E  +K
Sbjct  63   LTLFESRAITQYISGNYASNGTELIPKDSKKGAVVLTWIEVESHHFDPVAMKLVFEFCLK  122

Query  593  PVIGMA-TDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            P+ G+   D  +VE+++  L +VLD+YE RL  SKYLGGD FSLADLHHLP +  L+ T 
Sbjct  123  PLFGLGDADPAVVEKSEADLGQVLDIYEKRLSGSKYLGGDSFSLADLHHLPVLGYLLATP  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             K LF+SRP+V+AW  DI +RP+W K++   K
Sbjct  183  SKKLFESRPHVNAWVGDIIARPSWAKVLALRK  214



>ref|XP_008451607.1| PREDICTED: glutathione S-transferase-like [Cucumis melo]
Length=214

 Score =   241 bits (615),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 150/208 (72%), Gaps = 1/208 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG  +ST T RV+ACL EK L+F+F+++ +    HK+  FLS+NPFGQ+P F+DGD
Sbjct  3    GIKVHGLALSTPTCRVLACLYEKDLEFEFINVKLHEGEHKKPNFLSINPFGQIPGFQDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L LFESRAITQYI+   AN G  L+ +D K+ A    W+EVE+HHFDP AS L +EL +K
Sbjct  63   LTLFESRAITQYISANYANNGTRLIPQDVKEAAALLTWIEVESHHFDPLASKLVYELCLK  122

Query  593  PVIGMA-TDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            P +G   TD  +VEQ +  L+KVLD+YE RL  SKYL G+ FSLADLHH+  +  L+ TQ
Sbjct  123  PKLGWGETDGAVVEQKEAELAKVLDIYEKRLTESKYLAGEAFSLADLHHISTLGFLLETQ  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
             K LF++RP+V+AW  DI +RPAW K++
Sbjct  183  TKKLFEARPHVNAWVADIMARPAWAKVL  210



>gb|KDP28124.1| hypothetical protein JCGZ_13895 [Jatropha curcas]
Length=214

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 154/211 (73%), Gaps = 0/211 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKVHGN +STAT RV+A L EK L+F+FV ID+    HK+EPF+SLNPFGQVPA E GDL
Sbjct  4    IKVHGNPISTATQRVLATLYEKDLEFEFVHIDLATGEHKREPFISLNPFGQVPALEHGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYI +   +KG  L+C    KM   +VWMEVE   F+PAAS L WE+ +KP
Sbjct  64   KLFESRAITQYITHENPDKGTQLLCPGKVKMPILTVWMEVEAQKFEPAASKLNWEVFLKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G+ TD   VE N+  LSKVLDVYE RL +SKYL  D F+L DLHHLPN+  L+ TQ K
Sbjct  124  IFGLTTDSAAVEANEAELSKVLDVYEARLAQSKYLACDCFTLVDLHHLPNLQLLLLTQSK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             L +SRP+VSAW  DI++RPAW K++   K+
Sbjct  184  KLIESRPHVSAWAADITARPAWAKVLAMQKK  214



>ref|XP_010518489.1| PREDICTED: glutathione S-transferase F8, chloroplastic-like [Camelina 
sativa]
Length=217

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 148/212 (70%), Gaps = 1/212 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKVHG  MSTATMRV+A L EK L F+ + +DM A  HKQEPFLSLNPFGQ+PA +DGDL
Sbjct  6    IKVHGVPMSTATMRVLAALYEKDLQFELIPVDMRAGAHKQEPFLSLNPFGQIPALQDGDL  65

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATAS-VWMEVENHHFDPAASALTWELGIK  594
             +FESRAITQYIA   + KG  L C   K++  A+ +W++VE   FDP AS L +E   K
Sbjct  66   TIFESRAITQYIAEEYSEKGEKLFCPGCKEVKAATLIWLQVEGQQFDPIASKLAFERVFK  125

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
             + GM TD   V   + +L+KVLD+YE RL  S ++  D F+LADLHHLP IH LM T+ 
Sbjct  126  GMFGMTTDPAAVLDLESKLAKVLDIYEARLATSPFVACDCFTLADLHHLPAIHYLMSTES  185

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            K LF+SRP VS W   I++RPAW K+V+ LK+
Sbjct  186  KQLFESRPKVSEWVNKITARPAWAKVVDLLKQ  217



>gb|ADB93065.1| putative glutathione-s-transferase theta [Jatropha curcas]
Length=214

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKVHGN +STAT RV+A L EK L+F+FV ID+    HK+EPF+SLNPFGQVPA E GDL
Sbjct  4    IKVHGNPISTATQRVLATLYEKDLEFEFVHIDLATGEHKREPFISLNPFGQVPALEHGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYI +   +KG  L+C    KM   +VWMEVE   F+PAAS L WE+ +KP
Sbjct  64   KLFESRAITQYITHENPDKGTQLLCPGKVKMPILTVWMEVEAQKFEPAASKLNWEVFLKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G+ TD   VE N+  LSKVLDVYE RL +SKYL  D F+L DLHHLPN+  L+ TQ K
Sbjct  124  IFGLTTDSAAVEANEAELSKVLDVYEARLAQSKYLACDCFTLVDLHHLPNLQLLLLTQSK  183

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMV  333
             L +SRP+VSAW  DI++RPAW K++
Sbjct  184  KLIESRPHVSAWAADITARPAWAKVL  209



>ref|NP_850479.1| glutathione S-transferase phi 8 [Arabidopsis thaliana]
 sp|Q96266.3|GSTF8_ARATH RecName: Full=Glutathione S-transferase F8, chloroplastic; Short=AtGSTF8; 
AltName: Full=AtGSTF5; AltName: Full=GST class-phi 
member 8; AltName: Full=Glutathione S-transferase 6; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG30125.2|AF288176_1 glutathione S-transferase [Arabidopsis thaliana]
 gb|AAY82256.1| hypothetical protein At2g27720 [Arabidopsis thaliana]
 gb|AEC10880.1| glutathione S-transferase phi 8 [Arabidopsis thaliana]
Length=263

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 149/210 (71%), Gaps = 1/210 (0%)
 Frame = -2

Query  944  VHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDLEL  765
            VHG  MSTATMRV+A L EK L F+ + +DM A  HKQE  L+LNPFGQ+PA EDGDL L
Sbjct  54   VHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTL  113

Query  764  FESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGIKPV  588
            FESRAITQY+A   + KG  L+ +D KK+ AT +VW++VE   FDP AS L +E   K +
Sbjct  114  FESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGM  173

Query  587  IGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIKT  408
             GM TD   V++ + +L KVLDVYE RL +S++L GD F+LADLHHLP IH L+GT  K 
Sbjct  174  FGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKV  233

Query  407  LFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            LF SRP VS W   IS+RPAW K+++  K+
Sbjct  234  LFDSRPKVSEWIKKISARPAWAKVIDLQKQ  263



>ref|XP_004160543.1| PREDICTED: glutathione S-transferase PARB-like [Cucumis sativus]
Length=214

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 152/208 (73%), Gaps = 1/208 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKV+G  +ST T +V+ACL EK L+F+F+++ +    HK+ PFLS+NPFGQ+P F+DGD
Sbjct  3    SIKVYGLALSTPTCKVLACLYEKDLEFEFINVKLHEGEHKKHPFLSINPFGQIPGFQDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L LFESRAITQYI+    N G  L+ +D K+ A    W+EVE+HHF+P AS L +E+ +K
Sbjct  63   LTLFESRAITQYISANYTNNGTQLIPQDCKEAAALLTWIEVESHHFNPPASKLVYEICLK  122

Query  593  PVIGMA-TDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            P +G   TD  +VE+ +  L+KV+D+YE RL  SKYL G+ FSLADLHH+P +  L+ TQ
Sbjct  123  PKLGWGETDSAVVEEKEAELAKVVDIYEKRLAESKYLAGEAFSLADLHHIPTLGFLLETQ  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
             K LF++RP+V+AW  DI +RPAW K++
Sbjct  183  TKKLFEARPHVNAWVADIMARPAWAKVL  210



>ref|XP_004136043.1| PREDICTED: glutathione S-transferase PARB-like [Cucumis sativus]
 gb|KGN44914.1| hypothetical protein Csa_7G395810 [Cucumis sativus]
Length=214

 Score =   238 bits (608),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 152/208 (73%), Gaps = 1/208 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKV+G  +ST T +V+ACL EK L+F+F+++ +    HK+ PFLS+NPFGQ+P F+DGD
Sbjct  3    SIKVYGLALSTPTCKVLACLYEKDLEFEFINVKLHEGEHKKHPFLSINPFGQIPGFQDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L LFESRAITQYI+    N G  L+ +D K+ A    W+EVE+HHF+P AS L +E+ +K
Sbjct  63   LTLFESRAITQYISANYTNNGTQLIPQDCKEAAALLTWIEVESHHFNPPASKLVYEIYLK  122

Query  593  PVIGMA-TDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            P +G   TD  +VE+ +  L+KV+D+YE RL  SKYL G+ FSLADLHH+P +  L+ TQ
Sbjct  123  PKLGWGETDGAVVEEKEAELAKVVDIYEKRLAESKYLAGEAFSLADLHHIPTLGFLLETQ  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
             K LF++RP+V+AW  DI +RPAW K++
Sbjct  183  TKKLFEARPHVNAWVADIMARPAWAKVL  210



>ref|NP_171791.1| glutathione S-transferase F7 [Arabidopsis thaliana]
 sp|Q9SRY5.3|GSTF7_ARATH RecName: Full=Glutathione S-transferase F7; AltName: Full=AtGSTF8; 
AltName: Full=GST class-phi member 7; AltName: Full=Glutathione 
S-transferase 11 [Arabidopsis thaliana]
 gb|AAF02874.1|AC009525_8 glutathione S-transferase [Arabidopsis thaliana]
 gb|AAL32720.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAM13280.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AEE27496.1| glutathione S-transferase 7/11 [Arabidopsis thaliana]
Length=209

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 149/207 (72%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+FV I++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  ++KGN LV    K +A  ++ +E+E+H FDP  S L WE  +K
Sbjct  63   FKLFESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+T+VE+ + +L+KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  123  PLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPT  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP+VSAW  DI+SRP+  K++
Sbjct  183  KKLFDERPHVSAWVADITSRPSAKKVL  209



>gb|AAG30126.1|AF288177_1 glutathione S-transferase [Arabidopsis thaliana]
 emb|CAA74639.1| glutathione S-transferase [Arabidopsis thaliana]
Length=209

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 149/207 (72%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+FV I++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  ++KGN LV    K +A  ++ +E+E+H FDP  S L WE  +K
Sbjct  63   FKLFESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+T+VE+ + +L+KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  123  PLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPT  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP+VSAW  DI+SRP+  K++
Sbjct  183  KKLFAERPHVSAWVADITSRPSAKKVL  209



>ref|XP_006480110.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
Length=579

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 147/210 (70%), Gaps = 1/210 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IKVHG  MSTA  RV  CL EK L+F+FV +DM +  HK+E +LSLNPFGQVP  E G  
Sbjct  4    IKVHGAAMSTAAQRVFTCLYEKELNFEFVPVDMASGEHKKEAYLSLNPFGQVPTLEHGGQ  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            ++FESRAITQYIA     KG  L   D K  ++  +W EVE H FDP AS LTWE+ +KP
Sbjct  64   KIFESRAITQYIAMEYPEKGTRLASAD-KPNSSFLIWKEVEAHQFDPVASKLTWEIVLKP  122

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + GM  D T+VE+ K +L+KVLDVYE RL +SKYL  D F+L D+HHLP I+ LM TQ+K
Sbjct  123  MFGMTIDPTMVEEYKAKLAKVLDVYEARLTKSKYLASDSFTLVDMHHLPTINLLMRTQVK  182

Query  410  TLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             LF +RP VSAW  DI++RPAW K++   K
Sbjct  183  QLFNARPRVSAWVADITARPAWTKVLAMQK  212



>ref|XP_002892136.1| glutathione S-transferase 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68395.1| glutathione S-transferase 11 [Arabidopsis lyrata subsp. lyrata]
Length=209

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 148/207 (71%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+FV I++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  ++KGN LV    K +A  ++ +E+E+H FDP  S L WE   K
Sbjct  63   FKLFESRAITQYIAHFYSDKGNQLVSLGSKAIAVIAMGIEIESHEFDPVGSKLVWEQVFK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+T+VE+ + +L+KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  123  PLYGMTTDKTVVEEEEVKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPT  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP+VSAW  DI+SRP+  K++
Sbjct  183  KKLFDERPHVSAWVADITSRPSAQKVL  209



>ref|XP_007035561.1| Phi class glutathione transferase GSTF7 [Theobroma cacao]
 gb|EOY06487.1| Phi class glutathione transferase GSTF7 [Theobroma cacao]
Length=214

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 152/213 (71%), Gaps = 1/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M+IKVHG  MST T RV+ CL EKGL+++ V +D+    HKQ+P+LSLNPFGQ+PAFEDG
Sbjct  1    MSIKVHGYAMSTCTARVLLCLSEKGLEYEVVPVDVANGAHKQQPYLSLNPFGQIPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMAT-ASVWMEVENHHFDPAASALTWELG  600
            D+++FESRAI++Y+A    + G  L+      ++T    WMEVE+H F+    A+  ++ 
Sbjct  61   DVKIFESRAISKYLARKYKDTGIDLLGSSSLTVSTIVDTWMEVESHQFNSPMQAIIRQMI  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G+ATDE I+E   E+L KVLDVYE RL + KYLGGD++SLADLHH+P +   M T
Sbjct  121  VNPIFGIATDEKIIETELEKLGKVLDVYEERLSKCKYLGGDFYSLADLHHIPYLVYFMRT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
               ++  SRP+VSAWW DISSRPA +K+ E +K
Sbjct  181  PKSSVITSRPHVSAWWNDISSRPATVKVAETMK  213



>emb|CDX95731.1| BnaC03g26120D [Brassica napus]
Length=215

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 148/213 (69%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKVHG  MSTATMRV+A L EK L+F+ + +DM A  HKQEPFLSLNPFGQ+PA +DGD
Sbjct  3    SIKVHGVPMSTATMRVLAALYEKELEFELIPVDMRAGAHKQEPFLSLNPFGQIPALQDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGI  597
            L LFESRAIT+YIA   + KG  L+C    K+ A   VW+ VE   FDP AS + +E   
Sbjct  63   LTLFESRAITEYIADEYSEKGEKLMCPGCNKVKALTKVWLNVEGQQFDPIASKIAFERVF  122

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K + GM TD   V+  + +L +VLD+YE RL +S++L  D F+LADLHHLP IH LMGT 
Sbjct  123  KGMFGMTTDPAAVQDLEGKLVRVLDIYEARLSKSEFLACDCFTLADLHHLPVIHYLMGTD  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K LF+SRP V  W   I++RPAW K+V+  K+
Sbjct  183  SKALFESRPKVCEWVKKITARPAWAKVVDLQKQ  215



>emb|CDY71513.1| BnaAnng37730D [Brassica napus]
Length=264

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 148/213 (69%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKVHG  MSTATMRV+A L EK L+F+ + +DM A  HKQEPFLSLNPFGQ+PA +DGD
Sbjct  52   SIKVHGVPMSTATMRVLAALYEKDLEFELIPVDMRAGAHKQEPFLSLNPFGQIPALQDGD  111

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGI  597
            L LFESRAIT+YIA   + KG  L+C    K  A   VW+ VE   FDP AS + +E   
Sbjct  112  LTLFESRAITEYIADEYSEKGEKLMCPGCNKAKALTKVWLNVEGQQFDPIASKIAFERIF  171

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K + GM TD   V++ + +L +VLD+YE RL +S++L  D F+LADLHHLP IH LMGT 
Sbjct  172  KGMFGMTTDPAAVQELEGKLVRVLDIYEARLSKSEFLACDCFTLADLHHLPVIHYLMGTD  231

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K LF+SRP V  W   I++RPAW K+V+  K+
Sbjct  232  SKALFESRPKVCEWVKKITARPAWAKVVDLQKQ  264



>ref|XP_010090798.1| Glutathione S-transferase [Morus notabilis]
 gb|EXB40831.1| Glutathione S-transferase [Morus notabilis]
Length=257

 Score =   238 bits (606),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 153/251 (61%), Gaps = 44/251 (18%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKVHG+ +STAT R +A L EK LDF+FV +D+    HKQEP++S NPFGQVPA E GD
Sbjct  3    AIKVHGSPLSTATQRALATLYEKDLDFEFVTVDLSTGAHKQEPYISKNPFGQVPAVEIGD  62

Query  773  LELF--------------------------------------------ESRAITQYIAYT  726
            L+LF                                            ESRAIT++IA  
Sbjct  63   LKLFAADLKYHVIFSRRRYRTVVSAVVRPLPALRGPTEVVVGFVPLWEESRAITKFIAEE  122

Query  725  CANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKPVIGMATDETIVEQNK  546
             A+KG  LV  + +K A   VW+EVE H F+P AS L WEL  KP+  + TD   VE+N+
Sbjct  123  YADKGTQLVHSEKEKKAALYVWLEVEAHQFEPVASKLVWELVFKPLFKIPTDPAAVEENE  182

Query  545  ERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIKTLFQSRPNVSAWWVD  366
             +L KVLDVYENRL ++KYL GD F+LADLHHLPN   L+GT  K +F+SRP+V AW  D
Sbjct  183  AKLGKVLDVYENRLSKAKYLAGDSFTLADLHHLPNTTLLLGTSSKVVFESRPHVQAWAAD  242

Query  365  ISSRPAWLKMV  333
            I++RPAW K++
Sbjct  243  ITARPAWSKVL  253



>emb|CAA64613.1| gst6 [Arabidopsis thaliana]
Length=212

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 149/213 (70%), Gaps = 4/213 (2%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKVHG  MSTATMRV+A L EK L F+ + +DM A  HKQE  L+LNPFGQ+PA EDGD
Sbjct  3    SIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGI  597
            L LF   AITQY+A   + KG  L+ +D KK+ AT +VW++VE   FDP AS L +E   
Sbjct  63   LTLF---AITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVF  119

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K + GM TD   V++ + +L KVLDVYE RL +S++L GD F+LADLHHLP IH L+GT 
Sbjct  120  KGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTD  179

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K LF SRP VS W   IS+RPAW K+++  K+
Sbjct  180  SKVLFDSRPKVSEWIKKISARPAWAKVIDLQKQ  212



>ref|XP_010519349.1| PREDICTED: glutathione S-transferase F8, chloroplastic-like [Tarenaya 
hassleriana]
Length=216

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 147/212 (69%), Gaps = 1/212 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIK++G  +STATMR +A L EKGL+F+ V +D  +  HKQEP +S NPFGQVPAF+DGD
Sbjct  3    AIKLYGVPLSTATMRALAALYEKGLEFELVPVDTSSGAHKQEPHISRNPFGQVPAFDDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATAS-VWMEVENHHFDPAASALTWELGI  597
            ++LFESRAITQYIA    +KGN L C   K +  A+  WMEVE   F+P A  LT+E   
Sbjct  63   VKLFESRAITQYIAEEYNDKGNQLFCPGNKVVKAATRQWMEVEGQQFEPVAMKLTFERFY  122

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GM+TD    E+ + +L KVLDVYE RL  S+YL  + F+LADLHHLP +HCLM T 
Sbjct  123  KPMFGMSTDPAAAEELEGKLGKVLDVYEKRLGESEYLACNCFTLADLHHLPAVHCLMATD  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             K +FQ+RP VS W   I++R AW K++   K
Sbjct  183  SKKVFQARPKVSEWVAKITAREAWAKVLALQK  214



>ref|XP_009133827.1| PREDICTED: glutathione S-transferase F8, chloroplastic-like [Brassica 
rapa]
Length=264

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 148/213 (69%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKVHG  MSTATMRV+A L EK L+F+ + +DM A  HKQEPFLSLNPFGQ+PA +DGD
Sbjct  52   SIKVHGVPMSTATMRVLAALYEKELEFELIPVDMRAGAHKQEPFLSLNPFGQIPALQDGD  111

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGI  597
            L LFESRAIT+YI    + KG  L+C    K+ A   VW+ VE   FDP AS + +E   
Sbjct  112  LTLFESRAITEYIGDEYSEKGEKLMCPGCNKVKALTKVWLNVEGQQFDPIASKIAFERIF  171

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K + GM TD   V++ + +L +VLD+YE RL +S++L  D F+LADLHHLP IH LMGT 
Sbjct  172  KGMFGMTTDPAAVQELEGKLVRVLDIYEARLSKSEFLACDCFTLADLHHLPVIHYLMGTD  231

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K LF+SRP V  W   I++RPAW K+V+  K+
Sbjct  232  SKALFESRPKVCEWVKKITARPAWAKVVDLQKQ  264



>gb|KFK37514.1| hypothetical protein AALP_AA4G267100 [Arabis alpina]
Length=215

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 146/213 (69%), Gaps = 1/213 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG  MSTATMRV+A L EK LDF  + +DM A  HKQE FLSLNPFGQVPA EDGD
Sbjct  3    GIKVHGFPMSTATMRVLAALYEKELDFDLIFVDMRAGAHKQESFLSLNPFGQVPALEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATAS-VWMEVENHHFDPAASALTWELGI  597
            L LFESRAI +YI    + KG  L C   KK+  A+ VW++VE   FDP AS L +E   
Sbjct  63   LTLFESRAIAEYIVEEYSEKGEKLFCPGCKKVKAATKVWLQVEGQQFDPIASKLAFESVF  122

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            K + GM+ D   VE+ + +L KVLD+YE RL +S++L  D F+LADL+HLP IH LMGT 
Sbjct  123  KGMSGMSADPKAVEELEGKLVKVLDIYEARLGKSEFLACDCFTLADLNHLPAIHYLMGTD  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
             K LF+SR  VS W   I++RPAW K+VE  K+
Sbjct  183  SKKLFESRTKVSEWVKKITARPAWAKVVELTKQ  215



>ref|XP_006855529.1| hypothetical protein AMTR_s00057p00211420 [Amborella trichopoda]
 gb|ERN16996.1| hypothetical protein AMTR_s00057p00211420 [Amborella trichopoda]
Length=202

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 142/206 (69%), Gaps = 17/206 (8%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MAIK+HG+ MSTAT+RV A L EKGLDF+ V                  PFGQVPAFEDG
Sbjct  1    MAIKLHGSWMSTATLRVGATLYEKGLDFELVP-----------------PFGQVPAFEDG  43

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            DL+LFESRAIT+YIAY    +G  LV  +  +M    VWMEVE HHF   ++ L WEL I
Sbjct  44   DLKLFESRAITKYIAYKYKEQGTELVGANFSEMPIIGVWMEVEAHHFAGPSTKLVWELCI  103

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+IG+  DET+VE+   +L+ VLDVYE RL ++KYLGGD FSLADLHHLPNI  ++ T 
Sbjct  104  KPMIGIPVDETVVEEATGKLNGVLDVYEARLAKNKYLGGDEFSLADLHHLPNIRYILMTP  163

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLK  339
              +LF S P+VS WW DISSRPAW K
Sbjct  164  KASLFTSHPHVSRWWSDISSRPAWTK  189



>ref|XP_002892139.1| glutathione S-transferase 31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68398.1| glutathione S-transferase 31 [Arabidopsis lyrata subsp. lyrata]
Length=245

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 148/209 (71%), Gaps = 1/209 (0%)
 Frame = -2

Query  968  QHIFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPA  789
            + +    KVHG+  ST T RV+A L EKGL ++ + + +  D HK+EPFLSLNPFGQVP 
Sbjct  21   KKLVAGYKVHGDPFSTNTRRVLAVLHEKGLSYEPITVKLQTDEHKREPFLSLNPFGQVPV  80

Query  788  FEDGDLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALT  612
            FEDG+++L+ESRAITQYIAY  +++G  L+     + MAT ++WME+E H FDP AS LT
Sbjct  81   FEDGNVKLYESRAITQYIAYVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLT  140

Query  611  WELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHC  432
            WE  IKP+ G+ TD+TIV++N+  L KVL+VYE RL  S++L  + F+L DLHHLPNI  
Sbjct  141  WEQVIKPIYGLETDQTIVKENEAILEKVLNVYEKRLEESRFLACNSFTLVDLHHLPNIQY  200

Query  431  LMGTQIKTLFQSRPNVSAWWVDISSRPAW  345
            L+GT  K LF+ R  V  W  +I+SR AW
Sbjct  201  LLGTPTKILFEKRTKVRKWVDEITSREAW  229



>gb|AAF61392.1|AF133894_1 glutathione S-transferase [Persea americana]
Length=181

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 133/181 (73%), Gaps = 0/181 (0%)
 Frame = -2

Query  860  IDMGADHHKQEPFLSLNPFGQVPAFEDGDLELFESRAITQYIAYTCANKGNHLVCEDPKK  681
            ++M    HK+EPF+SLNPFGQVPA EDGDL+LFESRAIT YI++  A KG  L+C+D KK
Sbjct  1    VNMATGDHKKEPFISLNPFGQVPALEDGDLKLFESRAITNYISHEYAGKGTDLICKDSKK  60

Query  680  MATASVWMEVENHHFDPAASALTWELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLI  501
            MA  +VWMEVE HHFDP AS L WEL  KP+ G+ TD   V    E+L+KVLDVYE  L 
Sbjct  61   MAIVAVWMEVEAHHFDPEASKLVWELFYKPIYGLTTDPAAVTALSEKLAKVLDVYEGPLA  120

Query  500  RSKYLGGDWFSLADLHHLPNIHCLMGTQIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             SKYLGGD F  ADLHHLP ++ LM TQ+K LF SR +VSAW  DI +RPAW K+VE  K
Sbjct  121  HSKYLGGDCFHFADLHHLPCLNYLMTTQVKELFDSRLHVSAWCQDILARPAWAKVVEMQK  180

Query  320  E  318
            +
Sbjct  181  K  181



>ref|NP_171792.1| glutathione S-transferase F6 [Arabidopsis thaliana]
 ref|NP_001184893.1| glutathione S-transferase F6 [Arabidopsis thaliana]
 sp|P42760.2|GSTF6_ARATH RecName: Full=Glutathione S-transferase F6; Short=AtGSTF6; AltName: 
Full=AtGSTF3; AltName: Full=GST class-phi member 6; AltName: 
Full=Glutathione S-transferase 1; Short=AtGST1; AltName: 
Full=Protein EARLY RESPONSE TO DEHYDRATION 11 [Arabidopsis 
thaliana]
 gb|AAF02873.1|AC009525_7 glutathione S-transferase [Arabidopsis thaliana]
 emb|CAA72413.1| gluthatione S-transferase [Arabidopsis thaliana]
 gb|AAK91349.1| At1g02930/F22D16_7 [Arabidopsis thaliana]
 gb|AAM19908.1| At1g02930/F22D16_7 [Arabidopsis thaliana]
 gb|AEE27497.1| glutathione S-transferase 6 [Arabidopsis thaliana]
 gb|AEE27498.1| glutathione S-transferase 6 [Arabidopsis thaliana]
Length=208

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 150/207 (72%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK +DF+FV +++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             ++FESRAITQYIA+  ++KGN+L+    K MA  ++ +E+E+H FDP  S L WE  +K
Sbjct  63   FKIFESRAITQYIAHEFSDKGNNLLSTG-KDMAIIAMGIEIESHEFDPVGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+T+VE+ + +L+KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPT  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP+VSAW  DI+SRP+  K++
Sbjct  182  KKLFDERPHVSAWVADITSRPSAQKVL  208



>ref|XP_006305617.1| hypothetical protein CARUB_v10010300mg [Capsella rubella]
 gb|EOA38515.1| hypothetical protein CARUB_v10010300mg [Capsella rubella]
Length=208

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 145/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S AT RV+  L EK LDF+ V I++    HKQEPF+S NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASIATRRVLIALHEKNLDFELVHIELKDGEHKQEPFISRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  ++KGN L+    K MA  ++ ME+E H FDP AS L WE  +K
Sbjct  63   FKLFESRAITQYIAHNFSDKGNDLLAPG-KNMAIIAMGMEIEKHEFDPVASKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+ +VE+ + + +KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKAVVEEEEAKFAKVLDVYEHRLGDSKYLAADHFTLVDLHTIPAIQYLLGTPT  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP+V AW  DI+SRP+  K++
Sbjct  182  KKLFDERPHVGAWVADITSRPSAQKVL  208



>ref|XP_010545024.1| PREDICTED: glutathione S-transferase F8, chloroplastic [Tarenaya 
hassleriana]
Length=217

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 143/212 (67%), Gaps = 1/212 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV+G   STATMR +  L EKGLDF+ + +D+    HKQEP +S NPFG VPAFEDGD
Sbjct  3    GIKVYGVPFSTATMRALVALYEKGLDFELIPVDLTTGAHKQEPHISRNPFGLVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGI  597
            ++LFESRAITQY+A    +KGN L C   K + AT   WMEVE  HF+P A  LT+E   
Sbjct  63   VKLFESRAITQYLAEEYNDKGNQLFCPGDKVVKATTRQWMEVEGQHFEPTAMKLTFERVF  122

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP++GM TD   VE+ + +L KVLDVYE RL  S+YLG   F+LADLHHLP  H LMGT 
Sbjct  123  KPMLGMTTDPAAVEELEGKLGKVLDVYEKRLGESEYLGCGCFTLADLHHLPVAHYLMGTD  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             K +FQ+ P VSAW   I +R AW K++   K
Sbjct  183  SKKVFQAHPKVSAWLAKIFAREAWAKVLALQK  214



>gb|AFP86475.1| glutathione-S-transferase, partial [Brassica rapa subsp. chinensis]
Length=213

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 148/211 (70%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKV G+  +T+T RV+  L EK LDF+ +++D+    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    SIKVFGHATTTSTRRVLLTLHEKNLDFELINVDLKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMA---TASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   ++G +L+  D K +A   T S+ MEVE H FDPAAS L WE 
Sbjct  63   LKLFESRAITQYIAHRYDDQGTNLLPADSKNIAQYATMSIGMEVEAHQFDPAASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L+KVLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  LFKHIYGLTTDQAVVAEQEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASQKILQ  213



>ref|XP_006294807.1| hypothetical protein CARUB_v10023858mg, partial [Capsella rubella]
 gb|EOA27705.1| hypothetical protein CARUB_v10023858mg, partial [Capsella rubella]
Length=265

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 146/215 (68%), Gaps = 1/215 (0%)
 Frame = -2

Query  962  IFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFE  783
            I  +IKVHG  MSTATMRV+A L EK L F+ + +D+ A  HKQ+PF+SLNPFGQ+P  +
Sbjct  50   IMASIKVHGIPMSTATMRVLAALYEKDLQFELIPVDLRAGAHKQDPFISLNPFGQIPVLQ  109

Query  782  DGDLELFESRAITQYIAYTCANKGNHLVCEDPKKMATAS-VWMEVENHHFDPAASALTWE  606
            DGDL LFESRAITQYIA   + KG  L C   KK+  A+ VW++VE   FDP AS L +E
Sbjct  110  DGDLTLFESRAITQYIAEEYSEKGEKLFCPGCKKVKAATLVWLQVEGQQFDPIASKLAFE  169

Query  605  LGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLM  426
               K + GM TD   V   + +LSKVLD+YE RL  S ++  D F+LADLHHLP IH LM
Sbjct  170  RVFKGMFGMTTDPAAVLDLESKLSKVLDIYEARLSNSLFVACDCFTLADLHHLPAIHYLM  229

Query  425  GTQIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
            GT  K LF SRP V+ W   I++RPAW K+++  K
Sbjct  230  GTDSKHLFLSRPKVTEWVNKITTRPAWGKVIDLQK  264



>ref|XP_002892137.1| ATGSTF6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68396.1| ATGSTF6 [Arabidopsis lyrata subsp. lyrata]
Length=208

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 150/207 (72%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK +DF+FV +++    HK+EP++  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPYILRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             ++FESRAITQYIA+  ++KGN+L+    K MA  ++ +E+E+H FDP  S L WE  +K
Sbjct  63   FKIFESRAITQYIAHEFSDKGNNLLSAG-KGMAIIAMGIEIESHEFDPVGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+T+VE+ + +L+KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLAADHFTLVDLHTIPVIQYLLGTPT  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP+VSAW  DI+SRP+  K++
Sbjct  182  KKLFDERPHVSAWVADITSRPSAQKVL  208



>emb|CDY37454.1| BnaC08g45920D [Brassica napus]
Length=251

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 145/205 (71%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHGN  ST+T RV+A L+EKGL ++ + +D+ +  HK E FLSLNPFGQ+P F DG
Sbjct  31   LGYKVHGNPFSTSTRRVLAVLLEKGLSYESITVDLKSGEHKTESFLSLNPFGQIPVFVDG  90

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++L ESRAITQYIAY  + +G  L+  +  + MA  +VWME+E H FDP AS LTWE  
Sbjct  91   NIKLHESRAITQYIAYVHSTRGTQLLYLQSHETMAILTVWMEIEAHQFDPFASKLTWEQA  150

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD+ +V++N+  L KVLD+YE RL + ++L  + F+LADLHHLPNI  L+GT
Sbjct  151  IKPIYGLETDQVVVKENEANLEKVLDIYEKRLGKYRFLACNTFTLADLHHLPNIQYLLGT  210

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF+ RP V  W  +I+ R AW
Sbjct  211  PTKRLFEDRPKVLKWVGEITGREAW  235



>ref|XP_006294806.1| hypothetical protein CARUB_v10023858mg, partial [Capsella rubella]
 gb|EOA27704.1| hypothetical protein CARUB_v10023858mg, partial [Capsella rubella]
Length=253

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 146/215 (68%), Gaps = 1/215 (0%)
 Frame = -2

Query  962  IFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFE  783
            I  +IKVHG  MSTATMRV+A L EK L F+ + +D+ A  HKQ+PF+SLNPFGQ+P  +
Sbjct  38   IMASIKVHGIPMSTATMRVLAALYEKDLQFELIPVDLRAGAHKQDPFISLNPFGQIPVLQ  97

Query  782  DGDLELFESRAITQYIAYTCANKGNHLVCEDPKKMATAS-VWMEVENHHFDPAASALTWE  606
            DGDL LFESRAITQYIA   + KG  L C   KK+  A+ VW++VE   FDP AS L +E
Sbjct  98   DGDLTLFESRAITQYIAEEYSEKGEKLFCPGCKKVKAATLVWLQVEGQQFDPIASKLAFE  157

Query  605  LGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLM  426
               K + GM TD   V   + +LSKVLD+YE RL  S ++  D F+LADLHHLP IH LM
Sbjct  158  RVFKGMFGMTTDPAAVLDLESKLSKVLDIYEARLSNSLFVACDCFTLADLHHLPAIHYLM  217

Query  425  GTQIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
            GT  K LF SRP V+ W   I++RPAW K+++  K
Sbjct  218  GTDSKHLFLSRPKVTEWVNKITTRPAWGKVIDLQK  252



>gb|KFK42650.1| hypothetical protein AALP_AA1G022400 [Arabis alpina]
Length=211

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 145/208 (70%), Gaps = 1/208 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV GN +ST T RV+  L EK LDF+FV +D+    HK+EPFLSLNPFG+VPA EDGD
Sbjct  3    GIKVFGNAVSTPTRRVLIALHEKNLDFEFVHVDLNDGEHKKEPFLSLNPFGKVPALEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYIA+  A+KGN L+    K MA  ++ ME+E H FDP AS L WE   K
Sbjct  63   LKLFESRAITQYIAHAYADKGNQLLSLGTKNMAILAMGMEIEAHEFDPVASKLGWEKIYK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT-Q  417
               G+ T++ IVE+ + +L+KVLD+YE RL  SKYL  D F+L DLHH+P I  L+ T  
Sbjct  123  LFFGLTTNQAIVEEEEIKLAKVLDIYEARLKESKYLACDHFTLVDLHHIPVIQYLLSTPT  182

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMV  333
             K LF  RP VS+W   I+SRP+ LK++
Sbjct  183  TKKLFDERPRVSSWVDKITSRPSSLKIL  210



>emb|CDY50374.1| BnaCnng19060D [Brassica napus]
Length=213

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 143/209 (68%), Gaps = 3/209 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV GN  ST+T RV+  L EK LDF+ V+ID+    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGNAASTSTRRVLLALHEKNLDFELVNIDLKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCED---PKKMATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   ++G +L+  D   P   A  ++ MEVE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYESQGTNLLPADFKNPAHYAIMAIGMEVEAHQFDPVASKLVWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
             IK  +G+ TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P I  L+G
Sbjct  123  VIKNFVGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKM  336
            T  K LF  RP V+ W  +++ RPA  K+
Sbjct  183  TPTKKLFAERPRVNEWVAEVTKRPASQKI  211



>ref|XP_010474884.1| PREDICTED: glutathione S-transferase F6-like [Camelina sativa]
Length=208

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 148/207 (71%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+FV I++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFILRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  A+KG +L+    K MA  ++ +E+E+H FDP  S L WE  +K
Sbjct  63   FKLFESRAITQYIAHNFADKGTNLLSVG-KDMAIVAMGIEIESHEFDPVGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+ +VE+ + +L+KVLDVYE RL +SKYL GD F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKAVVEEEEAKLAKVLDVYEYRLGQSKYLAGDHFTLVDLHTIPVIQYLLGTPS  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  R +VSAW  DI+SRP+  K++
Sbjct  182  KKLFDERTHVSAWVADITSRPSAQKVL  208



>ref|XP_006306479.1| hypothetical protein CARUB_v10012455mg [Capsella rubella]
 gb|EOA39377.1| hypothetical protein CARUB_v10012455mg [Capsella rubella]
Length=208

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 148/207 (71%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+FV I++    HKQEP++  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKQEPYIFRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  A+KGN+L+    K MA  ++ +E+E+H FDP  S L WE  +K
Sbjct  63   FKLFESRAITQYIAHNYADKGNNLLSTG-KDMAIIAMGIEIESHEFDPVGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+ +VE+ + +L+KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKAVVEEEEAKLAKVLDVYEHRLGDSKYLAADHFTLVDLHIIPVIQYLLGTPT  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  R +VSAW  DI+SRP+  K++
Sbjct  182  KKLFDERTHVSAWVADITSRPSAQKVL  208



>ref|XP_010545022.1| PREDICTED: glutathione S-transferase F13 [Tarenaya hassleriana]
Length=218

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 143/208 (69%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+K+HG+ MS    RV+ CL EK  +F+ V +++ +  HKQ PFLS NPFGQVP  ED 
Sbjct  1    MAMKLHGDPMSACVARVMLCLHEKDAEFELVPVNLFSCEHKQPPFLSKNPFGQVPVLEDE  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCE-DPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT YIA  C   G  L    +PK+ A   VW EVE HHF+PA +A+  +L 
Sbjct  61   DLTLFESRAITAYIAEKCKETGTDLTRRRNPKEEAAVRVWSEVEAHHFNPAIAAVIHQLV  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G + D  +VE+N +RL K+LDVYE RL +S+YLGGD++SLADLHH+P  H  M T
Sbjct  121  VVPLHGKSPDTAVVEENIDRLGKILDVYEERLEKSEYLGGDFYSLADLHHVPYTHYFMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKM  336
            +  +L   RP V AWW D+SSRPA+LK+
Sbjct  181  EFASLINDRPRVKAWWHDLSSRPAYLKV  208



>emb|CDY53015.1| BnaC04g00150D [Brassica napus]
Length=200

 Score =   230 bits (587),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 142/200 (71%), Gaps = 1/200 (1%)
 Frame = -2

Query  914  MRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDLELFESRAITQYI  735
            MRV+A L EKGLDF+ V +DM A  HKQEP +SLNPFGQ+PA  DGDL LFESRAIT+YI
Sbjct  1    MRVLATLYEKGLDFEIVPVDMKAGAHKQEPLISLNPFGQIPALLDGDLTLFESRAITEYI  60

Query  734  AYTCANKGNHLVCEDPKKM-ATASVWMEVENHHFDPAASALTWELGIKPVIGMATDETIV  558
            A   ++KG  L+C+  KK+ AT  VW++VE   FDP AS L +E   K ++GM TD   V
Sbjct  61   AEEYSDKGEKLLCQGCKKLKATTKVWLQVEGQQFDPIASKLAFERVFKGMLGMTTDPAAV  120

Query  557  EQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIKTLFQSRPNVSA  378
            E  + +L KVLD+YE RL +S +L GD F+LADLHHLP I+ LMGT  K LF+SRP V  
Sbjct  121  EDLEAKLVKVLDIYEARLSKSPFLAGDCFTLADLHHLPIIYYLMGTDSKKLFESRPKVKE  180

Query  377  WWVDISSRPAWLKMVEWLKE  318
            W   I++RPAW+K++   K+
Sbjct  181  WIKKITARPAWVKVLHLQKQ  200



>ref|XP_002872833.1| hypothetical protein ARALYDRAFT_490313 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49092.1| hypothetical protein ARALYDRAFT_490313 [Arabidopsis lyrata subsp. 
lyrata]
Length=212

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 143/210 (68%), Gaps = 3/210 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S AT RV+  L EK LDF+ V I++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    GIKVFGHPASIATRRVLIALHEKNLDFELVHIELKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   N+G +L+  DPK +   A  ++ M+VE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHQYENQGTNLLQADPKNISQYAIMAIGMQVEAHQFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P I  L+G
Sbjct  123  LFKSIYGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPAIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            T  K LF  RP V+ W  +I+ RPA  K++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASEKVL  212



>ref|XP_009111176.1| PREDICTED: glutathione S-transferase F6-like [Brassica rapa]
 emb|CDY15444.1| BnaA08g27280D [Brassica napus]
Length=210

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 143/207 (69%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+ V +++    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKDLDFELVHVELKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  A+KGN L+    K MA  ++ ME+E H FD  AS L WE   K
Sbjct  63   FKLFESRAITQYIAHEYADKGNQLLSPGSKNMAILAMGMEIEAHEFDSVASKLGWEQIFK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
               G+ TD+ +V++ + +L KVLD YE RL  SKYL  D F+L DLHH+P I  L+GT  
Sbjct  123  NFFGLTTDQAVVKEEEVKLGKVLDNYEARLGESKYLASDHFTLVDLHHIPVIQYLLGTPT  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF+ RP+VSAW  DI+SRP+  K++
Sbjct  183  KKLFEERPHVSAWVADITSRPSSQKIL  209



>dbj|BAA04553.1| glutathione S-transferase [Arabidopsis thaliana]
Length=208

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 149/207 (72%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+   TAT RV+  L EK +DF+FV +++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPAFTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             ++FESRAITQYIA+  ++KGN+L+    K MA  ++ +E+E+H FDP  S L WE  +K
Sbjct  63   FKIFESRAITQYIAHEFSDKGNNLLSTG-KDMAIIAMGIEIESHEFDPVGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+T+VE+ + +L+KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPT  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP+VSAW  DI+SRP+  K++
Sbjct  182  KKLFDERPHVSAWVADITSRPSAQKVL  208



>ref|XP_009118738.1| PREDICTED: glutathione S-transferase F4-like [Brassica rapa]
Length=251

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 144/205 (70%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHGN  ST+T RV+A L+EKGL ++ + +D+ +  HK E FLSLNPFGQ+P F DG
Sbjct  31   LGYKVHGNPFSTSTRRVLAVLLEKGLSYESITVDLKSGEHKTESFLSLNPFGQIPVFVDG  90

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++L ESRAITQYIAY  + +G  L+  +  + MA  +VWME+E H FDP AS LTWE  
Sbjct  91   NIKLHESRAITQYIAYVHSTRGTQLLYLQSHETMAILTVWMEIEAHQFDPFASKLTWEQA  150

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD+ +V +N+  L KVLD+YE RL + ++L  + F+LADLHHLPNI  L+GT
Sbjct  151  IKPIYGLETDQVVVRENEANLEKVLDIYEKRLGKYRFLVCNTFTLADLHHLPNIQYLLGT  210

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF+ RP V  W  +I+ R AW
Sbjct  211  PTKRLFEDRPKVLKWVGEITGREAW  235



>ref|XP_009111278.1| PREDICTED: glutathione S-transferase F3 [Brassica rapa]
Length=213

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 148/211 (70%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKV G+  +T+T RV+  L EK LD++ V++++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    SIKVFGHATTTSTRRVLLTLHEKNLDYELVNVELKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMA---TASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   ++G +L+  D K +A   T S+ MEVE H FDPAAS L WE 
Sbjct  63   LKLFESRAITQYIAHRYEDQGTNLLPADSKNIAQYATMSIGMEVEAHQFDPAASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L+KVLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  LFKHIYGLTTDQAVVAEQEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASQKILQ  213



>ref|XP_010259661.1| PREDICTED: glutathione S-transferase F13 [Nelumbo nucifera]
Length=214

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 145/212 (68%), Gaps = 1/212 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+K++G  MST T RV+ CL EKG+DF+ V I++ A  HKQ  F+S NPFGQ+PA EDG
Sbjct  1    MAVKLYGIAMSTCTTRVMTCLHEKGVDFEIVPINLSAGEHKQPSFISKNPFGQIPALEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT+Y+A    +KG  L+  ++ K+ A  +VW+EVE   F+P  SAL ++  
Sbjct  61   DLTLFESRAITKYLATKHKDKGTDLLRLDNLKEAALVNVWLEVEAQQFNPPISALVYQRM  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
              P+ G   DE ++E N E+L KVLDVYE RL +SKYL GD++SLADLHHL   + LM  
Sbjct  121  FSPLFGGTPDEKVIEANAEKLGKVLDVYEERLSKSKYLAGDFYSLADLHHLSYTYYLMKN  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWL  324
                L  SRP+V AWW DISSRPA+ K  E +
Sbjct  181  PEANLINSRPHVKAWWEDISSRPAFRKAAEGM  212



>emb|CDY32486.1| BnaA09g51100D [Brassica napus]
Length=251

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 144/205 (70%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHGN  ST+T RV+A L+EKGL ++ + +D+ +  HK E FLSLNPFGQ+P F DG
Sbjct  31   LGYKVHGNPFSTSTRRVLAVLLEKGLSYESITVDLKSGEHKTESFLSLNPFGQIPVFVDG  90

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++L ESRAITQYIAY  + +G  L+  +  + MA  +VWME+E H FDP AS LTWE  
Sbjct  91   NIKLHESRAITQYIAYVHSTRGTQLLYLQSHETMAILTVWMEIEAHQFDPFASKLTWEQA  150

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD+ +V +N+  L KVLD+YE RL + ++L  + F+LADLHHLPNI  L+GT
Sbjct  151  IKPIYGLETDQVVVRENEANLEKVLDIYEKRLGKYRFLVCNTFTLADLHHLPNIQYLLGT  210

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF+ RP V  W  +I+ R AW
Sbjct  211  PTKRLFEDRPKVLKWVGEITGREAW  235



>ref|XP_010457292.1| PREDICTED: glutathione S-transferase F6-like [Camelina sativa]
Length=208

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 147/207 (71%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+FV I++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFILRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  A+KGN+L+    K MA  ++ +E+E+H FDP  S L WE  +K
Sbjct  63   FKLFESRAITQYIAHNFADKGNNLLSAG-KDMAIVAMGIEIESHEFDPVGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+ +VE+ + +L+KVLDVYE RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKAVVEEEEAKLAKVLDVYEYRLGGSKYLAADHFTLVDLHTIPVIQYLLGTPS  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  R +VSAW  DI+SRP+  K++
Sbjct  182  KKLFDERTHVSAWVADITSRPSAQKVL  208



>ref|XP_010481374.1| PREDICTED: glutathione S-transferase F6 [Camelina sativa]
Length=208

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 148/207 (71%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+FV I++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFILRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  A+KGN+L+    K MA  ++ +E+E+H F+P  S L WE  +K
Sbjct  63   FKLFESRAITQYIAHNFADKGNNLLSAG-KDMAIIAMGIEIESHEFEPVGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+ +VE+ + +L+KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKAVVEEEEAKLAKVLDVYEHRLGESKYLAADHFTLVDLHTIPVIQYLLGTPS  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  R +VSAW  DI+SRP+  K++
Sbjct  182  KKLFDERTHVSAWVADITSRPSAQKVL  208



>emb|CDY18131.1| BnaC05g01540D [Brassica napus]
Length=210

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 142/207 (69%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+ V ID+    HK+EPFLS NPFG++PAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKKLDFELVHIDLKDGEHKKEPFLSRNPFGKIPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  A+KGN L+    K MA  ++ ME+E H FD  AS L WE   K
Sbjct  63   FKLFESRAITQYIAHEYADKGNQLLSPGSKNMAILAMGMEIEAHEFDSVASKLGWEQIFK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
               G+ TD+ +V++ + +L KVLD YE RL  SKYL  D F+L DLHH+P I  L+GT  
Sbjct  123  NFFGLTTDQAVVKEEEVKLGKVLDNYEARLGESKYLACDHFTLVDLHHIPVIQYLLGTPT  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP+VSAW  DI+SRP+  K++
Sbjct  183  KKLFDERPHVSAWVADITSRPSSQKIL  209



>ref|XP_010269471.1| PREDICTED: glutathione S-transferase F13-like [Nelumbo nucifera]
Length=218

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 145/210 (69%), Gaps = 1/210 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +K+ G  MST T RV+ACL EKG+DF+ V +++ A  HKQ PFLS NPFGQ+PA +DGDL
Sbjct  4    VKLLGLPMSTCTARVLACLHEKGIDFELVPVNLPAGEHKQPPFLSKNPFGQIPALDDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             LFESRAIT+Y+A    + G  L+   D K+ A  +VW+EVE H + P  SAL ++  + 
Sbjct  64   TLFESRAITKYLATKRNDVGPDLLRLGDAKEAAFVNVWLEVEAHQYSPPISALVYQRVVL  123

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            PV G   DE ++E N E+L K+LDVYE RL +SKYL GD++SLADLHHLP  + L  T  
Sbjct  124  PVFGGTPDEKVIEANAEKLGKILDVYEERLSKSKYLAGDFYSLADLHHLPYTYYLTKTPE  183

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMVEWL  324
              L  SRP+V AWW DISSRPA+ K+ E +
Sbjct  184  AKLIYSRPHVKAWWEDISSRPAFKKVAEGM  213



>ref|XP_006304809.1| hypothetical protein CARUB_v10012427mg [Capsella rubella]
 gb|EOA37707.1| hypothetical protein CARUB_v10012427mg [Capsella rubella]
Length=208

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 147/207 (71%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             I+V G+  STAT RV+  L EK LDF+FV I++    HKQEP++  NPFG+VPAFEDGD
Sbjct  3    GIQVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKQEPYIFRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  A+KGN+L+    K MA  ++ +E+E+H FDP  S L WE  +K
Sbjct  63   FKLFESRAITQYIAHNYADKGNNLLSTG-KDMAIIAMGIEIESHEFDPVGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+ +VE+ + +L KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKAVVEEEEAKLGKVLDVYEHRLGDSKYLAADHFTLVDLHIIPVIQYLLGTPT  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  R +VSAW  DI+SRP+  K++
Sbjct  182  KKLFDERTHVSAWVADITSRPSAQKVL  208



>emb|CDY07850.1| BnaC03g47720D [Brassica napus]
Length=333

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 145/202 (72%), Gaps = 1/202 (0%)
 Frame = -2

Query  947  KVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDLE  768
            KVHG+  ST T RV+A L+EKG+ ++ + +D+    HK+E +LSLNPFGQVP FEDG+++
Sbjct  123  KVHGDPFSTNTRRVLAVLLEKGISYEPITVDLKTGEHKRESYLSLNPFGQVPVFEDGNIK  182

Query  767  LFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            L ESRAITQYIAY  +++G  L+  +  K MAT ++WME E H FDP AS LTWE  IKP
Sbjct  183  LCESRAITQYIAYVHSSRGTQLLNLQSHKTMATLTMWMEFEAHQFDPFASVLTWEQVIKP  242

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G+ TD+T+VE+N+  L  VL+VYE RL  S++L  + F+L DLHHLPNI  L+GT  K
Sbjct  243  IYGLETDQTVVEENETGLENVLNVYEKRLQESRFLACNTFTLVDLHHLPNIQYLLGTPTK  302

Query  410  TLFQSRPNVSAWWVDISSRPAW  345
             LF++RP V  W  DI+ R AW
Sbjct  303  KLFENRPKVRTWVDDITGREAW  324



>ref|XP_009144554.1| PREDICTED: glutathione S-transferase F3-like [Brassica rapa]
 gb|AAP58392.1| glutathione S-transferase 2 [Brassica juncea]
 gb|AAP82237.1| phi class glutathione S-transferase [Brassica juncea]
 gb|AAV80208.1| glutathione-S-transferase [Brassica rapa subsp. pekinensis]
 gb|AEQ59235.1| glutathione S-transferase [Brassica oleracea var. capitata]
 emb|CDY65569.1| BnaCnng47740D [Brassica napus]
Length=213

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 145/211 (69%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+ V +++    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHAASTATRRVLLTLHEKNLDFELVHVELKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +   A  ++ MEVE HHFDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYEEEGTNLLPADSKNISHYAIMAIGMEVEAHHFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K   GM TD+ +VE+ + +L+ VLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  VFKLFYGMTTDQAVVEEEEAKLATVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP+VS W  +I++RPA  K+++
Sbjct  183  TPTKKLFDERPHVSEWVAEITNRPASQKILQ  213



>emb|CDY22058.1| BnaA09g00870D [Brassica napus]
Length=213

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV GN  S +T RV+  L EK LDF+ V+ID+    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGNATSPSTRRVLLALHEKNLDFELVNIDLKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCED---PKKMATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   ++G +L+  D   P   A  ++ MEVE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYESQGTNLLPADSKNPSHYAIMAIGMEVEAHQFDPVASKLVWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
             IK  +G+ TD+ IV + + +L+KVLDVYE RL   KYL G+ F+L DLHH+P +  L+G
Sbjct  123  VIKNFVGLTTDQAIVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVVQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +++ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVAEVTKRPASQKILK  213



>ref|XP_006418284.1| hypothetical protein EUTSA_v10008570mg [Eutrema salsugineum]
 gb|ESQ36637.1| hypothetical protein EUTSA_v10008570mg [Eutrema salsugineum]
Length=251

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 147/205 (72%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHG+  ST T RV+A L+EKGL ++ + +D+    HK++ FLSLNPFGQVP  EDG
Sbjct  31   IGYKVHGHPFSTNTRRVLAVLLEKGLSYEPITVDLQTGEHKRDSFLSLNPFGQVPVLEDG  90

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++L ESRAITQYIAY  +++G  L+  +  + MAT ++WME+E H FDP AS LTWE  
Sbjct  91   NVKLCESRAITQYIAYVHSSRGTQLLNLQSHETMATLTMWMEIEAHQFDPPASKLTWEQV  150

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD+++V++N+  L KVL+VYE RL  S++L  + FSL DLHHLPNI  L+GT
Sbjct  151  IKPLYGLETDQSVVKENEASLEKVLNVYEKRLGESRFLACNTFSLVDLHHLPNIQYLLGT  210

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF+SRP +  W  +I+ R AW
Sbjct  211  STKRLFESRPKIRKWVDEITGREAW  235



>gb|KFK30848.1| hypothetical protein AALP_AA6G033400 [Arabis alpina]
Length=213

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S +T RV+  L EK LDF+ V I++    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHAASISTRRVLLALNEKNLDFELVHIELKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   N+G +L+ +    M   A  ++ +EVE HHFDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYENQGTNLLPDYATNMSRYAIMAIGLEVEAHHFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +VE+ +  L+KVLDVYE RL + KYL GD F+L DLHH+P +  L+G
Sbjct  123  VFKSIYGLTTDQAVVEEEEANLAKVLDVYEYRLKQHKYLSGDTFTLTDLHHIPAVQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  DI+ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVTDITKRPASQKILQ  213



>ref|XP_002876850.1| glutathione S-transferase 16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53109.1| glutathione S-transferase 16 [Arabidopsis lyrata subsp. lyrata]
Length=212

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 142/209 (68%), Gaps = 3/209 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G   ST+T RV+  L EK LDF+ V +++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    GIKVFGTPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVW---MEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   N+G +L+  D K +A  ++    MEVE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYENQGTNLLQADSKNIAQYAIMVIGMEVEAHQFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P I  L+G
Sbjct  123  VYKLIYGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKM  336
            T  K LF  RP V+ W  +I++RPA  K+
Sbjct  183  TPTKKLFTERPRVNEWVTEITNRPASQKV  211



>ref|XP_002531867.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF30504.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=217

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 143/210 (68%), Gaps = 1/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+K+HG  MST T  V+ CL EKG+DF+ V ID+ A  HKQ PF++ NPFGQVP  EDG
Sbjct  1    MALKLHGVAMSTCTSLVITCLHEKGVDFELVPIDLFAGEHKQPPFIAKNPFGQVPVLEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAI  YIA      G  L+  ++ K+ AT  VW EVE+  + PA + + ++L 
Sbjct  61   DLTLFESRAIAAYIAEKFKESGYDLIRHQNLKEAATVRVWTEVESQQYHPAIAPIVYQLY  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G++ D+ I+E N E+L KVLD+YE RL  SKYL GD++SLADLHHLP  + LM T
Sbjct  121  VNPLKGVSPDQEIIETNLEKLGKVLDIYEARLSTSKYLAGDFYSLADLHHLPYTYYLMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
               ++   RP+V AWW DISSRPA+ K  E
Sbjct  181  HAASVINERPHVKAWWEDISSRPAFKKASE  210



>gb|AAF02871.1|AC009525_5 Similar to glutathione S-transferases [Arabidopsis thaliana]
Length=238

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 143/205 (70%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHG+  ST T RV+A L EK L ++ + + +    HK EPFLSLNPFGQVP FEDG
Sbjct  18   LGYKVHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDG  77

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
             ++L+ESRAITQYIAY  +++G  L+     + MAT ++WME+E H FDP AS LTWE  
Sbjct  78   SVKLYESRAITQYIAYVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQV  137

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD+TIV++N+  L KVL++YE RL  S++L  + F+L DLHHLPNI  L+GT
Sbjct  138  IKPIYGLETDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGT  197

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF+ R  V  W  +I+SR AW
Sbjct  198  PTKKLFEKRSKVRKWVDEITSREAW  222



>gb|AAP58391.1| glutathione S-transferase 1 [Brassica juncea]
Length=213

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+ V +++    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHAASTATRRVLLTLHEKNLDFELVHVELKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +   A  ++ MEVE HHFDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYEEQGTNLLPADSKNISHYAIMAIGMEVEAHHFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K   GM TD+ +VE+ + +L+ VLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  VFKLFYGMTTDQAVVEEEEAKLAAVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP VS W  +I++RPA  K+++
Sbjct  183  TPTKKLFDERPRVSEWVEEITNRPASQKILQ  213



>ref|XP_006288647.1| hypothetical protein CARUB_v10001952mg [Capsella rubella]
 gb|EOA21545.1| hypothetical protein CARUB_v10001952mg [Capsella rubella]
Length=213

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  ST+T RV+  L EK LDF+ V +++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    GIKVFGHATSTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   N+G +L+  D K +   A  ++ MEVE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYENQGTNLLPADSKNVSQYAVMAIGMEVEAHQFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L KVLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  VFKNIYGLTTDQAVVAEEEAKLDKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF +RP V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTNRPRVNEWVTEITKRPASQKILQ  213



>ref|XP_010542861.1| PREDICTED: glutathione S-transferase F4-like [Tarenaya hassleriana]
Length=254

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 4/205 (2%)
 Frame = -2

Query  947  KVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLS-LNPFGQVPAFEDGDL  771
            KVHG+ +ST T RV+A L EKGL ++ +++D+ +  HK++PFL  LNPFGQ+P FEDG L
Sbjct  31   KVHGHPLSTNTRRVLAALYEKGLGYEAIEVDLKSGQHKKDPFLRHLNPFGQIPVFEDGSL  90

Query  770  ELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            +L ESRAITQYIAY  +++GN L+  E  K MA  ++WME+E   F P ASALTWE  IK
Sbjct  91   KLIESRAITQYIAYVHSSRGNPLLNLESHKTMAIQTMWMEIEAQQFSPPASALTWEQVIK  150

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKY--LGGDWFSLADLHHLPNIHCLMGT  420
            P+  + TD++ VE+N+ +LSKVLDVYE RL  + Y  L  + F+LADLHHLPNI  L  T
Sbjct  151  PIYNLPTDQSAVEENEAKLSKVLDVYEKRLAETGYDHLASESFTLADLHHLPNIELLYAT  210

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
            + + LF+ RP V+ W   I +RPAW
Sbjct  211  KTRRLFEERPRVTLWVARIRARPAW  235



>emb|CDX97273.1| BnaA02g20640D [Brassica napus]
Length=213

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+ V +++    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHAASTATRRVLLTLHEKNLDFELVHVELKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +   A  ++ MEVE HHFDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYEEEGTNLLPADSKNISHYAIMAIGMEVEAHHFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K   GM TD+ +VE+ + +L+ VLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  VFKLFYGMTTDQAVVEEEEAKLATVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP VS W  +I++RPA  K+++
Sbjct  183  TPTKKLFDERPLVSEWVAEITNRPASQKILQ  213



>ref|NP_563670.1| glutathione S-transferase F4 [Arabidopsis thaliana]
 ref|NP_001030937.1| glutathione S-transferase F4 [Arabidopsis thaliana]
 gb|AAG40875.1|AF320055_1 glutathione S-transferase [Arabidopsis thaliana]
 gb|AAV97790.1| At1g02950 [Arabidopsis thaliana]
 gb|AEE27500.1| glutathione S-transferase F4 [Arabidopsis thaliana]
 gb|AEE27502.1| glutathione S-transferase F4 [Arabidopsis thaliana]
Length=243

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 143/205 (70%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHG+  ST T RV+A L EK L ++ + + +    HK EPFLSLNPFGQVP FEDG
Sbjct  23   LGYKVHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDG  82

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
             ++L+ESRAITQYIAY  +++G  L+     + MAT ++WME+E H FDP AS LTWE  
Sbjct  83   SVKLYESRAITQYIAYVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQV  142

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD+TIV++N+  L KVL++YE RL  S++L  + F+L DLHHLPNI  L+GT
Sbjct  143  IKPIYGLETDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGT  202

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF+ R  V  W  +I+SR AW
Sbjct  203  PTKKLFEKRSKVRKWVDEITSREAW  227



>ref|XP_009111277.1| PREDICTED: glutathione S-transferase F3-like [Brassica rapa]
Length=213

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 143/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV GN  S +T RV+  L EK LDF+ V+ID+    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGNATSPSTRRVLLALHEKNLDFELVNIDLKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCED---PKKMATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   ++G +L+  D   P   A  ++ MEVE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYESQGTNLLPADSKNPAHYAIMAIGMEVEAHQFDPVASKLVWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
             IK  +G+ TD+ +V + + +L KVLDVYE RL   KYL G+ F+L DLHH+P +  L+G
Sbjct  123  VIKNFVGLTTDQAVVAEEEAKLVKVLDVYEARLKEFKYLAGETFTLTDLHHIPVVQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +++ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVAEVTKRPASQKILK  213



>ref|XP_007050849.1| Glutathione S-transferase phi 8 [Theobroma cacao]
 gb|EOX95006.1| Glutathione S-transferase phi 8 [Theobroma cacao]
Length=217

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 144/206 (70%), Gaps = 0/206 (0%)
 Frame = -2

Query  947  KVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDLE  768
            KV+G+  S AT++V+ACL E  LDF FV ID+ A  HK++PFLS+NPFGQVP FEDGD++
Sbjct  5    KVYGSLNSAATLKVLACLFEHDLDFDFVPIDLEAGEHKKKPFLSMNPFGQVPVFEDGDVK  64

Query  767  LFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKPV  588
             FESRAI + + +    KG  L+  D ++ A  + W++VE+HHF+P A  L  EL IKP 
Sbjct  65   QFESRAIIRSMGHQYGKKGEELIYWDSREQAVVANWIDVEDHHFEPPALKLISELVIKPK  124

Query  587  IGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIKT  408
             G+  DE  V + + +L+KVLDVYE RL + KYL  D +++AD+ HLPNI  L+GTQ K 
Sbjct  125  KGLTPDEETVAEAEAKLAKVLDVYEARLSKFKYLASDKYTIADMLHLPNIQALIGTQAKK  184

Query  407  LFQSRPNVSAWWVDISSRPAWLKMVE  330
            LF SRP +S W   I +RPAW+K+VE
Sbjct  185  LFDSRPRLSEWCTAILARPAWIKVVE  210



>ref|XP_009119597.1| PREDICTED: glutathione S-transferase F6-like [Brassica rapa]
 emb|CDX89931.1| BnaA10g01510D [Brassica napus]
Length=210

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 141/207 (68%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+ V ID+    HK+EPFLS NPFG++PAFEDG 
Sbjct  3    GIKVFGHPASTATRRVLIALHEKELDFELVHIDLKDGEHKKEPFLSRNPFGKIPAFEDGG  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  A+KGN L+    K MA  ++ ME+E H FD  AS L WE   K
Sbjct  63   FKLFESRAITQYIAHEYADKGNQLLSPGSKNMAILAMGMEIEAHEFDSVASKLGWEQIFK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
               G+ TD+ +V++ + +L KVLD YE RL  SKYL  D F+L DLHH+P I  L+GT  
Sbjct  123  NFFGLTTDQAVVKEEEVKLGKVLDNYEARLGESKYLACDHFTLVDLHHIPVIQYLLGTPT  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP+VSAW  DI+SRP+  K++
Sbjct  183  KKLFDERPHVSAWVADITSRPSSQKVL  209



>ref|NP_849581.1| glutathione S-transferase F4 [Arabidopsis thaliana]
 sp|Q84TK0.1|GSTF4_ARATH RecName: Full=Glutathione S-transferase F4; Short=AtGSTF4; AltName: 
Full=GST class-phi member 4; AltName: Full=Glutathione 
S-transferase 31 [Arabidopsis thaliana]
 gb|AAO64132.1| putative glutathione transferase [Arabidopsis thaliana]
 dbj|BAF00298.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AEE27501.1| glutathione S-transferase F4 [Arabidopsis thaliana]
Length=245

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -2

Query  947  KVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDLE  768
            KVHG+  ST T RV+A L EK L ++ + + +    HK EPFLSLNPFGQVP FEDG ++
Sbjct  28   KVHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVK  87

Query  767  LFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            L+ESRAITQYIAY  +++G  L+     + MAT ++WME+E H FDP AS LTWE  IKP
Sbjct  88   LYESRAITQYIAYVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKP  147

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIK  411
            + G+ TD+TIV++N+  L KVL++YE RL  S++L  + F+L DLHHLPNI  L+GT  K
Sbjct  148  IYGLETDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGTPTK  207

Query  410  TLFQSRPNVSAWWVDISSRPAW  345
             LF+ R  V  W  +I+SR AW
Sbjct  208  KLFEKRSKVRKWVDEITSREAW  229



>ref|XP_009119591.1| PREDICTED: glutathione S-transferase F4 isoform X2 [Brassica 
rapa]
Length=251

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 144/205 (70%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  K+HGN  ST T RV+A L+EKGL ++ + +D+    HK++ FL LNPFGQVP  EDG
Sbjct  31   LGYKLHGNPFSTNTRRVLAVLLEKGLSYEPITVDLKTGEHKKDSFLGLNPFGQVPVLEDG  90

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +L L ESRAITQYIAY  +++G  L+  +  + MA  ++WME+E H FDP AS LTWEL 
Sbjct  91   NLTLCESRAITQYIAYVHSSRGTQLLNLQSHETMAILTMWMEIEAHQFDPLASKLTWELV  150

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD  +V++N+  L KVLDVYE RL  S++L  + F+L DLHHLPNI  L+GT
Sbjct  151  IKPLYGLETDHMVVKENEAGLEKVLDVYEKRLGESRFLACNTFTLVDLHHLPNIQFLLGT  210

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF++RP V  W  +I+SR AW
Sbjct  211  PTKRLFENRPKVRNWVHEITSREAW  235



>gb|KCW44647.1| hypothetical protein EUGRSUZ_L01827 [Eucalyptus grandis]
Length=252

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 151/246 (61%), Gaps = 38/246 (15%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +K++G+  ST T RV A L EKGL F+FV +DM A  HK++ FL+LNPFGQVPAFEDG
Sbjct  1    MVMKIYGSVNSTETTRVFAALYEKGLPFEFVPVDMRAGEHKEDHFLALNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDP------------------------------  687
            DL+LFESRAIT+YIA+  A KG  LV E                                
Sbjct  61   DLKLFESRAITRYIAHKYAEKGTPLVYEGKPMAKVSARVEVKVAQESMESKLQCDFMLDR  120

Query  686  --------KKMATASVWMEVENHHFDPAASALTWELGIKPVIGMATDETIVEQNKERLSK  531
                      MAT +VW EVE   FDP AS L  EL  + + G+A D  + E+N   L+K
Sbjct  121  AADAAVIENMMATVNVWTEVEARQFDPVASKLQRELVHRQMFGVAPDAAVFEENGTELTK  180

Query  530  VLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIKTLFQSRPNVSAWWVDISSRP  351
            VLD+YE RL +SKYLG D+F++ADLHHLP +  LMGT  +TLF +RP VSAW  ++ +RP
Sbjct  181  VLDIYEARLSQSKYLGCDFFTVADLHHLPALTNLMGTPARTLFDARPKVSAWVANLMARP  240

Query  350  AWLKMV  333
            AWLK++
Sbjct  241  AWLKVL  246



>ref|XP_009119590.1| PREDICTED: glutathione S-transferase F4 isoform X1 [Brassica 
rapa]
 emb|CDX89927.1| BnaA10g01550D [Brassica napus]
Length=253

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 145/209 (69%), Gaps = 1/209 (0%)
 Frame = -2

Query  968  QHIFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPA  789
            + +    K+HGN  ST T RV+A L+EKGL ++ + +D+    HK++ FL LNPFGQVP 
Sbjct  29   KKLVAGYKLHGNPFSTNTRRVLAVLLEKGLSYEPITVDLKTGEHKKDSFLGLNPFGQVPV  88

Query  788  FEDGDLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALT  612
             EDG+L L ESRAITQYIAY  +++G  L+  +  + MA  ++WME+E H FDP AS LT
Sbjct  89   LEDGNLTLCESRAITQYIAYVHSSRGTQLLNLQSHETMAILTMWMEIEAHQFDPLASKLT  148

Query  611  WELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHC  432
            WEL IKP+ G+ TD  +V++N+  L KVLDVYE RL  S++L  + F+L DLHHLPNI  
Sbjct  149  WELVIKPLYGLETDHMVVKENEAGLEKVLDVYEKRLGESRFLACNTFTLVDLHHLPNIQF  208

Query  431  LMGTQIKTLFQSRPNVSAWWVDISSRPAW  345
            L+GT  K LF++RP V  W  +I+SR AW
Sbjct  209  LLGTPTKRLFENRPKVRNWVHEITSREAW  237



>gb|KFK42651.1| hypothetical protein AALP_AA1G022500 [Arabis alpina]
Length=210

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 141/207 (68%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+ V I++    HK+EPFLS NPFG++PAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKDLDFELVHIELKDGEHKKEPFLSRNPFGKIPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +L ESRAITQYIA+  A+KGN L+    K MA  ++ ME+E H FD  AS L WE   K
Sbjct  63   FKLIESRAITQYIAHEYADKGNQLLSLGSKNMAILAMGMEIEAHEFDKVASKLGWEQIFK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
               G+ TD+T+VE+ + +L+KVLD YE RL  SKYL    F+L DLHH+P I  L+GT  
Sbjct  123  NSFGLTTDQTVVEKEEVKLAKVLDNYEARLGESKYLSCGHFTLVDLHHIPVIQYLLGTPT  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP V+AW  DI+SRP+  K+V
Sbjct  183  KKLFDERPRVNAWVADITSRPSSKKIV  209



>ref|XP_006396463.1| hypothetical protein EUTSA_v10028957mg [Eutrema salsugineum]
 dbj|BAJ34001.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37916.1| hypothetical protein EUTSA_v10028957mg [Eutrema salsugineum]
Length=213

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  ST+T RV+  L EK LDF+ V +D+    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHAASTSTRRVLLALHEKNLDFELVHVDLKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMA---TASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   ++G +L+  DPK +A     ++  EVE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYQDQGTNLLPADPKNIALYAIMAIGTEVEAHQFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P I  L+G
Sbjct  123  VFKLMYGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            +  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  SPSKKLFTERPRVNEWVAEITKRPASQKILQ  213



>ref|XP_010457291.1| PREDICTED: glutathione S-transferase F6-like [Camelina sativa]
Length=208

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 145/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+FV I++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIHRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  A+KG  L+    K MA  ++ +E+E + FDP  S L WE  +K
Sbjct  63   FKLFESRAITQYIAHNFADKGTDLLTPG-KGMAFIAMGIEIEKNEFDPVGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+ +VE+ + +L+KVLDVYE+RL  SKYL  D F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKAVVEEEEAKLAKVLDVYEHRLGESKYLAADHFTLVDLHIIPVIQYLLGTPT  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  R +VSAW  DI+SRP+  K++
Sbjct  182  KKLFDERTHVSAWVADITSRPSAQKVL  208



>ref|NP_192161.1| glutathione S-transferase F2 [Arabidopsis thaliana]
 sp|P46422.3|GSTF2_ARATH RecName: Full=Glutathione S-transferase F2; Short=AtGSTF2; AltName: 
Full=24 kDa auxin-binding protein; Short=AtPM24; AltName: 
Full=GST class-phi member 2 [Arabidopsis thaliana]
 gb|AAG40032.1|AF324681_1 AT4g02520 [Arabidopsis thaliana]
 gb|AAG41485.1|AF326903_1 putative Atpm24.1 glutathione S transferase [Arabidopsis thaliana]
 gb|AAK15574.1|AF349527_1 putative Atpm24.1 glutathione S transferase [Arabidopsis thaliana]
 gb|AAA32800.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAA32801.1| glutathione S-transferase [Arabidopsis thaliana]
 emb|CAA53051.1| glutathione S-transferase [Arabidopsis thaliana]
 gb|AAC78264.1| Atpm24.1 glutathione S transferase [Arabidopsis thaliana]
 emb|CAB80745.1| Atpm24.1 glutathione S transferase [Arabidopsis thaliana]
 gb|AAK62635.1| AT4g02520/T10P11_18 [Arabidopsis thaliana]
 gb|AAL06970.1| AT4g02520/T10P11_18 [Arabidopsis thaliana]
 gb|AEE82183.1| glutathione S-transferase F2 [Arabidopsis thaliana]
Length=212

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 142/209 (68%), Gaps = 3/209 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S AT RV+  L EK LDF+ V +++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   N+G +L+  D K +   A  ++ M+VE+H FDP AS L +E 
Sbjct  63   LKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TDE +V + + +L+KVLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  IFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKM  336
            T  K LF  RP V+ W  +I+ RPA  K+
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASEKV  211



>pdb|1GNW|A Chain A, Structure Of Glutathione S-Transferase
 pdb|1GNW|B Chain B, Structure Of Glutathione S-Transferase
 pdb|1BX9|A Chain A, Glutathione S-Transferase In Complex With Herbicide
Length=211

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 142/209 (68%), Gaps = 3/209 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S AT RV+  L EK LDF+ V +++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  2    GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGD  61

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   N+G +L+  D K +   A  ++ M+VE+H FDP AS L +E 
Sbjct  62   LKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQ  121

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TDE +V + + +L+KVLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  122  IFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLG  181

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKM  336
            T  K LF  RP V+ W  +I+ RPA  K+
Sbjct  182  TPTKKLFTERPRVNEWVAEITKRPASEKV  210



>ref|XP_011010721.1| PREDICTED: glutathione S-transferase F13-like [Populus euphratica]
Length=217

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 144/210 (69%), Gaps = 1/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +K++G  MST T RV+ CL EK LDF+ V +D+ A  HKQ PFL+ NPFGQ+PA E+ 
Sbjct  1    MVLKLYGTPMSTCTSRVLTCLHEKSLDFELVPVDLFAGEHKQPPFLAKNPFGQIPALEED  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT Y+A      G  L+  E+ K+ A+  VW EVE+H ++PA + + ++  
Sbjct  61   DLTLFESRAITSYVAEKFKGSGYDLIRHENLKEAASVKVWTEVESHRYNPAIAPIVFQFL  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G   D+TI++ N E+L KVLDVYE +L  +KYL GD++SLADLHHLP  + LM T
Sbjct  121  VAPLQGNLPDQTIIDANLEKLGKVLDVYEAKLTSTKYLAGDFYSLADLHHLPYTYYLMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
               ++   RP+V AWW DISSRPA+ K+ E
Sbjct  181  PAASVVNERPHVKAWWEDISSRPAFKKVAE  210



>ref|XP_006386755.1| glutathione S-transferase family protein [Populus trichocarpa]
 gb|ERP64552.1| glutathione S-transferase family protein [Populus trichocarpa]
Length=217

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 145/210 (69%), Gaps = 1/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +K++G  MST T RV+ CL EK LDF+ V +D+ A  HKQ PFL+ NPFGQ+PA E+ 
Sbjct  1    MVLKLYGAPMSTCTSRVLTCLHEKNLDFELVPVDLFAGEHKQPPFLAKNPFGQIPALEED  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT YIA      G  L+  E+ K+ A+  VW EVE+H ++PA + + ++  
Sbjct  61   DLTLFESRAITSYIAEKFKGTGYDLIRHENLKEAASVKVWTEVESHRYNPAIAPIVFQFM  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G + D+TI++ N E+L KVLD+YE +L  +KYL GD++SLADLHHLP  + LM T
Sbjct  121  VAPLRGNSPDQTIIDDNVEKLGKVLDIYEAKLSSTKYLAGDFYSLADLHHLPYTYYLMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
               ++   RP+V AWW DISSRPA+ K+ E
Sbjct  181  PAASVVNERPHVKAWWEDISSRPAFKKVAE  210



>gb|AAM63854.1| Atpm24.1 glutathione S transferase [Arabidopsis thaliana]
Length=212

 Score =   223 bits (568),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 141/209 (67%), Gaps = 3/209 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S AT RV+  L EK LDF+ V +++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   N+G +L+  D K +   A  ++ M+VE+H FDP AS L +E 
Sbjct  63   LKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TDE +V   + +L+KVLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  ISKSIYGLTTDEAVVAXEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKM  336
            T  K LF  RP V+ W  +I+ RPA  K+
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASEKV  211



>gb|ADB11335.1| phi class glutathione transferase GSTF7 [Populus trichocarpa]
Length=217

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 145/210 (69%), Gaps = 1/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +K++G  MST T RV+ CL EK LDF+ V +D+ A  HKQ PFL+ NPFGQ+PA E+ 
Sbjct  1    MVLKLYGAPMSTCTSRVLTCLHEKNLDFELVPVDLFAGEHKQPPFLAKNPFGQIPALEED  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT Y+A      G  L+  E+ K+ A+  VW EVE+H ++PA + + ++  
Sbjct  61   DLTLFESRAITSYLAEKFKGTGYDLIRHENLKEAASVKVWTEVESHRYNPAIAPIVFQFM  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G + D+TI++ N E+L KVLD+YE +L  +KYL GD++SLADLHHLP  + LM T
Sbjct  121  VAPLRGNSPDQTIIDDNVEKLGKVLDIYEAKLSSTKYLAGDFYSLADLHHLPYTYYLMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
               ++   RP+V AWW DISSRPA+ K+ E
Sbjct  181  PAASVVNERPHVKAWWEDISSRPAFKKVAE  210



>ref|XP_010938431.1| PREDICTED: glutathione S-transferase 3 [Elaeis guineensis]
Length=215

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 140/208 (67%), Gaps = 2/208 (1%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KV+G  MST T+RVVA L EKGLD++ V +D+    HKQ  FL+LNPFGQ+P  EDG
Sbjct  1    MGLKVYGLAMSTNTVRVVAALNEKGLDYELVPVDLRTGAHKQPSFLALNPFGQIPVLEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCED--PKKMATASVWMEVENHHFDPAASALTWEL  603
            DL LFESRAI++YIA      G  L+     P + A   VW+EVE+  F P  + L +EL
Sbjct  61   DLVLFESRAISRYIASRYKETGPDLLRSGGGPAETAALEVWLEVESQQFGPPIADLVFEL  120

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
             IKP++G  TD  +VE+  E+L KVLDVYE+RL ++KYL G  F+LADL+H+P  H L+ 
Sbjct  121  LIKPLLGGTTDPAVVEKQAEKLGKVLDVYEDRLSKNKYLAGGHFTLADLNHMPYTHYLLQ  180

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLK  339
            T    L  +RP V AWW DIS+RPAW K
Sbjct  181  TPKADLVTARPRVLAWWQDISARPAWKK  208



>ref|XP_006418286.1| hypothetical protein EUTSA_v10008776mg [Eutrema salsugineum]
 dbj|BAJ34627.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36639.1| hypothetical protein EUTSA_v10008776mg [Eutrema salsugineum]
Length=209

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 141/207 (68%), Gaps = 0/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+ V I++    HK+EPFLS NPFG++PAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKDLDFELVHIELKDGEHKKEPFLSRNPFGKIPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  ++KGN L+    K MA  ++ ME+E H FD  AS L WE   K
Sbjct  63   FKLFESRAITQYIAHEYSDKGNQLLSLGSKNMAILAMGMEIEAHEFDSVASKLGWEQIFK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
               G+ TD+ +VE  + +L+KVLD YE RL  SKYL  D F+L DLHH+P I  L+ T  
Sbjct  123  HFFGLTTDQAVVEAEELKLAKVLDNYEARLGESKYLSCDHFTLVDLHHIPVIQYLLDTPT  182

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  RP+VSAW  DI++RP+  K++
Sbjct  183  KKLFDERPHVSAWVADITARPSSQKVL  209



>emb|CDY18136.1| BnaC05g01590D [Brassica napus]
Length=333

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 144/205 (70%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  K+HGN  ST T RV+A L+EKGL ++ + +D+    HK++ FL LNPFGQVP  EDG
Sbjct  31   LGYKLHGNPFSTNTRRVLAVLLEKGLSYEPITVDLKTGEHKKDSFLGLNPFGQVPVLEDG  90

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +L L ESRAITQYIAY  +++G  L+  +  + MA  ++WME+E H FDP AS LTWEL 
Sbjct  91   NLTLCESRAITQYIAYVHSSRGTQLLNLQSHETMAILTMWMEIEAHQFDPLASKLTWELV  150

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD  +V++N+  L KVLDVYE RL  S++L  + F+L DLHHLPNI  L+GT
Sbjct  151  IKPLYGLETDHMVVKENEAGLEKVLDVYEKRLGDSRFLACNTFTLVDLHHLPNIQFLLGT  210

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF++RP V  W  +I+SR AW
Sbjct  211  PTKRLFENRPKVRNWVHEITSREAW  235



>ref|XP_010481364.1| PREDICTED: glutathione S-transferase F6-like [Camelina sativa]
Length=208

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 145/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+FV I++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIHRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  ++KG  L+    K MA  ++ +E+E + FDP  S L WE  +K
Sbjct  63   FKLFESRAITQYIAHNFSDKGTDLLSPG-KGMAFIAMGIEIEKNEFDPVGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+ +VE+ + +L+KVLDVYE+RL  SKYL  + F+L DLH +P I  L+GT  
Sbjct  122  PLYGMTTDKAVVEEEEAKLAKVLDVYEHRLGESKYLAANHFTLVDLHIIPVIQYLLGTPT  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  R +VSAW  DI+SRP+  K++
Sbjct  182  KKLFNERTHVSAWVADITSRPSAQKVL  208



>gb|KFK30854.1| hypothetical protein AALP_AA6G033900 [Arabis alpina]
Length=213

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV+G+  S AT RV+  L EK LDF+ V I++    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVYGHAASVATRRVILALHEKNLDFELVHIELKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMA---TASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+ +    MA     ++ +EVE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYEGQGTNLLPDYANNMALYAIMAIGIEVEGHQFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +VE+ + +L+KVLDVYE RL  +KYL GD F+L +LHH+P I  L+ 
Sbjct  123  VFKNIYGLTTDQAVVEEEEAKLAKVLDVYEYRLKETKYLAGDTFTLVELHHIPVIQYLLT  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I++RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVTEITNRPASQKILQ  213



>ref|XP_010474883.1| PREDICTED: glutathione S-transferase F6-like [Camelina sativa]
Length=208

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 145/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+FV I++    HK+EPF+  NPFG+VPAFEDGD
Sbjct  3    GIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIHRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             +LFESRAITQYIA+  A+KG +L+    K MA  ++ +E+E + FDP  S L WE  +K
Sbjct  63   FKLFESRAITQYIAHNFADKGTNLLSPG-KTMANIAMGIEIEKNEFDPIGSKLVWEQVLK  121

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ GM TD+ +VE+ + +L+KVLDVYE+RL  SKYL  D F+L DL  +P I  L+GT  
Sbjct  122  PLYGMTTDKAVVEEEEAKLAKVLDVYEHRLGESKYLAADHFTLVDLLLIPVIQYLLGTPT  181

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMV  333
            K LF  R +VSAW  D++SRP+  K++
Sbjct  182  KKLFDERTHVSAWVADVTSRPSAKKVL  208



>gb|KFK30847.1| hypothetical protein AALP_AA6G033300 [Arabis alpina]
Length=213

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  ST+T RV+  L EK LDF+ V +++    H +EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHAASTSTRRVILALHEKNLDFELVHVELKDGEHMKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVW---MEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +A  +V    M+VE H FDP A+ L WEL
Sbjct  63   LKLFESRAITQYIAHRYEGQGTNLLPTDSKNIALYAVMAIGMQVEAHEFDPVATKLAWEL  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V++ K +L KVLDVYE RL  +KYL GD F+L DLHH+P I  L+G
Sbjct  123  VFKQLYGLTTDQAVVDEEKAKLDKVLDVYEARLKETKYLAGDTFTLTDLHHVPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T I  LF  R +V+ W  +I+ RPA  K+++
Sbjct  183  TPIGKLFTQRQHVNEWVSEITKRPASQKILQ  213



>dbj|BAF01093.1| putative glutathione S-transferase [Arabidopsis thaliana]
Length=212

 Score =   221 bits (563),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 142/210 (68%), Gaps = 3/210 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  ST+T RV+  L EK LDF+ V +++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    GIKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPK---KMATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   N+G +L+  D K   + A  S+ ++VE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYENQGTNLLPADSKNIARYAIMSIGIQVEAHQFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K   G+ TD+ +V + + +L+KVLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  VFKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            T  K LF  RP V+ W  +I+ RPA  K++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASEKVL  212



>ref|XP_010481385.1| PREDICTED: glutathione S-transferase F4-like [Camelina sativa]
Length=262

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 142/205 (69%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHG+  ST T RV+A L EKGL ++ + + +    HK E FL+LNPFGQVP FED 
Sbjct  41   LGYKVHGDPFSTNTRRVLAVLHEKGLSYEPITVKLQTGEHKSEHFLALNPFGQVPVFEDR  100

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++L ESRAITQYIAY    +G  L+  +  + MA  ++WME+E HHFDP AS LTWE  
Sbjct  101  NVKLSESRAITQYIAYVHGPRGTELLNLQSHETMAILTMWMEIEAHHFDPPASKLTWEQV  160

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD T+V++N+  L KVL+VYE RL  S++L  + F+L DLHHLPNI  L+GT
Sbjct  161  IKPLYGLETDHTVVKENEANLEKVLNVYEKRLQESRFLACNSFTLVDLHHLPNIQYLLGT  220

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF++RP V  W  +I+SR AW
Sbjct  221  PTKRLFKNRPKVHKWVDEITSREAW  245



>ref|XP_006575109.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase PARB-like 
[Glycine max]
Length=186

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            I++HGN  STATMR  A L EK L+F+FV IDM    HK+EPF+SLNPFGQVPAFEDGDL
Sbjct  4    IRLHGNPFSTATMRAAASLHEKQLEFEFVLIDMKNGEHKKEPFISLNPFGQVPAFEDGDL  63

Query  770  ELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIKP  591
            +LFESRAITQYI +  A+KG  L+ ++ KKMA   +W+EVE+ H+D  AS L WEL +KP
Sbjct  64   KLFESRAITQYIVHEYADKGTQLISKESKKMAKLRLWLEVESQHYDQPASKLVWELMVKP  123

Query  590  VIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCL  429
            + G+ TD   VE+N+ +L  VLD YE  L +SKY+ G+ F+LADLHHLP I  L
Sbjct  124  MYGLPTDPAAVEENEGKLGTVLDFYEKTLSQSKYVAGECFTLADLHHLPTIXLL  177



>ref|NP_178394.1| glutathione S-transferase F3 [Arabidopsis thaliana]
 sp|Q9SLM6.1|GSTF3_ARATH RecName: Full=Glutathione S-transferase F3; Short=AtGSTF3; AltName: 
Full=GST class-phi member 3; AltName: Full=Glutathione 
S-transferase 16 [Arabidopsis thaliana]
 gb|AAG30130.1|AF288181_1 glutathione S-transferase [Arabidopsis thaliana]
 gb|AAC32912.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|ABD94077.1| At2g02930 [Arabidopsis thaliana]
 gb|AEC05642.1| glutathione S-transferase F3 [Arabidopsis thaliana]
Length=212

 Score =   221 bits (562),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 142/210 (68%), Gaps = 3/210 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  ST+T RV+  L EK LDF+ V +++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    GIKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMAT---ASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   N+G +L+  D K +A     S+ ++VE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K   G+ TD+ +V + + +L+KVLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  VFKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            T  K LF  RP V+ W  +I+ RPA  K++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASEKVL  212



>ref|XP_010269470.1| PREDICTED: glutathione S-transferase F13-like [Nelumbo nucifera]
Length=217

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 144/213 (68%), Gaps = 1/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+K++G  MS+ T RV+ CL EK +DF+FV +++    HK+ PFL+ NPFG +P  EDG
Sbjct  1    MALKLYGLPMSSYTTRVMTCLHEKAVDFEFVPVNLFTCEHKEPPFLAKNPFGLIPVLEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAI  Y+A+   + G  L+   D K+ A   VWMEVE+  F+PA + + +E  
Sbjct  61   DLTLFESRAINSYVAHKYKDSGTDLLRLSDIKEAAAVGVWMEVESQQFNPAITPIIYEFF  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G   D+ I++ + E+L KVLD+YE RL  +KYL GD ++LADLHHLP    LM T
Sbjct  121  VAPISGKTPDQAIIDASAEKLGKVLDIYEARLSSTKYLAGDSYTLADLHHLPYTFYLMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
               +L +SRP+V AWW DISSRPA+ K+ E +K
Sbjct  181  PWASLIESRPHVKAWWEDISSRPAFKKVAEGMK  213



>gb|ABM53759.1| glutathione S-transferase [Brassica juncea]
Length=213

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKV G+  STAT RV+  L EK LDF+ V +++    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    AIKVFGHAASTATRRVLLTLHEKNLDFELVHVELKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMA---TASVWMEVENHHFDPAASALTWEL  603
            L+LFE+RAITQYIA+    +G +L+  D K +A     ++ M+VE H F+P A+ L  E 
Sbjct  63   LKLFETRAITQYIAHRYEGQGTNLLPADSKNIAHYAIMAIGMQVEAHQFEPVAAKLVSEH  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              KP  G  TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P I  L+G
Sbjct  123  VFKPKKGSTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPAIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP+VS W  +I++RPA  K+++
Sbjct  183  TPTKKLFDERPHVSEWVAEITNRPASQKILQ  213



>ref|XP_010090796.1| Glutathione S-transferase F13 [Morus notabilis]
 gb|EXB40829.1| Glutathione S-transferase F13 [Morus notabilis]
Length=217

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 141/208 (68%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +K+HG  MST+T RV+ CL EKGLDF+ V +D+ A  +KQ  FL+ NPFGQVP  EDG
Sbjct  1    MVLKLHGLPMSTSTTRVMICLHEKGLDFELVPVDLFARENKQPLFLAKNPFGQVPVLEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT Y+A    +  N L+  E   + A   VW EVE+H +DP  S +  +  
Sbjct  61   DLTLFESRAITAYLAEKYKDSRNDLIRHESLNESAMVKVWSEVESHEYDPVVSQIVHQHF  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+IG  +D+T++++N E+L KVLDVYE RL  +KYL GD+FSLADLHHLP     M T
Sbjct  121  VAPMIGKTSDQTVIDENLEKLGKVLDVYETRLSNTKYLAGDFFSLADLHHLPYTFYFMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKM  336
               ++   RP+V AWW DISSRPA+ K+
Sbjct  181  PWASILNDRPHVKAWWEDISSRPAFEKV  208



>ref|XP_010521004.1| PREDICTED: glutathione S-transferase F8, chloroplastic-like [Tarenaya 
hassleriana]
Length=210

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 144/212 (68%), Gaps = 7/212 (3%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIK++G  +STATMR +A L EKGL+F+ V +D  +  HKQEP +S NPFGQVPAF+DGD
Sbjct  3    AIKLYGVPLSTATMRALAALYEKGLEFELVPVDTSSGAHKQEPHISRNPFGQVPAFDDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATAS-VWMEVENHHFDPAASALTWELGI  597
            ++LFESRAITQYIA    +KGN L C   K +  A+  W+      F+P A  LT+E   
Sbjct  63   VKLFESRAITQYIAEEYNDKGNRLFCPGNKVVKAATRPWV------FEPVAMKLTFERFY  116

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQ  417
            KP+ GM+TD    E+ + +L KVLDVYE RL  S+YL  + F+LADLHHLP +HCLM T 
Sbjct  117  KPMFGMSTDPAAAEELEGKLGKVLDVYEKRLGESEYLACNCFTLADLHHLPAVHCLMATD  176

Query  416  IKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
             K +FQ+RP VS W   I++R AW K++   K
Sbjct  177  SKKVFQARPKVSEWVAKITAREAWAKVLALQK  208



>ref|XP_010474885.1| PREDICTED: glutathione S-transferase F4 isoform X1 [Camelina 
sativa]
Length=244

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 142/205 (69%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHG+  ST T RV+A L EKGL ++ + + +    H+ E FLSLNPFGQVP FED 
Sbjct  23   IGYKVHGDPFSTNTRRVLAVLHEKGLSYEPITVKLQTGEHQSESFLSLNPFGQVPVFEDR  82

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++L ESRAITQYIAY  + +G  L+  +  + MA  ++WME+E H FDP AS LTWE  
Sbjct  83   NIKLSESRAITQYIAYVHSPRGTQLLNLQSHETMAILTMWMEIEAHQFDPPASKLTWEQV  142

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD T+V++N+  L KVL+VYE RL  S++L  + F+L DLHHLPNI  L+GT
Sbjct  143  IKPLYGLETDHTVVKENEANLEKVLNVYEKRLQESRFLACNSFTLVDLHHLPNIQYLLGT  202

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF++RP V  W  +I+SR AW
Sbjct  203  PTKRLFKNRPKVHKWVDEITSREAW  227



>gb|AAP58395.1| glutathione S-transferase 5 [Brassica juncea]
Length=213

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 141/211 (67%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKV G+  S  TMRVV  L EK LDF+FV +D+    HK+E FL+ NPFGQVPAFEDGD
Sbjct  3    AIKVFGHPASAPTMRVVLTLHEKNLDFEFVHVDLMGGEHKKEAFLARNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +   A  ++ M+VE H F+P A+ L  E 
Sbjct  63   LKLFESRAITQYIAHRYEGQGTNLLPADSKNIAHYAIMAIGMQVEAHQFEPVAAKLVSEH  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              KP  G  TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P I  L+G
Sbjct  123  VFKPKKGSTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPAIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  TPSKRLFTERPRVNEWVAEITKRPASQKILQ  213



>ref|XP_006855528.1| hypothetical protein AMTR_s00057p00211000 [Amborella trichopoda]
 gb|ERN16995.1| hypothetical protein AMTR_s00057p00211000 [Amborella trichopoda]
Length=214

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 142/213 (67%), Gaps = 1/213 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +++HG  MST+T RV+AC  EKGL F+   + +    HKQ PFLSLNPFGQ+PAFED 
Sbjct  1    MGVELHGLAMSTSTARVIACFEEKGLPFELAPVRVEVGAHKQPPFLSLNPFGQIPAFEDD  60

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++LFESRA T YI+      G  L+   +  + A   VWMEVE H F+P  SA+  E  
Sbjct  61   EVKLFESRAKTNYISNKYNEIGADLLRFGNVPEFALVLVWMEVEAHRFNPPISAIVREAL  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            +KP  G  TD +++E   ++L+KVLDVYE+RL  +KYL G+ FSLADLHHLP IH L+ T
Sbjct  121  VKPAFGATTDASVIEAEAKKLAKVLDVYESRLSENKYLAGENFSLADLHHLPYIHYLLKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLK  321
                L  SR +V AWW DISSRP+W K+ E +K
Sbjct  181  SKADLITSRKHVKAWWDDISSRPSWKKVSENMK  213



>emb|CDY50375.1| BnaCnng19070D [Brassica napus]
Length=213

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            +IKV G+  +T+T RV+  L EK LD++ V++++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    SIKVFGHATTTSTRRVLLTLHEKNLDYELVNVELKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMA---TASVWMEVENHHFDPAASALTWEL  603
            L+LF  + ITQYIA+    +G +L+  D K +A   T S+ MEVE H FDPAAS L WE 
Sbjct  63   LKLFGMKPITQYIAHRYEGQGTNLLPADSKNIAHYATMSIGMEVEAHQFDPAASKLAWEE  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L+KVLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  LFKHIYGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASQKILQ  213



>ref|XP_010026139.1| PREDICTED: glutathione S-transferase-like [Eucalyptus grandis]
Length=308

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 153/250 (61%), Gaps = 38/250 (15%)
 Frame = -2

Query  968  QHIFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPA  789
            +   M   ++G   STA MR +A L EKGL FQ V +D+GA  HK+E FL+LNPFGQVPA
Sbjct  53   ERAIMMRNIYGRVDSTAMMRALAALHEKGLAFQLVPVDVGAGEHKKERFLALNPFGQVPA  112

Query  788  FEDGDLELFESRAITQYIAYTCANKGNHLVCE---------------DPKKM--------  678
            FEDGDL+LFESRAITQYIA    + G  L+ E               +P+ M        
Sbjct  113  FEDGDLKLFESRAITQYIARKYPDMGTPLILESKPTVKVSAWMEFEVNPETMESNVQWEL  172

Query  677  ---------------ATASVWMEVENHHFDPAASALTWELGIKPVIGMATDETIVEQNKE  543
                           AT ++W+EVE H FDP AS L  EL  + +IGMA D  +  +N  
Sbjct  173  LPDRAADAAVIENTMATVNMWIEVEAHQFDPVASRLQRELVYRQMIGMAPDTAVFGENWT  232

Query  542  RLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQIKTLFQSRPNVSAWWVDI  363
            RL+++LD+YE +L +SKYLG D+F+LADLHHLP +  LMGT  K LF +RP VSAW  +I
Sbjct  233  RLTELLDIYEAQLSQSKYLGCDFFTLADLHHLPALTNLMGTPAKALFDARPKVSAWVANI  292

Query  362  SSRPAWLKMV  333
             +RPAW+K++
Sbjct  293  MARPAWVKVL  302



>ref|XP_011033572.1| PREDICTED: glutathione S-transferase F13-like [Populus euphratica]
Length=217

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 143/210 (68%), Gaps = 1/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+K++G+ MST T RV+ CL EK LDF+ V +D+ A  HKQ PFL+ NPFGQ+PA ED 
Sbjct  1    MALKLYGSPMSTCTSRVLTCLHEKDLDFELVIVDLFAGEHKQPPFLAKNPFGQIPALEDD  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT Y+A      G  L+  ++ K+ A   VW EVE+  F PA + + ++  
Sbjct  61   DLTLFESRAITSYVAERFKETGYDLIRHQNIKEAALVKVWAEVESQQFHPAIAPIIFQFL  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G   D+T+++ N E+L KVLD+YE +L  +KYL GD++SLADLHHLP  + LM T
Sbjct  121  VAPLQGNLPDQTVIDTNLEKLGKVLDIYEAKLTSTKYLAGDFYSLADLHHLPYAYYLMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
               ++   RP+V AWW DISSRPA+ K+ E
Sbjct  181  PAASVVNERPHVKAWWEDISSRPAFKKVAE  210



>gb|AAP58393.1| glutathione S-transferase 3 [Brassica juncea]
Length=213

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 142/211 (67%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S +T RV+  L EK LDF+ V++++    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGSAASPSTRRVLLALHEKNLDFELVNVELKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMA---TASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +A     ++ +EVE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYEGQGTNLLPADSKNIAHYAIMAIGLEVEAHQFDPVASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K   G+ TD+ +V + + +L+KVLDVYE RL   KYL G+ F+L DLHH+P I  L+G
Sbjct  123  VFKNFYGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASQKILQ  213



>ref|XP_002321020.2| glutathione S-transferase family protein [Populus trichocarpa]
 gb|ADB11382.1| phi class glutathione transferase GSTF3 [Populus trichocarpa]
 gb|EEE99335.2| glutathione S-transferase family protein [Populus trichocarpa]
Length=217

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 142/210 (68%), Gaps = 1/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+K++G  MST T RV+ CL EK LDF+ V +D+ A  HKQ PFL+ NPFGQ+PA ED 
Sbjct  1    MALKLYGAPMSTCTSRVLTCLHEKDLDFELVIVDLFAGEHKQPPFLAKNPFGQIPALEDD  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT Y+A      G  L+  ++ K+ A   VW EVE+  F PA + + ++  
Sbjct  61   DLTLFESRAITSYVAERFKETGYDLIRHQNIKEAALVKVWTEVESQQFHPAIAPIIFQFL  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G   D+TI++ N E+L KVLD+YE +L  +KYL GD++SLADLHHLP  + LM T
Sbjct  121  VAPLQGNLPDQTIIDTNLEKLGKVLDIYEAKLTSTKYLAGDFYSLADLHHLPYAYYLMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
               ++   RP+V AWW DISSRPA+ K+ E
Sbjct  181  PAASVVNERPHVKAWWEDISSRPAFKKVAE  210



>ref|XP_009384404.1| PREDICTED: glutathione S-transferase 3-like [Musa acuminata subsp. 
malaccensis]
Length=215

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 141/208 (68%), Gaps = 2/208 (1%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KV+G  MST T+RV+A L EKG++F+ V +D+    HK+  FL+LNPFGQ+PA EDG
Sbjct  1    MGVKVYGMPMSTNTVRVLAALNEKGVEFELVIVDLRTGAHKKPDFLALNPFGQIPALEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCED--PKKMATASVWMEVENHHFDPAASALTWEL  603
            D+ LFESRAI +YIA   A  G  L+     P + A   +W+EVE+  F P  +AL +E 
Sbjct  61   DVVLFESRAINRYIATKYAEAGPDLLLSSGTPAERAVVDLWLEVESQQFGPPIAALVYEA  120

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
             IKP++G ATD T+VE    +L KVLDVYE RL +SKYL G  F+L DL+H+P  + LM 
Sbjct  121  LIKPMLGGATDVTVVEAQATKLEKVLDVYEARLAQSKYLAGAEFTLVDLNHIPYTNYLMK  180

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLK  339
            T   +L  SRP++ AWW D+SSRPAW K
Sbjct  181  TPKASLVTSRPHLLAWWQDVSSRPAWQK  208



>gb|AHA33630.1| glutathione S-transferase 6 protein [Brassica oleracea var. italica]
 emb|CDY18015.1| BnaC03g30870D [Brassica napus]
Length=213

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 141/211 (67%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            AIKV G+  S  TMRVV  L EK LDF+FV +D+    HK+E FL+ NPFGQVPAFEDGD
Sbjct  3    AIKVFGHPASAPTMRVVLALHEKNLDFEFVHVDLMGGEHKKEAFLARNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +   A  ++ M+VE H F+P A+ L  E 
Sbjct  63   LKLFESRAITQYIAHRYEGQGTNLLPADSKNIAHYAIMAIGMQVEAHQFEPVAAKLVSEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K   G+ TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P I  L+G
Sbjct  123  VFKLKKGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPTIKYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASQKILQ  213



>ref|XP_010522773.1| PREDICTED: glutathione S-transferase F4-like [Tarenaya hassleriana]
Length=248

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 145/207 (70%), Gaps = 4/207 (2%)
 Frame = -2

Query  947  KVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFL-SLNPFGQVPAFEDGDL  771
            KVHG+ +ST T RV+A L EKG+ ++ +++D+ +  HK+EPFL +LNPFGQ+P FEDG +
Sbjct  26   KVHGHPLSTNTRRVLATLYEKGIGYEAIEVDLKSGEHKKEPFLRNLNPFGQIPVFEDGQV  85

Query  770  ELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            +L ESRAITQYIAY  + +GN L+  +  + MAT ++WME+E   F+P ASALTWE  IK
Sbjct  86   KLIESRAITQYIAYVHSTRGNRLLNFQSHETMATLTMWMEIEAQSFNPLASALTWEQVIK  145

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRS--KYLGGDWFSLADLHHLPNIHCLMGT  420
            P   +  DE  V++N+ RL KVLDVYE RL  +  +YL  D F+LADLHHLPNI  L  T
Sbjct  146  PNYNLPRDEGAVKENESRLEKVLDVYERRLAETGYEYLACDSFTLADLHHLPNIEFLYLT  205

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLK  339
              + LF+ RP V+ W   I +RP+W +
Sbjct  206  PTRRLFEERPRVAQWVAKIRARPSWQR  232



>ref|XP_002263386.1| PREDICTED: glutathione S-transferase F13 [Vitis vinifera]
 emb|CBI32223.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 139/210 (66%), Gaps = 1/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+K+HG  MST T RV+ CL EKGLDF+ V +++ A  HKQ PFL+ NPFGQ+P  EDG
Sbjct  1    MALKLHGIPMSTCTTRVLTCLHEKGLDFELVPVNLFAGEHKQPPFLAKNPFGQIPVLEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT Y+A      G  L+   D K+ A   VW+EVE+  + PA   + ++  
Sbjct  61   DLTLFESRAITAYLAEKYKETGCDLLRHNDLKEAALVKVWLEVESQQYHPAIYQIVYQFF  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G   D+ I++ N E+L KVLDVYE RL  +K L GD++SLADLHHL   +  M T
Sbjct  121  VLPLQGKTADQAIIDVNLEKLGKVLDVYEARLGTTKCLAGDFYSLADLHHLSYTYYFMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
               +L  SRPNV AWW DISSRPA+ K+ E
Sbjct  181  PWASLINSRPNVKAWWEDISSRPAFKKVAE  210



>gb|KFK30855.1| hypothetical protein AALP_AA6G034000 [Arabis alpina]
Length=511

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 148/213 (69%), Gaps = 3/213 (1%)
 Frame = -2

Query  959  FMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFED  780
              +IKV+G+  S AT RV+  L EK LDF+ V I++    HK+EPFLS NPFG VPAFED
Sbjct  299  LTSIKVYGHAASIATRRVLLALHEKNLDFELVHIELKDGEHKKEPFLSRNPFGLVPAFED  358

Query  779  GDLELFESRAITQYIAYTCANKGNHLVCEDPKKMA---TASVWMEVENHHFDPAASALTW  609
            GDL+LFESRAITQYIA+   ++G +L+  + K +A   + ++ M+VE HHFDP+AS L W
Sbjct  359  GDLKLFESRAITQYIAHRYEDQGTNLLPTESKNIAHYASMAIGMQVEGHHFDPSASKLAW  418

Query  608  ELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCL  429
            E   K + G+ TD+ +VE+ +  L+KVLDVYE RL  +KYL GD F+L +LHH+P I  L
Sbjct  419  EQVFKNIYGLTTDQAVVEEEEANLAKVLDVYEYRLKETKYLAGDTFTLVELHHIPAIQYL  478

Query  428  MGTQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            + T  K LF  RP V+ W  +I++RPA  K+++
Sbjct  479  LTTPTKKLFTERPRVNEWVTEITNRPASEKILQ  511


 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 146/211 (69%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV+G+  STAT RV+  L EK LDF+ V +++    HK+EPFLS NPFGQVPAFEDGD
Sbjct  3    GIKVYGHAASTATRRVLLALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATAS---VWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYI +   ++G +L+  + K +A  +   + M+VE   FDP AS L WE 
Sbjct  63   LKLFESRAITQYITHRYEDQGTNLLPTESKNVAHCAHMAIGMQVEALQFDPPASKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +VE+ + +L+KVLDVYE RL  +KYL GD F+L +LHH+P I  L+G
Sbjct  123  VFKNIYGLTTDQAVVEEEEAKLAKVLDVYEYRLKETKYLAGDTFTLVELHHIPVIQYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I++RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVTEITNRPASQKILQ  213



>ref|NP_191835.1| glutathione S-transferase F13 [Arabidopsis thaliana]
 sp|Q9LZI9.1|GSTFD_ARATH RecName: Full=Glutathione S-transferase F13; Short=AtGSTF13; 
AltName: Full=GST class-phi member 13 [Arabidopsis thaliana]
 emb|CAB83126.1| Glutathione transferase III-like protein [Arabidopsis thaliana]
 gb|AEE80388.1| glutathione S-transferase F13 [Arabidopsis thaliana]
Length=219

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 142/208 (68%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+K++G++MS    RV+ CL EK  +F+ V +++ A HHK   FLS+NPFG+VPA +D 
Sbjct  1    MAMKLYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDD  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT YIA    +KG  L   EDPK+ A   +W EVE HHF+PA SA+  +L 
Sbjct  61   DLTLFESRAITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAVIHQLI  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G + +  IVE+N E L K+LDVYE RL ++KYL GD ++LADLHH+P  +  M T
Sbjct  121  VVPLQGESPNAAIVEENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKM  336
                L   RPNV AWW D+ SRPA+LK+
Sbjct  181  IHAGLINDRPNVKAWWEDLCSRPAFLKV  208



>gb|AAP58394.1| glutathione S-transferase 4 [Brassica juncea]
Length=213

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 141/211 (67%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  STAT RV+  L EK LDF+ V +++    HK+EPFLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHAASTATRRVLLTLHEKNLDFELVHVELKDGEHKKEPFLSRNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVW---MEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +A  ++    M+VE H FDP  S L WE 
Sbjct  63   LKLFESRAITQYIAHRYEGQGTNLLQGDSKNLAHYAIMALGMQVEAHQFDPLVSKLAWEH  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L+KVLDVYE RL   KYL G+ F+L DLHH+P I  L+ 
Sbjct  123  VFKLIYGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGNTFTLTDLHHIPAIQYLLE  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASQKILQ  213



>ref|XP_009150837.1| PREDICTED: glutathione S-transferase F4-like [Brassica rapa]
Length=243

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHG+  ST T RV+A L+EKGL ++ + +D+ +  HK E FLSLNPFGQVP FED 
Sbjct  23   IGYKVHGHPFSTNTRRVLAVLLEKGLLYEPITVDLKSGEHKSESFLSLNPFGQVPVFEDE  82

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++LFESRAITQYIAY  + +G  L+  E  + +AT ++WME+E H FDP AS LTWE  
Sbjct  83   NVKLFESRAITQYIAYLHSARGTQLLSLESEETLATLTMWMEIEAHQFDPFASRLTWEQV  142

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD T+V++N+  L +VL+VYE RL  S++L  + F+L DLHHLPNI  L+ T
Sbjct  143  IKPLYGLETDHTVVKENEAGLEQVLNVYEKRLGESRFLACNTFTLVDLHHLPNIQYLLET  202

Query  419  QIKTLFQSRPNVSAWWVDISSR  354
              K L ++RP V  W  +I+S+
Sbjct  203  PTKGLLENRPRVRMWVDEITSK  224



>ref|XP_002263424.1| PREDICTED: glutathione S-transferase F13 [Vitis vinifera]
 emb|CBI32222.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 138/210 (66%), Gaps = 1/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+K+HG  MST T RV+ CL EKGLDF+ V +++ A  HKQ PFL+ NPFGQ+P  EDG
Sbjct  1    MALKLHGIPMSTCTTRVLTCLHEKGLDFELVPVNLFAGEHKQPPFLAKNPFGQIPVLEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELG  600
            D  LFESRAIT Y+A      G  L+   D K+ A   VW+EVE+ H+ PA   + ++  
Sbjct  61   DFTLFESRAITAYLAEKYKETGCDLLRHNDLKEAALVKVWLEVESQHYYPAIYQIVYQFF  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
              P+ G   D+ I++ N E+L KVLDVYE RL  +K L GD++SLADLHHL   +  M T
Sbjct  121  ALPLQGKTADQAIIDVNLEKLGKVLDVYEARLGTTKCLAGDFYSLADLHHLSYTYYFMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
               +L  SRPNV AWW DISSRPA+ K+ E
Sbjct  181  PWASLINSRPNVKAWWDDISSRPAFKKVAE  210



>gb|KDP28123.1| hypothetical protein JCGZ_13894 [Jatropha curcas]
Length=217

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 140/210 (67%), Gaps = 1/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+K++G  MST+T  V+ CL EK +DF+F+ +D+ A  HKQ  F + NPFGQVP  EDG
Sbjct  1    MALKLYGAAMSTSTSLVLTCLHEKEVDFEFIPVDLFAGEHKQPHFGAKNPFGQVPVLEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDP-KKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT YI       G  L      ++ A   VW+EVE+  ++PA + + ++L 
Sbjct  61   DLTLFESRAITAYITEKYKEPGYDLTRHKKLEEAAMVKVWIEVESQRYNPAIAPIVYQLY  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G+A DE I++ N E+L KVLD+YE RL  SKYL GD+FSLADLHHLP  + LM T
Sbjct  121  VGPLKGVAPDEAIIDTNIEKLRKVLDIYEERLSCSKYLAGDFFSLADLHHLPYTYYLMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
               ++   RP V AWW DISSRPA+ K+ E
Sbjct  181  SAASVINERPRVKAWWDDISSRPAFKKVAE  210



>ref|XP_006305553.1| hypothetical protein CARUB_v10010097mg [Capsella rubella]
 gb|EOA38451.1| hypothetical protein CARUB_v10010097mg [Capsella rubella]
Length=251

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 140/205 (68%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHG+  ST T RV+A L EKGL +  + + + +  HK E FLSLNPFGQVP FE+ 
Sbjct  23   LGYKVHGDPFSTNTRRVLAVLHEKGLSYDPITVKLQSGEHKTEAFLSLNPFGQVPVFEER  82

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++L ESRAITQYIAY  + +G  L+  +  + MA  ++WME+E H FDP AS LTWE  
Sbjct  83   NVKLSESRAITQYIAYVHSPRGTQLLNLQSHETMAILTMWMEIEAHQFDPPASKLTWEQV  142

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD  +V++N+  L KVL+VYE RL  S++L    F+L DLHHLPNI  L+GT
Sbjct  143  IKPLYGLETDHKVVKENEAILEKVLNVYEKRLQESRFLACSSFTLVDLHHLPNIQYLLGT  202

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF++RP V  W  +I+SR AW
Sbjct  203  PTKRLFENRPKVHKWVDEITSREAW  227



>gb|AAP58396.1| glutathione S-transferase 6 [Brassica juncea]
 emb|CDX90933.1| BnaA03g26130D [Brassica napus]
Length=213

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 140/211 (66%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S  TMRV+  L EK LDF+FV +D+    HK+E FL+ NPFGQVPAFEDGD
Sbjct  3    GIKVFGHPASAPTMRVLLTLHEKNLDFEFVHVDLMGGEHKKEAFLARNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +   A  ++ M+VE H F+P A+ L  E 
Sbjct  63   LKLFESRAITQYIAHRYEGQGTNLLPADSKNIAHYAIMAIGMQVEAHQFEPVAAKLVSEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K   G+ TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P +  L+G
Sbjct  123  VFKLKKGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPTVKYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASQKILQ  213



>emb|CDX90934.1| BnaA03g26140D [Brassica napus]
Length=213

 Score =   215 bits (548),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 141/211 (67%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S +T RV+  L EK LDF+ V +D+    HK+E FLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHAASISTRRVLLTLHEKNLDFELVHVDLKDGEHKKESFLSHNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVW---MEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +A  ++    M+VE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAHRYEGQGTNLLQPDSKNLAQYAIMAMGMQVEAHQFDPLASKLAWEH  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P +  L+ 
Sbjct  123  VFKLIYGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPAVQYLLE  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP+V+ W  +I+ RPA  K+++
Sbjct  183  TPTKRLFTERPHVNKWVAEITKRPASQKILQ  213



>ref|XP_010457293.1| PREDICTED: glutathione S-transferase F4-like isoform X1 [Camelina 
sativa]
Length=244

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 141/205 (69%), Gaps = 1/205 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            +  KVHG+  ST T RV+A L EKGL ++ + + +    HK E FL+LNPFGQVP FED 
Sbjct  23   LGYKVHGDPFSTNTRRVLAVLHEKGLSYEPITVKLQTGEHKSEHFLALNPFGQVPVFEDR  82

Query  776  DLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPAASALTWELG  600
            +++L ESRAITQYIAY  + +G  L+  +  + MA  ++ ME+E H FDP AS LTWE  
Sbjct  83   NVKLSESRAITQYIAYVHSPRGTQLLNLQSHETMAILTMCMEIEAHQFDPPASKLTWEQV  142

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            IKP+ G+ TD T+V++N+  L KVL+VYE RL  S++L  + F+L DLHHLPNI  L+GT
Sbjct  143  IKPLYGLETDHTVVKENEANLEKVLNVYEKRLQESRFLACNSFTLVDLHHLPNIQYLLGT  202

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
              K LF++RP V  W  +I+SR AW
Sbjct  203  PTKRLFENRPKVHKWVDEITSREAW  227



>emb|CDX89147.1| BnaA04g00390D [Brassica napus]
Length=219

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 138/208 (66%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+KV+GN MS    RV+ CL EK  +F+ V +D+ A HHK   FLS+NPFGQVP  +D 
Sbjct  1    MAMKVYGNGMSVCVARVLLCLHEKETEFELVPVDLFACHHKLPSFLSMNPFGQVPVLQDD  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCE-DPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT YIA    +KG  L    D K+ A   +W EVE+HHF+PA SA+  +L 
Sbjct  61   DLTLFESRAITAYIAEKHKDKGTDLTRHADAKEAAIVKLWSEVESHHFNPAISAVIHQLI  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G   D  IVE+N E+L KVLDVYE +L ++KYL GD ++LADLHH+P  +  M T
Sbjct  121  VVPLQGKTPDAAIVEENLEKLGKVLDVYEEKLGKTKYLAGDSYTLADLHHVPYTYYFMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKM  336
                L   RP V AWW D+ SRPA+LK+
Sbjct  181  CHAGLVNDRPKVKAWWEDLCSRPAFLKV  208



>ref|XP_009134426.1| PREDICTED: glutathione S-transferase F3-like [Brassica rapa]
Length=213

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 139/211 (66%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S  TMRV+  L EK LDF+FV +D+    HK+E FL+ NPFGQVPAFEDGD
Sbjct  3    GIKVFGHPASAPTMRVLLTLHEKNLDFEFVHVDLMGGEHKKEAFLARNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKM---ATASVWMEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+    +G +L+  D K +   A  ++ M+VE H F+P A+ L  E 
Sbjct  63   LKLFESRAITQYIAHRYEGQGTNLLPADSKNIAHYAIMAIGMQVEAHQFEPVAAKLVSEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K   G+ TD+ +V + + +L KVLDVYE RL   KYL GD F+L DLHH+P +  L+G
Sbjct  123  VFKLKKGLTTDQAVVAEEEAKLDKVLDVYEARLKEFKYLAGDTFTLTDLHHIPTVKYLLG  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTERPRVNEWVAEITKRPASQKILQ  213



>ref|XP_009138718.1| PREDICTED: glutathione S-transferase F13 [Brassica rapa]
Length=219

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 138/208 (66%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            MA+KV+GN MS    RV+ CL EK  +F+ V +D+ A HHK   FLS+NPFGQVP  +D 
Sbjct  1    MAMKVYGNGMSVCVARVLLCLHEKETEFELVPVDLFACHHKLPSFLSMNPFGQVPVLQDD  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCE-DPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT YIA    +KG  L    D K+ A   +W EVE+HHF+PA SA+  +L 
Sbjct  61   DLTLFESRAITAYIAEKHKDKGTDLTRHADAKEAAIVKLWSEVESHHFNPAISAVIHQLI  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G   D  IVE+N E+L KVLDVYE +L ++KYL GD ++LADLHH+P  +  M T
Sbjct  121  VVPLQGKTPDAAIVEENLEKLGKVLDVYEEKLGKTKYLAGDSYTLADLHHVPYTYYFMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKM  336
                L   RP V AWW D+ SRPA+LK+
Sbjct  181  CHAGLVNDRPKVKAWWEDLCSRPAFLKV  208



>gb|KEH43227.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=167

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = -2

Query  815  LNPFGQVPAFEDGDLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHF  636
            + PFGQVPAFEDGDL+LFESRAITQYI +  A+KG  L   D KK+A   VW EVE+HHF
Sbjct  2    MQPFGQVPAFEDGDLKLFESRAITQYINHEYADKGTKLTSSDSKKLAIMGVWSEVESHHF  61

Query  635  DPAASALTWELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADL  456
            D  AS L WELGIK + G+  D  IVE+N+ +L  +LDVYE RL  SKY GGD F+L DL
Sbjct  62   DQVASKLVWELGIKTLFGIPLDPKIVEENEAKLDSILDVYEKRLSESKYFGGDSFTLVDL  121

Query  455  HHLPNIHCLMGTQIKTLFQSRPNVSAWWVDISSRPAW  345
            HHLP++H LM +Q K LF+SRP+VSAW  DI++RPAW
Sbjct  122  HHLPSLHYLMKSQSKKLFESRPHVSAWVADITARPAW  158



>ref|XP_010456018.1| PREDICTED: glutathione S-transferase F3 [Camelina sativa]
Length=213

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 140/211 (66%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  + +T RV+  L EK LDF+ V +++    HK+EPFLS NPFG VPAFEDGD
Sbjct  3    GIKVFGHAATISTRRVLIALHEKNLDFELVHVEIKDGEHKKEPFLSRNPFGLVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVW---MEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA+   N+G +L+  D K ++  ++    M+VE H FDP A+ L WE 
Sbjct  63   LKLFESRAITQYIAHKYENQGTNLLPADSKNVSQYAIMANGMQVEAHQFDPVATKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
             IK + G+ TD+ +V + + +L KVLD YE RL   KY+ GD F+L DLHH+P I  L+ 
Sbjct  123  VIKLIYGLTTDQAVVAEEEAKLDKVLDAYEARLKEFKYMAGDTFTLTDLHHIPVIQYLLE  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTKRPRVNEWVTEITKRPASQKVLQ  213



>emb|CDY18016.1| BnaC03g30880D [Brassica napus]
Length=213

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 141/211 (67%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S +T RV+  L EK LDF+ V +D+    HK+E FLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHAASISTRRVLLTLHEKNLDFELVHVDLKDGEHKKESFLSHNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVW---MEVENHHFDPAASALTWEL  603
            L++FESRAITQYIA+    +G +L+  D K +A  ++    M+VE H FDP AS L WE 
Sbjct  63   LKIFESRAITQYIAHRYEGQGTNLLQPDSKNLAHYAIMAMGMQVEAHQFDPLASKLAWEH  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P +  L+ 
Sbjct  123  VFKLIYGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPAVQYLLE  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP+V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTERPHVNKWVAEITKRPASQKILQ  213



>ref|XP_002878475.1| hypothetical protein ARALYDRAFT_486776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54734.1| hypothetical protein ARALYDRAFT_486776 [Arabidopsis lyrata subsp. 
lyrata]
Length=217

 Score =   213 bits (543),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 140/206 (68%), Gaps = 1/206 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            +KV+G++MS +  RV+ CL EK  +F+ V +++ A HHK   FLS+NPFGQVPA +D DL
Sbjct  1    MKVYGDEMSASVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGQVPALQDDDL  60

Query  770  ELFESRAITQYIAYTCANKGNHLVC-EDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             LFESRAIT YIA    +KG  L   E+ K+ A   +W EVE HHF+PA  A+  +L + 
Sbjct  61   TLFESRAITAYIAEKHRDKGTDLTRHENSKEAAIVKLWSEVEAHHFNPAIFAVIHQLIVV  120

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ G + D  IVE+N E+L KVLDVYE RL ++KYL GD ++LADLHH+P  +  M T  
Sbjct  121  PLQGESPDAAIVEKNLEKLGKVLDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKTSH  180

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKM  336
              L   RPNV AWW D+ SRPA+LK+
Sbjct  181  AGLINDRPNVKAWWEDLCSRPAFLKV  206



>ref|XP_010904820.1| PREDICTED: probable glutathione S-transferase GSTF1 [Elaeis guineensis]
Length=216

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 141/207 (68%), Gaps = 1/207 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KV+G  MST T RV++ L E G +++ V ID  A  HKQ P L+ NPFGQVPAFEDG
Sbjct  1    MGVKVYGPPMSTCTARVISTLEEMGAEYEVVPIDFEAGEHKQPPHLARNPFGQVPAFEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCE-DPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAI +Y+A    + G  L+ E + ++ A   +W+EVE+  ++PA + + ++  
Sbjct  61   DLMLFESRAIARYVARKYKSSGPDLLREGNLQESAMVDLWLEVESQQYNPAIAPIVYQCL  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G   D+ +++ N E+L KVLDVYE+ L ++KYL GD+FSLADL HLP  H  M T
Sbjct  121  VIPMRGGVADQKLIDANVEKLGKVLDVYEDHLSKTKYLAGDFFSLADLSHLPYTHYFMAT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLK  339
               +LF+SRP+V AWW D+SSRPA  K
Sbjct  181  PYASLFESRPHVQAWWQDLSSRPAVRK  207



>gb|KCW58510.1| hypothetical protein EUGRSUZ_H01183 [Eucalyptus grandis]
Length=239

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 145/232 (63%), Gaps = 38/232 (16%)
 Frame = -2

Query  914  MRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDLELFESRAITQYI  735
            MR +A L EKGL FQ V +D+GA  HK+E FL+LNPFGQVPAFEDGDL+LFESRAITQYI
Sbjct  2    MRALAALHEKGLAFQLVPVDVGAGEHKKERFLALNPFGQVPAFEDGDLKLFESRAITQYI  61

Query  734  AYTCANKGNHLVCE---------------DPKKM-----------------------ATA  669
            A    + G  L+ E               +P+ M                       AT 
Sbjct  62   ARKYPDMGTPLILESKPTVKVSAWMEFEVNPETMESNVQWELLPDRAADAAVIENTMATV  121

Query  668  SVWMEVENHHFDPAASALTWELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKY  489
            ++W+EVE H FDP AS L  EL  + +IGMA D  +  +N  RL+++LD+YE +L +SKY
Sbjct  122  NMWIEVEAHQFDPVASRLQRELVYRQMIGMAPDTAVFGENWTRLTELLDIYEAQLSQSKY  181

Query  488  LGGDWFSLADLHHLPNIHCLMGTQIKTLFQSRPNVSAWWVDISSRPAWLKMV  333
            LG D+F+LADLHHLP +  LMGT  K LF +RP VSAW  +I +RPAW+K++
Sbjct  182  LGCDFFTLADLHHLPALTNLMGTPAKALFDARPKVSAWVANIMARPAWVKVL  233



>ref|XP_009134427.1| PREDICTED: glutathione S-transferase F2-like [Brassica rapa]
Length=213

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 139/211 (66%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  S +T RV+  L EK LDF+ V +D+    HK E FLS NPFG+VPAFEDGD
Sbjct  3    GIKVFGHAASISTRRVLLTLHEKNLDFELVHVDLKDGEHKTESFLSHNPFGKVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVW---MEVENHHFDPAASALTWEL  603
            L+LFESRAITQYIA     +G +L+  D K +A  ++    M+VE H FDP AS L WE 
Sbjct  63   LKLFESRAITQYIAPRYEGQGTNLLQPDSKNLAQYAIMAMGMQVEAHQFDPLASKLAWEH  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L+KVLDVYE RL   KYL GD F+L DLHH+P +  L+ 
Sbjct  123  VFKLIYGLTTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGDTFTLTDLHHIPAVQYLLE  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF  RP+V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTERPHVNKWVAEITKRPASQKILQ  213



>ref|XP_008789932.1| PREDICTED: glutathione S-transferase 3 [Phoenix dactylifera]
Length=215

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 138/208 (66%), Gaps = 2/208 (1%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KV+G  +ST T+RVVA L EKGL+++ V ID+    HKQ  FL+LNPFGQ+P  ED 
Sbjct  1    MGLKVYGLPLSTNTVRVVAALNEKGLEYELVPIDLRTGAHKQPSFLALNPFGQIPVLEDE  60

Query  776  DLELFESRAITQYIAYTCANKGNHLV--CEDPKKMATASVWMEVENHHFDPAASALTWEL  603
            D+ LFESRAI +YI   C   G  L+      K+ A   VW+EVE+ HF P  + L +E+
Sbjct  61   DIVLFESRAINRYIVSKCKETGPDLLRSGAGAKETAALEVWLEVESQHFGPPIADLVFEI  120

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
             IKP+ G ATD   VE++ E+L KVLDVYE  L ++KYL G  F+LADL+H+P  H LM 
Sbjct  121  LIKPLFGGATDPATVEKHAEKLGKVLDVYEAHLSKNKYLAGGEFTLADLNHMPYTHYLMK  180

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLK  339
            T    L  +RP+V AWW ++S+RPAW K
Sbjct  181  TPKADLVTARPHVLAWWQEVSARPAWKK  208



>emb|CDX93963.1| BnaC04g21220D [Brassica napus]
Length=219

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 137/208 (66%), Gaps = 1/208 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KV+G+ MS    RV+ CL EK  +F+ V +D+ + HHK   FLS+NPFGQVP  +D 
Sbjct  1    MVMKVYGDGMSACVARVLLCLHEKETEFELVPVDLFSCHHKLPSFLSMNPFGQVPVLQDE  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCE-DPKKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT YIA    +KG  L    D K+ A   +W EVE+HHF PA SA+  +L 
Sbjct  61   DLTLFESRAITAYIAEKHKDKGTDLTRHADAKEAAIVKLWSEVESHHFSPAISAVIHQLI  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            + P+ G   D  IVE+N E+L KVLDVYE +L ++KYL GD ++LADLHH+P  +  M T
Sbjct  121  VVPLQGKTPDAAIVEENLEKLGKVLDVYEEKLGKTKYLAGDSYTLADLHHVPYTYYFMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKM  336
                L   RPNV AWW D+ SRPA+LK+
Sbjct  181  GHAGLVNDRPNVKAWWEDLCSRPAFLKV  208



>gb|AFK38141.1| unknown [Medicago truncatula]
Length=186

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKVHG+ +STATM V A L EK L+F+FV I+M    HK+ PF+SLNPFGQVPAFEDGD
Sbjct  3    TIKVHGSPISTATMLVTATLYEKELEFEFVSINMRNGEHKKGPFISLNPFGQVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWELGIK  594
            L+LFESRAITQYI +  A+KG  L   D KKMA  SVW EVE+ H+D  AS L WELGIK
Sbjct  63   LKLFESRAITQYIDHEYADKGTKLTSSDSKKMAIMSVWSEVESLHYDQVASILVWELGIK  122

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLAD  459
             + G+  D  +VE+N+ +L  +LDVYE RL +SKYLGGD F+L D
Sbjct  123  TLFGIPLDSNVVEENEAKLDIILDVYEKRLSKSKYLGGDSFTLVD  167



>ref|XP_007050850.1| Glutathione S-transferase 7, putative isoform 1 [Theobroma cacao]
 gb|EOX95007.1| Glutathione S-transferase 7, putative isoform 1 [Theobroma cacao]
Length=216

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 146/215 (68%), Gaps = 2/215 (1%)
 Frame = -2

Query  956  MAIK-VHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFED  780
            MA+K V+G     ATMRV+A ++E GLDF+F+ +D+ A  H +E FLSL+PFGQVP F+D
Sbjct  1    MAVKKVYGTPACPATMRVLASMLEHGLDFEFIYVDLKAGDHMKESFLSLSPFGQVPVFQD  60

Query  779  G-DLELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVWMEVENHHFDPAASALTWEL  603
              DL LFESRAI ++I++     G   V E PK+    + W++VE+H FDP AS L  EL
Sbjct  61   DQDLTLFESRAIMRFISHHYPKPGKEQVYEAPKEQGIVAAWIDVEDHQFDPPASKLRTEL  120

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              KP+ GM+ D+ +V + +  L++VLDVYE RL  SKYLGGD F+ ADL HLPN++ LM 
Sbjct  121  LEKPLNGMSADKQVVAEAEANLARVLDVYEERLKDSKYLGGDKFTSADLTHLPNLYYLMK  180

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVEWLKE  318
            T +K LF  R  VS W  D+ +R AW K+V+ +++
Sbjct  181  TPVKRLFDERARVSGWCRDLLARSAWAKVVDMVEK  215



>ref|XP_006444271.1| hypothetical protein CICLE_v10022160mg [Citrus clementina]
 gb|ESR57511.1| hypothetical protein CICLE_v10022160mg [Citrus clementina]
Length=219

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 139/210 (66%), Gaps = 1/210 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IK++G  +ST T RV+ CL EK +DF  V +D+ +  HKQ PFL+ NPFGQ+P  EDGDL
Sbjct  5    IKLYGAPVSTCTARVMTCLHEKAVDFALVPVDLFSCEHKQPPFLAKNPFGQIPVLEDGDL  64

Query  770  ELFESRAITQYIAYTCANKGNHLVCE-DPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             LFESRA+T Y+A      G  L+   D K+ A   VW+EVE+  F PA + + +E  + 
Sbjct  65   TLFESRAMTAYVAEKFKEAGTDLIRHHDLKEAALVKVWIEVESQQFHPAIAPIVYEYFVA  124

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ G + D+ +++ N E+LSKVLDVYE +L  +KYL GD++SLADLHHLP  +  M T  
Sbjct  125  PIQGKSPDQGVIDANLEKLSKVLDVYEAKLSSAKYLAGDFYSLADLHHLPYTYYFMKTPC  184

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMVEWL  324
             ++   R +V AWW DISSRPA+ K+ E +
Sbjct  185  ASIISERAHVKAWWEDISSRPAFKKVSEGM  214



>gb|ACT82511.1| glutathione S-transferase [Arachis hypogaea]
Length=218

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 138/205 (67%), Gaps = 2/205 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
            A+KV+G  +STA  RV+ACL+EK + F+ + +DM    HK+  FLSL PFGQVP F+DG+
Sbjct  3    AVKVYGPTLSTAVSRVLACLIEKDVQFEVIPVDMSKGEHKRPEFLSLQPFGQVPVFQDGN  62

Query  773  LELFESRAITQYIAYTCANKGNH-LVCEDPKKMATASVWMEVENHHFDPAASALTWELGI  597
            + LFESRAI +Y+    A +GN  L   DP   A+   W+E E   F+P +SAL ++L  
Sbjct  63   ISLFESRAICRYVCEKYAERGNKGLYGTDPLAKASIDQWVEAEGQSFNPPSSALVFQLAF  122

Query  596  KPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLM-GT  420
             P + +  D+ ++ QN+E+L+KVLDVYE RL ++++L GD FSLADL HLPN H L+ GT
Sbjct  123  APRMKLKQDQGVIRQNEEKLAKVLDVYEKRLSQTRFLAGDDFSLADLSHLPNAHYLVTGT  182

Query  419  QIKTLFQSRPNVSAWWVDISSRPAW  345
                LF  R NVS WW DIS+R +W
Sbjct  183  DRAPLFTQRDNVSRWWNDISTRQSW  207



>ref|XP_010429797.1| PREDICTED: glutathione S-transferase F3-like [Camelina sativa]
Length=213

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 139/211 (66%), Gaps = 3/211 (1%)
 Frame = -2

Query  953  AIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGD  774
             IKV G+  +T+T RV+  L EK LDF+ V +++    HK+EPFLS NPFG VPAFEDGD
Sbjct  3    GIKVFGHAATTSTRRVLIALHEKNLDFELVHVEIKDGEHKKEPFLSRNPFGLVPAFEDGD  62

Query  773  LELFESRAITQYIAYTCANKGNHLVCEDPKKMATASVW---MEVENHHFDPAASALTWEL  603
            L+LFESRAITQY+A+   N+G +L+  D K ++  ++    M+VE H FDP A+ L WE 
Sbjct  63   LKLFESRAITQYVAHKYENQGTNLLPADSKNVSQYAIMANGMQVEAHQFDPVATKLAWEQ  122

Query  602  GIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMG  423
              K + G+ TD+ +V + + +L KVLD YE RL   KY+ GD F+L DLHH+P I  L+ 
Sbjct  123  VFKLIYGLTTDQAVVAEEEAKLDKVLDAYEARLKEFKYMAGDTFTLTDLHHIPVIQYLLE  182

Query  422  TQIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
            T  K LF   P V+ W  +I+ RPA  K+++
Sbjct  183  TPTKKLFTKHPRVNEWVTEITKRPASQKVLQ  213



>ref|XP_008373435.1| PREDICTED: glutathione S-transferase F13-like [Malus domestica]
Length=217

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 137/210 (65%), Gaps = 1/210 (0%)
 Frame = -2

Query  956  MAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDG  777
            M +KVHG  +ST T RV+  L EKGLDF+ V +++ A  HKQ PFL+ NPFGQ+P  EDG
Sbjct  1    MGVKVHGVAVSTCTSRVLTILHEKGLDFELVPVNLLAGEHKQPPFLAKNPFGQIPVLEDG  60

Query  776  DLELFESRAITQYIAYTCANKGNHLVCEDP-KKMATASVWMEVENHHFDPAASALTWELG  600
            DL LFESRAIT Y+A      G  L+  +   + A   VW EVE+  F PA S + ++  
Sbjct  61   DLTLFESRAITAYVAEKFKENGVDLIRHNNLNEAALVKVWTEVESQSFHPAISPIVFQHI  120

Query  599  IKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGT  420
            I P+ G   D+ +++ N E+L+KVLDVYE RL  +KYL GD++SLADLHHL   +  M T
Sbjct  121  IVPMRGQTPDQAVIDANLEKLAKVLDVYEXRLSSTKYLAGDFYSLADLHHLSYTYYFMKT  180

Query  419  QIKTLFQSRPNVSAWWVDISSRPAWLKMVE  330
               +L   RP+V AWW DISSRPA+ K+ E
Sbjct  181  PGASLVNERPHVKAWWEDISSRPAFKKVAE  210



>gb|KDO87318.1| hypothetical protein CISIN_1g036627mg [Citrus sinensis]
Length=219

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 139/210 (66%), Gaps = 1/210 (0%)
 Frame = -2

Query  950  IKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPFGQVPAFEDGDL  771
            IK++G  +ST T RV+ CL EK +DF  V +D+ +  HKQ PFL+ NPFGQ+P  EDGDL
Sbjct  5    IKLYGAPVSTCTARVMTCLHEKAVDFALVPVDLFSCEHKQPPFLAKNPFGQIPVLEDGDL  64

Query  770  ELFESRAITQYIAYTCANKGNHLVCE-DPKKMATASVWMEVENHHFDPAASALTWELGIK  594
             LFESRA+T Y+A      G  L+   D K+ A   VW+EVE+  F PA + + +E  + 
Sbjct  65   TLFESRAMTAYVAEKFKEAGTDLIRHHDLKEAALVKVWIEVESQQFHPAIAPIVYEYFVA  124

Query  593  PVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHLPNIHCLMGTQI  414
            P+ G + D+ +++ N E+LSKVLDVYE +L  +KYL GD++SLADLHHLP  +  M T  
Sbjct  125  PIQGKSPDQGVIDANLEKLSKVLDVYEAKLSSAKYLAGDFYSLADLHHLPYTYYFMKTPC  184

Query  413  KTLFQSRPNVSAWWVDISSRPAWLKMVEWL  324
             ++   R +V AWW DISSRPA+ K+ E +
Sbjct  185  ASIISERAHVKAWWEDISSRPAFNKVSEGM  214



>ref|XP_007050848.1| Phi class glutathione transferase GSTF3 [Theobroma cacao]
 gb|EOX95005.1| Phi class glutathione transferase GSTF3 [Theobroma cacao]
Length=277

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 146/217 (67%), Gaps = 1/217 (0%)
 Frame = -2

Query  983  SIIVSQHIFMAIKVHGNKMSTATMRVVACLMEKGLDFQFVDIDMGADHHKQEPFLSLNPF  804
            S+ +S  I MA+K++G  MST T RV+ CL EK  DF+F+ +++ A  HK+ PFL+ NPF
Sbjct  50   SLKLSNLIEMALKLYGAAMSTCTSRVLTCLHEKEADFEFISVNLFAGEHKESPFLAKNPF  109

Query  803  GQVPAFEDGDLELFESRAITQYIAYTCANKGNHLV-CEDPKKMATASVWMEVENHHFDPA  627
            GQ+P  EDGDL LFESRAI+ Y+A      G  L+  ++ K+ A   VWMEVE+  + PA
Sbjct  110  GQIPVLEDGDLTLFESRAISAYVAEKFKESGYDLIRYQNVKEGAQVKVWMEVESQQYHPA  169

Query  626  ASALTWELGIKPVIGMATDETIVEQNKERLSKVLDVYENRLIRSKYLGGDWFSLADLHHL  447
             S + ++  + P+ G + ++ I++++ E+L KVLD+YE++L R+KYL GD++SLADL HL
Sbjct  170  ISPIVFQFFVAPLQGKSPEQAIIDEHLEKLGKVLDIYEDKLSRTKYLAGDFYSLADLFHL  229

Query  446  PNIHCLMGTQIKTLFQSRPNVSAWWVDISSRPAWLKM  336
               +  M T        RP+V AWW DISSRPA+LK+
Sbjct  230  SYTYYFMKTPWANQINDRPHVKAWWEDISSRPAFLKV  266



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2230116990256