BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c36545_g1_i1 len=118 path=[96:0-117]

Length=118
                                                                      Score     E

ref|WP_032489153.1|  truncated YiaK protein                           84.7    5e-20   
gb|KDY67373.1|  malate/L-lactate dehydrogenase family protein         84.7    6e-20   
gb|KIH08564.1|  2,3-diketo-L-gulonate reductase                       86.3    1e-19   
gb|EFW53106.1|  3-dehydro-L-gulonate 2-dehydrogenase                  86.7    1e-19   
ref|WP_032334019.1|  2,3-diketo-L-gulonate reductase                  86.3    1e-19   
gb|EMW92161.1|  malate/L-lactate dehydrogenase family protein         85.5    2e-19   
ref|WP_023566248.1|  2,3-diketo-L-gulonate reductase                  86.7    2e-19   
gb|EGI90235.1|  malate/L-lactate dehydrogenase family protein         86.7    2e-19   
emb|CDL24865.1|  3-dehydro-L-gulonate 2-dehydrogenase                 86.7    3e-19   
gb|EYD80852.1|  malate/L-lactate dehydrogenase family protein         84.0    3e-19   
ref|WP_000869029.1|  2,3-diketo-L-gulonate reductase                  86.7    4e-19   
ref|WP_024232773.1|  2,3-diketo-L-gulonate reductase                  86.7    4e-19   
ref|WP_023277684.1|  2,3-diketo-L-gulonate reductase                  86.7    4e-19   
ref|WP_001455471.1|  2,3-diketo-L-gulonate reductase                  86.7    4e-19   
ref|WP_001712935.1|  2,3-diketo-L-gulonate reductase                  86.7    4e-19   
ref|WP_001388653.1|  2,3-diketo-L-gulonate reductase                  86.7    4e-19   
ref|WP_029305680.1|  2,3-diketo-L-gulonate reductase                  86.7    4e-19   
ref|WP_032284227.1|  2,3-diketo-L-gulonate reductase                  86.7    4e-19   
ref|WP_016246404.1|  2,3-diketo-L-gulonate reductase                  86.7    4e-19   
ref|WP_032302148.1|  2,3-diketo-L-gulonate reductase                  86.3    4e-19   
ref|WP_032198825.1|  2,3-diketo-L-gulonate reductase                  86.3    4e-19   
ref|WP_024238623.1|  2,3-diketo-L-gulonate reductase                  86.3    4e-19   
ref|WP_021523291.1|  2,3-diketo-L-gulonate reductase                  86.3    4e-19   
ref|WP_001753186.1|  2,3-diketo-L-gulonate reductase                  86.3    4e-19   
ref|WP_000869048.1|  2,3-diketo-L-gulonate reductase                  86.3    4e-19   
ref|WP_001316724.1|  2,3-diketo-L-gulonate reductase                  86.7    5e-19   
ref|WP_001611122.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869028.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    86.3    5e-19   
ref|WP_000869023.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
gb|KHH89371.1|  2,3-diketo-L-gulonate reductase                       86.3    5e-19   
ref|WP_001710893.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
gb|AAB18552.1|  unnamed protein product                               86.3    5e-19   Escherichia coli K-12
ref|WP_033557507.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
gb|KFH98186.1|  2,3-diketo-L-gulonate reductase                       86.3    5e-19   
ref|WP_032343651.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869050.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_038346849.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869030.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_024240361.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_023156458.1|  3-dehydro-L-gulonate 2-dehydrogenase             86.3    5e-19   
ref|WP_001669978.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_001588199.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869047.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_032279124.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_032319004.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_024009384.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_021570303.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869043.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869024.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869025.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
gb|KFH95574.1|  2,3-diketo-L-gulonate reductase                       86.3    5e-19   
ref|WP_032182262.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_021571471.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_020219130.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869039.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    86.3    5e-19   
gb|KFH90388.1|  2,3-diketo-L-gulonate reductase                       86.3    5e-19   
ref|WP_000869042.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    86.3    5e-19   
ref|WP_000869044.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_001742386.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    86.3    5e-19   
ref|WP_000869026.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869049.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869037.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductas...  86.3    5e-19   
ref|WP_001593529.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_039020894.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_001573022.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_001480802.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869032.1|  2,3-diketo-L-gulonate reductase                  86.3    5e-19   
ref|WP_000869038.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
gb|KFH78887.1|  2,3-diketo-L-gulonate reductase                       86.3    6e-19   
ref|WP_032240859.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_000869035.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    86.3    6e-19   
ref|WP_000869015.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    86.3    6e-19   
ref|WP_032233816.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_001724044.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_000869034.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_000869045.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
gb|EGB61409.1|  malate/L-lactate dehydrogenase                        86.3    6e-19   
ref|WP_001560093.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_033802940.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_029403569.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_000869036.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_024046337.1|  hypothetical protein                             86.3    6e-19   
ref|WP_023063767.1|  3-dehydro-L-gulonate 2-dehydrogenase             86.3    6e-19   
ref|WP_021559573.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_001567101.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_001503070.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_001526420.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_001774637.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_000869041.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_001399489.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_001433848.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_000869022.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    86.3    6e-19   
ref|WP_000869046.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
gb|KFH83696.1|  2,3-diketo-L-gulonate reductase                       86.3    6e-19   
ref|WP_032185411.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_000869020.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    86.3    6e-19   
ref|WP_000869058.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    86.3    6e-19   
ref|WP_020235684.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_000869040.1|  2,3-diketo-L-gulonate reductase                  86.3    6e-19   
ref|WP_016160049.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    85.9    6e-19   
ref|WP_001493492.1|  2,3-diketo-L-gulonate reductase                  85.9    6e-19   
ref|WP_021549997.1|  2,3-diketo-L-gulonate reductase                  85.9    7e-19   
gb|ESA79020.1|  3-dehydro-L-gulonate 2-dehydrogenase                  86.3    7e-19   
ref|WP_000869033.1|  2,3-diketo-L-gulonate reductase                  85.9    7e-19   
ref|WP_001706630.1|  2,3-diketo-L-gulonate reductase                  85.9    7e-19   
ref|WP_020231430.1|  2,3-diketo-L-gulonate reductase                  85.9    7e-19   
ref|WP_000869021.1|  lactate dehydrogenase                            85.9    7e-19   
ref|WP_032358804.1|  2,3-diketo-L-gulonate reductase                  85.9    7e-19   
ref|WP_038355711.1|  2,3-diketo-L-gulonate reductase                  85.5    1e-18   
ref|WP_000869055.1|  2,3-diketo-L-gulonate reductase                  85.5    1e-18   
ref|WP_000869057.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    85.5    1e-18   
ref|WP_032202711.1|  2,3-diketo-L-gulonate reductase                  85.1    1e-18   
ref|WP_024248328.1|  2,3-diketo-L-gulonate reductase                  85.1    1e-18   
ref|WP_000869017.1|  2,3-diketo-L-gulonate reductase                  85.1    1e-18   
gb|AHE60243.1|  2,3-diketo-L-gulonate reductase                       85.1    1e-18   
ref|WP_000869054.1|  2,3-diketo-L-gulonate reductase                  85.1    1e-18   
ref|WP_001540049.1|  2,3-diketo-L-gulonate reductase                  85.1    1e-18   
ref|WP_000869018.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    85.1    1e-18   
ref|WP_000869019.1|  2,3-diketo-L-gulonate reductase                  85.1    2e-18   
ref|WP_001514035.1|  2,3-diketo-L-gulonate reductase                  84.7    2e-18   
ref|WP_021534799.1|  2,3-diketo-L-gulonate reductase                  84.7    2e-18   
ref|WP_001597107.1|  2,3-diketo-L-gulonate reductase                  84.7    2e-18   
ref|WP_001469493.1|  2,3-diketo-L-gulonate reductase                  84.7    2e-18   
ref|WP_001647710.1|  2,3-diketo-L-gulonate reductase                  84.7    2e-18   
ref|WP_001645930.1|  2,3-diketo-L-gulonate reductase                  84.7    2e-18   
ref|WP_032230280.1|  2,3-diketo-L-gulonate reductase                  84.7    2e-18   
ref|WP_001642356.1|  2,3-diketo-L-gulonate reductase                  84.7    2e-18   
ref|WP_001765170.1|  2,3-diketo-L-gulonate reductase                  84.3    2e-18   
ref|WP_001553593.1|  2,3-diketo-L-gulonate reductase                  84.3    2e-18   
ref|WP_000869051.1|  2,3-diketo-L-gulonate reductase                  84.3    2e-18   
ref|WP_021548268.1|  2,3-diketo-L-gulonate reductase                  84.3    2e-18   
ref|WP_032343217.1|  2,3-diketo-L-gulonate reductase                  84.3    3e-18   
ref|WP_000869059.1|  2,3-diketo-L-gulonate reductase                  84.0    3e-18   
gb|KHJ14344.1|  2,3-diketo-L-gulonate reductase                       84.0    3e-18   
ref|WP_032207353.1|  2,3-diketo-L-gulonate reductase                  84.0    3e-18   
ref|WP_000869060.1|  2,3-diketo-L-gulonate reductase                  84.0    4e-18   
ref|WP_000869016.1|  2,3-diketo-L-gulonate reductase                  83.6    5e-18   
ref|WP_016235390.1|  2,3-diketo-L-gulonate reductase                  83.6    5e-18   
ref|WP_001545006.1|  2,3-diketo-L-gulonate reductase                  83.6    5e-18   
ref|WP_023351622.1|  2,3-diketo-L-gulonate reductase                  83.6    6e-18   
ref|WP_016233635.1|  2,3-diketo-L-gulonate reductase                  83.2    7e-18   
pdb|1S20|A  Chain A, A Novel Nad Binding Protein Revealed By The ...  82.8    9e-18   
pdb|1NXU|A  Chain A, Crystal Structure Of E. Coli Hypothetical Ox...  82.8    1e-17   
ref|WP_039080160.1|  2,3-diketo-L-gulonate reductase                  80.1    1e-16   
ref|WP_002954688.1|  2,3-diketo-L-gulonate reductase                  80.1    1e-16   
ref|WP_039031159.1|  2,3-diketo-L-gulonate reductase                  79.7    1e-16   
ref|WP_023186094.1|  2,3-diketo-L-gulonate reductase                  79.7    1e-16   
ref|WP_000868495.1|  2,3-diketo-L-gulonate reductase                  79.7    1e-16   
ref|WP_000869053.1|  2,3-diketo-L-gulonate reductase                  79.7    1e-16   
ref|WP_004868847.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    79.7    1e-16   
gb|KGZ15878.1|  2,3-diketo-L-gulonate reductase                       79.7    1e-16   
ref|WP_023247335.1|  2,3-diketo-L-gulonate reductase                  79.7    1e-16   
ref|WP_000868494.1|  2,3-diketo-L-gulonate reductase                  79.7    1e-16   
ref|WP_024359745.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    79.3    2e-16   
ref|WP_014227214.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    79.3    2e-16   
ref|WP_013094954.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    79.3    2e-16   
ref|WP_038635224.1|  2,3-diketo-L-gulonate reductase                  79.3    2e-16   
emb|CEJ64783.1|  3-dehydro-L-gulonate 2-dehydrogenase                 79.3    2e-16   
ref|WP_014839766.1|  2,3-diketo-L-gulonate reductase                  79.3    2e-16   
gb|EIQ80579.1|  2,3-diketo-L-gulonate reductase                       79.3    2e-16   
ref|WP_036116652.1|  2,3-diketo-L-gulonate reductase                  79.0    2e-16   
ref|WP_032664684.1|  2,3-diketo-L-gulonate reductase                  79.0    3e-16   
ref|WP_004137795.1|  2,3-diketo-L-gulonate reductase                  79.0    3e-16   
ref|WP_010436730.1|  2,3-diketo-L-gulonate reductase                  79.0    3e-16   
gb|KHQ31930.1|  2,3-diketo-L-gulonate reductase                       79.0    3e-16   
ref|WP_025910535.1|  2,3-diketo-L-gulonate reductase                  79.0    3e-16   
ref|WP_032643755.1|  2,3-diketo-L-gulonate reductase                  79.0    3e-16   
ref|WP_021242451.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    79.0    3e-16   
ref|WP_028015849.1|  2,3-diketo-L-gulonate reductase                  79.0    3e-16   
ref|WP_023334065.1|  2,3-diketo-L-gulonate reductase                  79.0    3e-16   
ref|WP_012135714.1|  2,3-diketo-L-gulonate reductase                  79.0    3e-16   
emb|CDZ86408.1|  2,3-diketo-L-gulonate reductase                      79.0    3e-16   
ref|WP_014068405.1|  2,3-diketo-L-gulonate reductase                  78.6    3e-16   
ref|WP_038252722.1|  2,3-diketo-L-gulonate reductase                  78.6    3e-16   
dbj|GAL46157.1|  2,3-diketo-L-gulonate reductase                      78.6    4e-16   
gb|KDF08086.1|  2,3-diketo-L-gulonate reductase                       78.6    4e-16   
ref|WP_024909055.1|  2,3-diketo-L-gulonate reductase                  78.6    4e-16   
ref|WP_006687562.1|  2,3-diketo-L-gulonate reductase                  78.6    4e-16   
ref|WP_016154935.1|  2,3-diketo-L-gulonate reductase                  78.6    4e-16   
ref|WP_003827358.1|  2,3-diketo-L-gulonate reductase                  78.6    4e-16   
ref|WP_003024235.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    78.2    4e-16   
ref|WP_000869052.1|  2,3-diketo-L-gulonate reductase                  78.2    5e-16   
ref|WP_032650785.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    78.2    5e-16   
ref|WP_014830199.1|  2,3-diketo-L-gulonate reductase                  78.2    5e-16   
ref|WP_032950498.1|  2,3-diketo-L-gulonate reductase                  78.2    5e-16   
emb|CEL83979.1|  2,3-diketo-L-gulonate dehydrogenase, NADH-dependent  78.2    6e-16   
gb|KHE27375.1|  2,3-diketo-L-gulonate reductase                       77.8    6e-16   
ref|WP_039102635.1|  2,3-diketo-L-gulonate reductase                  77.8    6e-16   
ref|WP_012540326.1|  2,3-diketo-L-gulonate reductase                  77.8    6e-16   
ref|WP_032679989.1|  2,3-diketo-L-gulonate reductase                  77.8    6e-16   
ref|WP_014168108.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    77.8    7e-16   
gb|KIF87225.1|  2,3-diketo-L-gulonate reductase                       77.8    7e-16   
ref|WP_032668999.1|  2,3-diketo-L-gulonate reductase                  77.4    8e-16   
ref|WP_015572752.1|  MULTISPECIES: Malate/L-lactate dehydrogenases    77.4    8e-16   
ref|WP_023621210.1|  2,3-diketo-L-gulonate reductase                  77.4    8e-16   
ref|WP_023298858.1|  2,3-diketo-L-gulonate reductase                  77.4    8e-16   
ref|XP_004151197.1|  PREDICTED: 2,3-diketo-L-gulonate reductase-like  77.4    8e-16   
ref|WP_022652028.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    77.4    8e-16   
ref|WP_038416903.1|  2,3-diketo-L-gulonate reductase                  77.4    9e-16   
ref|WP_032649824.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    77.4    9e-16   
gb|KHG56456.1|  3-dehydro-L-gulonate 2-dehydrogenase                  77.4    9e-16   
ref|WP_025758389.1|  2,3-diketo-L-gulonate reductase                  77.4    1e-15   
ref|WP_028018243.1|  2,3-diketo-L-gulonate reductase                  77.4    1e-15   
gb|EUM06905.1|  2,3-diketo-L-gulonate reductase                       77.4    1e-15   
ref|WP_007373801.1|  2,3-diketo-L-gulonate reductase                  77.4    1e-15   
ref|WP_035893133.1|  2,3-diketo-L-gulonate reductase                  77.4    1e-15   
emb|CDL39516.1|  3-dehydro-L-gulonate 2-dehydrogenase                 76.3    1e-15   
ref|WP_032644462.1|  2,3-diketo-L-gulonate reductase                  77.0    1e-15   
ref|WP_021440874.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    76.3    3e-15   
ref|WP_004150165.1|  2,3-diketo-L-gulonate reductase                  76.3    3e-15   
gb|ABF60034.1|  YiaK                                                  75.9    3e-15   Klebsiella pneumoniae
ref|WP_038395676.1|  2,3-diketo-L-gulonate reductase                  72.4    4e-15   
gb|AHS60475.1|  2,3-diketo-L-gulonate reductase                       73.9    4e-15   
gb|AHS75190.1|  hypothetical protein AU59_25035                       72.8    5e-15   
ref|WP_000869003.1|  hypothetical protein                             72.8    5e-15   
ref|WP_001803048.1|  2,3-diketo-L-gulonate reductase                  74.7    6e-15   
ref|WP_015962527.1|  malate/lactate dehydrogenase                     75.1    6e-15   
gb|AHO21135.1|  hypothetical protein AV75_20950                       73.2    7e-15   
ref|WP_000869006.1|  2,3-diketo-L-gulonate reductase                  74.3    1e-14   
gb|EHC79610.1|  3-dehydro-L-gulonate 2-dehydrogenase                  74.3    1e-14   
ref|WP_000869004.1|  2,3-diketo-L-gulonate reductase                  74.3    1e-14   
gb|AHW26086.1|  2,3-diketo-L-gulonate reductase                       74.3    1e-14   
ref|WP_001698190.1|  2,3-diketo-L-gulonate reductase                  74.3    1e-14   
ref|WP_000869007.1|  2,3-diketo-L-gulonate reductase                  74.3    1e-14   
gb|AHT99837.1|  2,3-diketo-L-gulonate reductase                       73.9    1e-14   
ref|WP_000861182.1|  2,3-diketo-L-gulonate reductase                  74.3    1e-14   
ref|WP_000869008.1|  2,3-diketo-L-gulonate reductase                  74.3    1e-14   
gb|KFS76377.1|  2,3-diketo-L-gulonate reductase                       74.3    1e-14   
ref|WP_024156870.1|  2,3-diketo-L-gulonate reductase                  74.3    1e-14   
ref|WP_000869009.1|  2,3-diketo-L-gulonate reductase                  74.3    1e-14   
ref|WP_000861181.1|  2,3-diketo-L-gulonate reductase                  74.3    1e-14   
ref|WP_000869005.1|  2,3-diketo-L-gulonate reductase                  74.3    1e-14   
ref|WP_024910003.1|  2,3-diketo-L-gulonate reductase                  74.3    2e-14   
ref|WP_023166584.1|  2,3-diketo-L-gulonate reductase                  73.9    2e-14   
ref|WP_031613305.1|  2,3-diketo-L-gulonate reductase                  73.9    2e-14   
ref|WP_000869010.1|  2,3-diketo-L-gulonate reductase                  73.9    2e-14   
ref|WP_006892019.1|  2,3-diketo-L-gulonate reductase                  73.9    2e-14   
ref|WP_004126498.1|  2,3-diketo-L-gulonate reductase                  73.9    2e-14   
ref|WP_004855404.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    72.4    6e-14   
gb|EHC30625.1|  3-dehydro-L-gulonate 2-dehydrogenase                  72.4    6e-14   
gb|EHC50522.1|  3-dehydro-L-gulonate 2-dehydrogenase                  72.4    6e-14   
ref|WP_000869014.1|  2,3-diketo-L-gulonate reductase                  72.4    6e-14   
ref|WP_024159191.1|  2,3-diketo-L-gulonate reductase                  72.4    7e-14   
ref|WP_015690844.1|  3-dehydro-L-gulonate 2-dehydrogenase             70.9    7e-14   
gb|KFU64316.1|  2,3-diketo-L-gulonate reductase                       72.4    7e-14   
ref|WP_023227840.1|  2,3-diketo-L-gulonate reductase                  72.4    7e-14   
ref|WP_023227135.1|  2,3-diketo-L-gulonate reductase                  72.4    7e-14   
ref|WP_000869011.1|  2,3-diketo-L-gulonate reductase                  72.4    7e-14   
ref|WP_023232389.1|  2,3-diketo-L-gulonate reductase                  72.4    7e-14   
ref|WP_029096367.1|  2,3-diketo-L-gulonate reductase                  72.4    7e-14   
ref|WP_022562484.1|  putative carboxylic acid dehydrogenase           72.4    7e-14   
ref|WP_000861183.1|  2,3-diketo-L-gulonate reductase                  72.4    8e-14   
ref|WP_000869012.1|  2,3-diketo-L-gulonate reductase                  72.4    8e-14   
ref|WP_000861184.1|  2,3-diketo-L-gulonate reductase                  72.0    9e-14   
ref|WP_000869013.1|  2,3-diketo-L-gulonate reductase                  72.0    9e-14   
ref|WP_023208523.1|  2,3-diketo-L-gulonate reductase                  72.0    9e-14   
ref|WP_020978465.1|  hypothetical protein                             70.5    1e-13   
ref|WP_013364220.1|  2,3-diketo-L-gulonate reductase                  71.6    1e-13   
gb|KFC90792.1|  3-dehydro-L-gulonate 2-dehydrogenase                  71.6    1e-13   
gb|AIU74311.1|  2,3-diketo-L-gulonate reductase                       71.2    2e-13   
sp|Q93Q64.1|DLGD_KLEOX  RecName: Full=2,3-diketo-L-gulonate reduc...  71.2    2e-13   Klebsiella oxytoca
ref|WP_034613138.1|  2,3-diketo-L-gulonate reductase                  70.9    2e-13   
ref|WP_035504409.1|  2,3-diketo-L-gulonate reductase                  70.9    3e-13   
ref|WP_008815262.1|  2,3-diketo-L-gulonate reductase                  70.9    3e-13   
gb|EHM37500.1|  3-dehydro-L-gulonate 2-dehydrogenase                  70.5    4e-13   
ref|WP_021014263.1|  2,3-diketo-L-gulonate reductase                  70.1    5e-13   
ref|WP_005182865.1|  2,3-diketo-L-gulonate reductase                  70.1    5e-13   
ref|WP_039184796.1|  2,3-diketo-L-gulonate reductase                  69.7    7e-13   
ref|WP_024530149.1|  2,3-diketo-L-gulonate reductase                  68.2    2e-12   
ref|WP_039567254.1|  2,3-diketo-L-gulonate reductase                  68.2    2e-12   
ref|WP_039136787.1|  2,3-diketo-L-gulonate reductase                  68.2    3e-12   
ref|WP_021806490.1|  3-dehydro-L-gulonate 2-dehydrogenase             68.2    3e-12   
ref|WP_039085534.1|  2,3-diketo-L-gulonate reductase                  68.2    3e-12   
ref|WP_021462160.1|  2,3-diketo-L-gulonate reductase                  68.2    3e-12   
ref|WP_021177875.1|  3-dehydro-L-gulonate 2-dehydrogenase             68.2    3e-12   
ref|WP_024486029.1|  2,3-diketo-L-gulonate reductase                  67.4    3e-12   
ref|WP_025119119.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    67.4    5e-12   
ref|WP_033654044.1|  2,3-diketo-L-gulonate reductase                  67.0    7e-12   
ref|WP_033649422.1|  2,3-diketo-L-gulonate reductase                  67.0    7e-12   
ref|WP_034168445.1|  2,3-diketo-L-gulonate reductase                  67.0    8e-12   
ref|WP_004952539.1|  2,3-diketo-L-gulonate reductase                  66.2    1e-11   
gb|AHY09068.1|  2,3-diketo-L-gulonate reductase                       66.2    1e-11   
ref|WP_013814410.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    66.2    1e-11   
ref|WP_006327774.1|  2,3-diketo-L-gulonate reductase                  66.2    1e-11   
ref|WP_006319496.1|  2,3-diketo-L-gulonate reductase                  66.2    2e-11   
ref|WP_034864210.1|  2,3-diketo-L-gulonate reductase                  65.9    2e-11   
ref|WP_015433632.1|  2,3-diketo-L-gulonate reductase                  65.5    3e-11   
gb|AHG87513.1|  2,3-diketo-L-gulonate reductase                       65.5    3e-11   
ref|WP_037418212.1|  2,3-diketo-L-gulonate reductase                  65.1    3e-11   
ref|WP_005973135.1|  2,3-diketo-L-gulonate reductase                  65.1    4e-11   
ref|WP_014701531.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    65.1    4e-11   
dbj|GAK28049.1|  2,3-diketo-L-gulonate reductase                      65.1    4e-11   
ref|WP_029495134.1|  2,3-diketo-L-gulonate reductase                  65.1    4e-11   
ref|WP_035530446.1|  2,3-diketo-L-gulonate reductase                  64.7    4e-11   
gb|EJP27788.1|  3-dehydro-L-gulonate 2-dehydrogenase                  64.7    5e-11   
ref|WP_039305525.1|  2,3-diketo-L-gulonate reductase                  64.7    5e-11   
ref|WP_020828511.1|  2,3-diketo-L-gulonate reductase                  64.7    5e-11   
ref|WP_016930017.1|  2,3-diketo-L-gulonate reductase                  64.7    5e-11   
ref|WP_012146635.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    64.7    5e-11   
emb|CDG13894.1|  2,3-diketo-l-gulonate reductase                      64.7    5e-11   
ref|WP_033632143.1|  2,3-diketo-L-gulonate reductase                  64.7    6e-11   
gb|KFF77212.1|  2,3-diketo-L-gulonate reductase                       64.3    7e-11   
gb|EJS88519.1|  2,3-diketo-L-gulonate reductase                       62.0    7e-11   
ref|WP_016532882.1|  2,3-diketo-L-gulonate reductase                  61.2    7e-11   
ref|WP_026916735.1|  2,3-diketo-L-gulonate reductase                  64.3    8e-11   
ref|WP_035495487.1|  2,3-diketo-L-gulonate reductase                  64.3    8e-11   
ref|WP_035519852.1|  2,3-diketo-L-gulonate reductase                  64.3    8e-11   
ref|WP_021114476.1|  2,3-diketo-L-gulonate reductase                  63.9    9e-11   
ref|WP_021111842.1|  2,3-diketo-L-gulonate reductase                  63.9    9e-11   
ref|WP_021110118.1|  2,3-diketo-L-gulonate reductase                  63.9    9e-11   
ref|WP_015841821.1|  2,3-diketo-L-gulonate reductase                  63.9    1e-10   
gb|EJS87685.1|  2,3-diketo-L-gulonate reductase                       62.4    1e-10   
ref|WP_005713303.1|  lactate dehydrogenase                            61.2    1e-10   
ref|WP_005717718.1|  2,3-diketo-L-gulonate reductase                  62.8    3e-10   
ref|WP_005751923.1|  2,3-diketo-L-gulonate reductase                  62.8    3e-10   
ref|WP_005763673.1|  2,3-diketo-L-gulonate reductase                  62.8    3e-10   
ref|WP_005723769.1|  2,3-diketo-L-gulonate reductase                  62.0    5e-10   
ref|WP_005757429.1|  2,3-diketo-L-gulonate reductase                  62.0    5e-10   
ref|WP_005621126.1|  lactate dehydrogenase                            59.3    6e-10   
ref|WP_013509049.1|  2,3-diketo-L-gulonate reductase                  61.6    6e-10   
ref|WP_021183286.1|  3-dehydro-L-gulonate 2-dehydrogenase             61.6    6e-10   
gb|AHG76717.1|  2,3-diketo-L-gulonate reductase                       61.2    9e-10   
ref|WP_011608912.1|  2,3-diketo-L-gulonate reductase                  61.2    1e-09   
gb|AHG80640.1|  2,3-diketo-L-gulonate reductase                       61.2    1e-09   
gb|AHG74609.1|  2,3-diketo-L-gulonate reductase                       61.2    1e-09   
ref|WP_028536592.1|  2,3-diketo-L-gulonate reductase                  61.2    1e-09   
ref|WP_005598913.1|  2,3-diketo-L-gulonate reductase                  61.2    1e-09   
ref|WP_012263290.1|  lactate dehydrogenase                            58.9    1e-09   
ref|WP_027073488.1|  2,3-diketo-L-gulonate reductase                  60.8    1e-09   
gb|EXI62834.1|  2,3-diketo-L-gulonate reductase                       60.8    1e-09   
gb|AHG72217.1|  2,3-diketo-L-gulonate reductase                       60.8    1e-09   
ref|WP_005605513.1|  lactate dehydrogenase                            58.5    1e-09   
sp|Q65WJ9.2|DLGD_MANSM  RecName: Full=2,3-diketo-L-gulonate reduc...  60.5    2e-09   
ref|WP_039198525.1|  2,3-diketo-L-gulonate reductase                  60.5    2e-09   
ref|WP_031192865.1|  2,3-diketo-L-gulonate reductase                  60.5    2e-09   
ref|WP_006248995.1|  2,3-diketo-L-gulonate reductase                  60.5    2e-09   
ref|WP_005610680.1|  2,3-diketo-L-gulonate reductase                  60.1    2e-09   
ref|WP_018652421.1|  2,3-diketo-L-gulonate reductase                  60.1    2e-09   
ref|WP_005615968.1|  2,3-diketo-L-gulonate reductase                  60.1    2e-09   
ref|WP_011978922.1|  2,3-diketo-L-gulonate reductase                  60.1    2e-09   
ref|WP_031200631.1|  2,3-diketo-L-gulonate reductase                  60.1    2e-09   
ref|WP_006251392.1|  2,3-diketo-L-gulonate reductase                  60.1    2e-09   
ref|WP_015674298.1|  2,3-diketo-L-gulonate reductase                  60.1    3e-09   
ref|WP_006121625.1|  2,3-diketo-L-gulonate reductase                  60.1    3e-09   
ref|WP_005608948.1|  2,3-diketo-L-gulonate reductase                  60.1    3e-09   
ref|WP_033739101.1|  2,3-diketo-L-gulonate reductase                  59.7    3e-09   
ref|WP_011199238.1|  2,3-diketo-L-gulonate reductase [                60.1    3e-09   
ref|WP_035686494.1|  2,3-diketo-L-gulonate reductase                  59.7    4e-09   
ref|WP_016192037.1|  2,3-diketo-L-gulonate reductase                  59.3    5e-09   
ref|WP_032108228.1|  2,3-diketo-L-gulonate reductase                  58.9    6e-09   
ref|WP_017806299.1|  2,3-diketo-L-gulonate reductase                  58.9    7e-09   
ref|WP_028723116.1|  2,3-diketo-L-gulonate reductase                  58.5    1e-08   
ref|WP_013024264.1|  2,3-diketo-L-gulonate reductase                  58.5    1e-08   
ref|WP_014595128.1|  2,3-diketo-L-gulonate reductase                  58.2    1e-08   
ref|WP_032094059.1|  2,3-diketo-L-gulonate reductase                  58.2    1e-08   
ref|WP_035293955.1|  2,3-diketo-L-gulonate reductase                  57.8    2e-08   
ref|WP_018355949.1|  2,3-diketo-L-gulonate reductase                  57.8    2e-08   
gb|EER47267.1|  2,3-diketo-L-gulonate reductase                       57.8    2e-08   
ref|WP_024471393.1|  2,3-diketo-L-gulonate reductase                  57.8    2e-08   
ref|WP_005820367.1|  2,3-diketo-L-gulonate reductase                  57.8    2e-08   
gb|KDR13721.1|  2,3-diketo-L-gulonate reductase                       57.0    2e-08   
gb|KIG22548.1|  2,3-diketo-L-gulonate reductase                       57.4    3e-08   
ref|WP_012055360.1|  2,3-diketo-L-gulonate reductase                  57.4    3e-08   
ref|WP_005647834.1|  hypothetical protein                             55.5    5e-08   
ref|WP_034934050.1|  2,3-diketo-L-gulonate reductase                  55.5    1e-07   
gb|EMX47299.1|  2,3-diketo-L-gulonate reductase                       55.1    1e-07   
ref|WP_021519891.1|  2,3-diketo-L-gulonate reductase                  55.1    1e-07   
ref|WP_000458010.1|  2,3-diketo-L-gulonate reductase                  55.1    1e-07   
ref|WP_005693365.1|  2,3-diketo-L-gulonate reductase                  55.1    2e-07   
gb|ETJ15057.1|  hypothetical protein Q609_ECAC02520G0001              50.8    4e-07   
ref|WP_014856999.1|  Malate/L-lactate dehydrogenase                   53.9    5e-07   
ref|WP_005669761.1|  hypothetical protein                             49.7    1e-06   
ref|WP_026446668.1|  2,3-diketo-L-gulonate reductase                  52.0    2e-06   
ref|WP_013768801.1|  3-dehydro-L-gulonate 2-dehydrogenase             51.6    3e-06   
ref|WP_017258162.1|  hypothetical protein                             51.6    3e-06   
ref|WP_016314950.1|  hypothetical protein                             51.6    3e-06   
ref|WP_014219862.1|  3-dehydro-L-gulonate 2-dehydrogenase             51.2    4e-06   
ref|WP_031574018.1|  2,3-diketo-L-gulonate reductase                  50.8    4e-06   
ref|WP_035359143.1|  2,3-diketo-L-gulonate reductase                  50.8    5e-06   
ref|WP_013607908.1|  3-dehydro-L-gulonate 2-dehydrogenase             50.4    6e-06   
ref|WP_022421625.1|  putative uncharacterized protein                 50.4    7e-06   
gb|END11390.1|  malate/L-lactate dehydrogenase family protein         47.4    7e-06   
ref|WP_015027882.1|  Malate/L-lactate dehydrogenase                   50.4    8e-06   
ref|WP_008202678.1|  2,3-diketo-L-gulonate reductase                  50.4    8e-06   
ref|WP_025608812.1|  2,3-diketo-L-gulonate reductase                  50.1    1e-05   
ref|WP_038108196.1|  2,3-diketo-L-gulonate reductase                  49.7    1e-05   
ref|WP_016298143.1|  hypothetical protein                             49.7    1e-05   
ref|WP_015897065.1|  2,3-diketo-L-gulonate reductase                  49.7    1e-05   
gb|EON77717.1|  putative dehydrogenase                                49.3    2e-05   
ref|WP_019535166.1|  hypothetical protein                             48.9    2e-05   
ref|WP_015809240.1|  2,3-diketo-L-gulonate reductase                  48.9    2e-05   
ref|WP_035805296.1|  2,3-diketo-L-gulonate reductase                  48.9    2e-05   
ref|WP_020714667.1|  hypothetical protein                             48.9    2e-05   
ref|WP_026656719.1|  2,3-diketo-L-gulonate reductase                  48.9    2e-05   
gb|ERL22479.1|  malate/L-lactate dehydrogenase                        48.9    3e-05   
ref|WP_036599493.1|  2,3-diketo-L-gulonate reductase                  48.9    3e-05   
ref|WP_025230432.1|  2,3-diketo-L-gulonate reductase                  48.5    4e-05   
ref|WP_009214164.1|  2,3-diketo-L-gulonate reductase                  48.5    4e-05   
ref|WP_014021380.1|  malate/L-lactate dehydrogenase                   48.1    4e-05   
ref|WP_013567135.1|  malate/L-lactate dehydrogenase                   48.1    5e-05   
ref|WP_004075640.1|  hypothetical protein                             48.1    5e-05   
ref|WP_026386302.1|  2,3-diketo-L-gulonate reductase                  47.8    6e-05   
ref|WP_024294566.1|  MULTISPECIES: 2,3-diketo-L-gulonate reductase    47.8    6e-05   
dbj|GAK59784.1|  malate/L-lactate dehydrogenase                       47.8    7e-05   
ref|WP_022068349.1|  malate/L-lactate dehydrogenase                   47.8    7e-05   
ref|WP_021870213.1|  putative uncharacterized protein                 47.4    8e-05   
ref|WP_025485293.1|  2,3-diketo-L-gulonate reductase                  47.4    9e-05   
ref|WP_008720201.1|  malate/L-lactate dehydrogenase                   47.4    9e-05   
ref|WP_008719350.1|  malate/L-lactate dehydrogenase                   47.0    1e-04   
ref|WP_003442705.1|  2,3-diketo-L-gulonate reductase                  46.6    1e-04   
ref|WP_024735500.1|  2,3-diketo-L-gulonate reductase                  46.6    2e-04   
ref|WP_007714635.1|  hypothetical protein [                           46.6    2e-04   
ref|WP_022844743.1|  malate/L-lactate dehydrogenase                   46.6    2e-04   
ref|WP_037302015.1|  2,3-diketo-L-gulonate reductase                  46.2    2e-04   
ref|WP_026884193.1|  2,3-diketo-L-gulonate reductase                  46.2    2e-04   
ref|WP_013580119.1|  malate/L-lactate dehydrogenase                   46.2    2e-04   
ref|WP_012199625.1|  2,3-diketo-L-gulonate reductase                  45.8    3e-04   
ref|WP_013931026.1|  3-dehydro-L-gulonate 2-dehydrogenase             45.8    3e-04   
ref|WP_002593433.1|  MULTISPECIES: 3-dehydro-L-gulonate 2-dehydro...  45.8    3e-04   
ref|WP_014270439.1|  malate/lactate dehydrogenase                     45.4    4e-04   
ref|WP_002587651.1|  3-dehydro-L-gulonate 2-dehydrogenase [           45.4    4e-04   
ref|WP_026774513.1|  2,3-diketo-L-gulonate reductase                  45.4    4e-04   
ref|WP_026768490.1|  2,3-diketo-L-gulonate reductase                  45.4    4e-04   
ref|WP_009033777.1|  2,3-diketo-L-gulonate reductase                  45.4    5e-04   
ref|WP_022202760.1|  putative uncharacterized protein                 45.1    5e-04   
ref|WP_026955702.1|  2,3-diketo-L-gulonate reductase                  45.1    5e-04   
ref|WP_002604501.1|  3-dehydro-L-gulonate 2-dehydrogenase [           45.1    5e-04   
ref|WP_010234405.1|  2,3-diketo-L-gulonate reductase                  45.1    6e-04   
ref|WP_020533925.1|  hypothetical protein                             45.1    6e-04   
ref|WP_015614859.1|  malate/lactate dehydrogenase                     45.1    6e-04   
ref|WP_025230317.1|  2,3-diketo-L-gulonate reductase                  45.1    6e-04   
ref|WP_026888637.1|  2,3-diketo-L-gulonate reductase                  45.1    7e-04   
ref|WP_017210917.1|  hypothetical protein                             45.1    7e-04   
ref|WP_027641146.1|  2,3-diketo-L-gulonate reductase [                44.7    7e-04   
ref|WP_002564737.1|  3-dehydro-L-gulonate 2-dehydrogenase [           44.7    8e-04   
ref|WP_008508625.1|  Malate/L-lactate dehydrogenase                   44.7    8e-04   
ref|WP_002575030.1|  MULTISPECIES: 3-dehydro-L-gulonate 2-dehydro...  44.7    8e-04   
gb|ETP72306.1|  malate/lactate dehydrogenase                          44.3    0.001   



>ref|WP_032489153.1| truncated YiaK protein, partial [Escherichia coli]
 ref|YP_009075348.1| truncated YiaK protein, partial [Escherichia coli]
 emb|CAA11398.1| truncated YiaK protein [Escherichia coli]
Length=61

 Score = 84.7 bits (208),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KDY67373.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
2-460-02_S4_C2]
 gb|KDY75199.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
2-460-02_S4_C3]
 gb|KDZ38333.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
3-020-07_S3_C1]
 gb|KEJ47498.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
2-460-02_S4_C1]
 gb|KEJ65825.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
3-020-07_S3_C2]
Length=81

 Score = 84.7 bits (208),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KIH08564.1| 2,3-diketo-L-gulonate reductase, partial [Escherichia coli]
Length=165

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|EFW53106.1| 3-dehydro-L-gulonate 2-dehydrogenase [Shigella boydii ATCC 9905]
Length=185

 Score = 86.7 bits (213),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032334019.1| 2,3-diketo-L-gulonate reductase, partial [Shigella boydii]
Length=181

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|EMW92161.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
174750]
Length=146

 Score = 85.5 bits (210),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023566248.1| 2,3-diketo-L-gulonate reductase, partial [Escherichia coli]
 gb|EST87673.1| 2,3-diketo-L-gulonate reductase, partial [Escherichia coli ECC-1470]
Length=220

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|EGI90235.1| malate/L-lactate dehydrogenase family protein [Shigella boydii 
5216-82]
Length=248

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>emb|CDL24865.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli ISC7]
Length=266

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|EYD80852.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
1-176-05_S3_C2]
Length=123

 Score = 84.0 bits (206),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGV+SETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVNSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869029.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri]
 ref|YP_691278.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 5 str. 8401]
 gb|ABF05973.1| putative dehydrogenase [Shigella flexneri 5 str. 8401]
 gb|EID64204.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 5a str. M90T]
Length=330

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024232773.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023277684.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ESK00481.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 98 (4-5799287)]
 gb|KHO58846.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001455471.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ENB58236.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.6]
 gb|END89371.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0301904.3]
 gb|KEN10446.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 7-233-03_S4_C2]
Length=332

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001712935.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMV98589.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2853500]
Length=332

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001388653.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMV16324.1| 2,3-diketo-L-gulonate reductase [Escherichia coli C-34666]
 gb|ENA59939.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 179550]
 gb|ENB92710.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299438.11]
 gb|ENB95953.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299438.3]
 gb|ENC52995.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299917.4]
 gb|ENC75647.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299917.7]
 gb|ENE06974.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.14]
 gb|ENG40394.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.12]
 gb|EYD80278.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-176-05_S1_C1]
Length=332

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_029305680.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032284227.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KDW79228.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-392-07_S1_C2]
Length=332

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_016246404.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EOW18481.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE107]
Length=332

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032302148.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KEL38270.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-172-05_S3_C3]
Length=332

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032198825.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KDX85436.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-222-05_S3_C3]
 gb|KEN87159.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-222-05_S3_C1]
 gb|KEN94670.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-222-05_S3_C2]
Length=332

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024238623.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_021523291.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EQP31364.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 65 (4-2262045)]
 gb|EQV96768.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 77 (202a)]
Length=332

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001753186.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ELF31361.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE161]
 gb|EMX28847.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021561.2]
Length=332

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869048.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EHX89001.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC14D]
Length=332

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001316724.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EGI39368.1| 2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase) [Escherichia coli TA280]
Length=345

 Score = 86.7 bits (213),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  29   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  67



>ref|WP_001611122.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ELH16893.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE173]
 gb|ELH22183.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE175]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869028.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacteriaceae]
 gb|EIQ56447.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 1235-66]
 gb|EJL10532.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 6603-63]
 gb|EMW93731.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ThroopD]
 gb|KDV79416.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-052-05_S4_C3]
Length=330

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869023.1| 2,3-diketo-L-gulonate reductase [Shigella dysenteriae]
 gb|EFW50945.1| 3-dehydro-L-gulonate 2-dehydrogenase [Shigella dysenteriae CDC 
74-1112]
 gb|EIQ65519.1| 2,3-diketo-L-gulonate reductase [Shigella dysenteriae 225-75]
Length=330

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KHH89371.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001710893.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMV86936.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2865200]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|AAB18552.1| unnamed protein product [Escherichia coli str. K-12 substr. MG1655]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_033557507.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KFH98186.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032343651.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KEL52452.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-175-07_S1_C1]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869050.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 ref|YP_006098163.1| 2,3-diketo-l-gulonate reductase [Escherichia coli 042]
 emb|CBG36704.1| 2,3-diketo-l-gulonate reductase [Escherichia coli 042]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_038346849.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI75124.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=330

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869030.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EGI29697.1| 2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase) [Escherichia coli TA143]
Length=330

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024240361.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023156458.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli]
 gb|ESA71144.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907357]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001669978.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ENH42878.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.5]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001588199.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ENE62788.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.13]
 gb|ENF17341.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.11]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869047.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EFZ59862.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
LT-68]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032279124.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EZJ68753.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-182-04_S3_C3]
 gb|EZJ80672.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ89393.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-182-04_S3_C1]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032319004.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EZA38349.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O103:H11 str. 
04-3023]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024009384.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ETF34444.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3489-1]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_021570303.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EQY90517.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3317-1]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869043.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EHV92455.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC7B]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869024.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 ref|YP_006140841.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli NA114]
 ref|YP_008723943.1| 2,3-diketo-L-gulonate reductase [Escherichia coli JJ1886]
 gb|AEG38567.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli NA114]
 gb|ELD94446.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE49]
 emb|CCW27138.1| hypothetical oxidoreductase YiaK [Escherichia coli O25b:H4-ST131 
str. EC958]
 gb|EQT18908.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 176 (4-3428664)]
 gb|EQT53254.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 186 (4-3405044)]
 gb|ERO92706.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BWH 24]
 gb|ESA94033.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907779]
 gb|ESD04367.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907700]
 gb|ESD15555.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907701]
 gb|ESD58556.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908524]
 gb|ESD96427.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908624]
 gb|ESE10684.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908632]
 gb|ESE18325.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908691]
 gb|AGY86256.1| 2,3-diketo-L-gulonate reductase [Escherichia coli JJ1886]
 gb|ESL33519.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 38]
 gb|ETE28367.1| 2,3-diketo-L-gulonate reductase [Escherichia coli LAU-EC7]
 emb|CDL03549.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli IS35]
 emb|CDK88556.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli IS29]
 gb|ETX88156.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 20B]
 gb|ETX91835.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 20A]
 gb|ETY47063.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BWH 34]
 emb|CDL50454.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli ISC41]
 gb|EYB45707.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KCW94846.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KDF72239.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 58]
 gb|KDF83676.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 62]
 gb|KDF84723.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 64]
 gb|KDF85578.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 63]
 gb|KDG00354.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 70]
 gb|KDG25328.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 76]
 gb|KDG25924.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 75]
 gb|KDG39228.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 78]
 gb|KDG43367.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 79]
 gb|KDG45551.1| 2,3-diketo-L-gulonate reductase [Escherichia coli CHS 68]
 gb|KDG57638.1| 2,3-diketo-L-gulonate reductase [Escherichia coli CHS 69]
 gb|KDG69020.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UCI 51]
 gb|KDN09071.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli]
 emb|CDN84332.1| hypothetical oxidoreductase YiaK [Escherichia coli O25b:H4-ST131 
str. EC958]
 gb|KDY47071.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-427-07_S4_C2]
 gb|KEJ37526.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-460-02_S1_C3]
 gb|KEO36799.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-460-02_S1_C2]
 gb|KEP15852.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGP49127.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGP51956.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869025.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EDU62125.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
53638]
Length=330

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KFH95574.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032182262.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KDZ00964.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-474-04_S1_C2]
 gb|KEN21866.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 8-415-05_S1_C1]
 gb|KEO06500.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 8-415-05_S1_C2]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_021571471.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EQY94977.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3329-1]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_020219130.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869039.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacteriaceae]
 ref|NP_709360.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 2a str. 301]
 ref|NP_839311.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 2a str. 2457T]
 ref|YP_002295126.1| 2,3-diketo-L-gulonate reductase [Escherichia coli SE11]
 ref|YP_002389049.1| 2,3-diketo-L-gulonate reductase [Escherichia coli IAI1]
 ref|YP_002404959.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 55989]
 ref|YP_003224488.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli O103:H2 str. 12009]
 ref|YP_003231920.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
11368]
 ref|YP_003236708.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli O111:H- str. 11128]
 ref|YP_005275879.1| malate/L-lactate dehydrogenase [Escherichia coli KO11FL]
 ref|YP_005729217.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 2002017]
 ref|YP_006126431.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli W]
 ref|YP_006163307.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KO11FL]
 ref|YP_006175187.1| 2,3-diketo-L-gulonate reductase [Escherichia coli W]
 ref|YP_006781990.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
2009EL-2071]
 ref|YP_006776931.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
2011C-3493]
 ref|YP_006767886.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
2009EL-2050]
 ref|YP_007383499.1| 2,3-diketo-L-gulonate reductase [Escherichia coli APEC O78]
 ref|YP_008566723.1| 2,3-diketo-L-gulonate reductase [Escherichia coli LY180]
 sp|Q83PQ6.1|DLGD_SHIFL RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Shigella flexneri]
 sp|B7M3J9.1|DLGD_ECO8A RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli IAI1]
 sp|B6I3E8.1|DLGD_ECOSE RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli SE11]
 sp|B7L6Z1.1|DLGD_ECO55 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli 55989]
 gb|AAN45067.1| putative dehydrogenase [Shigella flexneri 2a str. 301]
 gb|AAP19122.1| putative dehydrogenase [Shigella flexneri 2a str. 2457T]
 gb|EDV64372.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli B7A]
 gb|EDV85212.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli E22]
 gb|EDV88673.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli E110019]
 gb|EDX30725.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli B171]
 dbj|BAG79375.1| putative dehydrogenase [Escherichia coli SE11]
 emb|CAV00526.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli 55989]
 emb|CAR00539.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli IAI1]
 dbj|BAI28180.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli O26:H11 str. 11368]
 dbj|BAI33354.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli O103:H2 str. 12009]
 dbj|BAI38157.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli O111:H- str. 11128]
 gb|ADA75924.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 2002017]
 gb|EFE61442.1| 2,3-diketo-L-gulonate reductase [Escherichia coli B088]
 gb|EFJ88734.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 84-1]
 gb|EFJ95838.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 115-1]
 gb|EFK46452.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 119-7]
 gb|EFK53147.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 107-1]
 gb|EFK67868.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 124-1]
 gb|EFN36367.1| Malate/L-lactate dehydrogenase [Escherichia coli W]
 gb|EFO56097.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 145-7]
 gb|EFS12003.1| malate/L-lactate dehydrogenase family protein [Shigella flexneri 
2a str. 2457T]
 gb|ADT77189.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli W]
 gb|EFU34074.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 85-1]
 gb|EFW75983.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli EC4100B]
 gb|EFZ41658.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
EPECa14]
 gb|EFZ46594.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
E128010]
 gb|EFZ65027.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
OK1180]
 gb|EFZ68135.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
OK1357]
 gb|ADX48815.1| Malate/L-lactate dehydrogenase [Escherichia coli KO11FL]
 gb|EGB40598.1| malate/L-lactate dehydrogenase [Escherichia coli H120]
 gb|EGB87124.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 117-3]
 gb|EGC10462.1| malate/L-lactate dehydrogenase [Escherichia coli E1167]
 gb|EGI34392.1| 2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase) [Escherichia coli TA271]
 gb|EGI44153.1| 2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase) [Escherichia coli H591]
 gb|EGJ07843.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli D9]
 gb|EGJ80386.1| malate/L-lactate dehydrogenase family protein [Shigella flexneri 
K-671]
 gb|EGJ80542.1| malate/L-lactate dehydrogenase family protein [Shigella flexneri 
4343-70]
 gb|EGJ81690.1| malate/L-lactate dehydrogenase family protein [Shigella flexneri 
2747-71]
 gb|EGJ94458.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 2930-71]
 gb|EGK15979.1| malate/L-lactate dehydrogenase family protein [Shigella flexneri 
VA-6]
 gb|EGK16747.1| malate/L-lactate dehydrogenase family protein [Shigella flexneri 
K-218]
 gb|EGK32187.1| malate/L-lactate dehydrogenase family protein [Shigella flexneri 
K-304]
 gb|EGM59318.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri J1713]
 gb|EGR61355.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
01-09591]
 gb|EGR72427.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
LB226692]
 gb|EGT69036.1| yiaK [Escherichia coli O104:H4 str. C227-11]
 gb|EGU96905.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MS 79-10]
 gb|EGW65319.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
2534-86]
 gb|EGW80136.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
STEC_94C]
 gb|EGW86768.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
STEC_DG131-3]
 gb|EGX05703.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
STEC_H.1.8]
 gb|EGX20714.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
TX1999]
 gb|EHF19374.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
C236-11]
 gb|EHF23812.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
C227-11]
 gb|EHF24698.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
04-8351]
 gb|EHF31813.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
09-7901]
 gb|EHF38309.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-3677]
 gb|EHF46415.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-4404]
 gb|EHF50643.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-4522]
 gb|EHF54769.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-4623]
 gb|EHF66366.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-4632 C1]
 gb|EHF69131.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-4632 C2]
 gb|EHF70923.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-4632 C3]
 gb|EHF73751.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-4632 C4]
 gb|EHF81492.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-4632 C5]
 gb|EHV75378.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC7A]
 gb|EHV84467.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC7C]
 gb|EHV87283.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC7D]
 gb|EHV98022.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC7E]
 gb|EHW06173.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC8A]
 gb|EHW06634.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC8B]
 gb|EHW11796.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC8C]
 gb|EHW20575.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC8D]
 gb|EHW23909.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC8E]
 gb|EHW29850.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC9A]
 gb|EHW36052.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC9B]
 gb|EHW41439.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC9C]
 gb|EHW48671.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC9D]
 gb|EHW51277.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC9E]
 gb|EHW57944.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC10A]
 gb|EHW63405.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC10B]
 gb|EHW67884.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC10C]
 gb|EHW74995.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC10D]
 gb|EHW85956.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC10F]
 gb|EHW86542.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC10E]
 gb|EHW87569.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC11A]
 gb|EHW99655.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC11B]
 gb|EHX05547.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC11D]
 gb|EHX07636.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC11C]
 gb|EHX16604.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC11E]
 gb|EHX22084.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC12B]
 gb|EHX26437.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC12A]
 gb|EHX27237.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC12C]
 gb|EHX39540.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC12D]
 gb|EHX43523.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC13A]
 gb|EHX43706.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC12E]
 gb|EHX56471.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC13C]
 gb|EHX57327.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC13B]
 gb|EHX59915.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC13D]
 gb|EHX70387.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC13E]
 gb|EHX74105.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC14A]
 gb|EHX75921.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC14B]
 gb|EHX85139.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC14C]
 gb|EHX93057.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC15A]
 gb|EHY00720.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC15B]
 gb|EHY04366.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC15C]
 gb|EHY12624.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC15D]
 gb|EHY16242.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC15E]
 gb|AFH15955.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KO11FL]
 gb|AFH13401.1| 2,3-diketo-L-gulonate reductase [Escherichia coli W]
 gb|EID68457.1| Malate/L-lactate dehydrogenase [Escherichia coli W26]
 gb|EIE53982.1| Malate/L-lactate dehydrogenase [Escherichia coli AI27]
 gb|EIG46489.1| 2,3-diketo-L-gulonate reductase [Escherichia coli B799]
 gb|EIH01253.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 5.0588]
 gb|EIH24721.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 1.2264]
 gb|EIH44252.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 99.0741]
 gb|EIH53660.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 3.2608]
 gb|EIH66404.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 93.0624]
 gb|EIH75985.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 4.0522]
 gb|EIH88198.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli JB1-95]
 gb|EII02315.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 96.154]
 gb|EII12835.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 5.0959]
 gb|EII36386.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 4.0967]
 gb|EII56741.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 3.3884]
 gb|EIJ15179.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 900105 
(10e)]
 gb|EIL00315.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H11 str. 
CVM9534]
 gb|EIL06170.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O103:H25 str. 
CVM9340]
 gb|EIL06335.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O103:H2 str. 
CVM9450]
 gb|EIL25443.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H8 str. 
CVM9574]
 gb|EIL28452.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H8 str. 
CVM9570]
 gb|EIL38089.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
CVM9942]
 gb|EIL39653.1| malate/L-lactate dehydrogenase [Escherichia coli O26:H11 str. 
CVM10026]
 gb|EIL50604.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 541-15]
 gb|EIL68814.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 541-1]
 gb|EIL78734.1| 2,3-diketo-L-gulonate reductase [Escherichia coli CUMT8]
 gb|EIQ02778.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri K-1770]
 gb|EIQ03795.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 2850-71]
 gb|EIQ16572.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri K-315]
 gb|EIQ20058.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri K-404]
 gb|EIQ59744.1| 2,3-diketo-L-gulonate reductase [Escherichia coli EPECa12]
 gb|EJE65837.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
CVM10224]
 gb|EJE67226.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H8 str. 
CVM9602]
 gb|EJE71381.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H8 str. 
CVM9634]
 gb|EJE74330.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H11 str. 
CVM9553]
 gb|EJE79833.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H11 str. 
CVM9455]
 gb|EJE83466.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
CVM10021]
 gb|EJE96110.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
CVM10030]
 gb|EJF00989.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
CVM9952]
 gb|EJK94459.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
STEC_O31]
 gb|EJZ61549.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 1485-80]
 gb|AFS54926.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
2009EL-2050]
 gb|AFS72130.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
2011C-3493]
 gb|AFS88649.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
2009EL-2071]
 gb|EKI49194.1| 2,3-diketo-L-gulonate reductase [Escherichia coli N1]
 gb|EKJ11998.1| 2,3-diketo-L-gulonate reductase [Escherichia coli EC1865]
 gb|EKJ55512.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 0.1288]
 emb|CCK48884.1| putative dehydrogenase [Escherichia coli chi7122]
 emb|CCJ46197.1| putative dehydrogenase [Escherichia coli]
 gb|EKT92344.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H11 str. 
CFSAN001630]
 gb|EKT97690.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H8 str. 
CFSAN001632]
 gb|EKT98216.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
CFSAN001629]
 gb|EKY83779.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-02092]
 gb|EKY93043.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-02030]
 gb|EKY93654.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-02033-1]
 gb|EKZ09695.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-02093]
 gb|EKZ10213.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-02281]
 gb|EKZ13449.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-02318]
 gb|EKZ25374.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-02913]
 gb|EKZ27057.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-03439]
 gb|EKZ27363.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-03943]
 gb|EKZ37965.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
11-04080]
 gb|EKZ39244.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec11-9990]
 gb|EKZ42509.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec11-9450]
 gb|EKZ50263.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec11-4984]
 gb|EKZ52798.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec11-4986]
 gb|EKZ60831.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec11-4987]
 gb|EKZ64608.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec11-4988]
 gb|EKZ69624.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec11-5603]
 gb|EKZ75636.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec11-5604]
 gb|EKZ79766.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec12-0465]
 gb|EKZ84770.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec11-6006]
 gb|EKZ90901.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec12-0466]
 gb|EKZ94625.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
Ec11-9941]
 gb|ELC13648.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE10]
 gb|ELC18621.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE12]
 gb|ELD19137.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE210]
 gb|ELD67041.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE234]
 gb|ELF08656.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE142]
 gb|ELF83942.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE29]
 gb|ELF95541.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE48]
 gb|ELG39437.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE91]
 gb|ELG47069.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE101]
 gb|ELG66476.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE136]
 gb|ELG66954.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE135]
 gb|ELH40799.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE184]
 gb|ELH56617.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE203]
 gb|ELI76767.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE138]
 gb|ELJ20621.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE166]
 gb|ELJ77482.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE90]
 gb|ELJ81758.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE94]
 gb|AGC89055.1| 2,3-diketo-L-gulonate reductase [Escherichia coli APEC O78]
 gb|EMR97206.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli O104:H4 str. E92/11]
 gb|EMR99082.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli O104:H4 str. E112/10]
 gb|EMU58173.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021552.7]
 gb|EMU58261.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021552.11]
 gb|EMU67009.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021552.12]
 gb|EMV18163.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE034_MS-14]
 gb|EMV30396.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE002_MS12]
 gb|EMV35192.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2875000]
 gb|EMV43543.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2872800]
 gb|EMV54911.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2867750]
 gb|EMV68448.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2866450]
 gb|EMV71031.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2866750]
 gb|EMV89711.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2860050]
 gb|EMW14967.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2850400]
 gb|EMW39748.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2788150]
 gb|EMW45828.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2780750]
 gb|EMW48132.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2770900]
 gb|EMW57212.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2756500]
 gb|EMW65857.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2749250]
 gb|EMW71367.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2747800]
 gb|EMW76670.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 180600]
 gb|EMW97132.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.1]
 gb|EMX05792.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302308.1]
 gb|EMX12497.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302293.2]
 gb|EMX35711.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021552.8]
 gb|EMX45938.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP020980.2]
 gb|EMX50861.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP020940.1]
 gb|EMX60745.1| 2,3-diketo-L-gulonate reductase [Escherichia coli Jurua 18/11]
 gb|EMX66801.1| 2,3-diketo-L-gulonate reductase [Escherichia coli Envira 10/1]
 gb|EMX66890.1| 2,3-diketo-L-gulonate reductase [Escherichia coli Envira 8/11]
 gb|EMX73105.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2726800]
 gb|EMX85371.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE001_MS16]
 gb|EMX88481.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2720900]
 gb|EMZ61022.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 174900]
 gb|EMZ63981.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2735000]
 gb|EMZ81484.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.1]
 gb|EMZ94047.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.1]
 gb|ENA02449.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299917.1]
 gb|ENA49066.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2729250]
 gb|ENA63581.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 180200]
 gb|ENA77333.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2730350]
 gb|ENA91925.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2864350]
 gb|ENB04933.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2866350]
 gb|ENB33120.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021561.3]
 gb|ENC07508.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299438.5]
 gb|ENC13242.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299438.7]
 gb|ENC29711.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P02997067.6]
 gb|ENC37548.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299917.10]
 gb|ENC44785.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299917.2]
 gb|ENC51043.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299917.3]
 gb|ENC58307.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299917.5]
 gb|ENC68070.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299917.8]
 gb|ENC80608.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299917.9]
 gb|END00316.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302308.11]
 gb|END08351.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302308.3]
 gb|END20269.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302308.5]
 gb|END20927.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302308.4]
 gb|END30617.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 179100]
 gb|END38254.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2854350]
 gb|END49662.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP020980.1]
 gb|END65493.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299483.1]
 gb|END77204.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299483.2]
 gb|END79172.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299483.3]
 gb|END95709.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302293.7]
 gb|ENE02948.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304799.3]
 gb|ENE18331.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302293.10]
 gb|ENE20305.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302293.3]
 gb|ENE34055.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302293.6]
 gb|ENE43420.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.10]
 gb|ENE48312.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302293.9]
 gb|ENE54180.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.11]
 gb|ENE61008.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.12]
 gb|ENE68086.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.14]
 gb|ENE78526.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.2]
 gb|ENE84636.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.3]
 gb|ENE91643.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.4]
 gb|ENE95776.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.5]
 gb|ENF06369.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.8]
 gb|ENF09639.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.9]
 gb|ENF21359.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.10]
 gb|ENF28344.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.12]
 gb|ENF37740.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.13]
 gb|ENF44040.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.15]
 gb|ENF47983.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.2]
 gb|ENF58344.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.6]
 gb|ENF65819.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.8]
 gb|ENG27235.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.10]
 gb|ENG38784.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.11]
 gb|ENG49191.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.15]
 gb|ENG58794.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.3]
 gb|ENG61509.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.4]
 gb|ENG68906.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.8]
 gb|ENG75463.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.9]
 gb|ENG80846.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 178200]
 gb|ENG88296.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 178850]
 gb|ENH12869.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302308.13]
 gb|ENH14974.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302308.12]
 gb|ENH17284.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302308.14]
 gb|ENH29865.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.3]
 gb|ENH36569.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.5]
 gb|ENH49503.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.7]
 gb|ENH54028.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.6]
 gb|ENO09994.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O157:H43 str. 
T22]
 gb|EOU29122.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE13]
 gb|EOV41705.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE222]
 gb|EOV53597.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE64]
 gb|EOW02194.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE100]
 gb|EOW14707.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE102]
 gb|EOX20899.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE185]
 gb|EPH47147.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli E2265]
 gb|EQN61748.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 18 (4-8589585)]
 gb|EQO25793.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 33 (4-2174936)]
 gb|EQP90294.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 82 (4-2209276)]
 gb|EQR34301.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 121 (4-6877826)]
 gb|EQR92942.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 139 (4-3192644)]
 gb|EQS30109.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 147 (4-5893887)]
 gb|EQS51519.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 150 (4-3258106)]
 gb|EQT90402.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 195 (3-7155360)]
 gb|EQU19776.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 200 (4-4449924)]
 gb|EQV42857.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 33 (68a)]
 gb|EQW09674.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 131 (358a)]
 gb|EQW40730.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3065-1]
 gb|EQX52351.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3176-1]
 gb|EQX92818.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3201-1]
 gb|EQY96038.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3318-1]
 gb|EQZ10520.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3355-1]
 gb|ERA03097.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3805-1]
 gb|ERA58520.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 95NR1]
 gb|ERB32671.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3292-1]
 gb|ERC54568.1| 2,3-diketo-L-gulonate reductase [Escherichia coli TW07509]
 gb|ERE06708.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 95JB1]
 gb|ERF88507.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H21 str. 
CFSAN002236]
 gb|ERF94294.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H21 str. 
CFSAN002237]
 gb|AGW10632.1| 2,3-diketo-L-gulonate reductase [Escherichia coli LY180]
 gb|ESA25109.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli SCD1]
 gb|ESA63162.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 113303]
 gb|ESD10078.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 113302]
 gb|ESD27212.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907710]
 gb|ESD65658.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908555]
 gb|ESD74017.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908541]
 gb|ESK03211.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3336-1]
 gb|ESK17487.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 50 (4-2593475)]
 gb|ESP06748.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 36 (4-5675286)]
 gb|EST02123.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli CE418]
 gb|EST65925.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P4-96]
 gb|EST66352.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P4-NR]
 gb|ESV05635.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli E1777]
 gb|ETD59499.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ATCC BAA-2215]
 gb|ETD61442.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ATCC BAA-2209]
 gb|ETI73772.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ATCC BAA-2196]
 gb|ETI78971.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ATCC BAA-2219]
 gb|ETJ55569.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ATCC BAA-2193]
 emb|CDK56040.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli IS9]
 gb|EYB42596.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EYE34223.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-110-08_S1_C2]
 gb|EYU75250.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-4221]
 gb|EYU77562.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2010C-4254]
 gb|EYU79138.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:NM str. 
2010C-4347]
 gb|EYU92598.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O45:H2 str. 
2010C-3876]
 gb|EYU93944.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-4086]
 gb|EYU98375.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-3977]
 gb|EYV02358.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2010C-3840]
 gb|EYV06965.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2010C-3609]
 gb|EYV61784.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O103:H11 str. 
2010C-3214]
 gb|EYV73929.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2009EL1412]
 gb|EYV78160.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2009C-4659]
 gb|EYW89088.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
08-4487]
 gb|EYX05353.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O118:H16 str. 
08-3651]
 gb|EYX19185.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O69:H11 str. 
07-4281]
 gb|EYX61997.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H4 str. 
2011EL-1675A]
 gb|EYX77174.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2011C-3679]
 gb|EYX79658.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2011C-3632]
 gb|EYX81950.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O156:H25 str. 
2011C-3602]
 gb|EYX85468.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O103:H2 str. 
2011C-3750]
 gb|EYX95851.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2011C-3573]
 gb|EYX98657.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2011C-3537]
 gb|EYY01834.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2011C-3500]
 gb|EYY07518.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2011C-3362]
 gb|EYY10912.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2011C-3216]
 gb|EYY12827.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2011C-3170]
 gb|EYY20823.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2011C-3108]
 gb|EYY24696.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2011C-3072]
 gb|EYY30522.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2010EL1058]
 gb|EYY38890.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2010C-4989]
 gb|EYY43829.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O153:H2 str. 
2010C-5034]
 gb|EYY51898.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2010C-4966]
 gb|EYY61108.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2010C-4824]
 gb|EYY62574.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-4818]
 gb|EYY70503.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-4799]
 gb|EYY73041.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-4746]
 gb|EYY77670.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:NM str. 
2010C-4788]
 gb|EYY84911.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-4735]
 gb|EYY90412.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-4715]
 gb|EYY91148.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2010C-4732]
 gb|EYY93979.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-4622]
 gb|EYZ01748.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-4592]
 gb|EYZ23158.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O103:H2 str. 
2010C-4433]
 gb|EYZ25033.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O103:H25 str. 
2010C-4529]
 gb|EYZ43260.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O91:H14 str. 
06-3691]
 gb|EYZ48901.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
06-3822]
 gb|EYZ56336.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O79:H7 str. 
06-3501]
 gb|EYZ67335.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O118:H16 str. 
06-3612]
 gb|EYZ75448.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O69:H11 str. 
06-3325]
 gb|EYZ83661.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
06-3003]
 gb|EYZ86475.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
04-3211]
 gb|EYZ89951.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O118:H16 str. 
06-3256]
 gb|EZA00663.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O174:H21 str. 
03-3269]
 gb|EZA04011.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
03-3484]
 gb|EZA11166.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
03-3227]
 gb|EZA18798.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O113:H21 str. 
07-4224]
 gb|EZA22129.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O45:H2 str. 
01-3147]
 gb|EZA33380.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O174:H8 str. 
04-3038]
 gb|EZA34307.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
05-3646]
 gb|EZA65924.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O104:H21 str. 
94-3025]
 gb|EZA87875.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H8 str. 
F6627]
 gb|EZA94953.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
F6714]
 gb|EZC49182.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
K5198]
 gb|EZC51532.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
K5269]
 gb|EZD21072.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
K6723]
 gb|EZD29921.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
K6728]
 gb|EZD32990.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
K6722]
 gb|EZD35053.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
K6890]
 gb|EZD45193.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
K6895]
 gb|EZD50036.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
K6897]
 gb|EZD51657.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
K6898]
 gb|EZD62278.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
K6904]
 gb|EZD65443.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
K6908]
 gb|EZD71013.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
K6915]
 gb|EZD87978.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O39:NM str. 
F8704-2]
 gb|EZD95967.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O91:H14 str. 
2009C-3227]
 gb|EZE04267.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O103:H2 str. 
2009C-3279]
 gb|EZE12963.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H7 str. 
2009C-3299]
 gb|EZE14562.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O69:H11 str. 
08-4661]
 gb|EZE17318.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O123:H11 str. 
2009C-3307]
 gb|EZE19608.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O45:H2 str. 
2009C-3686]
 gb|EZE28886.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O69:H11 str. 
2009C-3601]
 gb|EZE37599.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O91:NM str. 
2009C-3745]
 gb|EZE40372.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2009C-4006]
 gb|EZE47066.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2009C-4050]
 gb|EZE50812.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2009C-4052]
 gb|EZE54337.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O118:H16 str. 
2009C-4446]
 gb|EZE61739.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O91:H21 str. 
2009C-4646]
 gb|EZE71279.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O45:H2 str. 
2009C-4780]
 gb|EZE75220.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2009C-4750]
 gb|EZE88271.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2009EL1302]
 gb|EZE96544.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2010C-3794]
 gb|EZG46853.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
06-3464]
 gb|EZG52090.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
03-3500]
 gb|EZG57218.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2010C-4430]
 gb|EZG61496.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2010C-4819]
 gb|EZG69067.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2010C-4834]
 gb|EZG77149.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2010C-5028]
 gb|EZG79846.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2010EL-1699]
 gb|EZG87146.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2011C-3270]
 gb|EZG97340.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2011C-3387]
 gb|EZH00882.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2011C-3282]
 gb|EZH03375.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2011C-3506]
 gb|EZH08512.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2011C-3655]
 gb|EZH11443.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2009C-3612]
 gb|EZH11997.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2009C-3689]
 gb|EZH20781.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2009C-3996]
 gb|EZH26032.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2009C-4760]
 gb|EZH29921.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2009C-4826]
 gb|EZH41681.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2010C-3051]
 gb|EZH45452.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2010C-3472]
 gb|EZH48062.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2010C-3871]
 gb|EZH51420.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2010C-3902]
 gb|EZH59121.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2010C-4244]
 gb|EZJ16474.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-182-04_S4_C3]
 gb|EZJ26717.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-392-07_S4_C2]
 gb|EZJ38358.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-182-04_S4_C2]
 gb|EZJ58858.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-182-04_S4_C1]
 gb|EZJ92866.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-182-04_S1_C3]
 gb|EZK05706.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-176-05_S1_C3]
 gb|EZK11676.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-005-03_S1_C3]
 gb|EZK14998.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-176-05_S1_C2]
 gb|EZK27564.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-182-04_S1_C1]
 gb|EZK29061.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-005-03_S1_C2]
 gb|EZK37439.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-005-03_S1_C1]
 gb|EZQ25108.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H8 str. 
2009EL-2169]
 gb|EZQ25773.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
2010C-3053]
 gb|EZQ34259.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H1 str. 
2009C-4747]
 gb|EZQ41429.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H8 str. 
2011C-3453]
 gb|EZQ43894.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:H8 str. 
2009C-4126]
 gb|KDA61826.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-052-05_S1_C1]
 gb|KDA66706.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-182-04_S1_C2]
 gb|KDF65113.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 59]
 gb|KDG19067.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 74]
 gb|KDG55861.1| 2,3-diketo-L-gulonate reductase [Escherichia coli CHS 77]
 gb|KDG63363.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MGH 57]
 gb|KDG74725.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UCI 53]
 gb|KDG94059.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UCI 66]
 gb|KDM74242.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KDM87806.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KDT10926.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-052-05_S1_C3]
 gb|KDT16296.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-052-05_S3_C1]
 gb|KDT62184.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-267-03_S1_C3]
 gb|KDT93309.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-267-03_S3_C2]
 gb|KDU19480.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-267-03_S1_C1]
 gb|KDU24640.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-267-03_S4_C2]
 gb|KDU60101.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 4-203-08_S1_C1]
 gb|KDV13661.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O78:H12 str. 
00-3279]
 gb|KDV13797.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O111:NM str. 
01-3076]
 gb|KDV33376.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O69:H11 str. 
07-3763]
 gb|KDV40801.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O146:H21 str. 
2010C-3325]
 gb|KDV45374.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O91:H21 str. 
2009C-3740]
 gb|KDV53985.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O121:H19 str. 
2011C-3609]
 gb|KDV59157.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O45:H2 str. 
2010C-4211]
 gb|KDV68114.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O26:H11 str. 
2011C-3274]
 gb|KDV73777.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O118:H16 str. 
07-4255]
 gb|KDV79246.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-052-05_S4_C2]
 gb|KDV79806.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-052-05_S3_C3]
 gb|KDV98408.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-156-04_S3_C1]
 gb|KDV98876.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-156-04_S1_C3]
 gb|KDW15667.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-177-06_S1_C1]
 gb|KDW31213.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-177-06_S1_C2]
 gb|KDW38062.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-177-06_S1_C3]
 gb|KDW43818.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-177-06_S4_C2]
 gb|KDW55626.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-005-03_S3_C1]
 gb|KDW64578.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-005-03_S3_C3]
 gb|KDW86229.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-210-07_S4_C1]
 gb|KDX01457.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-210-07_S3_C2]
 gb|KDX07653.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-177-06_S4_C3]
 gb|KDX23276.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-156-04_S4_C2]
 gb|KDX44486.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-177-06_S3_C2]
 gb|KDX66833.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-222-05_S1_C1]
 gb|KDX74025.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-222-05_S1_C2]
 gb|KDX75659.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-222-05_S1_C3]
 gb|KDY00502.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-316-03_S3_C2]
 gb|KDY05238.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-316-03_S3_C3]
 gb|KDY25635.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-427-07_S1_C2]
 gb|KDY29879.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-427-07_S3_C3]
 gb|KDY30495.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-427-07_S3_C1]
 gb|KDY88162.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-427-07_S1_C3]
 gb|KDZ03831.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ15060.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-474-04_S4_C3]
 gb|KDZ41985.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-020-07_S4_C2]
 gb|KDZ47753.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ73398.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-073-06_S4_C2]
 gb|KDZ94381.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-427-07_S1_C1]
 gb|KEJ44075.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-427-07_S4_C3]
 gb|KEJ57763.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-267-03_S4_C1]
 gb|KEK81653.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-475-03_S1_C2]
 gb|KEK87376.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-475-03_S3_C2]
 gb|KEK91740.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 4-203-08_S1_C2]
 gb|KEK93403.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 4-203-08_S1_C3]
 gb|KEL84464.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-366-08_S3_C2]
 gb|KEM10492.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-319-05_S1_C2]
 gb|KEM24018.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-319-05_S1_C3]
 gb|KEM73539.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-537-08_S3_C1]
 gb|KEM81484.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-537-08_S3_C3]
 gb|KEM98746.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-319-05_S1_C1]
 gb|KEN15054.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-537-08_S3_C2]
 gb|KEN64378.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-392-07_S4_C3]
 gb|KEN73383.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-052-05_S3_C2]
 gb|KEN82954.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-474-04_S4_C1]
 gb|KEN96831.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-392-07_S4_C1]
 gb|KEO06768.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-177-06_S3_C3]
 gb|KEO26549.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-460-02_S1_C1]
 gb|KEO96088.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AIF63151.1| 2,3-diketo-L-gulonate reductase [Escherichia coli B7A]
 gb|AIL37946.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 2003036]
 gb|AIL42890.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri Shi06HN006]
 gb|KFV22427.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KFV28039.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGI47052.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli]
 gb|KGM67074.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 emb|CDX09018.1| 2,3-diketo-L-gulonate reductase,2,3-diketo-L-gulonate reductase,2,3-diketo-L-gulonate 
reductase,Malate/L-lactate dehydrogenases,ureidoglycolate 
dehydrogenase,Malate/L-lactate dehydrogenase 
[Shigella flexneri]
 gb|KGY80287.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri]
 gb|KHG70776.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHG70930.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHG71477.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHG87761.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHG91171.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHG97009.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH03431.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH17879.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH18612.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH23572.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH25675.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH27554.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH37933.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH42640.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH50472.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH66212.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH79788.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH84338.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI02613.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI07006.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI10842.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI27565.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI34726.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI44115.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI58796.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI62210.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI64094.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI70464.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI77743.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI86758.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI97697.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHJ02478.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHJ08009.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHJ13448.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHJ19299.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHJ26065.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AIZ84610.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AIZ89184.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 emb|CEK08011.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli O26:H11]
 emb|CCQ31146.2| 2,3-diketo-L-gulonate reductase, NADH-dependent [Escherichia 
coli]
 gb|KIG28035.1| 2,3-diketo-L-gulonate reductase [Escherichia coli C691-71 (14b)]
 gb|KIG38859.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG56074.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG61919.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG65877.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG88332.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG92658.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIH03679.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIH07377.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIH09890.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIH19822.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIH21032.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIH26577.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AJE58139.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KFH90388.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869042.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacteriaceae]
 ref|YP_001745863.1| 2,3-diketo-L-gulonate reductase [Escherichia coli SMS-3-5]
 ref|YP_002409970.1| 2,3-diketo-L-gulonate reductase [Escherichia coli IAI39]
 ref|YP_006146121.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O7:K1 str. 
CE10]
 sp|B7NP75.1|DLGD_ECO7I RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli IAI39]
 sp|B1LJD7.1|DLGD_ECOSM RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli SMS-3-5]
 gb|ACB16566.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli SMS-3-5]
 gb|EDX36766.1| 3-dehydro-L-gulonate 2-dehydrogenase [Shigella dysenteriae 1012]
 emb|CAR20195.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli IAI39]
 gb|EFF11149.1| conserved hypothetical protein [Escherichia coli B354]
 gb|EFJ82397.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 69-1]
 gb|EFK21232.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 21-1]
 gb|EGE62923.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
STEC_7v]
 gb|EGI89715.1| malate/L-lactate dehydrogenase family protein [Shigella dysenteriae 
155-74]
 gb|EGX02264.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
STEC_MHI813]
 gb|AEQ14835.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O7:K1 str. 
CE10]
 gb|EHN84155.1| 2,3-diketo-L-gulonate reductase [Escherichia coli TA124]
 gb|EHN96341.1| 2,3-diketo-L-gulonate reductase [Escherichia coli B093]
 gb|EHP63788.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 4_1_47FAA]
 gb|EIG80690.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 1.2741]
 gb|EII21735.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 9.0111]
 gb|EIL55631.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KD2]
 gb|EIQ24934.1| 2,3-diketo-L-gulonate reductase [Shigella boydii 965-58]
 gb|ELC35425.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE21]
 gb|ELD79480.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE236]
 gb|ELD84431.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE237]
 gb|ELE56968.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE76]
 gb|ELF14884.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE143]
 gb|ELF52255.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE9]
 gb|ELG09574.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE50]
 gb|ELG23832.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE78]
 gb|ELG35394.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE79]
 gb|ELG47823.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE115]
 gb|ELG81005.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE144]
 gb|ELG91500.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE147]
 gb|ELH49761.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE202]
 gb|ELI50820.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE125]
 gb|EOU63430.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE20]
 gb|EOU68627.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE24]
 gb|EOU87691.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE37]
 gb|EOV01551.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE38]
 gb|EOV23034.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE199]
 gb|EOV61231.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE69]
 gb|EOV69869.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE70]
 gb|EOV85400.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE74]
 gb|EOW02118.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE98]
 gb|EOW27777.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE121]
 gb|EQN22812.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 6 (3-8296502)]
 gb|EQN89640.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 25 (4-5851939)]
 gb|EQO68046.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 44 (4-2298570)]
 gb|EQO70412.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 43 (4-2173468)]
 gb|EQP04081.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 53 (4-0631051)]
 gb|EQQ01031.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 87 (4-5977630)]
 gb|EQT34693.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 182 (4-0985554)]
 gb|EQT51275.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 187 (4-4471660)]
 gb|EQW09602.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 118 (317a)]
 gb|EQW27328.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3033-1]
 gb|EQX29273.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3163-1]
 gb|EQX76013.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3190-1]
 gb|EQX84015.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3200-1]
 gb|EQY80723.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3304-1]
 gb|ERA37019.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3899-1]
 gb|ERB12318.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3144-1]
 gb|ERO98565.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 19C]
 gb|ESA73081.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 110957]
 gb|ESD03988.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907672]
 gb|ESD44366.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907889]
 gb|ESD79147.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908525]
 gb|ESD88745.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908573]
 gb|ESK32579.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3323-1]
 gb|ESP13427.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 136 (4-5970458)]
 gb|ETE09332.1| 2,3-diketo-L-gulonate reductase [Escherichia coli LAU-EC8]
 gb|ETE20811.1| 2,3-diketo-L-gulonate reductase [Escherichia coli LAU-EC10]
 gb|ETE37246.1| 2,3-diketo-L-gulonate reductase [Escherichia coli LAU-EC9]
 emb|CDK44167.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli IS1]
 emb|CDK52780.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli IS5]
 gb|ETX78879.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 43b]
 gb|ETX86677.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 43a]
 gb|ETX99506.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 19B]
 gb|ETY06523.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 19A]
 gb|ETY11115.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 17B]
 gb|ETY17714.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 17A]
 gb|ETY23304.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 15]
 gb|ETY29497.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 9]
 gb|ETY31177.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 3]
 gb|ETY37303.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 2B]
 gb|ETY41064.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BWH 40]
 gb|ETY62881.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 6]
 gb|EWC54477.1| 2,3-diketo-L-gulonate reductase [Escherichia coli EC096/10]
 gb|AHM45824.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AHM50427.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AHM54870.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EZB61218.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O15:H18 str. 
K1516]
 gb|EZQ64555.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 82]
 gb|KDA55937.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-011-08_S1_C1]
 gb|KDG05382.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 71]
 gb|KDG41332.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 77]
 gb|KDG82902.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UCI 57]
 gb|KDG83347.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UCI 58]
 gb|KDG91411.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UCI 65]
 gb|KDU02969.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-267-03_S1_C2]
 gb|KDV63042.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O128:H2 str. 
2011C-3317]
 gb|KDW70892.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-392-07_S1_C1]
 gb|KEJ07561.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-175-07_S1_C2]
 gb|KEJ72365.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-366-08_S1_C3]
 gb|KEL67957.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-366-08_S1_C1]
 gb|KEL73022.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-366-08_S3_C3]
 gb|KEL93412.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-366-08_S3_C1]
 gb|KEM50208.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-175-07_S1_C3]
 gb|AIX65520.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI22519.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIE73694.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869044.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 ref|YP_671554.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 536]
 sp|Q0TBM6.1|DLGD_ECOL5 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli 536]
 gb|ABG71653.1| hypothetical oxidoreductase YiaK [Escherichia coli 536]
 gb|EDV68999.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli F11]
 gb|EFJ62967.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 200-1]
 gb|EGB83463.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 60-1]
 gb|ELD12211.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE206]
 gb|ELF46171.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE8]
 gb|ELI64117.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE131]
 gb|EQO06132.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 28 (4-0907367)]
 gb|EQP05474.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 56 (4-2153033)]
 gb|EQQ36838.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 100 (4-2850729)]
 gb|EQQ84492.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 112 (4-5987253)]
 gb|EQT47244.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 185 (4-2876639)]
 gb|EQV30632.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 30 (63a)]
 gb|EQV66050.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 58 (171a)]
 gb|EQV81687.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 70 (185a)]
 gb|EQW16201.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3022-1]
 gb|EQW52761.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3097-1]
 gb|EQW63974.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3113-1]
 gb|EQY25918.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3217-1]
 gb|EQZ08905.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3341-1]
 gb|EQZ30999.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3585-1]
 gb|EQZ36210.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3617-1]
 gb|ESE28525.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli A35218R]
 gb|ESK13013.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3426-1]
 gb|ESK14699.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3290-1]
 gb|KDO88577.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001742386.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacteriaceae]
 gb|EMW84398.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 180050]
 gb|ESL32585.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 37]
 gb|KEL58285.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-172-05_S1_C3]
 gb|KHH48552.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869026.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EIG90993.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 97.0246]
 gb|EYZ04770.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O177:NM str. 
2010C-4558]
 gb|EZE05813.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O145:H28 str. 
2009C-3292]
 gb|KDV37173.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O145:H25 str. 
07-3858]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869049.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EGW67413.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
STEC_B2F1]
 gb|EIH31908.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 96.0497]
 gb|KFV26552.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KFV36195.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869037.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase, NADH-dependent 
[Enterobacteriaceae]
 ref|NP_418032.1| 2,3-diketo-L-gulonate reductase, NADH-dependent [Escherichia 
coli str. K-12 substr. MG1655]
 ref|YP_001460371.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HS]
 ref|YP_001723148.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ATCC 8739]
 ref|YP_001732404.1| 2,3-diketo-L-gulonate reductase [Escherichia coli str. K-12 substr. 
DH10B]
 ref|YP_002928461.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BW2952]
 ref|YP_003001124.1| 2,3-diketo-L-gulonate reductase monomer, subunit of 2,3-diketo-L-gulonate 
reductase [Escherichia coli BL21(DE3)]
 ref|YP_003034421.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 'BL21-Gold(DE3)pLysS 
AG']
 ref|YP_003046607.1| 2,3-diketo-L-gulonate reductase [Escherichia coli B str. REL606]
 ref|YP_003055997.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli BL21(DE3)]
 ref|YP_006090118.1| malate/L-lactate dehydrogenase [Escherichia coli DH1]
 ref|YP_006136041.1| hypothetical protein UMNK88_4360 [Escherichia coli UMNK88]
 ref|YP_006170692.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P12b]
 ref|YP_006130857.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DH1]
 ref|YP_491859.1| 2,3-diketo-L-gulonate dehydrogenase [Escherichia coli str. K-12 
substr. W3110]
 ref|YP_007558565.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli str. K-12 substr. MDS42]
 sp|P37672.2|DLGD_ECOLI RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli K-12]
 sp|A8A634.1|DLGD_ECOHS RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli HS]
 sp|B1IZL7.1|DLGD_ECOLC RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli ATCC 8739]
 sp|B1X8J1.1|DLGD_ECODH RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli str. K-12 substr. DH10B]
 sp|C4ZXG6.1|DLGD_ECOBW RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli BW2952]
 gb|AAC76599.1| 2,3-diketo-L-gulonate reductase, NADH-dependent [Escherichia 
coli str. K-12 substr. MG1655]
 dbj|BAE77718.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli str. K-12 substr. W3110]
 gb|ABV07988.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli HS]
 gb|ACA75821.1| Malate/L-lactate dehydrogenase [Escherichia coli ATCC 8739]
 gb|ACB04626.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli str. K-12 substr. DH10B]
 gb|EDX41306.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 101-1]
 gb|EEH71292.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. 1_1_43]
 gb|ACR61745.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli BW2952]
 emb|CAQ33895.1| 2,3-diketo-L-gulonate reductase monomer, subunit of 2,3-diketo-L-gulonate 
reductase [Escherichia coli BL21(DE3)]
 gb|ACT27236.1| Malate/L-lactate dehydrogenase [Escherichia coli 'BL21-Gold(DE3)pLysS 
AG']
 gb|ACT41071.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli B str. REL606]
 gb|ACT45226.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli BL21(DE3)]
 gb|ACX37829.1| Malate/L-lactate dehydrogenase [Escherichia coli DH1]
 gb|EFI90861.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 196-1]
 gb|EFJ65436.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 175-1]
 gb|EFK13949.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 116-1]
 gb|EFK90547.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 146-1]
 gb|EFQ00728.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
1827-70]
 dbj|BAJ45312.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DH1]
 gb|EFU98972.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
3431]
 gb|EGB35732.1| malate/L-lactate dehydrogenase [Escherichia coli E482]
 gb|EGB66579.1| malate/L-lactate dehydrogenase [Escherichia coli TA007]
 gb|EGI08808.1| 2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase) [Escherichia coli H736]
 gb|AEE58878.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gb|AEJ58983.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
UMNF18]
 gb|EGU26528.1| 2,3-diketo-L-gulonate reductase [Escherichia coli XH140A]
 gb|EGV46958.1| 2,3-diketo-L-gulonate reductase [Escherichia coli XH001]
 gb|EGW91048.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
STEC_EH250]
 gb|EGX02618.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
G58-1]
 gb|EGX19796.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
STEC_S1191]
 dbj|BAL40172.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli str. K-12 substr. MDS42]
 gb|EHV52692.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC6B]
 gb|EHV53369.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC6A]
 gb|EHV56283.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC6C]
 gb|EHV67556.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC6D]
 gb|EHV69655.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC6E]
 gb|AFG42522.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P12b]
 gb|EIE38981.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
J53]
 gb|EIF16868.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O32:H37 str. 
P4]
 gb|EIF84657.1| 2,3-diketo-L-gulonate reductase [Escherichia coli M919]
 gb|EIG45777.1| 2,3-diketo-L-gulonate reductase [Escherichia coli H730]
 gb|EIG68714.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. 4_1_40B]
 gb|EII44177.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 2.3916]
 gb|EII67101.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 2.4168]
 gb|EII78317.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 3.2303]
 gb|EIJ03358.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli B41]
 gb|EIL72123.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 75]
 gb|EKI15994.1| 2,3-diketo-L-gulonate reductase [Escherichia coli TW15901]
 gb|EKI24022.1| 2,3-diketo-L-gulonate reductase [Escherichia coli TW00353]
 gb|EKI34013.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3006]
 gb|EKJ80675.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
AD30]
 gb|EKK40240.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 8.0566]
 gb|EKK41250.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 8.0569]
 gb|ELC56811.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE44]
 gb|ELD27436.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE212]
 gb|ELD69436.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE233]
 gb|ELD95777.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE51]
 gb|ELE16023.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE56]
 gb|ELE61072.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE77]
 gb|ELE68807.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE81]
 gb|ELE95831.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE111]
 gb|ELF06114.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE119]
 gb|ELF16802.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE156]
 gb|ELF34952.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE171]
 gb|ELF70524.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE42]
 gb|ELH00211.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE154]
 gb|ELH43891.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE197]
 gb|ELI35423.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE120]
 gb|ELJ53838.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE232]
 emb|CCP95806.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli O10:K5(L):H4 
str. ATCC 23506]
 emb|CCQ03641.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli O5:K4(L):H4 
str. ATCC 23502]
 gb|EMD05074.1| 2,3-diketo-L-gulonate reductase [Escherichia coli S17]
 gb|EMR92918.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli ONT:H33 str. C48/93]
 gb|EMS05776.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli O127:H27 str. C43/90]
 gb|EMU74141.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021017.9]
 gb|EMU75940.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021017.6]
 gb|EMU78194.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021017.5]
 gb|EMU89274.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021017.4]
 gb|EMU90607.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021017.3]
 gb|EMU93078.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021017.2]
 gb|EMV04244.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021017.10]
 gb|EMV14886.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021017.12]
 gb|EMV82672.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2861200]
 gb|EMW28608.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2845350]
 gb|EMW53709.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2762100]
 gb|EMW73868.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2731150]
 gb|EMX17981.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0301867.1]
 gb|EMX21366.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021566.1]
 gb|EMX36043.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021017.1]
 gb|EMX82549.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2719100]
 gb|EMZ76432.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2722950]
 gb|ENA11430.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.1]
 gb|ENA13360.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE008_MS-13]
 gb|ENA17204.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 201600.1]
 gb|ENA27938.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE007_MS-11]
 gb|ENA37343.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0301867.4]
 gb|ENA49000.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2726950]
 gb|ENA58363.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 178900]
 gb|ENA74835.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2730450]
 gb|ENA76532.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2741950]
 gb|ENA91780.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2862600]
 gb|ENB08842.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2875150]
 gb|ENB10644.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE008_MS-01]
 gb|ENB19047.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE011_MS-01]
 gb|ENB25260.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE030_MS-09]
 gb|ENB30790.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE032_MS-12]
 gb|ENB36378.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.10]
 gb|ENB45407.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.11]
 gb|ENB51684.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.14]
 gb|ENB54651.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.12]
 gb|ENB59477.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.2]
 gb|ENB72788.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.8]
 gb|ENB74532.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.9]
 gb|ENB75166.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.7]
 gb|ENB85671.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299438.10]
 gb|ENC00477.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299438.4]
 gb|ENC89048.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0301867.11]
 gb|ENC89832.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0301867.8]
 gb|END38472.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2733950]
 gb|END62930.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.4]
 gb|END88150.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0301867.13]
 gb|ENG94510.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0301867.3]
 gb|ENH06546.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0301867.7]
 gb|EOU41842.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE35]
 gb|EOU56065.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE14]
 gb|EOU86872.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE34]
 gb|EOV08786.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE40]
 gb|EOV15116.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE198]
 gb|EOV47699.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE61]
 gb|EOV71766.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE71]
 gb|EOV74815.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE73]
 gb|EOW10317.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE103]
 gb|EOW28066.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE108]
 gb|EOW41482.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE130]
 gb|EOW43538.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE132]
 gb|EOW56187.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE155]
 gb|EOW89650.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE41]
 gb|EQQ17438.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 91 (4-4638751)]
 gb|EQS82439.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 164 (4-5953081)]
 gb|EQU74462.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 209 (4-3062651)]
 gb|EQV04643.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 221 (4-3136817)]
 gb|EQV53406.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 40 (102a)]
 gb|EQW28388.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3052-1]
 gb|EQW88946.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3139-1]
 gb|EQX49134.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3174-1]
 gb|EQX66682.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3180-1]
 gb|EQX81182.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3199-1]
 gb|EQY14980.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3212-1]
 gb|EQY56915.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3240-1]
 gb|EQY83989.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3314-1]
 gb|EQZ30629.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3592-1]
 gb|EQZ36324.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3609-1]
 gb|EQZ62172.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3682-1]
 gb|ERA14470.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3889-1]
 gb|ERA98111.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 3 (4a)]
 gb|ERB01611.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 7 (16a)]
 gb|ERB22416.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3150-1]
 gb|ERB25175.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3271-1]
 gb|AGX35527.1| 2,3-diketo-L-gulonate reductase, NADH-dependent [Escherichia 
coli C321.deltaA]
 gb|ESA93545.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 909945-2]
 gb|ESE10640.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908658]
 gb|ESL19296.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 39]
 gb|ESP33098.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 152 (4-3447545)]
 gb|ESP42378.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3148-1]
 emb|CDJ73300.1| 2,3-diketo-L-gulonate reductase [Escherichia coli str. K-12 substr. 
MC4100]
 gb|ESS91846.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli CE549]
 gb|EST64204.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ECC-Z]
 gb|EST75499.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ECA-727]
 gb|EST88937.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ECA-0157]
 emb|CDK84481.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli IS25]
 emb|CDK78592.1| 3-dehydro-L-gulonate 2-dehydrogenase [Klebsiella pneumoniae IS22]
 gb|ETS27930.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O6:H16:CFA/II 
str. B2C]
 gb|AHM32144.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AHM32570.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AHM37172.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EYB48110.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EYD80417.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-176-05_S3_C1]
 gb|EYD95080.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-110-08_S4_C3]
 gb|EYD96317.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-110-08_S4_C2]
 gb|EYE18009.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-110-08_S1_C3]
 gb|EYE32752.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-110-08_S1_C1]
 gb|EYV91145.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O6:H16 str. 
99-3165]
 gb|EZA70310.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O157:H16 str. 
98-3133]
 gb|EZA73907.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O25:NM str. 
E2539C1]
 gb|EZA80016.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O6:H16 str. 
F5656C1]
 gb|EZJ18890.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-176-05_S4_C3]
 gb|EZJ34253.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-250-04_S4_C2]
 gb|EZJ51853.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-250-04_S4_C1]
 gb|EZJ66944.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-392-07_S3_C3]
 gb|EZJ67065.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-176-05_S4_C1]
 gb|KDA77845.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-011-08_S3_C2]
 gb|KDA82944.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-011-08_S3_C3]
 gb|KDA88157.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-176-05_S4_C2]
 emb|CDP74403.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 emb|CDP75182.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
 gb|KDP15440.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KDS96398.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-011-08_S3_C1]
 gb|KDS96566.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-011-08_S1_C3]
 gb|KDT02271.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-011-08_S4_C1]
 gb|KDT14935.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-011-08_S4_C3]
 gb|KDT34919.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-105-05_S1_C1]
 gb|KDT37769.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-105-05_S3_C1]
 gb|KDT49594.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-105-05_S3_C2]
 gb|KDT49866.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-105-05_S4_C3]
 gb|KDT66648.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-267-03_S3_C1]
 gb|KDT68962.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-373-03_S3_C1]
 gb|KDT71144.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-373-03_S3_C3]
 gb|KDT79767.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-373-03_S1_C2]
 gb|KDT84170.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-475-03_S4_C1]
 gb|KDT84903.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-475-03_S1_C1]
 gb|KDT91168.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-105-05_S4_C1]
 gb|KDU08289.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-373-03_S3_C2]
 gb|KDU10292.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-105-05_S3_C3]
 gb|KDU29580.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-373-03_S4_C2]
 gb|KDU34446.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-073-06_S4_C1]
 gb|KDU39438.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-373-03_S1_C3]
 gb|KDU45886.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-373-03_S1_C1]
 gb|KDU51316.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-373-03_S4_C1]
 gb|KDU57885.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-475-03_S4_C2]
 gb|KDU67565.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 4-203-08_S4_C3]
 gb|KDW05181.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-156-04_S3_C3]
 gb|KDW15910.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-156-04_S4_C1]
 gb|KDW49500.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-210-07_S1_C3]
 gb|KDW61876.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-392-07_S3_C2]
 gb|KDW80288.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-005-03_S4_C1]
 gb|KDW91344.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-210-07_S1_C2]
 gb|KDX05616.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-392-07_S3_C1]
 gb|KDX18452.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-210-07_S3_C3]
 gb|KDX38796.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-156-04_S4_C3]
 gb|KDX54300.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-210-07_S3_C1]
 gb|KDX57072.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-210-07_S4_C2]
 gb|KDX62684.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-210-07_S4_C3]
 gb|KDX86970.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-222-05_S4_C2]
 gb|KDX93908.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-316-03_S3_C1]
 gb|KDY17210.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-316-03_S4_C2]
 gb|KDY51082.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-460-02_S3_C1]
 gb|KDY58331.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-460-02_S3_C2]
 gb|KDY59701.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-460-02_S3_C3]
 gb|KDY77849.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-474-04_S1_C1]
 gb|KDY90931.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-474-04_S3_C1]
 gb|KDY98336.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-474-04_S3_C2]
 gb|KDZ17888.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ20788.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ23674.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-020-07_S1_C2]
 gb|KDZ30878.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ59906.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-073-06_S3_C1]
 gb|KDZ60140.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-073-06_S1_C2]
 gb|KDZ70499.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-073-06_S3_C2]
 gb|KDZ79191.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-073-06_S4_C3]
 gb|KDZ80502.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-105-05_S1_C2]
 gb|KDZ91416.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-105-05_S1_C3]
 gb|KEK92720.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 4-203-08_S3_C3]
 gb|KEL06606.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 4-203-08_S3_C2]
 gb|KEL08633.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 4-203-08_S4_C2]
 gb|KEL17107.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 4-203-08_S3_C1]
 gb|KEL23440.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-373-03_S4_C3]
 gb|KEL23495.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-172-05_S4_C2]
 gb|KEL27873.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-366-08_S4_C2]
 gb|KEL38309.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-172-05_S4_C1]
 gb|KEL55158.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-172-05_S3_C1]
 gb|KEL60392.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-172-05_S4_C3]
 gb|KEM02203.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-175-07_S4_C2]
 gb|KEM02657.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-175-07_S4_C1]
 gb|KEM28714.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-319-05_S4_C2]
 gb|KEM38005.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-537-08_S1_C1]
 gb|KEM45830.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-175-07_S4_C3]
 gb|KEM57019.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-319-05_S4_C3]
 gb|KEM59812.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 7-233-03_S1_C2]
 gb|KEM69731.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 7-233-03_S3_C1]
 gb|KEM87138.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-222-05_S4_C1]
 gb|KEM88678.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-537-08_S4_C1]
 gb|KEM97622.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 7-233-03_S1_C3]
 gb|KEM99501.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 7-233-03_S3_C3]
 gb|KEN20941.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 7-233-03_S3_C2]
 gb|KEN39317.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 7-233-03_S4_C1]
 gb|KEN45054.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-537-08_S1_C2]
 gb|KEN51722.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 7-233-03_S4_C3]
 gb|KEN52044.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-537-08_S1_C3]
 gb|KEN60306.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-537-08_S4_C2]
 gb|KEO13672.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-222-05_S4_C3]
 gb|KEP08713.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AIF38859.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KLY]
 emb|CDU41594.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KFF38838.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KFF53689.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 emb|CEE05571.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AIN33902.1| 2,3-diketo-L-gulonate reductase, NADH-dependent [Escherichia 
coli BW25113]
 gb|KGA88595.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 emb|CDY63189.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 emb|CDZ22351.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGL71568.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli NCTC 50110]
 gb|KGM61698.1| 2,3-diketo-L-gulonate reductase [Escherichia coli G3/10]
 gb|KGM72383.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGM76024.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGM84931.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGM85805.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGP10389.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGP13283.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGP20472.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGP38085.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGT04735.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGT10668.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGT20247.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGT23352.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGT28703.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KGT30574.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHD37857.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHD45266.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHD54495.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHD58005.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH11201.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH50281.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH57226.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH68585.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH72315.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHH89517.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI12844.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI15718.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI32313.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI57867.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KHI88558.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|AIZ30057.1| 2,3-diketo-L-gulonate reductase, NADH-dependent [Escherichia 
coli ER2796]
 gb|AIZ53381.1| 2,3-diketo-L-gulonate reductase, NADH-dependent [Escherichia 
coli K-12]
 gb|AIZ93626.1| 2,3-diketo-L-gulonate reductase [Escherichia coli str. K-12 substr. 
MG1655]
 gb|AJB53596.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG34870.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG46003.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG53910.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG70613.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG72849.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG80637.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIG97485.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIH32551.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001593529.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMW03923.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2850750]
 gb|ENE74189.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.15]
 gb|ENH29585.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.4]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_039020894.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001573022.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ENE38952.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302293.8]
 gb|ENF31981.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.14]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001480802.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ENC67976.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299917.6]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869032.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EIQ68198.1| 2,3-diketo-L-gulonate reductase [Escherichia coli EPEC C342-62]
Length=332

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869038.1| 2,3-diketo-L-gulonate reductase [Shigella boydii]
 ref|YP_001882229.1| 2,3-diketo-L-gulonate reductase [Shigella boydii CDC 3083-94]
 gb|ACD07337.1| 3-dehydro-L-gulonate 2-dehydrogenase [Shigella boydii CDC 3083-94]
Length=329

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KFH78887.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032240859.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KEK77059.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-475-03_S3_C1]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869035.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Escherichia]
 ref|YP_002400076.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ED1a]
 ref|YP_002558424.1| 2,3-diketo-L-gulonate reductase [Escherichia coli LF82]
 ref|YP_006121902.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O83:H1 str. 
NRG 857C]
 ref|YP_003351400.1| putative dehydrogenase [Escherichia coli SE15]
 sp|B7N223.1|DLGD_ECO81 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli ED1a]
 emb|CAR10394.2| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli ED1a]
 emb|CAP78035.1| 2,3-diketo-L-gulonate reductase [Escherichia coli LF82]
 dbj|BAI56950.1| putative dehydrogenase [Escherichia coli SE15]
 gb|ADR28968.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O83:H1 str. 
NRG 857C]
 gb|EGH38153.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli AA86]
 gb|EGI25139.1| 2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase) [Escherichia coli TA206]
 gb|EII97499.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli TW07793]
 gb|ELC33862.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE25]
 gb|ELC46612.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE28]
 gb|ELC61756.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE178]
 gb|ELC81699.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE189]
 gb|ELC88297.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE191]
 gb|ELD38893.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE216]
 gb|ELF26861.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE162]
 gb|ELF48139.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE6]
 gb|ELF54255.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE17]
 gb|ELF61911.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE18]
 gb|ELF72377.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE23]
 gb|ELH12078.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE165]
 gb|ELH68416.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE211]
 gb|ELH70313.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE217]
 gb|ELI03352.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE104]
 gb|ELI08029.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE106]
 gb|ELI81651.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE139]
 gb|ELI92366.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE148]
 gb|ELI93753.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE150]
 gb|ELL44035.1| 2,3-diketo-L-gulonate reductase [Escherichia coli J96]
 gb|EOV04512.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE195]
 gb|EOX27913.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE186]
 emb|CDC75319.1| 2 3-diketo-L-gulonate reductase [Escherichia coli CAG:4]
 gb|EQN14413.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 4 (4-7276109)]
 gb|EQN50413.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 17 (4-7473087)]
 gb|EQN73090.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 21 (4-4517873)]
 gb|EQN82347.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 24 (4-5985145)]
 gb|EQO83357.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 46 (4-2758776)]
 gb|EQP66204.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 78 (4-2735946)]
 gb|EQP86519.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 84 (4-1021478)]
 gb|EQQ11296.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 90 (4-3191362)]
 gb|EQQ72173.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 111 (4-7039018)]
 gb|EQR91757.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 138 (4-6066704)]
 gb|EQS00533.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 141 (4-5995973)]
 gb|EQS10584.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 143 (4-5674999)]
 gb|EQS30868.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 146 (4-3189767)]
 gb|EQS46926.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 153 (3-9344314)]
 gb|EQS62886.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 154 (4-5636698)]
 gb|EQS76541.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 162 (4-5627982)]
 gb|EQS96583.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 171 (4-3191958)]
 gb|EQT66393.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 190 (4-3255514)]
 gb|EQU10683.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 197 (4-4466217)]
 gb|EQU30734.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 202 (4-3163997)]
 gb|EQU43620.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 205 (4-3094677)]
 gb|EQW63063.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3108-1]
 gb|EQX07855.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3155-1]
 gb|EQX16635.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3160-1]
 gb|EQX64068.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3185-1]
 gb|EQX73792.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3193-1]
 gb|EQY53073.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3244-1]
 gb|EQZ87084.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3703-1]
 gb|ERA31365.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3955-1]
 gb|ERA34572.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 4075-1]
 gb|ERA90231.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 228 (4-7787030)]
 gb|ESC93687.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907446]
 gb|ESK24953.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3693-1]
 gb|ESP41386.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 108 (4-6924867)]
 gb|ETF15712.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 177 (4-2876612)]
 gb|EZA10197.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O81:NM str. 
02-3012]
 gb|EZJ35466.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-005-03_S4_C3]
 gb|EZJ48430.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-005-03_S4_C2]
 gb|EZQ56608.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 83]
 gb|KDT26425.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-052-05_S4_C1]
 gb|KDT43170.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-105-05_S4_C2]
 gb|KDY14903.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-316-03_S4_C3]
 gb|KEJ54910.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-020-07_S4_C1]
 gb|KEJ74459.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-175-07_S3_C2]
 gb|KEL89206.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-175-07_S3_C1]
 gb|KEL98611.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-175-07_S3_C3]
 gb|KEM19063.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-319-05_S3_C1]
 gb|KEM27222.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-319-05_S3_C2]
 gb|KEM58475.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 6-319-05_S3_C3]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869015.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Shigella]
 ref|YP_409893.1| 2,3-diketo-L-gulonate reductase [Shigella boydii Sb227]
 sp|Q31V43.1|DLGD_SHIBS RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Shigella boydii Sb227]
 gb|ABB68065.1| putative dehydrogenase [Shigella boydii Sb227]
 gb|EFW62407.1| 3-dehydro-L-gulonate 2-dehydrogenase [Shigella flexneri CDC 796-83]
 gb|EGI94472.1| malate/L-lactate dehydrogenase family protein [Shigella boydii 
3594-74]
 gb|EIQ04272.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri CCH060]
 gb|EIQ32612.1| 2,3-diketo-L-gulonate reductase [Shigella boydii 4444-74]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032233816.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EYD99152.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-110-08_S4_C1]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001724044.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMW32558.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2785200]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869034.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EHU04732.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC1C]
 gb|EHU04936.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC1A]
 gb|EHU07845.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC1B]
 gb|EHU18164.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC1D]
 gb|EHU21439.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC1E]
 gb|EHU24455.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC2A]
 gb|EHU35535.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC2B]
 gb|EHU37831.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC2C]
 gb|EHU39821.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC2D]
 gb|EHU51108.1| 2,3-diketo-L-gulonate reductase [Escherichia coli DEC2E]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869045.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri]
 gb|EGK17234.1| malate/L-lactate dehydrogenase family protein [Shigella flexneri 
K-272]
 gb|EGK32740.1| malate/L-lactate dehydrogenase family protein [Shigella flexneri 
K-227]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|EGB61409.1| malate/L-lactate dehydrogenase [Escherichia coli M863]
Length=330

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  14   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  52



>ref|WP_001560093.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ELE39633.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE66]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_033802940.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_029403569.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869036.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 ref|YP_002331291.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O127:H6 str. 
E2348/69]
 sp|B7ULD6.1|DLGD_ECO27 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli O127:H6 str. E2348/69]
 emb|CAS11375.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli O127:H6 str. E2348/69]
 gb|EQR40215.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 125 (4-2634716)]
 gb|EQV63212.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 56 (169a)]
 gb|EQY37213.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3221-1]
 gb|EQY40716.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3230-1]
 gb|ERA46085.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 4076-1]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024046337.1| hypothetical protein [Escherichia coli]
 gb|ETJ10421.1| hypothetical protein Q609_ECAC02899G0002 [Escherichia coli DORA_A_5_14_21]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023063767.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli]
 gb|ESA25136.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli SCD2]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_021559573.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ERB15768.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3151-1]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001567101.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ENE27556.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302293.4]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001503070.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|END35698.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.13]
 gb|ENF60087.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.7]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001526420.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMV36826.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE019_MS-13]
 gb|ENA42889.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0301867.2]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001774637.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ELJ10944.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE163]
 gb|EOV33887.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE221]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869041.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EGP23118.1| 2,3-diketo-L-gulonate reductase [Escherichia coli PCN033]
 gb|EIH12208.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 97.0259]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001399489.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMV67335.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2866550]
 gb|EMV98535.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2851500]
 gb|EMW18508.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2848050]
 gb|EMZ75737.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 199900.1]
 gb|ENA90105.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2860650]
 gb|ENC11888.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299438.6]
 gb|ENC21610.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299438.8]
 gb|ENE98286.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304777.7]
 gb|ENF68637.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0304816.9]
 gb|ENG52940.1| 2,3-diketo-L-gulonate reductase [Escherichia coli p0305293.2]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001433848.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMV07881.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP021017.11]
 gb|ENB57985.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.15]
 gb|END54239.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BCE006_MS-23]
 gb|END63477.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0298942.3]
 gb|ENG99449.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0301867.5]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869022.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Escherichia]
 gb|EGB70121.1| malate/L-lactate dehydrogenase [Escherichia coli TW10509]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869046.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EGB55052.1| malate/L-lactate dehydrogenase [Escherichia coli H489]
 gb|EMV52452.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2872000]
 gb|EMZ63304.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2846750]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KFH83696.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032185411.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KDW28736.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-156-04_S3_C2]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869020.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Escherichia]
 ref|YP_002414729.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMN026]
 sp|B7NEM8.1|DLGD_ECOLU RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli UMN026]
 emb|CAR15229.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli UMN026]
 gb|EFE99044.1| 2,3-diketo-L-gulonate reductase [Escherichia coli FVEC1412]
 gb|EFI18301.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli FVEC1302]
 gb|EFJ73499.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 198-1]
 gb|EGW64170.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
STEC_C165-02]
 gb|EIL69955.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 576-1]
 gb|ELB96177.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE2]
 gb|ELC44126.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE26]
 gb|ELC70239.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE181]
 gb|ELD02786.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE204]
 gb|ELD17664.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE208]
 gb|ELD58033.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE228]
 gb|ELD75621.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE235]
 gb|ELE67920.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE80]
 gb|ELE77486.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE83]
 gb|ELE96822.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE116]
 gb|ELG11067.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE54]
 gb|ELG96584.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE158]
 gb|ELH17851.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE190]
 gb|ELI03662.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE105]
 gb|ELI39076.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE122]
 gb|ELI51490.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE128]
 gb|ELJ40043.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE177]
 gb|ELJ63020.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE82]
 gb|EOU48811.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE231]
 gb|EOV20143.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE200]
 gb|EOV57673.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE68]
 gb|EOW32246.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE127]
 gb|EOW58207.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE134]
 gb|EOW64373.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE170]
 gb|EOW73268.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. KTE172]
 gb|EOW88991.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE1]
 gb|EOX15346.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE225]
 gb|EQN38226.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 10 (4-6832164)]
 gb|EQN78576.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 22 (4-2258986)]
 gb|EQO04639.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 29 (4-3418073)]
 gb|EQO75760.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 45 (4-3129918)]
 gb|EQP22144.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 63 (4-2542528)]
 gb|EQP32060.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 69 (4-2837072)]
 gb|EQP89481.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 85 (4-0792144)]
 gb|EQQ00763.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 88 (4-5854636)]
 gb|EQQ56638.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 106 (4-6881831)]
 gb|EQQ63668.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 110 (4-6978754)]
 gb|EQQ85161.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 113 (4-7535473)]
 gb|EQR17519.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 119 (4-6879578)]
 gb|EQR30845.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 122 (4-6851606)]
 gb|EQR59646.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 130 (4-7036876)]
 gb|EQR72604.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 135 (4-4449320)]
 gb|EQR81520.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 134 (4-6073441)]
 gb|EQR83350.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 133 (4-4466519)]
 gb|EQR99505.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 140 (4-5894387)]
 gb|EQS27368.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 145 (4-5672112)]
 gb|EQS44689.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 151 (4-5755573)]
 gb|EQS80109.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 163 (4-4697553)]
 gb|EQS84585.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 167 (4-6073565)]
 gb|EQT10053.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 173 (3-9175482)]
 gb|EQT34227.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 183 (4-3205932)]
 gb|EQT73170.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 189 (4-3220125)]
 gb|EQU46578.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 206 (4-3128229)]
 gb|EQU57694.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 208 (4-3112292)]
 gb|EQU85600.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 215 (4-3008371)]
 gb|EQV18058.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 223 (4-2976528)]
 gb|EQV76412.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 68 (182a)]
 gb|EQV80740.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 62 (175a)]
 gb|EQV98211.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 73 (195a)]
 gb|ERA64344.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 155 (4-4509048)]
 gb|ESD18119.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907715]
 gb|ESD45557.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908521]
 gb|ESD48760.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908522]
 gb|ESD83929.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908585]
 gb|ESD85300.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908616]
 gb|EYB62559.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KDA71652.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-005-03_S3_C2]
 gb|KDG72649.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MGH 58]
 gb|KEJ21722.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-316-03_S1_C1]
 gb|KEJ22859.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-316-03_S1_C2]
 gb|KEP16477.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869058.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Escherichia]
 gb|EOU46067.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. KTE114]
Length=332

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_020235684.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=335

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869040.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=333

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_016160049.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Escherichia]
 gb|EOQ46357.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE33]
 gb|EOU83978.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. KTE31]
Length=332

 Score = 85.9 bits (211),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001493492.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ENC96455.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0302308.10]
Length=332

 Score = 85.9 bits (211),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_021549997.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EQV95531.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 71 (186a)]
Length=332

 Score = 85.9 bits (211),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|ESA79020.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907713]
Length=345

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  29   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  67



>ref|WP_000869033.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EFR15250.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
2362-75]
Length=325

 Score = 85.9 bits (211),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001706630.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMV52861.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2871950]
Length=332

 Score = 85.9 bits (211),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_020231430.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 85.9 bits (211),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869021.1| lactate dehydrogenase [Escherichia sp. TW15838]
Length=332

 Score = 85.9 bits (211),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032358804.1| 2,3-diketo-L-gulonate reductase, partial [Escherichia coli]
 gb|EZA23611.1| 2,3-diketo-L-gulonate reductase, partial [Escherichia coli O28ac:NM 
str. 02-3404]
Length=330

 Score = 85.9 bits (211),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_038355711.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. HT073016]
Length=330

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LVSRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869055.1| 2,3-diketo-L-gulonate reductase [Escherichia albertii]
Length=332

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869057.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Escherichia]
 gb|ELC15893.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. KTE11]
 gb|EOV46211.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. KTE52]
 gb|EOV92761.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. KTE96]
 gb|EOW60015.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. KTE159]
Length=332

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LVSRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032202711.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EYV92568.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O86:H34 str. 
99-3124]
 gb|KDY40388.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-427-07_S4_C1]
Length=332

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVD+ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDNETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024248328.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVD+ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDNETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869017.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EFM50924.1| 2,3-diketo-L-gulonate reductase [Escherichia coli NC101]
 gb|ELC25122.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE16]
 gb|ELC25607.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE15]
 gb|ELD49570.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE224]
 gb|ELE48051.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE72]
 gb|ELE78146.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE86]
 gb|ELE87435.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE93]
 gb|ELF34678.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE169]
 gb|ELF80206.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE43]
 gb|ELH10199.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE194]
 gb|ELH40580.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE183]
 gb|ELH58953.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE207]
 gb|ELH74267.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE215]
 gb|ELI22716.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE113]
 gb|ELI67822.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE133]
 gb|ELI85019.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE145]
 gb|ELJ24376.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE168]
 gb|ELJ66837.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE88]
 gb|EOV86982.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE89]
 gb|EQO43407.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 38 (4-2774682)]
 gb|EQZ14939.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3391-1]
 gb|KIE66851.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVD+ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDNETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|AHE60243.1| 2,3-diketo-L-gulonate reductase [Escherichia albertii KF1]
Length=332

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869054.1| 2,3-diketo-L-gulonate reductase [Escherichia albertii]
Length=332

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001540049.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ELD07924.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE205]
 gb|ELI55606.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE129]
 gb|ELJ67078.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE85]
 gb|EOW93528.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE182]
Length=332

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVD+ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDNETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869018.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Escherichia]
 ref|NP_756258.1| 2,3-diketo-L-gulonate reductase [Escherichia coli CFT073]
 ref|YP_543076.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UTI89]
 ref|YP_859181.1| 2,3-diketo-L-gulonate reductase [Escherichia coli APEC O1]
 ref|YP_002393565.1| 2,3-diketo-L-gulonate reductase [Escherichia coli S88]
 ref|YP_006103121.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli IHE3034]
 ref|YP_006112473.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UM146]
 ref|YP_006151213.1| 2,3-diketo-L-gulonate reductase [Escherichia coli str. 'clone 
D i2']
 ref|YP_006156132.1| 2,3-diketo-L-gulonate reductase [Escherichia coli str. 'clone 
D i14']
 ref|YP_006107986.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli ABU 83972]
 ref|YP_008573658.1| 2,3-diketo-L-gulonate reductase [Escherichia coli PMV-1]
 sp|Q8FCD6.1|DLGD_ECOL6 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli CFT073]
 sp|Q1R519.1|DLGD_ECOUT RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli UTI89]
 sp|A1AHB7.1|DLGD_ECOK1 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli APEC O1]
 sp|B7MFE1.1|DLGD_ECO45 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli S88]
 gb|AAN82832.1|AE016768_250 Hypothetical oxidoreductase yiaK [Escherichia coli CFT073]
 gb|ABE09545.1| hypothetical oxidoreductase YiaK [Escherichia coli UTI89]
 gb|ABJ03057.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli APEC O1]
 emb|CAR05203.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
coli S88]
 gb|EEH88870.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia sp. 3_2_53FAA]
 gb|EEJ49791.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 83972]
 gb|ADE88279.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli IHE3034]
 gb|EFJ57400.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 185-1]
 gb|EFJ94778.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 45-1]
 gb|ADN48455.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli ABU 83972]
 gb|ADN72961.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UM146]
 gb|EFU44772.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 110-3]
 gb|EFU53455.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 153-1]
 gb|EFU59390.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 16-3]
 gb|EFW68545.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli WV_060327]
 gb|EGB45703.1| malate/L-lactate dehydrogenase [Escherichia coli H252]
 gb|EGB50660.1| malate/L-lactate dehydrogenase [Escherichia coli H263]
 gb|EGB76586.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 57-2]
 gb|EHF99120.1| 2,3-diketo-L-gulonate reductase [Escherichia coli cloneA_i1]
 gb|AER86589.1| 2,3-diketo-L-gulonate reductase [Escherichia coli str. 'clone 
D i2']
 gb|AER91508.1| 2,3-diketo-L-gulonate reductase [Escherichia coli str. 'clone 
D i14']
 gb|EHN92551.1| 2,3-diketo-L-gulonate reductase [Escherichia coli H397]
 gb|EIA34724.1| 2,3-diketo-L-gulonate reductase [Escherichia coli SCI-07]
 gb|EIL53493.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KD1]
 gb|EIL79783.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HM605]
 gb|EKI35342.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 07798]
 gb|ELC06136.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE5]
 gb|ELC54049.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE39]
 gb|ELC70204.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE187]
 gb|ELC79005.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE188]
 gb|ELC96934.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE201]
 gb|ELD34572.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE214]
 gb|ELD47194.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE220]
 gb|ELD58339.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE230]
 gb|ELE03219.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE53]
 gb|ELE08977.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE55]
 gb|ELE18540.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE57]
 gb|ELE20756.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE58]
 gb|ELE28596.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE60]
 gb|ELE30012.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE62]
 gb|ELE37811.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE67]
 gb|ELE87100.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE87]
 gb|ELF63353.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE45]
 gb|ELF88980.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE22]
 gb|ELF95047.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE46]
 gb|ELG11890.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE59]
 gb|ELG13982.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE63]
 gb|ELG21903.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE65]
 gb|ELG32439.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE84]
 gb|ELG51749.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE118]
 gb|ELG76474.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE141]
 gb|ELH05391.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE192]
 gb|ELH66258.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE209]
 gb|ELH81836.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE218]
 gb|ELH83555.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE223]
 gb|ELH88030.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE227]
 gb|ELH98421.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE229]
 gb|ELI16074.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE109]
 gb|ELI39165.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE124]
 gb|ELI70635.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE137]
 gb|ELI99318.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE153]
 gb|ELJ06918.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE157]
 gb|ELJ08303.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE160]
 gb|ELJ23124.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE167]
 gb|ELJ34032.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE174]
 gb|ELJ36553.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE176]
 gb|ELJ49132.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE179]
 gb|ELJ49548.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE180]
 gb|ELJ91993.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE97]
 gb|ELJ95480.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE99]
 emb|CCQ06395.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli Nissle 
1917]
 gb|EOR50497.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ATCC 25922]
 gb|EOU28187.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE7]
 gb|EOU73643.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE27]
 gb|EOV31808.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE219]
 gb|EOX06308.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE226]
 gb|EQN00176.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 2 (4-6943160)]
 gb|EQN02714.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 3 (4-7276001)]
 gb|EQN04684.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 1 (4-6876161)]
 gb|EQN15546.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 5 (4-7148410)]
 gb|EQN29051.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 9 (4-6942539)]
 gb|EQN29863.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 7 (4-7315031)]
 gb|EQN44060.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 13 (4-7634056)]
 gb|EQN46169.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 16 (4-7649002)]
 gb|EQN59657.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 20 (4-5865042)]
 gb|EQN66328.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 19 (4-7154984)]
 gb|EQN90343.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 26 (4-5703913)]
 gb|EQN93532.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 27 (4-7449267)]
 gb|EQO12755.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 30 (4-2661829)]
 gb|EQO14958.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 31 (4-2602156)]
 gb|EQO19576.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 32 (4-3773988)]
 gb|EQO28417.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 35 (4-2962667)]
 gb|EQO35570.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 37 (4-2773848)]
 gb|EQO40026.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 39 (4-2679949)]
 gb|EQO50491.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 40 (4-1219782)]
 gb|EQO57602.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 42 (4-2100061)]
 gb|EQO81009.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 48 (4-2658593)]
 gb|EQO89742.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 51 (4-2172526)]
 gb|EQO96222.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 55 (4-2646161)]
 gb|EQP07681.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 58 (4-2839709)]
 gb|EQP17932.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 61 (4-2736020)]
 gb|EQP31706.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 68 (4-0888028)]
 gb|EQP46783.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 73 (4-2393174)]
 gb|EQP48206.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 74 (4-1034782)]
 gb|EQP58856.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 76 (4-2538717)]
 gb|EQP67292.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 77 (4-2605759)]
 gb|EQP76155.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 80 (4-2428830)]
 gb|EQQ02569.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 89 (4-5885604)]
 gb|EQQ21694.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 92 (4-5930790)]
 gb|EQQ24273.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 95 (4-6074464)]
 gb|EQQ35979.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 96 (4-5934869)]
 gb|EQQ37032.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 102 (4-6906788)]
 gb|EQQ46691.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 104 (4-6977960)]
 gb|EQQ47189.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 103 (4-5904188)]
 gb|EQQ66951.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 107 (4-5860571)]
 gb|EQQ69079.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 109 (4-6977162)]
 gb|EQQ86355.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 114 (4-7037740)]
 gb|EQR04670.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 116 (4-6879942)]
 gb|EQR12465.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 117 (4-6857191)]
 gb|EQR14037.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 118 (4-7345399)]
 gb|EQR25286.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 120 (4-6978681)]
 gb|EQR44936.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 126 (4-6034225)]
 gb|EQR56791.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 128 (4-7030436)]
 gb|EQR63410.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 132 (4-6876862)]
 gb|EQR85969.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 137 (4-2124971)]
 gb|EQS14871.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 142 (4-5627451)]
 gb|EQS15989.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 144 (4-4451937)]
 gb|EQS71974.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 161 (4-3119890)]
 gb|EQS93720.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 169 (4-1075578)]
 gb|EQS99423.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 170 (4-3026949)]
 gb|EQT08185.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 172 (4-3248542)]
 gb|EQT24041.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 180 (4-3051617)]
 gb|EQT73934.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 191 (3-9341900)]
 gb|EQT79818.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 192 (4-3054470)]
 gb|EQT98093.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 196 (4-4530470)]
 gb|EQU07642.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 199 (4-5670322)]
 gb|EQU09111.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 198 (4-3206106)]
 gb|EQU19460.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 201 (4-4459431)]
 gb|EQU31156.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 203 (4-3126218)]
 gb|EQU39497.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 204 (4-3112802)]
 gb|EQU52657.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 207 (4-3113221)]
 gb|EQU67118.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 211 (4-3041891)]
 gb|EQU69679.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 212 (3-9305343)]
 gb|EQU76790.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 213 (4-3042928)]
 gb|EQU89589.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 217 (4-1022806)]
 gb|EQU91777.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 216 (4-3042952)]
 gb|EQU98345.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 218 (4-4500903)]
 gb|EQV06291.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 220 (4-5876842)]
 gb|EQV23121.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 227 (4-2277670)]
 gb|EQV23694.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 225 (4-1273116)]
 gb|EQV51647.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 43 (105a)]
 gb|EQV54701.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 44 (106a)]
 gb|EQV64581.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 61 (174a)]
 gb|EQW15073.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3014-1]
 gb|EQW38895.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3053-1]
 gb|EQW48915.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3087-1]
 gb|EQW58253.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3088-1]
 gb|EQW73091.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3117-1]
 gb|EQW76213.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3121-1]
 gb|EQW81394.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3122-1]
 gb|EQW98714.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3152-1]
 gb|EQX07790.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3159-1]
 gb|EQX16309.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3161-1]
 gb|EQX24719.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3162-1]
 gb|EQX40660.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3175-1]
 gb|EQX41339.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3173-1]
 gb|EQX53399.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3178-1]
 gb|EQX96532.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3203-1]
 gb|EQX96930.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3206-1]
 gb|EQY08426.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3208-1]
 gb|EQY12303.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3215-1]
 gb|EQY19792.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3216-1]
 gb|EQY30156.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3220-1]
 gb|EQY40382.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3222-1]
 gb|EQY52527.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3233-1]
 gb|EQY64968.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3264-1]
 gb|EQY67582.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3257-1]
 gb|EQY73709.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3268-1]
 gb|EQY97770.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3337-1]
 gb|EQZ22003.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3490-1]
 gb|EQZ47553.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3632-1]
 gb|EQZ51165.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3656-1]
 gb|EQZ52393.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3662-1]
 gb|EQZ67226.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3687-1]
 gb|EQZ72967.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3694-1]
 gb|EQZ74848.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3702-1]
 gb|EQZ87029.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3707-1]
 gb|EQZ88385.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3705-1]
 gb|ERA05952.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3821-1]
 gb|ERA16423.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3834-1]
 gb|ERA17088.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3893-1]
 gb|ERA43240.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 4207-1]
 gb|ERA69400.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 156 (4-3206505)]
 gb|ERA71351.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 157 (4-3406229)]
 gb|ERA75458.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 159 (4-5818141)]
 gb|ERA83007.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 160 (4-5695937)]
 gb|ERA86153.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 210 (4-3042480)]
 gb|ERB30832.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3298-1]
 gb|ERF52496.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3652-1]
 emb|CDH67244.1| 2,3-diketo-L-gulonate reductase [Escherichia coli PMV-1]
 gb|ESC98440.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907391]
 gb|ESD38893.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908519]
 gb|ESD39382.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 907892]
 gb|ESE17499.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 910096-2]
 gb|ESE32712.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli A25922R]
 gb|ESK26670.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3342-1]
 gb|ETE14383.1| 2,3-diketo-L-gulonate reductase [Escherichia coli LAU-EC6]
 gb|ETF22531.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 23 (4-6066488)]
 gb|ETF27467.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 83 (4-2051087)]
 gb|ETF29559.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 214 (4-3062198)]
 gb|EYB59413.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EYB65209.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KDF94155.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 65]
 gb|KDG05062.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 72]
 gb|KDG15001.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 73]
 gb|KDZ52172.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 3-073-06_S1_C1]
 gb|KEJ06924.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 8-415-05_S4_C2]
 gb|KEJ07456.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 8-415-05_S4_C1]
 gb|KEJ27593.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 8-415-05_S4_C3]
 gb|KEN31370.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 8-415-05_S3_C3]
 gb|KEN37411.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 8-415-05_S3_C1]
 gb|KEN69653.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 8-415-05_S3_C2]
 gb|AID80715.1| 2,3-diketo-L-gulonate reductase [Escherichia coli Nissle 1917]
 gb|KEP01054.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KEP03214.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KFB97465.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli DSM 30083 
= JCM 1649 = ATCC 11775]
 gb|AIL18122.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ATCC 25922]
 gb|AJB36822.1| 2,3-diketo-L-gulonate reductase [Escherichia coli APEC IMT5155]
 gb|KIE69492.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KIE79137.1| 2,3-diketo-L-gulonate reductase [Escherichia coli RS218]
Length=332

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVD+ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDNETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869019.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EFZ74663.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
RN587/1]
 gb|EII86584.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 3003]
 gb|EKI23312.1| 2,3-diketo-L-gulonate reductase [Escherichia coli ARS4.2123]
Length=332

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVD+ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDNETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001514035.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ELB96752.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE4]
 gb|EOU29411.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE3]
 gb|EOX07745.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE240]
 gb|EQP14361.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 59 (4-1119338)]
 gb|EQR50621.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 127 (4-7303629)]
 gb|EQV10816.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 222 (4-2977443)]
 gb|EQV44944.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 32 (66a)]
 gb|EQW27876.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3041-1]
 gb|EQX00345.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3140-1]
 gb|ESE19905.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli 908675]
 gb|ESP14725.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 12 (4-7653042)]
 gb|ESP29031.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 178 (4-3189163)]
 gb|ESP37211.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 148 (4-3192490)]
 gb|ETY54248.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 49b]
 gb|ETY57702.1| 2,3-diketo-L-gulonate reductase [Escherichia coli BIDMC 49a]
Length=332

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVD+ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDNETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_021534799.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EQS36739.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 149 (4-4451880)]
 gb|EQX31170.1| 2,3-diketo-L-gulonate reductase [Escherichia coli UMEA 3172-1]
Length=332

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVD+ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDNETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001597107.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ELG62553.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE123]
Length=332

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVD+ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDNETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001469493.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMZ90995.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.1]
 gb|ENA01515.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299438.2]
 gb|ENC28744.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0299438.9]
 gb|ENE05031.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.2]
 gb|ENF72722.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.10]
 gb|ENF80637.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.11]
 gb|ENF82693.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.12]
 gb|ENF94749.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.15]
 gb|ENG09949.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.5]
 gb|ENG13336.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.6]
 gb|ENG14131.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.7]
 gb|ENG23440.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.8]
 gb|ENG31173.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.9]
Length=332

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADTCAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001647710.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ENG01362.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.4]
Length=332

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADTCAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001645930.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ENF99770.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.3]
Length=332

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADTCAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032230280.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EYE10676.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-110-08_S3_C3]
 gb|EYE17506.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-110-08_S3_C2]
 gb|EYE20171.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 1-110-08_S3_C1]
Length=332

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMF RTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFVRTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001642356.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ENF87575.1| 2,3-diketo-L-gulonate reductase [Escherichia coli P0305260.13]
Length=332

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADTCAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001765170.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EMZ40620.1| 2,3-diketo-L-gulonate reductase [Escherichia coli SWW33]
 gb|EQP45324.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 70 (4-2963531)]
 gb|EQS58682.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 158 (4-3224287)]
 gb|EQT20845.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 175 (4-3405184)]
 gb|EQT42524.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 184 (4-3343286)]
 gb|EQT86653.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 193 (4-3331423)]
 gb|EQU01771.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 194 (4-2356805)]
 gb|EWY51741.1| 2,3-diketo-L-gulonate reductase [Escherichia coli MP1]
 gb|EYT07367.1| 2,3-diketo-L-gulonate reductase [Escherichia coli K02]
Length=332

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADTCAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001553593.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ELD88093.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE47]
 gb|EOW33927.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE126]
Length=332

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADTCAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869051.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 ref|YP_001465051.1| 2,3-diketo-L-gulonate reductase [Escherichia coli E24377A]
 sp|A7ZTC2.1|DLGD_ECO24 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia coli E24377A]
 gb|ABV18700.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli E24377A]
 gb|EFK01554.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 182-1]
 gb|EFK72968.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli MS 78-1]
 gb|EGW80777.1| malate/L-lactate dehydrogenase family protein [Escherichia coli 
3030-1]
 gb|EHN82048.1| 2,3-diketo-L-gulonate reductase [Escherichia coli H494]
 gb|EMD04236.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O08]
 gb|EQQ95648.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 115 (4-4465989)]
 gb|EQQ99836.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 115 (4-4465997)]
 gb|ESS89928.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli CE516]
 gb|EZG31992.1| 2,3-diketo-L-gulonate reductase [Escherichia coli E1728]
 gb|KDW13209.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-177-06_S3_C1]
 gb|KEP77494.1| 2,3-diketo-L-gulonate reductase [Escherichia coli E1140]
 gb|AIT36723.1| 2,3-diketo-L-gulonate reductase [Escherichia coli FAP1]
 gb|KIG30860.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETA+ACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETANACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_021548268.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ERB03049.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KOEGE 10 (25a)]
Length=332

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADTCAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032343217.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|KEO21660.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-366-08_S4_C1]
Length=332

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFART ESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEMFARTIESGVYSHGVNRFPRFIQ  54



>ref|WP_000869059.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. TW11588]
Length=332

 Score = 84.0 bits (206),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGV+SETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVNSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KHJ14344.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
Length=332

 Score = 84.0 bits (206),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFP FIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPHFIQ  54



>ref|WP_032207353.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EYY51586.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O165:H25 str. 
2010C-4874]
Length=332

 Score = 84.0 bits (206),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAEMFARTTESGVYSHGVNRFP FIQ
Sbjct  16   LISRGVDSETADACAEMFARTTESGVYSHGVNRFPHFIQ  54



>ref|WP_000869060.1| 2,3-diketo-L-gulonate reductase [Escherichia sp. TW14182]
Length=332

 Score = 84.0 bits (206),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGV+SETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVNSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869016.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EGI48821.1| 2,3-diketo-L-gulonate reductase (2,3-DKG reductase) (3-dehydro-L-gulonate 
2-dehydrogenase) [Escherichia coli H299]
 gb|ELE52082.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE75]
 gb|EMD06766.1| 2,3-diketo-L-gulonate reductase [Escherichia coli SEPT362]
 gb|EQP68379.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 79 (4-2512823)]
 gb|EQT58050.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 188 (4-2356988)]
 gb|EYZ98175.1| 2,3-diketo-L-gulonate reductase [Escherichia coli O119:H4 str. 
03-3458]
 gb|KDX51692.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-177-06_S4_C1]
Length=332

 Score = 83.6 bits (205),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISR VDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRDVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_016235390.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EOU87139.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE36]
Length=332

 Score = 83.6 bits (205),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISR VDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRDVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001545006.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ELD31474.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE213]
 gb|ELG70573.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE140]
 gb|ELJ80537.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE95]
 gb|KDY10106.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 2-316-03_S4_C1]
Length=332

 Score = 83.6 bits (205),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LSSRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023351622.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|ESP18610.1| 2,3-diketo-L-gulonate reductase [Escherichia coli HVH 86 (4-7026218)]
Length=332

 Score = 83.6 bits (205),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
             ISRGVD+ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   FISRGVDNETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_016233635.1| 2,3-diketo-L-gulonate reductase [Escherichia coli]
 gb|EOU61000.1| 2,3-diketo-L-gulonate reductase [Escherichia coli KTE19]
Length=332

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGV SETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVGSETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>pdb|1S20|A Chain A, A Novel Nad Binding Protein Revealed By The Crystal 
Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak) Northeast 
Structural Genomics Consortium Target Er82
 pdb|1S20|B Chain B, A Novel Nad Binding Protein Revealed By The Crystal 
Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak) Northeast 
Structural Genomics Consortium Target Er82
 pdb|1S20|C Chain C, A Novel Nad Binding Protein Revealed By The Crystal 
Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak) Northeast 
Structural Genomics Consortium Target Er82
 pdb|1S20|D Chain D, A Novel Nad Binding Protein Revealed By The Crystal 
Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak) Northeast 
Structural Genomics Consortium Target Er82
 pdb|1S20|E Chain E, A Novel Nad Binding Protein Revealed By The Crystal 
Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak) Northeast 
Structural Genomics Consortium Target Er82
 pdb|1S20|F Chain F, A Novel Nad Binding Protein Revealed By The Crystal 
Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak) Northeast 
Structural Genomics Consortium Target Er82
 pdb|1S20|G Chain G, A Novel Nad Binding Protein Revealed By The Crystal 
Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak) Northeast 
Structural Genomics Consortium Target Er82
 pdb|1S20|H Chain H, A Novel Nad Binding Protein Revealed By The Crystal 
Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak) Northeast 
Structural Genomics Consortium Target Er82
Length=340

 Score = 82.8 bits (203),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAE FARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEXFARTTESGVYSHGVNRFPRFIQ  54



>pdb|1NXU|A Chain A, Crystal Structure Of E. Coli Hypothetical Oxidoreductase 
Yiak Northeast Structural Genomics Consortium Target Er82.
 pdb|1NXU|B Chain B, Crystal Structure Of E. Coli Hypothetical Oxidoreductase 
Yiak Northeast Structural Genomics Consortium Target Er82.
Length=333

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LISRGVDSETADACAE FARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LISRGVDSETADACAEXFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_039080160.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. Bisph2]
Length=332

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_002954688.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|ENZ84962.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. houtenae 
serovar 16:z4,z32:-- str. RKS3027]
Length=332

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRGVATDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_039031159.1| 2,3-diketo-L-gulonate reductase [Leclercia adecarboxylata]
Length=332

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023186094.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|ESE91849.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. houtenae 
serovar 50:g,z51:- str. 01-0133]
Length=332

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRGVATDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000868495.1| 2,3-diketo-L-gulonate reductase [Escherichia fergusonii]
 ref|YP_002384648.1| 2,3-diketo-L-gulonate reductase [Escherichia fergusonii ATCC 
35469]
 sp|B7LTI6.1|DLGD_ESCF3 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Escherichia fergusonii ATCC 35469]
 emb|CAQ91045.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Escherichia 
fergusonii ATCC 35469]
 gb|EGC96988.1| 2,3-diketo-L-gulonate reductase [Escherichia fergusonii ECD227]
Length=332

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGV  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRGVAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869053.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|ESE67883.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. salamae 
serovar 58:l,z13,z28:z6 str. 00-0163]
Length=332

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRGVATDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_004868847.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacteriaceae]
 ref|YP_007876156.1| 2,3-diketo-L-gulonate reductase [Raoultella ornithinolytica B6]
 gb|EHT04616.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca 10-5246]
 gb|AGJ88604.1| 2,3-diketo-L-gulonate reductase [Raoultella ornithinolytica B6]
Length=332

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KGZ15878.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae]
Length=332

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023247335.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|ESJ17783.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. diarizonae 
serovar 60:r:e,n,x,z15 str. 01-0170]
 gb|ESJ19080.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. diarizonae 
serovar 60:r:e,n,x,z15 str. 01-0170]
Length=332

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRGVAADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000868494.1| 2,3-diketo-L-gulonate reductase [Escherichia fergusonii]
 gb|EGC05890.1| malate/L-lactate dehydrogenase [Escherichia fergusonii B253]
Length=332

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGV  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRGVAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024359745.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Klebsiella]
Length=332

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_014227214.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Klebsiella]
 ref|YP_005017109.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca KCTC 1686]
 gb|AEX02870.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca KCTC 1686]
 gb|EUB41626.1| 3-dehydro-L-gulonate 2-dehydrogenase [Klebsiella sp. AS10]
 gb|AHW86373.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca HKOPL1]
 gb|AID92843.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca KONIH1]
 gb|AIE67681.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca]
 gb|KGZ20486.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca]
Length=332

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+ +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGITAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_013094954.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacter]
 ref|YP_003610708.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae subsp. 
cloacae ATCC 13047]
 gb|ADF59759.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae subsp. 
cloacae ATCC 13047]
 gb|KGB10395.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|AIV27831.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|KIF96548.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
Length=332

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_038635224.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii]
 gb|AHY10986.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii CFNIH1]
Length=332

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+ +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>emb|CEJ64783.1| 3-dehydro-L-gulonate 2-dehydrogenase [Citrobacter sp. CIP 55.13]
Length=332

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+ +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_014839766.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca]
 ref|YP_006501266.1| 3-dehydro-L-gulonate 2-dehydrogenase [Klebsiella oxytoca E718]
 gb|AFN34694.1| 3-dehydro-L-gulonate 2-dehydrogenase [Klebsiella oxytoca E718]
 gb|EWF60033.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca MGH 41]
 gb|KFC44122.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca]
Length=332

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+ +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|EIQ80579.1| 2,3-diketo-L-gulonate reductase [Shigella flexneri 1235-66]
Length=332

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+ +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_036116652.1| 2,3-diketo-L-gulonate reductase [Mangrovibacter sp. MFB070]
 gb|KEA49910.1| 2,3-diketo-L-gulonate reductase [Mangrovibacter sp. MFB070]
Length=332

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG++ +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LVNRGINPQTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032664684.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|KDF54780.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae MGH 54]
Length=332

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_004137795.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca]
 gb|EKP25958.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca M5al]
Length=332

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_010436730.1| 2,3-diketo-L-gulonate reductase [Enterobacter mori]
Length=332

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KHQ31930.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
Length=332

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_025910535.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. 5-4]
Length=332

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032643755.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. EGD-HP1]
 gb|KFA82143.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. EGD-HP1]
Length=332

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_021242451.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacter cloacae 
complex]
 gb|EPY95007.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae EC_38VIM1]
 gb|ESL79356.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae UCICRE 
12]
 gb|ESN48425.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. MGH 16]
 gb|EUL59049.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae UCI 39]
 gb|KDF52800.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae CHS 79]
Length=332

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_028015849.1| 2,3-diketo-L-gulonate reductase, partial [Enterobacter sp. MR1]
Length=329

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  14   LLDRGVKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  52



>ref|WP_023334065.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. MGH 24]
 gb|ESN15453.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. MGH 24]
Length=332

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_012135714.1| 2,3-diketo-L-gulonate reductase [Citrobacter koseri]
 ref|YP_001456512.1| 2,3-diketo-L-gulonate reductase [Citrobacter koseri ATCC BAA-895]
 sp|A8ARG3.1|DLGD_CITK8 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Citrobacter koseri ATCC BAA-895]
 gb|ABV16076.1| hypothetical protein CKO_05033 [Citrobacter koseri ATCC BAA-895]
Length=332

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>emb|CDZ86408.1| 2,3-diketo-L-gulonate reductase [Citrobacter koseri]
Length=332

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVAAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_014068405.1| 2,3-diketo-L-gulonate reductase [Enterobacter asburiae]
 ref|YP_004826707.1| 2,3-diketo-L-gulonate reductase [Enterobacter asburiae LF7a]
 gb|AEN62922.1| 2,3-diketo-L-gulonate reductase [Enterobacter asburiae LF7a]
Length=332

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLNRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_038252722.1| 2,3-diketo-L-gulonate reductase [Yokenella regensburgei]
 gb|KFD25076.1| 3-dehydro-L-gulonate 2-dehydrogenase [Yokenella regensburgei 
ATCC 49455]
Length=332

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>dbj|GAL46157.1| 2,3-diketo-L-gulonate reductase [Citrobacter werkmanii NBRC 105721]
Length=332

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KDF08086.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii MGH 56]
 gb|KGZ30036.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii]
Length=332

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024909055.1| 2,3-diketo-L-gulonate reductase [Enterobacter asburiae]
Length=332

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RG+ +ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGIKAETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_006687562.1| 2,3-diketo-L-gulonate reductase [Citrobacter youngae]
 gb|EFE06237.1| 3-dehydro-L-gulonate 2-dehydrogenase [Citrobacter youngae ATCC 
29220]
Length=332

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_016154935.1| 2,3-diketo-L-gulonate reductase [Citrobacter sp. KTE151]
 gb|EOQ45135.1| 2,3-diketo-L-gulonate reductase [Citrobacter sp. KTE151]
 gb|KHE10622.1| 2,3-diketo-L-gulonate reductase [Citrobacter braakii]
Length=332

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_003827358.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii]
 gb|EHL85487.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii 4_7_47CFAA]
Length=332

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_003024235.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacteriaceae]
 gb|EJF23313.1| 2,3-diketo-L-gulonate reductase [Citrobacter sp. A1]
 gb|EKS57300.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii ATCC 8090 
= MTCC 1658]
 gb|EKU32906.1| hth-type transcriptional regulator yiaj [Citrobacter sp. L17]
 gb|EMF24572.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii GTC 09479]
 gb|EOD61373.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii GTC 09629]
 gb|EOQ20741.1| 2,3-diketo-L-gulonate reductase [Citrobacter sp. KTE30]
 gb|EXF32091.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii RLS1]
 gb|KEL79914.1| 2,3-diketo-L-gulonate reductase [Escherichia coli 5-172-05_S1_C1]
 gb|KFC00465.1| 3-dehydro-L-gulonate 2-dehydrogenase [Citrobacter freundii ATCC 
8090 = MTCC 1658]
 dbj|GAL40894.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii NBRC 12681]
Length=332

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869052.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|EHY67976.1| malate/L-lactate dehydrogenase [Salmonella enterica subsp. houtenae 
str. ATCC BAA-1581]
Length=332

 Score = 78.2 bits (191),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SRGV ++TADACAE+FARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRGVATDTADACAEIFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032650785.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacter]
 gb|EWG65795.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. DC3]
 gb|EWG71048.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. DC4]
Length=332

 Score = 78.2 bits (191),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACA+MFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAETADACADMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_014830199.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 ref|YP_006475652.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae subsp. 
dissolvens SDM]
 gb|AFM57950.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae subsp. 
dissolvens SDM]
Length=332

 Score = 78.2 bits (191),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032950498.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii]
 gb|ETX67501.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii UCI 31]
 gb|KGY87629.1| 2,3-diketo-L-gulonate reductase [Citrobacter freundii]
Length=332

 Score = 78.2 bits (191),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>emb|CEL83979.1| 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent [Klebsiella 
variicola]
Length=332

 Score = 78.2 bits (191),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACA+MFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLKRGVAAETADACADMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KHE27375.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae]
Length=332

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACA+MFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLKRGVAAETADACADMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_039102635.1| 2,3-diketo-L-gulonate reductase [Klebsiella variicola]
 gb|AJA94642.1| 2,3-diketo-L-gulonate reductase [Klebsiella variicola]
Length=332

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACA+MFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLKRGVAAETADACADMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_012540326.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae]
 ref|YP_002236050.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae 342]
 sp|B5XMX0.1|DLGD_KLEP3 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Klebsiella pneumoniae 342]
 gb|ACI08708.1| 3-dehydro-L-gulonate 2-dehydrogenase [Klebsiella pneumoniae 342]
 gb|KDM01656.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae MGH 80]
 gb|KDM28774.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae MGH 76]
Length=332

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETADACA+MFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLKRGVAAETADACADMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032679989.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. BIDMC 30]
 gb|EUM12971.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. BIDMC 30]
Length=332

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LVDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_014168108.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacter cloacae 
complex]
 ref|YP_004950021.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae EcWSU1]
 gb|AEW71600.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae EcWSU1]
 gb|EPR40548.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae str. Hanford]
 gb|AHE72268.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae P101]
 gb|EUM24853.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. BIDMC 26]
Length=332

 Score = 77.8 bits (190),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LVDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KIF87225.1| 2,3-diketo-L-gulonate reductase [Enterobacter ludwigii]
Length=332

 Score = 77.8 bits (190),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LVDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032668999.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|EUL66941.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae UCI 30]
 gb|EUM00039.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae UCI 23]
Length=332

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_015572752.1| MULTISPECIES: Malate/L-lactate dehydrogenases [Enterobacter cloacae 
complex]
 ref|YP_007847884.1| Malate/L-lactate dehydrogenases [Enterobacter cloacae subsp. 
cloacae NCTC 9394]
 emb|CBK87797.1| Malate/L-lactate dehydrogenases [Enterobacter cloacae subsp. 
cloacae NCTC 9394]
 gb|ESL85165.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae UCICRE 
11]
 gb|ESM09935.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae UCICRE 
5]
 gb|EUM23028.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. BIDMC 27]
 gb|EUM51164.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. MGH 15]
 gb|EUM54567.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. MGH 33]
 gb|EUM79907.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. MGH 10]
 gb|EUM87582.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. MGH 6]
 gb|EUM99696.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. MGH 1]
 gb|AIE66084.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae ECNIH2]
 gb|KGY90462.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|KGZ09318.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|KHM16518.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|KHQ40231.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|AJB64936.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
Length=332

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023621210.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
Length=332

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETA+ACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAETANACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023298858.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|ESL93803.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae UCICRE 
9]
Length=332

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|XP_004151197.1| PREDICTED: 2,3-diketo-L-gulonate reductase-like [Cucumis sativus]
Length=332

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_022652028.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacter cloacae 
complex]
 gb|ERP00838.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. MGH 14]
 emb|CDL35705.1| 3-dehydro-L-gulonate 2-dehydrogenase [Enterobacter cloacae ISC8]
 gb|EUM99740.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. MGH 3]
 gb|AJB83872.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
Length=332

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_038416903.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|AIN24731.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae ECNIH3]
 gb|AIN30071.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae ECR091]
 gb|AIX61118.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
Length=332

 Score = 77.4 bits (189),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032649824.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Enterobacter cloacae 
complex]
 gb|EUM19158.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. BIDMC 28]
 gb|KDF52391.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae MGH 53]
Length=332

 Score = 77.4 bits (189),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KHG56456.1| 3-dehydro-L-gulonate 2-dehydrogenase [Enterobacter cloacae MRSN 
11489]
Length=332

 Score = 77.4 bits (189),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_025758389.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
Length=332

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV ++TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVSADTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_028018243.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
Length=332

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            LI RGV ++ ADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LIDRGVKADAADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|EUM06905.1| 2,3-diketo-L-gulonate reductase [Enterobacter sp. BIDMC 29]
Length=332

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RG+  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGIKVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_007373801.1| 2,3-diketo-L-gulonate reductase [Kosakonia radicincitans]
 gb|EJI88359.1| 2,3-diketo-L-gulonate reductase [Kosakonia radicincitans DSM 
16656]
 gb|KDE37835.1| 2,3-diketo-L-gulonate reductase [Kosakonia radicincitans UMEnt01/12]
Length=332

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+SR V  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLSRKVREETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_035893133.1| 2,3-diketo-L-gulonate reductase [Kluyvera ascorbata]
 gb|KFD06151.1| 3-dehydro-L-gulonate 2-dehydrogenase [Kluyvera ascorbata ATCC 
33433]
Length=332

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV +ETADACAEMFA TTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVAAETADACAEMFASTTESGVYSHGVNRFPRFIQ  54



>emb|CDL39516.1| 3-dehydro-L-gulonate 2-dehydrogenase [Escherichia coli ISC11]
Length=254

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RG+  ETADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGIAVETADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_032644462.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae]
 gb|KDF40129.1| 2,3-diketo-L-gulonate reductase [Enterobacter cloacae BWH 43]
Length=332

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +E ADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLDRGVKAEAADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_021440874.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Klebsiella]
 gb|ERI56740.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae KP-1]
 gb|ESB00134.1| 3-dehydro-L-gulonate 2-dehydrogenase [Klebsiella pneumoniae 909957]
 gb|ESM87334.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae MGH 36]
 emb|CDI16429.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae subsp. 
pneumoniae BJ1-GA]
 gb|KDL33439.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae MGH 64]
 gb|KDL48724.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae MGH 66]
Length=332

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETA+ACA+MFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLKRGVAAETAEACADMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_004150165.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae]
 gb|EJK89493.1| 3-dehydro-L-gulonate 2-dehydrogenase [Klebsiella pneumoniae subsp. 
pneumoniae DSM 30104]
 gb|KFJ74503.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae]
 gb|KHF68046.1| 2,3-diketo-L-gulonate reductase [Klebsiella pneumoniae]
Length=332

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETA+ACA+MFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLKRGVAAETAEACADMFARTTESGVYSHGVNRFPRFIQ  54



>gb|ABF60034.1| YiaK [Klebsiella pneumoniae]
Length=332

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L+ RGV +ETA+ACA+MFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLKRGVAAETAEACADMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_038395676.1| 2,3-diketo-L-gulonate reductase, partial [Salmonella enterica]
Length=77

 Score = 72.4 bits (176),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|AHS60475.1| 2,3-diketo-L-gulonate reductase, partial [Salmonella enterica 
subsp. enterica serovar Enteritidis str. SA20085285]
Length=163

 Score = 73.9 bits (180),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|AHS75190.1| hypothetical protein AU59_25035, partial [Salmonella enterica 
subsp. enterica serovar Enteritidis str. SA20100239]
Length=114

 Score = 72.8 bits (177),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869003.1| hypothetical protein, partial [Salmonella enterica]
Length=107

 Score = 72.8 bits (177),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001803048.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
Length=270

 Score = 74.7 bits (182),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_015962527.1| malate/lactate dehydrogenase [Enterobacteriaceae bacterium strain 
FGI 57]
 ref|YP_007338414.1| malate/lactate dehydrogenase [Enterobacteriaceae bacterium strain 
FGI 57]
 gb|AGB76229.1| malate/lactate dehydrogenase [Enterobacteriaceae bacterium strain 
FGI 57]
Length=332

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV ++TA+ACA+MFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVAADTAEACADMFARTTESGVYSHGVNRFPRFIQ  54



>gb|AHO21135.1| hypothetical protein AV75_20950 [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121180]
Length=134

 Score = 73.2 bits (178),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869006.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 ref|NP_458259.1| carboxylic acid dehydrogenase [Salmonella enterica subsp. enterica 
serovar Typhi str. CT18]
 ref|NP_807471.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Typhi str. Ty2]
 ref|YP_005219504.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Typhi str. P-stx-12]
 ref|YP_007928092.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Typhi str. Ty21a]
 sp|Q8Z2C5.1|DLGD_SALTI RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Salmonella enterica subsp. enterica serovar Typhi]
 pir||AD0979 probable carboxylic acid dehydrogenase STY4130 [imported] - Salmonella 
enterica subsp. enterica serovar Typhi (strain CT18)
 emb|CAD07960.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Typhi str. CT18]
 gb|AAO71331.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Typhi str. Ty2]
 gb|AEZ47651.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Typhi str. P-stx-12]
 gb|AGK69362.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Typhi str. Ty21a]
 gb|ETZ13344.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Typhi str. STH2370]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|EHC79610.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Rubislaw str. A4-653]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869004.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 ref|YP_002228528.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Gallinarum str. 287/91]
 emb|CAR39543.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Gallinarum str. 287/91]
 gb|EGE36210.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Gallinarum str. SG9]
 gb|ELX77287.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Gallinarum str. 9184]
 gb|ESG08748.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Pullorum str. 19945]
 gb|ESJ90750.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Stanleyville str. CFSAN000624]
 gb|KHK43006.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Gallinarum]
Length=330

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|AHW26086.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Abony str. 0014]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_001698190.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|ELL64563.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 22704]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869007.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|EGE31760.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Dublin str. SD3246]
 emb|CDS71088.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Dublin]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|AHT99837.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20090419]
Length=317

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  112  SRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  3    SRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  39



>ref|WP_000861182.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|EDX47499.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Kentucky str. CVM29188]
 gb|EDZ02131.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Virchow str. SL491]
 gb|EDZ20075.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Kentucky str. CDC 191]
 gb|ELX48966.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 29439]
 gb|ERN64409.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 22694]
 gb|ERN69658.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 13562]
 gb|ERN70924.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 29166]
 gb|ERN76420.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Kentucky str. N312]
 gb|ERN80889.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 20793]
 gb|ESC05002.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 0253]
 gb|ESE93071.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Virchow str. ATCC 51955]
 gb|ESF39132.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. ATCC 8400]
 gb|ESG30222.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Meleagridis str. 0047]
 gb|ESG82588.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 5349]
 gb|ESH65320.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000197]
 gb|ESH74145.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Bareilly str. 2780]
 gb|ESJ05880.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Anatum str. USDA 100]
 gb|ESJ39220.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Havana str. CFSAN001082]
 gb|ETO87590.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Virchow str. SVQ1]
 gb|AHW15661.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Anatum str. ATCC BAA-1592]
 gb|KFS53901.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000754]
 gb|KFS80599.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000236]
 gb|KFT77056.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000207]
 gb|KHP05281.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP35650.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP37685.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869008.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 ref|YP_002116602.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Schwarzengrund str. CVM19633]
 ref|YP_002148597.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. SL483]
 ref|YP_002217629.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Dublin str. CT_02021853]
 ref|YP_002245556.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. P125109]
 ref|YP_005214964.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Gallinarum/pullorum str. RKS5078]
 ref|YP_008262912.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Cubana str. CFSAN002050]
 ref|YP_008383063.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Pullorum str. S06004]
 ref|YP_008483422.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Gallinarum/pullorum str. CDC1983-67]
 ref|YP_008863091.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 24249]
 sp|B5EX79.1|DLGD_SALA4 RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Salmonella enterica subsp. enterica serovar Agona str. SL483]
 sp|B5FLE5.1|DLGD_SALDC RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
 sp|B5R4Q5.1|DLGD_SALEP RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Salmonella enterica subsp. enterica serovar Enteritidis str. 
P125109]
 sp|B4TZ64.1|DLGD_SALSV RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Salmonella enterica subsp. enterica serovar Schwarzengrund 
str. CVM19633]
 gb|ACF92796.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Schwarzengrund str. CVM19633]
 gb|ACH48748.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. SL483]
 gb|EDY30734.1| 2,3-diketo-L-gulonate reductase (2,3-DKG reductase) [Salmonella 
enterica subsp. enterica serovar Schwarzengrund str. SL480]
 gb|ACH76180.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Dublin str. CT_02021853]
 emb|CAR35069.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Enteritidis str. P125109]
 gb|EHB40200.1| malate/L-lactate dehydrogenase [Salmonella enterica subsp. enterica 
serovar Infantis str. SARB27]
 gb|EHC30768.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Gaminara str. A4-567]
 gb|EHC45035.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Hvittingfoss str. A4-620]
 gb|EHC73921.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Montevideo str. S5-403]
 gb|EHC80917.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Senftenberg str. A4-543]
 gb|AET56134.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Gallinarum/pullorum str. RKS5078]
 gb|EHL36037.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. LQC 10]
 gb|EHL42041.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. SARB31]
 gb|EHL45416.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. SARB30]
 gb|EHL45549.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. ATCC BAA710]
 gb|EHL47188.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 29N]
 gb|EHL55561.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 4441 H]
 gb|EHL57255.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 42N]
 gb|EJH94003.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 640631]
 gb|EJI01013.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 639016-6]
 gb|EJI01230.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 622731-39]
 gb|EJI10983.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 607307-6]
 gb|EJI13938.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 485549-17]
 gb|EJI14948.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 77-0424]
 gb|EJI19238.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 596866-22]
 gb|EJI26843.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 629164-26]
 gb|EJI27748.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 596866-70]
 gb|EJI31586.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 629164-37]
 gb|EJI34397.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 639672-46]
 gb|EJI37612.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 639672-50]
 gb|EJI45615.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 77-1427]
 gb|EJI46215.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 78-1757]
 gb|EJI47522.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 77-2659]
 gb|EJI58311.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648905 5-18]
 gb|EJI59454.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 22510-1]
 gb|EJI66632.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 8b-1]
 gb|EJI78523.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 50-3079]
 gb|EJI80662.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648901 6-18]
 gb|EJI81454.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 58-6482]
 gb|ELL46319.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Pullorum str. ATCC 9120]
 gb|ELL50273.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CHS44]
 gb|ELL58972.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1882]
 gb|ELL64694.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1884]
 gb|ELL73740.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1594]
 gb|ELL79595.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1580]
 gb|ELL80326.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1566]
 gb|ELL88750.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1441]
 gb|ELL89428.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1543]
 gb|ELM01566.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1810]
 gb|ELM02706.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1558]
 gb|ELM04007.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SE30663]
 gb|ELM09322.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1018]
 gb|ELM12409.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1010]
 gb|ELM14007.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1729]
 gb|ELM20286.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_0895]
 gb|ELM24702.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_0899]
 gb|ELM26241.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1457]
 gb|ELM30481.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1747]
 gb|ELM38638.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1444]
 gb|ELM50216.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1445]
 gb|ELM51897.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1565]
 gb|ELM53538.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1808]
 gb|ELM58119.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1559]
 gb|ELM68971.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1811]
 gb|ELM74889.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_0956]
 gb|ELM74937.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1455]
 gb|ELM80639.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1575]
 gb|ELM84073.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1745]
 gb|ELM85540.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1725]
 gb|ELM96346.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1791]
 gb|ELM97294.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_1795]
 gb|ELN03666.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 576709]
 gb|ELN09239.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 607308-16]
 gb|ELN09469.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 635290-58]
 gb|ELN11224.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 607308-19]
 gb|ELN23125.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 607307-2]
 gb|ELN26590.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 607308-9]
 gb|ELN26753.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 629163]
 gb|ELN29953.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SE15-1]
 gb|ELN39312.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CVM_N202]
 gb|ELN40408.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CVM_56-3991]
 gb|ELN47696.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CVM_81-2490]
 gb|ELN49135.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CVM_76-3618]
 gb|ELN55659.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SL909]
 gb|ELN60189.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SL913]
 gb|ELN66741.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CVM_69-4941]
 gb|ELN73036.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 638970-15]
 gb|ELN78603.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 17927]
 gb|ELN80147.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CHS4]
 gb|ELN83164.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 543463 22-17]
 gb|ELN92842.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 543463 40-18]
 gb|ELN94125.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 13183-1]
 gb|ELN96041.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 22558]
 gb|ELN99533.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 561362 1-1]
 gb|ELO06195.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 642044 4-1]
 gb|ELO09541.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648898 4-5]
 gb|ELO11199.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 642046 4-7]
 gb|ELO17767.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648900 1-16]
 gb|ELO27182.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648901 1-17]
 gb|ELO30871.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648899 3-17]
 gb|ELO31196.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648901 39-2]
 gb|ELO33362.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648902 6-8]
 gb|ELO35365.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648903 1-6]
 gb|ELO43733.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648904 3-6]
 gb|ELO47291.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 653049 13-19]
 gb|ELO52977.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 642044 8-1]
 gb|ELO57804.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 561362 9-7]
 gb|ELO67883.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 543463 42-20]
 gb|ELO69751.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 648901 16-16]
 gb|ELO72403.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 33944]
 gb|ELO81418.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 76-2651]
 gb|ELO91549.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 81-2625]
 gb|ELO95722.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 62-1976]
 gb|ELP01015.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 53-407]
 gb|ELP01055.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 6.0562-1]
 gb|ELP08438.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 50-5646]
 gb|ELP10133.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. SH10GFN094]
 gb|ELP12124.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. SH08SF124]
 gb|ELP20675.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. SH11G1113]
 gb|ELX30901.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Rissen str. 150]
 gb|ELX55851.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Tennessee str. 4535]
 gb|ELX73282.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Dublin str. SL1438]
 gb|ELX83393.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Dublin str. HWS51]
 gb|ELX87746.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SE10]
 gb|ELX89190.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SE8a]
 gb|ELX94287.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 20037]
 gb|ELY00044.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 18569]
 gb|ELY02881.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 13-1]
 gb|ELY10931.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. PT23]
 gb|ELY14794.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 436]
 gb|EMR52272.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Dublin str. UC16]
 emb|CCR00485.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 73.H.09]
 emb|CCR07307.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 72.A.52]
 emb|CCR09613.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 71.E.05]
 emb|CCR14055.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 70.E.05]
 emb|CCR18364.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 69.H.06]
 emb|CCR23461.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 68.U.05]
 emb|CCR29570.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 66.F.99]
 emb|CCR32883.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 65.H.72]
 emb|CCR37512.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 64.H.00]
 emb|CCR43051.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 63.H.87]
 emb|CCR46412.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 62.H.72]
 emb|CCR53557.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 61.O.08]
 emb|CCR58852.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 60.O.08]
 emb|CCR60647.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 59.F.08]
 emb|CCR65351.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 58.E.08]
 emb|CCR69596.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 56.O.08]
 emb|CCR74516.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 55.U.08]
 emb|CCR78885.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 54.O.08]
 emb|CCR83580.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 53.F.08]
 emb|CCR88538.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 52.F.08]
 emb|CCR94947.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 51.E.09]
 emb|CCR96504.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 50.E.08]
 emb|CCS02224.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 48.E.08]
 emb|CCS08599.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 46.E.09]
 emb|CCT77931.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 08.A.05]
 emb|CCT81846.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 07.O.05]
 emb|CCT86643.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 06.O.05]
 emb|CCT91609.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 05.O.06]
 emb|CCT99618.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 04.O.05]
 emb|CCU03015.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 03.O.05]
 emb|CCU04894.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 02.O.05]
 emb|CCU12573.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 01.O.05]
 emb|CCU15627.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 10.A.05]
 emb|CCU20183.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 67.H.09]
 emb|CCU28938.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 49.E.09]
 emb|CCU38461.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 30.H.04]
 emb|CCU44020.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 26.F.98]
 emb|CCU54048.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 16.H.08]
 emb|CCS14212.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 45.E.09]
 emb|CCS18272.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 44.E.09]
 emb|CCS20518.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 43.E.09]
 emb|CCS26930.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 42.E.09]
 emb|CCS29905.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 40.E.08]
 emb|CCS35780.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 41.E.09]
 emb|CCS41680.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 38.O.03]
 emb|CCS44770.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 37.F.02]
 emb|CCS48144.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 36.H.00]
 emb|CCS54500.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 35.H.08]
 emb|CCS57499.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 34.H.09]
 emb|CCS61993.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 33.A.05]
 emb|CCS67884.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 32.A.00]
 emb|CCS71410.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 31.H.09]
 emb|CCS75413.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 29.O.08]
 emb|CCS79794.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 28.O.08]
 emb|CCS88104.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 27.O.98]
 emb|CCS89653.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 24.H.04]
 emb|CCS95804.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 23.F.01]
 emb|CCS98898.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 22.H.04]
 emb|CCT05734.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 21.H.10]
 emb|CCT08582.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 20.H.06]
 emb|CCT15144.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 19.F.03]
 emb|CCT17577.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 18.H.07]
 emb|CCT23348.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 17.H.06]
 emb|CCT31641.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 15.H.03]
 emb|CCT36326.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 14.E.05]
 emb|CCT41238.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 13.E.05]
 emb|CCT45988.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 12.A.06]
 emb|CCT50567.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 11.A.05]
 emb|CCT55227.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 09.F.08]
 gb|EPI70534.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Enteritidis str. 08-1080]
 gb|EPI75329.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Enteritidis str. 2009K0958]
 gb|EPI76438.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Dublin str. DG22]
 gb|EPI79214.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Enteritidis str. 2009K1726]
 gb|EPI79760.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Enteritidis str. 2010K-0262]
 gb|EPI84314.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Enteritidis str. 2009K1651]
 gb|EPI96829.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Enteritidis str. 2010K-0284]
 gb|EPJ00161.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Enteritidis str. 2010K-0271]
 gb|EPJ00929.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Enteritidis str. 2010K-0267]
 gb|EPJ08632.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Enteritidis str. 2010K-0286]
 gb|AGQ75914.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Cubana str. CFSAN002050]
 gb|AGS65876.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Pullorum str. S06004]
 gb|AGU66634.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Gallinarum/pullorum str. CDC1983-67]
 gb|ERH40289.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 10-34587]
 emb|CCU67885.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 47.E.09]
 gb|ESB09550.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 460004 2-1]
 gb|ESB10524.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 311387-1]
 gb|ESB15064.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 339787]
 gb|ESB23405.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 447967 2-1]
 gb|ESB26654.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 460004 1-1]
 gb|ESB26705.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 447967 1-1]
 gb|ESB32947.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 442692 2-4]
 gb|ESB33269.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 409753-6]
 gb|ESB38091.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 442692 2-5]
 gb|ESB45851.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 557928]
 gb|ESB52045.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 620239]
 gb|ESB53447.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 467481]
 gb|ESB55115.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 432613]
 gb|ESB63722.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 266757-1]
 gb|ESB63752.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Muenster str. 660]
 gb|ESB68206.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Pullorum str. 13036]
 gb|ESB79375.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. SA-5]
 gb|ESB87972.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. SA-4]
 gb|ESB94302.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. ATCC BAA-707]
 gb|ESC03730.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. SARA61]
 gb|ESC22796.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 0322]
 gb|ESC23663.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 0292]
 gb|ESC27452.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. SA-1]
 gb|ESC32357.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. SA-2]
 gb|ESC47284.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. SA-3]
 gb|ESE75310.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. SARA62]
 gb|ESF42105.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Sloterdijk str. ATCC 15791]
 gb|ESF44476.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Tennessee str. TXSC_TXSC08-21]
 gb|ESF54228.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. ATCC 43845]
 gb|ESF62947.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Rubislaw str. ATCC 10717]
 gb|ESF66488.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Soerenga str. 695]
 gb|ESF85265.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. ATCC 51962]
 gb|ESF98128.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. ATCC BAA-1585]
 gb|ESG35811.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 8387]
 gb|ESG47586.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Mbandaka str. ATCC 51958]
 gb|ESG60390.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Muenster str. 420]
 gb|ESG64327.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Muenster str. 0315]
 gb|ESG85517.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Javiana str. 10721]
 gb|ESH11425.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Give str. 564]
 gb|ESH12532.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Chester str. ATCC 11997]
 gb|ESH15673.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Gaminara str. ATCC BAA-711]
 gb|ESH80865.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 648586-1]
 gb|ESH86262.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 419639 2-1]
 gb|ESH93406.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. ATCC 51957]
 gb|ESH96018.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 632182-2]
 gb|ESH99819.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Albany str. ATCC 51960]
 gb|ESJ25888.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Eastbourne str. CFSAN001084]
 gb|ESJ49886.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Cubana str. CFSAN001083]
 gb|ESJ53584.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Ohio str. CFSAN001079]
 gb|ESJ67092.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Norwich str. CFSAN001077]
 gb|ESO16738.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 400095 18]
 gb|ESO17303.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 400095 14]
 gb|ESO17631.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 400095 17]
 gb|ESO27598.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 400095 13]
 gb|ESO33237.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 400095 11]
 gb|ESO33831.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 392869-2]
 gb|ESO39145.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 392869-1]
 gb|ESO44874.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 246555-3]
 gb|ESO48367.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 241981]
 gb|ESV52101.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Cubana str. CVM42234]
 gb|AHB46190.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 24249]
 gb|ETA89931.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Cubana str. 76814]
 gb|ETC08317.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Typhimurium var. 5- str. CFSAN004345]
 gb|ETC40354.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Muenster str. CFSAN004344]
 gb|ETC46780.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CFSAN004346]
 gb|ETC69647.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 3402]
 gb|ETX31720.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Gallinarum/pullorum str. FCAV198]
 gb|AHN78048.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Tennessee str. TXSC_TXSC08-19]
 gb|AHO00059.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121175]
 gb|AHO05691.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121176]
 gb|AHO08750.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121178]
 gb|AHO14461.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121179]
 gb|AHO26012.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20093266]
 gb|AHO30667.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110223]
 gb|AHO35064.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120005]
 gb|AHO39495.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120544]
 gb|AHO43776.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120548]
 gb|AHO48056.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120555]
 gb|AHO52606.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110361]
 gb|AHO56929.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110360]
 gb|AHO61300.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110359]
 gb|AHO65630.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110358]
 gb|AHO69972.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110357]
 gb|AHO91460.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110356]
 gb|AHO95784.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19981857]
 gb|AHP00053.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19982831]
 gb|AHP04321.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19983126]
 gb|AHP08651.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19992322]
 gb|AHP49879.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19994216]
 gb|AHP54453.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20083456]
 gb|AHP58751.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20083636]
 gb|AHP62849.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20084384]
 gb|AHP67150.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19930684]
 gb|AHP12922.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19942384]
 gb|AHP17192.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19943269]
 gb|AHP21530.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19960848]
 gb|AHP25807.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19961622]
 gb|AHP30143.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19970510]
 gb|AHP34439.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19970769]
 gb|AHP38694.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19971331]
 gb|AHP42966.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19980677]
 gb|AHP47304.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19981522]
 gb|AHP71391.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20090135]
 gb|AHP75796.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20090193]
 gb|AHP80168.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20090332]
 gb|AHP84537.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20090877]
 gb|AHP88810.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20091739]
 gb|AHP93066.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20093421]
 gb|AHP97351.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20093430]
 gb|AHQ01633.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20093538]
 gb|AHQ05913.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20093543]
 gb|AHQ10188.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20093784]
 gb|AHQ14523.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094352]
 gb|AHQ18802.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094383]
 gb|AHQ23070.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094389]
 gb|AHQ27329.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094521]
 gb|AHQ31581.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094642]
 gb|AHQ32695.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120916]
 gb|AHQ38703.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121177]
 gb|AHQ44660.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20092320]
 gb|AHQ49347.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094803]
 gb|AHQ53610.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20095309]
 gb|AHQ57896.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20111561]
 gb|AHQ62178.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20111576]
 gb|AHQ66471.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120002]
 gb|AHQ70891.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120003]
 gb|AHQ75351.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120007]
 gb|AHR03911.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20130348]
 gb|AHR07832.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120200]
 gb|AHR12214.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20100103]
 gb|AHR16654.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20090884]
 gb|AHR21057.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20090531]
 gb|AHR25461.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20122033]
 gb|AHR29751.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20122045]
 gb|AHR34017.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20123395]
 gb|AHR38313.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20130345]
 gb|AHR42606.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20130346]
 gb|AHR69375.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121990]
 gb|AHR73632.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20122022]
 gb|AHR77902.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20122026]
 gb|AHR82178.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20122031]
 gb|AHS29923.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121765]
 gb|AHS34199.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121986]
 gb|AHS38486.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121989]
 gb|AHS42405.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120051]
 gb|AHS64010.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20090195]
 gb|AHS68168.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094682]
 gb|AHS72377.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20100131]
 gb|AHS99975.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120686]
 gb|AHT04228.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120687]
 gb|AHT10995.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120722]
 gb|AHT15280.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121976]
 gb|AHS78800.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121671]
 gb|AHS83060.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121672]
 gb|AHS87106.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121689]
 gb|AHS91428.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20121703]
 gb|AHS95706.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121744]
 gb|AHS46098.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120528]
 gb|AHS49051.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120994]
 gb|AHS53127.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121541]
 gb|AHS57929.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121542]
 gb|AHS07116.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120469]
 gb|AHS11398.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120496]
 gb|AHS15680.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120497]
 gb|AHS19612.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120498]
 gb|AHR85594.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120213]
 gb|AHR90034.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120219]
 gb|AHR94313.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120229]
 gb|AHR98593.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120240]
 gb|AHS02829.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120356]
 gb|AHR49762.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110222]
 gb|AHR54039.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20111514]
 gb|AHR58322.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20111515]
 gb|AHR62606.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20111554]
 gb|AHQ79716.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20093788]
 gb|AHQ83996.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20093950]
 gb|AHQ88279.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20093977]
 gb|AHQ92561.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094079]
 gb|AHQ96840.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094350]
 gb|AHT40599.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120580]
 gb|AHT44937.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120581]
 gb|AHT49215.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120590]
 gb|AHT53490.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120597]
 gb|AHT55893.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120685]
 gb|AHT81988.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20100100]
 gb|AHT86269.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20100130]
 gb|AHU04224.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20090435]
 gb|AHU08423.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20090530]
 gb|AHU12585.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20100088]
 gb|AHU16818.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20100089]
 gb|AHT19559.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121746]
 gb|AHT23797.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121748]
 gb|AHT28040.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121750]
 gb|AHT32307.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121751]
 gb|AHT36556.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121753]
 gb|AHT60614.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120734]
 gb|AHT64877.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120738]
 gb|AHT69155.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120765]
 gb|AHT73435.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120773]
 gb|AHT77719.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120774]
 gb|AHU21105.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120775]
 gb|AHU25386.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120776]
 gb|AHU29658.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120917]
 gb|AHU33919.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120918]
 gb|AHU38199.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120925]
 gb|AHU42404.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120927]
 gb|AHU46676.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120963]
 gb|AHU50950.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120968]
 gb|AHU55055.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120969]
 gb|AHU59365.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120970]
 gb|AHU63644.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121812]
 gb|AHU67918.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121825]
 gb|AHU72175.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121826]
 gb|AHU76463.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121969]
 gb|AHU80746.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121970]
 gb|AHT90642.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20100134]
 gb|AHV41235.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20111095]
 gb|AHV47267.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120929]
 gb|AHV51463.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121747]
 gb|AHV55641.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA19940857]
 gb|AHV15887.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20090641]
 gb|AHV20221.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110355]
 gb|AHV24219.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110353]
 gb|AHV28485.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20111175]
 gb|AHV32816.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20111174]
 gb|AHU94167.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110354]
 gb|AHU98504.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120008]
 gb|AHV02837.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20100101]
 gb|AHV07180.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20110221]
 gb|AHV11513.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20090698]
 gb|AHV60388.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20084644]
 gb|AHV64483.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20084824]
 gb|AHV68489.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094177]
 gb|AHV72657.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20094301]
 gb|AHV76899.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20111510]
 gb|AHW03138.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AHW17748.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Abaetetuba str. ATCC 35640]
 gb|AHW24022.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Bredeney str. CFSAN001080]
 gb|AHW04510.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. CDC_2010K_0968]
 gb|AHT95033.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20100325]
 gb|KAJ98601.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar 9,12:l,v:- str. 94293]
 gb|AHZ04574.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 77-1427]
 gb|KDQ96838.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. FVM_628064]
 emb|CDS69679.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Pullorum]
 gb|AIM68371.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIM72799.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIM76823.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIM81096.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIM85438.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIM89801.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIM94166.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIM98531.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIN02897.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIN07265.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIN11589.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|AIN70004.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Enteritidis]
 gb|KGZ00899.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|KHP10837.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP11604.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP19650.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP27303.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP27639.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP42160.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP47741.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP51623.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP58525.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP58708.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP62028.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KFS76377.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000235]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024156870.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869009.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 ref|YP_152636.1| carboxylic acid dehydrogenase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. ATCC 9150]
 ref|YP_002144125.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. AKU_12601]
 sp|Q5PLN6.1|DLGD_SALPA RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Salmonella enterica subsp. enterica serovar Paratyphi A str. 
ATCC 9150]
 sp|B5BHV4.1|DLGD_SALPK RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Salmonella enterica subsp. enterica serovar Paratyphi A str. 
AKU_12601]
 gb|AAV79324.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Paratyphi A str. ATCC 9150]
 emb|CAR61549.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Paratyphi A str. AKU_12601]
 gb|EPE42286.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. GZ9A00052]
 gb|EPE42679.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. JX05-19]
 gb|EPE42926.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. GXS2268]
 gb|EPE53752.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. ZJ98-53]
 gb|EPE54295.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. YN09620]
 gb|ESF95888.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. ATCC 11511]
 gb|AJD99279.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi A]
 gb|AJD97497.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi A]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000861181.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 emb|CCF86765.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. SS209]
 gb|ESB97785.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. 361154004]
 gb|ESC86862.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. NC_MB012510-0038]
 gb|ESF53009.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. 604314]
 gb|ESG29737.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. 423984-2]
 gb|ESG62586.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. 316235162]
 gb|KHP74052.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP76042.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP82527.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP89295.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP94447.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHP96054.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHQ01739.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869005.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 ref|YP_007472783.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Javiana str. CFSAN001992]
 gb|EDZ07221.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Javiana str. GA_MM04042433]
 gb|EFY10883.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 315996572]
 gb|EFY17184.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 495297-1]
 gb|EFY22148.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 495297-3]
 gb|EFY26785.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 495297-4]
 gb|EFY30937.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 515920-1]
 gb|EFY32606.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 515920-2]
 gb|EFY39650.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 531954]
 gb|EFY41130.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. NC_MB110209-0054]
 gb|EFY47228.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. OH_2009072675]
 gb|EFY49335.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CASC_09SCPH15965]
 gb|EFY56203.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 19N]
 gb|EFY59500.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 81038-01]
 gb|EFY64935.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. MD_MDA09249507]
 gb|EFY70508.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 414877]
 gb|EFY74438.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 366867]
 gb|EFY76917.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 413180]
 gb|EFY83154.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 446600]
 gb|EFZ77373.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 609458-1]
 gb|EFZ85718.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 556150-1]
 gb|EFZ86420.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 609460]
 gb|EFZ96648.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 556152]
 gb|EGA00903.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. MB101509-0077]
 gb|EGA04852.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. MB102109-0047]
 gb|EGA10470.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. MB110209-0055]
 gb|EGA12506.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. MB111609-0052]
 gb|EGA18284.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 2009083312]
 gb|EGA21248.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 2009085258]
 gb|EGA28704.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 315731156]
 gb|EGA33099.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2009159199]
 gb|EGA34580.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008282]
 gb|EGA41262.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008283]
 gb|EGA45845.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008284]
 gb|EGA49652.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008285]
 gb|EGA52254.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008287]
 gb|EHC44270.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Give str. S5-487]
 gb|EHC60693.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Minnesota str. A4-603]
 gb|EHN20890.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 80959-06]
 gb|EHN25655.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CT_02035318]
 gb|EHN27556.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CT_02035278]
 gb|EHN34094.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CT_02035320]
 gb|EHN37084.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CT_02035321]
 gb|EHN42858.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CT_02035327]
 gb|EHN48684.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Pomona str. ATCC 10729]
 gb|EHP20214.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008286]
 gb|ELX37994.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Javiana str. ATCC BAA-1593]
 gb|ELX63435.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 316111868]
 gb|AGF83345.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Javiana str. CFSAN001992]
 gb|ESG05169.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Panama str. ATCC 7378]
 gb|ESG13035.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Oranienburg str. 701]
 gb|ESG17123.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Oranienburg str. 0250]
 gb|ESG18022.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Poona str. ATCC BAA-1673]
 gb|ESG27056.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Minnesota str. ATCC 49284]
 gb|ESG42743.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Miami str. 1923]
 gb|ESG88833.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Javiana str. PRS_2010_0720]
 gb|ESP72928.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Saintpaul str. S-70]
 gb|ESP77720.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Oranienburg str. S-76]
 gb|AHW11548.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 507440-20]
 gb|KGR31316.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
Length=332

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024910003.1| 2,3-diketo-L-gulonate reductase [Serratia fonticola]
 gb|AHG19356.1| 2,3-diketo-L-gulonate reductase [Serratia fonticola RB-25]
Length=332

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV   TADACAEMFA TTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVVEATADACAEMFAETTESGVYSHGVNRFPRFIQ  54



>ref|WP_023166584.1| 2,3-diketo-L-gulonate reductase, partial [Salmonella enterica]
 gb|ESB98259.1| 2,3-diketo-L-gulonate reductase, partial [Salmonella enterica 
subsp. enterica serovar Senftenberg str. 423984-1]
Length=328

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_031613305.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|KDR98437.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. RI-11-013988]
 gb|KDS04850.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. RI-11-014316]
 gb|KDS06681.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. RI-11-014319]
 gb|KDU72540.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. RI-11-013312]
 gb|KDU75834.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 640151-11]
Length=332

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869010.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 ref|YP_002047697.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SL476]
 ref|YP_006089742.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Heidelberg str. B182]
 ref|YP_008244958.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41578]
 ref|YP_008251520.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CFSAN002069]
 sp|B4T959.1|DLGD_SALHS RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Salmonella enterica subsp. enterica serovar Heidelberg str. 
SL476]
 gb|ACF66975.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SL476]
 gb|EDZ25664.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SL486]
 gb|EIC34472.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41579]
 gb|EIC36629.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41573]
 gb|EIC37005.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41563]
 gb|EIC52819.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41566]
 gb|EIC61488.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41565]
 gb|AFH47465.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Heidelberg str. B182]
 gb|EJW28880.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CFSAN00322]
 gb|EJW29577.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CFSAN00325]
 gb|EJW30439.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CFSAN00326]
 gb|EJW36280.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CFSAN00328]
 gb|AGQ62488.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41578]
 gb|AGQ80335.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CFSAN002069]
 gb|ESE47334.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SARA35]
 gb|ESE49370.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 82-2052]
 gb|ESE50363.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 24390]
 gb|AHB95513.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CFSAN002064]
 gb|EYE74031.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N1514]
 gb|EYE80546.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N1536]
 gb|EYE82688.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 29169]
 gb|EYH50986.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SARA32]
 gb|EYH55923.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SARA31]
 gb|EYH68211.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N418]
 gb|EYH72776.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N19992]
 gb|EYH74701.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N189]
 gb|EYH78092.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SARA 39]
 gb|EYH83557.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N4403]
 gb|EYH84399.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N4496]
 gb|EYH94599.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 21381]
 gb|EYH95814.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N653]
 gb|EYI08039.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N4630]
 gb|EYI10642.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N19871]
 gb|EYI15379.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N4541]
 gb|EYI19479.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N26457]
 gb|EYI21907.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N18393]
 gb|EYI24866.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N15757]
 gb|EYI25659.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41567]
 gb|EYI30301.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41576]
 gb|EYI33505.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41584]
 gb|EYI42648.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N29341]
 gb|EYI43182.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N30678]
 gb|EYI54626.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 32507]
 gb|EYI58615.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N20134]
 gb|EYI60790.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 24393]
 gb|EYI66290.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CVM24391]
 gb|EYI72430.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CVM20752]
 gb|EYI80192.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CVM24388]
 gb|EYI85306.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N18413]
 gb|EYI87190.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CVM24359]
 gb|EYI88620.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N18453]
 gb|EYI88855.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N18440]
 gb|KHO85522.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHO92659.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHO96667.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
 gb|KHO97393.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
Length=332

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_006892019.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 emb|CCU24494.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Agona str. 57.A.08]
Length=332

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TADACAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADACAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_004126498.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca]
 gb|EHT10536.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca 10-5250]
Length=332

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  ETAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNITEETADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_004855404.1| MULTISPECIES: 2,3-diketo-L-gulonate reductase [Klebsiella]
 gb|EHS93467.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca 10-5242]
 gb|EJU24452.1| 3-dehydro-L-gulonate 2-dehydrogenase [Klebsiella sp. OBRC7]
 gb|EWF94395.1| 2,3-diketo-L-gulonate reductase [Klebsiella oxytoca MGH 27]
Length=332

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  ETAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNITEETADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|EHC30625.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Adelaide str. A4-669]
Length=332

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|EHC50522.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica subsp. 
enterica serovar Inverness str. R8-3668]
Length=332

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869014.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 ref|YP_002042916.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. SL254]
 ref|YP_008358134.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. USMARC-S3124.1]
 sp|B4SWL6.1|DLGD_SALNS RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Salmonella enterica subsp. enterica serovar Newport str. 
SL254]
 gb|ACF62670.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. SL254]
 gb|EJA37360.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 22513]
 gb|EJA38655.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 21550]
 gb|EJA44266.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 21538]
 gb|EJA50312.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 22425]
 gb|EJA53946.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM N18486]
 gb|EJA61443.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM N1543]
 gb|EJA67624.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 21554]
 gb|EJA72005.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 37978]
 gb|EJA80996.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 22462]
 gb|EJA83441.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 19593]
 gb|AGS27190.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. USMARC-S3124.1]
 gb|ESB84745.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. 637564_17]
 gb|ESC41731.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. RI_10P079]
 gb|ESC50070.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. RI_10P078]
 gb|ESC50358.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. RI_10P069]
 gb|ESC52124.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. RI_10P068]
 gb|ESC60191.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. WA_14885]
 gb|ESC64549.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. WA_14900]
 gb|ESC68405.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. WA_14882]
 gb|ESC71794.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. WA_14881]
 gb|ESC76523.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. VA_R100512572]
 gb|ESC81101.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. VA_R100512570]
 gb|ESO56842.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. VA_R100506907]
 gb|AIT45179.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM N18486]
 gb|AIT51146.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 21554]
 gb|AJB10335.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 22462]
Length=332

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADKCAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_024159191.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
Length=330

 Score = 72.4 bits (176),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_015690844.1| 3-dehydro-L-gulonate 2-dehydrogenase [Salmonella enterica]
 ref|YP_005398990.1| carboxylic acid dehydrogenase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 798]
 gb|AFD60525.1| putative carboxylic acid dehydrogenase [Salmonella enterica subsp. 
enterica serovar Typhimurium str. 798]
Length=158

 Score = 70.9 bits (172),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>gb|KFU64316.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000181]
Length=332

 Score = 72.4 bits (176),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023227840.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|ESH00677.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Inverness str. ATCC 10720]
Length=332

 Score = 72.4 bits (176),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023227135.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|ESG95079.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Indiana str. ATCC 51959]
Length=332

 Score = 72.4 bits (176),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_000869011.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 ref|YP_001590705.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. SPB7]
 sp|A9MUW2.1|DLGD_SALPB RecName: Full=2,3-diketo-L-gulonate reductase; Short=2,3-DKG 
reductase; AltName: Full=3-dehydro-L-gulonate 2-dehydrogenase 
[Salmonella enterica subsp. enterica serovar Paratyphi B str. 
SPB7]
 gb|ABX69872.1| hypothetical protein SPAB_04559 [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. SPB7]
 gb|ESF80271.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. ATCC 19940]
 gb|ESF89687.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. ATCC 10719]
 gb|KHP71900.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica]
Length=332

 Score = 72.4 bits (176),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_023232389.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica]
 gb|ESH15626.1| 2,3-diketo-L-gulonate reductase [Salmonella enterica subsp. enterica 
serovar Derby str. 626]
Length=332

 Score = 72.4 bits (176),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L SR +  +TAD CAEMFARTTESGVYSHGVNRFPRFIQ
Sbjct  16   LRSRNIAEDTADECAEMFARTTESGVYSHGVNRFPRFIQ  54



>ref|WP_029096367.1| 2,3-diketo-L-gulonate reductase [Budvicia aquatica]
Length=332

 Score = 72.4 bits (176),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  118  LISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQ  2
            L++RGV +E AD CA MFA+TTESGVYSHGVNRFPRFIQ
Sbjct  16   LLARGVKAELADECATMFAQTTESGVYSHGVNRFPRFIQ  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519686539684