BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c36008_g1_i1 len=1338 path=[1:0-1337]

Length=1338
                                                                      Score     E

ref|XP_004237719.1|  PREDICTED: uncharacterized protein LOC101258062    322   6e-103   
ref|XP_009790690.1|  PREDICTED: uncharacterized protein LOC104238109    309   6e-98    
ref|XP_009586898.1|  PREDICTED: uncharacterized protein LOC104084686    310   2e-96    
ref|XP_002520252.1|  conserved hypothetical protein                     297   2e-93    Ricinus communis
gb|KEH40474.1|  transmembrane protein, putative                         295   2e-92    
gb|KDP43074.1|  hypothetical protein JCGZ_25260                         294   2e-92    
gb|AFK37921.1|  unknown                                                 293   1e-91    
gb|KEH35396.1|  transmembrane protein, putative                         291   2e-91    
ref|XP_011075019.1|  PREDICTED: uncharacterized protein LOC105159603    291   6e-91    
ref|XP_002307472.2|  hypothetical protein POPTR_0005s20850g             291   7e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010999841.1|  PREDICTED: uncharacterized protein LOC105107569    290   2e-90    
ref|XP_004498373.1|  PREDICTED: uncharacterized protein LOC101496539    290   2e-90    
gb|EYU32463.1|  hypothetical protein MIMGU_mgv1a018498mg                286   6e-89    
ref|XP_010042860.1|  PREDICTED: uncharacterized protein LOC104432060    284   2e-88    
ref|XP_002262838.1|  PREDICTED: uncharacterized protein LOC100255146    281   4e-87    Vitis vinifera
ref|XP_002267135.1|  PREDICTED: uncharacterized protein LOC100243726    280   1e-86    Vitis vinifera
ref|XP_002309916.2|  hypothetical protein POPTR_0007s04180g             277   9e-86    Populus trichocarpa [western balsam poplar]
ref|XP_010089328.1|  hypothetical protein L484_021860                   276   3e-85    
ref|XP_007161389.1|  hypothetical protein PHAVU_001G064700g             276   3e-85    
ref|XP_006596263.1|  PREDICTED: uncharacterized protein LOC102660467    275   9e-85    
ref|XP_002309917.1|  hypothetical protein POPTR_0007s04191g             275   1e-84    Populus trichocarpa [western balsam poplar]
ref|XP_008373300.1|  PREDICTED: uncharacterized protein LOC103436635    274   2e-84    
ref|XP_011023091.1|  PREDICTED: uncharacterized protein LOC105124685    271   2e-83    
ref|XP_007137514.1|  hypothetical protein PHAVU_009G133500g             270   6e-83    
ref|XP_007200390.1|  hypothetical protein PRUPE_ppa008434mg             270   6e-83    
ref|XP_007019305.1|  Uncharacterized protein TCM_035327                 270   8e-83    
ref|XP_010264907.1|  PREDICTED: uncharacterized protein LOC104602788    269   2e-82    
ref|XP_006434342.1|  hypothetical protein CICLE_v10001753mg             269   2e-82    
ref|XP_011022935.1|  PREDICTED: uncharacterized protein LOC105124568    268   4e-82    
ref|XP_008237718.1|  PREDICTED: uncharacterized protein LOC103336454    267   1e-81    
ref|XP_008381733.1|  PREDICTED: uncharacterized protein LOC103444562    266   4e-81    
ref|NP_001241069.1|  uncharacterized protein LOC100819866               265   7e-81    
gb|KDO83562.1|  hypothetical protein CISIN_1g019636mg                   265   1e-80    
ref|XP_010041277.1|  PREDICTED: uncharacterized protein LOC104430213    264   1e-80    
ref|XP_004502568.1|  PREDICTED: uncharacterized protein LOC101512421    264   1e-80    
ref|XP_010041278.1|  PREDICTED: uncharacterized protein LOC104430214    262   3e-80    
ref|XP_003526666.1|  PREDICTED: uncharacterized protein LOC100798371    263   5e-80    
ref|XP_009368431.1|  PREDICTED: uncharacterized protein LOC103957931    259   8e-79    
ref|XP_011100146.1|  PREDICTED: uncharacterized protein LOC105178379    256   2e-77    
emb|CDP10982.1|  unnamed protein product                                256   2e-77    
emb|CDP21521.1|  unnamed protein product                                250   3e-75    
ref|XP_010270454.1|  PREDICTED: uncharacterized protein LOC104606785    249   4e-75    
ref|XP_010065112.1|  PREDICTED: uncharacterized protein LOC104452333    249   4e-75    
ref|XP_004292550.1|  PREDICTED: uncharacterized protein LOC101297805    249   5e-75    
gb|KHN25585.1|  hypothetical protein glysoja_050259                     248   1e-74    
ref|XP_007048406.1|  Uncharacterized protein TCM_001500                 249   1e-74    
ref|XP_010260469.1|  PREDICTED: uncharacterized protein LOC104599567    248   3e-74    
ref|XP_011027398.1|  PREDICTED: uncharacterized protein LOC105127...    247   8e-74    
ref|XP_010680207.1|  PREDICTED: uncharacterized protein LOC104895408    244   5e-73    
ref|XP_008466696.1|  PREDICTED: uncharacterized protein LOC103504045    243   2e-72    
ref|XP_010105097.1|  hypothetical protein L484_000477                   241   8e-72    
ref|XP_003522558.1|  PREDICTED: uncharacterized protein LOC100817862    239   4e-71    
ref|XP_002526640.1|  conserved hypothetical protein                     235   2e-69    Ricinus communis
ref|XP_006842394.1|  hypothetical protein AMTR_s00209p00027350          235   2e-69    
gb|KGN47743.1|  hypothetical protein Csa_6G398200                       234   3e-69    
ref|XP_004146074.1|  PREDICTED: uncharacterized protein LOC101219186    233   8e-69    
ref|XP_008463672.1|  PREDICTED: uncharacterized protein LOC103501766    233   1e-68    
gb|EYU23743.1|  hypothetical protein MIMGU_mgv1a026174mg                233   2e-68    
gb|KHN44271.1|  hypothetical protein glysoja_024491                     232   2e-68    
ref|XP_010027648.1|  PREDICTED: uncharacterized protein LOC104418115    231   5e-68    
ref|XP_010089323.1|  hypothetical protein L484_021855                   230   1e-67    
ref|XP_010921707.1|  PREDICTED: uncharacterized protein LOC105045215    226   7e-66    
ref|XP_010041179.1|  PREDICTED: uncharacterized protein LOC104430114    225   1e-65    
emb|CBI19944.3|  unnamed protein product                                226   2e-65    
ref|XP_010030341.1|  PREDICTED: uncharacterized protein LOC104420146    224   5e-65    
ref|XP_002278755.1|  PREDICTED: uncharacterized protein LOC100245483    223   9e-65    Vitis vinifera
gb|EYU24100.1|  hypothetical protein MIMGU_mgv1a024728mg                221   4e-64    
ref|XP_010030352.1|  PREDICTED: uncharacterized protein LOC104420156    221   7e-64    
ref|XP_006386332.1|  hypothetical protein POPTR_0002s07480g             219   4e-63    
ref|XP_002278720.1|  PREDICTED: uncharacterized protein LOC100255793    217   1e-62    Vitis vinifera
gb|ACU21517.1|  unknown                                                 216   1e-62    Glycine max [soybeans]
gb|EYU23744.1|  hypothetical protein MIMGU_mgv1a019112mg                216   3e-62    
ref|XP_008810898.1|  PREDICTED: uncharacterized protein LOC103722200    214   2e-61    
emb|CAN61489.1|  hypothetical protein VITISV_042682                     213   4e-61    Vitis vinifera
gb|EYU23845.1|  hypothetical protein MIMGU_mgv1a009636mg                212   1e-60    
ref|XP_006386334.1|  hypothetical protein POPTR_0002s07500g             209   3e-60    
ref|XP_010911549.1|  PREDICTED: uncharacterized protein LOC105037605    211   4e-60    
ref|XP_008813041.1|  PREDICTED: uncharacterized protein LOC103723786    209   2e-59    
ref|XP_010030350.1|  PREDICTED: uncharacterized protein LOC104420154    206   2e-58    
ref|XP_009360779.1|  PREDICTED: uncharacterized protein LOC103951194    205   2e-58    
gb|EYU18030.1|  hypothetical protein MIMGU_mgv1a017782mg                206   4e-58    
ref|XP_002278947.1|  PREDICTED: uncharacterized protein LOC100243642    204   2e-57    Vitis vinifera
ref|XP_009382943.1|  PREDICTED: uncharacterized protein LOC103970755    201   3e-56    
gb|KEH35395.1|  transmembrane protein, putative                         199   5e-56    
ref|XP_003573268.1|  PREDICTED: uncharacterized protein LOC100828305    197   7e-55    
ref|XP_010030348.1|  PREDICTED: uncharacterized protein LOC104420152    197   7e-55    
dbj|BAJ96330.1|  predicted protein                                      197   7e-55    
gb|EYU20214.1|  hypothetical protein MIMGU_mgv1a0238521mg               196   1e-54    
ref|XP_010030351.1|  PREDICTED: uncharacterized protein LOC104420155    194   6e-54    
ref|XP_008352648.1|  PREDICTED: uncharacterized protein LOC103416171    191   2e-53    
gb|AFW74213.1|  hypothetical protein ZEAMMB73_246875                    195   3e-53    
ref|NP_001143962.1|  uncharacterized protein LOC100276777               191   1e-52    Zea mays [maize]
ref|XP_008647663.1|  PREDICTED: uncharacterized protein LOC100276...    193   1e-52    
ref|XP_006659031.1|  PREDICTED: uncharacterized protein LOC102709862    191   1e-52    
ref|XP_010041111.1|  PREDICTED: uncharacterized protein LOC104430023    187   2e-51    
ref|XP_010030342.1|  PREDICTED: uncharacterized protein LOC104420147    189   3e-51    
ref|XP_010063901.1|  PREDICTED: uncharacterized protein LOC104450888    186   3e-51    
gb|KHN06024.1|  hypothetical protein glysoja_050104                     181   6e-50    
ref|NP_001060795.1|  Os08g0107100                                       182   1e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010041974.1|  PREDICTED: uncharacterized protein LOC104430968    182   3e-49    
ref|XP_004972432.1|  PREDICTED: uncharacterized protein LOC101755585    181   1e-48    
ref|XP_008664724.1|  PREDICTED: uncharacterized protein LOC103643340    180   1e-48    
gb|ABK26963.1|  unknown                                                 179   3e-48    Picea sitchensis
ref|XP_008464345.1|  PREDICTED: uncharacterized protein LOC103502253    179   5e-48    
gb|ABR16362.1|  unknown                                                 177   3e-47    Picea sitchensis
ref|XP_003543959.1|  PREDICTED: uncharacterized protein LOC100776586    174   2e-46    
gb|EEC82781.1|  hypothetical protein OsI_27526                          171   1e-45    Oryza sativa Indica Group [Indian rice]
tpg|DAA49205.1|  TPA: hypothetical protein ZEAMMB73_866262              176   2e-45    
emb|CBI19938.3|  unnamed protein product                                170   2e-45    
ref|XP_010030343.1|  PREDICTED: uncharacterized protein LOC104420148    172   3e-45    
ref|XP_011027693.1|  PREDICTED: uncharacterized protein LOC105127910    168   6e-45    
ref|XP_001762332.1|  predicted protein                                  169   1e-44    
ref|XP_011027399.1|  PREDICTED: uncharacterized protein LOC105127...    167   2e-44    
ref|XP_010041279.1|  PREDICTED: uncharacterized protein LOC104430215    165   2e-44    
ref|XP_011016504.1|  PREDICTED: uncharacterized protein LOC105120011    164   9e-44    
ref|XP_002306664.1|  hypothetical protein POPTR_0005s20680g             166   3e-43    Populus trichocarpa [western balsam poplar]
ref|XP_011006316.1|  PREDICTED: uncharacterized protein LOC105112334    162   7e-42    
ref|XP_002300951.2|  hypothetical protein POPTR_0002s07480g             160   9e-42    Populus trichocarpa [western balsam poplar]
ref|XP_010030346.1|  PREDICTED: uncharacterized protein LOC104420151    160   1e-41    
ref|XP_004164698.1|  PREDICTED: uncharacterized protein LOC101229535    158   3e-41    
gb|EYU23745.1|  hypothetical protein MIMGU_mgv1a025495mg                159   4e-41    
ref|XP_001779672.1|  predicted protein                                  159   1e-40    
ref|XP_010664867.1|  PREDICTED: uncharacterized protein LOC100259232    159   1e-40    
ref|XP_001768541.1|  predicted protein                                  157   3e-40    
ref|XP_002278929.1|  PREDICTED: uncharacterized protein LOC100249009    157   5e-40    Vitis vinifera
gb|KGN45907.1|  hypothetical protein Csa_6G020210                       151   2e-38    
emb|CAG27628.1|  hypothetical protein                                   143   3e-37    Populus deltoides x Populus maximowiczii
ref|XP_010030338.1|  PREDICTED: uncharacterized protein LOC104420144    147   2e-36    
gb|AFK48911.1|  unknown                                                 142   2e-36    
ref|XP_010041176.1|  PREDICTED: uncharacterized protein LOC104430112    145   5e-36    
ref|XP_007041069.1|  Polyadenylate-binding protein 1-B-binding pr...    143   4e-35    
ref|XP_011085153.1|  PREDICTED: uncharacterized protein LOC105167226    140   3e-34    
emb|CDY69846.1|  BnaAnng31730D                                          139   1e-33    
emb|CDX98243.1|  BnaC07g08550D                                          139   1e-33    
emb|CDX77557.1|  BnaA07g06950D                                          139   2e-33    
ref|XP_010260589.1|  PREDICTED: uncharacterized protein LOC104599665    138   2e-33    
ref|XP_010042509.1|  PREDICTED: uncharacterized protein LOC104431600    138   2e-33    
ref|XP_009115016.1|  PREDICTED: uncharacterized protein LOC103840270    138   2e-33    
gb|KFK44925.1|  hypothetical protein AALP_AA1G320500                    138   2e-33    
ref|XP_011100147.1|  PREDICTED: uncharacterized protein LOC105178380    139   2e-33    
gb|EYU43665.1|  hypothetical protein MIMGU_mgv1a026880mg                137   3e-33    
ref|XP_008383297.1|  PREDICTED: uncharacterized protein LOC103446015    137   6e-33    
ref|XP_009102672.1|  PREDICTED: uncharacterized protein LOC103828788    137   8e-33    
gb|KDP30542.1|  hypothetical protein JCGZ_15251                         135   1e-32    
emb|CDY43164.1|  BnaCnng10920D                                          135   1e-32    
ref|XP_010540664.1|  PREDICTED: uncharacterized protein LOC104814356    135   2e-32    
emb|CDY02362.1|  BnaA09g25400D                                          135   3e-32    
emb|CDP20309.1|  unnamed protein product                                134   3e-32    
ref|XP_002523654.1|  conserved hypothetical protein                     135   3e-32    Ricinus communis
ref|XP_010538302.1|  PREDICTED: uncharacterized protein LOC104812705    135   4e-32    
ref|XP_006415365.1|  hypothetical protein EUTSA_v10008216mg             134   4e-32    
ref|XP_008371897.1|  PREDICTED: uncharacterized protein LOC103435294    134   4e-32    
emb|CDP11268.1|  unnamed protein product                                134   5e-32    
ref|XP_010058033.1|  PREDICTED: uncharacterized protein LOC104445812    134   7e-32    
ref|XP_008245148.1|  PREDICTED: uncharacterized protein LOC103343260    134   8e-32    
ref|XP_003621678.1|  hypothetical protein MTR_7g021620                  134   8e-32    
ref|XP_006304027.1|  hypothetical protein CARUB_v10009765mg             134   9e-32    
ref|XP_002321825.1|  hypothetical protein POPTR_0015s14940g             134   9e-32    Populus trichocarpa [western balsam poplar]
ref|XP_007211639.1|  hypothetical protein PRUPE_ppa008766mg             133   1e-31    
ref|XP_009108135.1|  PREDICTED: uncharacterized protein LOC103833829    132   2e-31    
ref|XP_010478556.1|  PREDICTED: uncharacterized protein LOC104757507    132   2e-31    
ref|XP_010499664.1|  PREDICTED: uncharacterized protein LOC104777151    132   2e-31    
ref|XP_010460912.1|  PREDICTED: uncharacterized protein LOC104741705    132   3e-31    
gb|EPS73552.1|  hypothetical protein M569_01204                         132   3e-31    
ref|XP_011000166.1|  PREDICTED: uncharacterized protein LOC105107810    131   4e-31    
ref|XP_010093191.1|  hypothetical protein L484_013314                   130   9e-31    
ref|XP_010434346.1|  PREDICTED: uncharacterized protein LOC104718320    130   1e-30    
ref|NP_564374.1|  uncharacterized protein                               129   2e-30    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519002.1|  PREDICTED: uncharacterized protein LOC104798556    129   2e-30    
gb|EMT33780.1|  hypothetical protein F775_30040                         126   3e-30    
ref|XP_010439634.1|  PREDICTED: uncharacterized protein LOC104723041    129   3e-30    
ref|XP_006413920.1|  hypothetical protein EUTSA_v10026779mg             129   3e-30    
ref|XP_003608510.1|  hypothetical protein MTR_4g096890                  129   3e-30    
gb|KGN47744.1|  hypothetical protein Csa_6G398210                       129   4e-30    
ref|XP_006387906.1|  hypothetical protein POPTR_0487s002102g            125   4e-30    
ref|XP_006465008.1|  PREDICTED: uncharacterized protein LOC102615061    128   8e-30    
ref|XP_010536691.1|  PREDICTED: uncharacterized protein LOC104811630    127   1e-29    
ref|XP_011096819.1|  PREDICTED: uncharacterized protein LOC105175883    126   3e-29    
ref|NP_193728.2|  uncharacterized protein                               126   3e-29    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006468502.1|  PREDICTED: uncharacterized protein LOC102615278    125   6e-29    
ref|XP_010696334.1|  PREDICTED: uncharacterized protein LOC104908866    125   6e-29    
ref|XP_010648978.1|  PREDICTED: uncharacterized protein LOC100252459    125   8e-29    
ref|XP_010449275.1|  PREDICTED: uncharacterized protein LOC104731548    125   8e-29    
ref|XP_004293771.1|  PREDICTED: uncharacterized protein LOC101293075    124   1e-28    
ref|XP_004231583.1|  PREDICTED: uncharacterized protein LOC101247571    124   2e-28    
ref|XP_006284127.1|  hypothetical protein CARUB_v10005259mg             124   2e-28    
ref|XP_010030339.1|  PREDICTED: uncharacterized protein LOC104420145    123   2e-28    
emb|CAA16603.1|  putative protein                                       123   2e-28    Arabidopsis thaliana [mouse-ear cress]
emb|CDY12438.1|  BnaC08g09270D                                          123   3e-28    
ref|XP_003524809.1|  PREDICTED: uncharacterized protein LOC100797824    123   4e-28    
ref|XP_010041178.1|  PREDICTED: uncharacterized protein LOC104430113    122   4e-28    
ref|XP_008440618.1|  PREDICTED: uncharacterized protein LOC103484985    123   4e-28    
gb|KDO77337.1|  hypothetical protein CISIN_1g020766mg                   123   5e-28    
ref|XP_010441817.1|  PREDICTED: uncharacterized protein LOC104724...    122   8e-28    
ref|XP_004504676.1|  PREDICTED: uncharacterized protein LOC101515353    122   1e-27    
ref|XP_006356886.1|  PREDICTED: uncharacterized protein LOC102605...    122   1e-27    
ref|XP_004145125.1|  PREDICTED: uncharacterized protein LOC101217213    120   4e-27    
gb|KGN64471.1|  hypothetical protein Csa_1G058060                       120   5e-27    
ref|XP_006398126.1|  hypothetical protein EUTSA_v10001106mg             119   8e-27    
ref|XP_010481699.1|  PREDICTED: uncharacterized protein LOC104760477    119   1e-26    
emb|CDY50777.1|  BnaC07g18260D                                          119   1e-26    
ref|XP_009764357.1|  PREDICTED: uncharacterized protein LOC104216094    119   1e-26    
ref|XP_007158902.1|  hypothetical protein PHAVU_002G191400g             118   1e-26    
gb|EMS48934.1|  hypothetical protein TRIUR3_32538                       118   2e-26    
ref|XP_009101630.1|  PREDICTED: uncharacterized protein LOC103827822    118   2e-26    
ref|XP_009630354.1|  PREDICTED: uncharacterized protein LOC104120320    118   2e-26    
gb|KFK31603.1|  hypothetical protein AALP_AA6G134500                    117   3e-26    
ref|XP_002863539.1|  hypothetical protein ARALYDRAFT_917078             117   5e-26    
ref|XP_010494539.1|  PREDICTED: uncharacterized protein LOC104771669    116   1e-25    
ref|NP_199299.1|  uncharacterized protein                               115   1e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002318888.1|  hypothetical protein POPTR_0012s14750g             115   1e-25    Populus trichocarpa [western balsam poplar]
ref|XP_010529293.1|  PREDICTED: uncharacterized protein LOC104806216    114   3e-25    
ref|XP_006280824.1|  hypothetical protein CARUB_v10026792mg             114   5e-25    
ref|XP_010030349.1|  PREDICTED: uncharacterized protein LOC104420153    109   7e-24    
ref|XP_009759733.1|  PREDICTED: uncharacterized protein LOC104212215    110   8e-24    
ref|XP_011029940.1|  PREDICTED: uncharacterized protein LOC105129531    110   9e-24    
ref|XP_008381731.1|  PREDICTED: uncharacterized protein LOC103444560    105   2e-23    
ref|XP_009589786.1|  PREDICTED: uncharacterized protein LOC104087091    109   2e-23    
emb|CDY51890.1|  BnaC01g41310D                                          107   5e-23    
ref|XP_004229510.1|  PREDICTED: uncharacterized protein LOC101252815    108   5e-23    
ref|XP_006354606.1|  PREDICTED: uncharacterized protein LOC102603419    107   8e-23    
gb|KDO51680.1|  hypothetical protein CISIN_1g035634mg                   107   2e-22    
ref|XP_010680472.1|  PREDICTED: uncharacterized protein LOC104895611    100   6e-22    
ref|XP_009397210.1|  PREDICTED: uncharacterized protein LOC103982118    104   9e-22    
ref|XP_008798698.1|  PREDICTED: uncharacterized protein LOC103713518    104   1e-21    
ref|XP_010932271.1|  PREDICTED: uncharacterized protein LOC105052977    103   2e-21    
gb|KGN47986.1|  hypothetical protein Csa_6G421800                       103   2e-21    
ref|XP_008464353.1|  PREDICTED: uncharacterized protein LOC103502262    103   2e-21    
ref|XP_006658971.1|  PREDICTED: uncharacterized protein LOC102710140    102   6e-21    
ref|XP_006432197.1|  hypothetical protein CICLE_v10003650mg             101   7e-21    
dbj|BAF01423.1|  hypothetical protein                                 99.4    1e-20    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010030345.1|  PREDICTED: uncharacterized protein LOC104420150  97.8    6e-20    
ref|XP_008795789.1|  PREDICTED: uncharacterized protein LOC103711430  99.0    8e-20    
gb|KGN63125.1|  hypothetical protein Csa_2G404770                     96.7    6e-19    
ref|XP_001779038.1|  predicted protein                                95.5    2e-18    
ref|XP_006432196.1|  hypothetical protein CICLE_v10003463mg           94.7    3e-18    
ref|XP_003564405.2|  PREDICTED: uncharacterized protein LOC100837055  95.5    5e-18    
gb|KDO51679.1|  hypothetical protein CISIN_1g037643mg                 93.2    1e-17    
ref|XP_010480794.1|  PREDICTED: uncharacterized protein LOC104759583  90.5    2e-17    
ref|XP_008466772.1|  PREDICTED: uncharacterized protein LOC103504102  89.0    2e-17    
gb|KDO51678.1|  hypothetical protein CISIN_1g020089mg                 91.7    3e-17    
ref|XP_002986807.1|  hypothetical protein SELMODRAFT_7569             87.4    6e-17    
gb|EYU18031.1|  hypothetical protein MIMGU_mgv1a013845mg              89.4    6e-17    
ref|XP_006432195.1|  hypothetical protein CICLE_v10001800mg           90.5    1e-16    
ref|XP_002969307.1|  hypothetical protein SELMODRAFT_7568             87.0    1e-16    
emb|CDY27163.1|  BnaA08g08010D                                        87.0    2e-16    
emb|CDM84566.1|  unnamed protein product                              89.4    3e-16    
ref|XP_010027372.1|  PREDICTED: uncharacterized protein LOC104417866  86.7    3e-16    
gb|ADN33683.1|  hypothetical protein                                  88.6    3e-16    
dbj|BAK06822.1|  predicted protein                                    87.8    7e-16    
ref|XP_008783758.1|  PREDICTED: uncharacterized protein LOC103702898  85.5    8e-16    
gb|AGT16254.1|  hypothetical protein SHCRBa_190_D01_F_230             87.4    1e-15    
ref|XP_002458638.1|  hypothetical protein SORBIDRAFT_03g037170        87.4    1e-15    Sorghum bicolor [broomcorn]
gb|EAY76156.1|  hypothetical protein OsI_04089                        86.7    2e-15    Oryza sativa Indica Group [Indian rice]
ref|NP_001044532.1|  Os01g0800300                                     86.7    2e-15    Oryza sativa Japonica Group [Japonica rice]
gb|EPS64551.1|  hypothetical protein M569_10230                       82.4    3e-15    
ref|XP_010680474.1|  PREDICTED: uncharacterized protein LOC104895612  82.4    3e-15    
gb|AFW84847.1|  hypothetical protein ZEAMMB73_050855                  85.9    3e-15    
ref|NP_001144570.1|  uncharacterized protein LOC100277579             85.5    3e-15    Zea mays [maize]
gb|AEX10879.1|  hypothetical protein 0_1077_01                        82.0    5e-15    
gb|EEE67910.1|  hypothetical protein OsJ_25760                        85.1    5e-15    Oryza sativa Japonica Group [Japonica rice]
gb|AEX10882.1|  hypothetical protein 0_1077_01                        81.6    7e-15    
ref|NP_001143915.1|  uncharacterized protein LOC100276723             84.7    8e-15    Zea mays [maize]
gb|AEX10892.1|  hypothetical protein 0_1077_01                        81.3    8e-15    
gb|EMT22601.1|  hypothetical protein F775_27405                       82.8    9e-15    
tpg|DAA57245.1|  TPA: hypothetical protein ZEAMMB73_755605            84.0    2e-14    
ref|XP_006448670.1|  hypothetical protein CICLE_v100162932mg          80.1    3e-14    
ref|XP_006387907.1|  hypothetical protein POPTR_0487s002101g          79.0    3e-14    
gb|AFG48854.1|  hypothetical protein 2_2250_02                        78.2    4e-14    
gb|AFG64432.1|  hypothetical protein 2_2503_02                        77.4    5e-14    
gb|AFG48853.1|  hypothetical protein 2_2250_02                        77.8    6e-14    
ref|XP_006644846.1|  PREDICTED: uncharacterized protein LOC102710070  80.5    2e-13    
gb|KCW62326.1|  hypothetical protein EUGRSUZ_H04969                   79.3    3e-13    
ref|XP_004164875.1|  PREDICTED: uncharacterized LOC101206734          78.6    6e-13    
gb|EPS59180.1|  hypothetical protein M569_15630                       73.9    4e-12    
gb|KHN23441.1|  hypothetical protein glysoja_015743                   73.2    4e-12    
ref|XP_006387909.1|  hypothetical protein POPTR_0487s00230g           71.2    8e-12    
gb|EAZ13845.1|  hypothetical protein OsJ_03769                        73.6    1e-11    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002520273.1|  hypothetical protein RCOM_0560070                73.6    3e-11    Ricinus communis
ref|XP_010027371.1|  PREDICTED: uncharacterized protein LOC104417864  68.6    4e-10    
ref|XP_002869957.1|  hypothetical protein ARALYDRAFT_329571           68.9    6e-10    
gb|EMS52950.1|  hypothetical protein TRIUR3_05285                     67.0    2e-09    
gb|KGN45909.1|  hypothetical protein Csa_6G020230                     65.9    6e-09    
ref|XP_002457313.1|  hypothetical protein SORBIDRAFT_03g005440        66.2    1e-08    
ref|XP_004987105.1|  PREDICTED: uncharacterized protein LOC101782706  65.1    2e-08    
gb|KHN21702.1|  hypothetical protein glysoja_048088                   63.2    2e-08    
gb|AEX12319.1|  hypothetical protein 0_8573_01                        63.5    2e-08    
ref|XP_008441626.1|  PREDICTED: uncharacterized protein LOC103485706  63.5    2e-08    
gb|AEX12321.1|  hypothetical protein 0_8573_01                        62.4    4e-08    
ref|XP_008650299.1|  PREDICTED: uncharacterized protein LOC103631074  63.2    5e-08    
gb|AEX12318.1|  hypothetical protein 0_8573_01                        62.4    5e-08    
gb|AEX12328.1|  hypothetical protein 0_8573_01                        61.6    7e-08    
gb|AEX12325.1|  hypothetical protein 0_8573_01                        60.8    1e-07    
gb|AEX12326.1|  hypothetical protein 0_8573_01                        60.8    1e-07    
gb|AEX12329.1|  hypothetical protein 0_8573_01                        60.5    2e-07    
gb|KDP34246.1|  hypothetical protein JCGZ_07817                       60.1    1e-06    
ref|XP_010501697.1|  PREDICTED: uncharacterized protein LOC104778996  56.2    7e-06    
gb|KDP34249.1|  hypothetical protein JCGZ_07820                       55.1    5e-05    
emb|CDP02916.1|  unnamed protein product                              54.3    1e-04    
gb|EMT03476.1|  hypothetical protein F775_14882                       52.8    1e-04    
ref|XP_010525750.1|  PREDICTED: uncharacterized protein LOC104803513  53.5    2e-04    
ref|XP_007014001.1|  Uncharacterized protein TCM_038592               51.6    7e-04    



>ref|XP_004237719.1| PREDICTED: uncharacterized protein LOC101258062 [Solanum lycopersicum]
Length=344

 Score =   322 bits (825),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 209/341 (61%), Positives = 264/341 (77%), Gaps = 5/341 (1%)
 Frame = -3

Query  1240  AMDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
              MDREQEEMQFLGLFDIYIE+YKVIY+ +KIFSQI LSL+LP++ IFLA  EV  L FS+
Sbjct  4     TMDREQEEMQFLGLFDIYIEAYKVIYQWKKIFSQITLSLILPMSFIFLAHMEVYHLFFSD  63

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             L+H+ESQL ++  G+ +Y R+SDH+ S+  +L LF   YFT L++FSLLSTSAVVYT+A 
Sbjct  64    LKHSESQLRHTHTGTAKYNRISDHIDSEITSLWLFIIVYFTILIIFSLLSTSAVVYTIAS  123

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR----  713
             +YT+R++ +KKV++VVPKVWKR+MVTFL  FL FF+YN ++     +W   A S R    
Sbjct  124   IYTSREVGYKKVMNVVPKVWKRVMVTFLCAFLCFFIYNLVSFFLLALWFVWAFSMRGENH  183

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
               A+    +   VY VG +Y+S+IW LA  V+VLEDSYG KAM KSK LL+GKM + +VF
Sbjct  184   GLANFIFVIMAIVYVVGSVYLSVIWHLATVVTVLEDSYGVKAMIKSKDLLKGKMRIALVF  243

Query  532   FLKLHFALFLVNLIFKRFVVNG-WDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
             F K + +L ++N +FK+FVV+G    HLGM+ RVGVGL CLL+LF L++FGLV QT+IYF
Sbjct  244   FFKFNLSLGILNFVFKKFVVHGSHHMHLGMLYRVGVGLFCLLLLFALILFGLVIQTIIYF  303

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY HENIDKSALSDHLEVYLGEY PLKS+DVQ+E YQV
Sbjct  304   VCKSYHHENIDKSALSDHLEVYLGEYEPLKSQDVQMESYQV  344



>ref|XP_009790690.1| PREDICTED: uncharacterized protein LOC104238109 [Nicotiana sylvestris]
Length=341

 Score =   309 bits (792),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 206/341 (60%), Positives = 262/341 (77%), Gaps = 6/341 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLGLFDIYIE+YK+IYR RKIFSQI LSL+LP+  I LA  E+  + FS+L
Sbjct  1     MDREQEEMQFLGLFDIYIEAYKLIYRWRKIFSQITLSLILPMCFIILAHMEIYHIFFSDL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +H+E QL ++  G+ +Y ++SDH+ S+ A+L LF   Y T L++FSLLSTSAVVYT+AC+
Sbjct  61    KHSEFQLLHTHTGTAKYNKISDHINSELASLWLFIIVYITFLIIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFAD-  701
             YT+R+++F KV+SVVPKVWKR+MVTFL  F+ FF+YN +A  A VI    A   +   D 
Sbjct  121   YTSREVNFMKVMSVVPKVWKRVMVTFLCAFVCFFIYNLVAFFALVIVSIWAFGMQGENDG  180

Query  700   ---IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
                  L +   VY +G +Y+S+IW LA+ V+VLEDSYG K M KSK+LL+GKM + +VFF
Sbjct  181   LVKFVLVIMAIVYVLGSVYLSVIWHLASVVTVLEDSYGVKVMLKSKELLKGKMTIALVFF  240

Query  529   LKLHFALFLVNLIFKRFVVNGWD--FHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
              K + +L ++N IFK+FVV+G     HLGM+ R G GLLCLL++FKLV+ GLV QT+IYF
Sbjct  241   FKFNLSLGILNFIFKKFVVHGHGKHMHLGMLYRTGFGLLCLLMMFKLVLLGLVIQTIIYF  300

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY HENIDKSALSDHLEVYLGEY PLKSKDVQ+E Y+V
Sbjct  301   VCKSYHHENIDKSALSDHLEVYLGEYEPLKSKDVQMEGYEV  341



>ref|XP_009586898.1| PREDICTED: uncharacterized protein LOC104084686 [Nicotiana tomentosiformis]
Length=483

 Score =   310 bits (794),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 209/342 (61%), Positives = 265/342 (77%), Gaps = 6/342 (2%)
 Frame = -3

Query  1240  AMDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             +MDREQEEMQFLGLFDIYIE+YK+IYR RKIFSQI LSL+LP+  I LA  E+  L FS+
Sbjct  142   SMDREQEEMQFLGLFDIYIEAYKLIYRWRKIFSQITLSLILPMCFIILAHMEIYHLFFSD  201

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             L+H+E QL ++  G+ +Y ++SDH+ S+ A+L LF   Y T L++FSLLSTSAVVYT+AC
Sbjct  202   LKHSEFQLLHTHTGTAKYNKISDHINSELASLWLFIIVYITFLIIFSLLSTSAVVYTIAC  261

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFAD  701
             +YT+R+++F KV+SVVPKVWKR+MVTFL  F+ FF+YN +A  A VI    A   +   D
Sbjct  262   IYTSREVNFMKVMSVVPKVWKRVMVTFLCAFVCFFIYNLVAFLALVIVSIWAFGMQGEND  321

Query  700   ----IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
                   L +   VY +G +Y+S+IW LA+ V+VLEDSYG KAM KSK+LL+GKM + +VF
Sbjct  322   GLVKFVLVIMAIVYVLGSVYLSVIWHLASVVTVLEDSYGVKAMLKSKELLKGKMTIALVF  381

Query  532   FLKLHFALFLVNLIFKRFVVNGWD--FHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             F K + +L ++N IFK+FVV+G     HLGM+ R G GLLCLL++FKLV+FGLV QT+IY
Sbjct  382   FFKFNLSLGILNFIFKKFVVHGHGKHMHLGMLYRTGFGLLCLLMMFKLVLFGLVIQTIIY  441

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             FVCKSY HENIDKSALSDHLEVYLGEY PLKSKDVQ+E Y+V
Sbjct  442   FVCKSYHHENIDKSALSDHLEVYLGEYEPLKSKDVQMEGYEV  483



>ref|XP_002520252.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42038.1| conserved hypothetical protein [Ricinus communis]
Length=332

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 199/335 (59%), Positives = 255/335 (76%), Gaps = 3/335 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLGLFDI+ ESYK+++  RKIFSQI L+L+LPL+ IFLA  ++S LI +++
Sbjct  1     MDREQEEMQFLGLFDIFKESYKIVFTWRKIFSQITLALILPLSFIFLAHIQISDLISADI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E QL+ +Q GS R ++L+D + S+   L+LFKFAYFT  L+FSLLST+AVVYT+AC+
Sbjct  61    NRDEDQLDQTQAGSARNKKLNDLIFSELTYLMLFKFAYFTFFLIFSLLSTAAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTARD+SFKKV+SVVPKVWKRLMVTFL  F   F YN +A   F+ W F+ LS      +
Sbjct  121   YTARDVSFKKVMSVVPKVWKRLMVTFLCIFGAIFAYNIVAGFLFITW-FILLSDTSVGVV  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
                  + +Y VG +Y+ IIWQLA+ VSVLE++ G KAM KS+QL+RGK+ +  +    L+
Sbjct  180   SFLAFLVLYFVGVVYLGIIWQLASVVSVLEEACGVKAMIKSRQLIRGKIWIAAIINFTLN  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              +LF++  +F+R VV+G   +  MV RV  G++C L+LFKL +FGLV  TVIYFVCKSY 
Sbjct  240   LSLFIIQAVFERLVVHGRSLN--MVNRVSYGIICFLLLFKLFLFGLVIHTVIYFVCKSYH  297

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ++V
Sbjct  298   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQFEV  332



>gb|KEH40474.1| transmembrane protein, putative [Medicago truncatula]
Length=333

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 183/338 (54%), Positives = 244/338 (72%), Gaps = 8/338 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD+EQE+MQFLG F  Y ES+K+I+  RKIF+QI L+L+LPL+ IFL   EVS LIF  +
Sbjct  1     MDKEQEDMQFLGFFGCYKESFKIIFSWRKIFTQITLTLLLPLSFIFLFHIEVSNLIFKKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +HTE Q++++Q G+P+Y++L+D ++S F  LLLFK  YFT LL+FSLLSTSA+VYT A +
Sbjct  61    QHTEEQIDHTQQGTPKYEKLTDIISSQFITLLLFKLVYFTFLLIFSLLSTSAIVYTTASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRV-FAD  701
             +T++D+SFKKV+ +VPKVWKRLM+TFL  +  FF YNF+    F + I LA++  +    
Sbjct  121   FTSKDVSFKKVMKIVPKVWKRLMITFLCAYAAFFAYNFI---TFFVIILLAITISIKSGG  177

Query  700   IPLWVGVAV-YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
             I L + + + Y +GF+Y+++IWQLA+ V+VLED YG KAM KSK+L++GKM L +  FL 
Sbjct  178   IVLLIFIMIFYFIGFVYLTLIWQLASVVTVLEDFYGIKAMVKSKELIKGKMGLSIFIFLV  237

Query  523   LHFALFLVNLIFKRFVVNG-WDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
             L+ +  L+ L+FK  VVNG W F        G+     L    L    L  QTV+Y VCK
Sbjct  238   LNVSFVLIRLVFKVVVVNGRWCFGYVDRTGYGILCFLFLSCLFLFGLVL--QTVLYLVCK  295

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY HENIDKSAL+DHLEVYLGEYVPL +KDVQLE Y+V
Sbjct  296   SYHHENIDKSALADHLEVYLGEYVPLTAKDVQLENYRV  333



>gb|KDP43074.1| hypothetical protein JCGZ_25260 [Jatropha curcas]
Length=335

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 254/336 (76%), Gaps = 9/336 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG+F IY ESYK+I   RKIF+QI L+L+LPL+ IFLA  ++S LIFS++
Sbjct  1     MDREQEEMQFLGIFGIYKESYKIISTWRKIFTQITLALILPLSFIFLAHIQISDLIFSDI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E QL+ +Q G+ RY +L+  ++SD+    LFK  YFT LL+FSLLST+AVVYT+AC+
Sbjct  61    IHDEIQLDQTQQGTTRYNKLNSLISSDWTYFWLFKIVYFTFLLIFSLLSTAAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRV----  710
             YTA++++F K++SVVPKVWKRLMVTFL  F   F YN +A     + +F AL+F V    
Sbjct  121   YTAKEITFAKIMSVVPKVWKRLMVTFLCIFAAVFAYNMVA-----VLLFFALAFLVWGTS  175

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
             FA I L + + +Y VG +YMSIIWQLA+ VSVLE++ G +AM KSK L++GK+ +  + F
Sbjct  176   FAFISLLIFMILYFVGIVYMSIIWQLASVVSVLEEACGIQAMVKSKALIKGKIWMTSIIF  235

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
               L+ +LF++   F+R VV+G    +GMV RV  G++CLL+L    +FGLV QTVIYFVC
Sbjct  236   FMLNVSLFIIQFAFERLVVHGHRRSIGMVNRVSYGIICLLLLLMFFLFGLVIQTVIYFVC  295

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             KS+ HENIDKSALSDHLEVYLGEYVPLK+KDVQLEQ
Sbjct  296   KSFHHENIDKSALSDHLEVYLGEYVPLKAKDVQLEQ  331



>gb|AFK37921.1| unknown [Medicago truncatula]
Length=333

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 183/338 (54%), Positives = 245/338 (72%), Gaps = 8/338 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD+EQE+MQFLG F  Y ES+K+I+  RKIF+QI L+L+LPL+ IFL   EVS LIF  +
Sbjct  1     MDKEQEDMQFLGFFGCYKESFKIIFSWRKIFTQITLTLLLPLSFIFLFHIEVSNLIFKKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +HTE Q++++Q G+P+Y++L+D ++S F  LLLFK  YFT LL+FSLLSTSA+VYT A +
Sbjct  61    QHTEEQIDHTQQGTPKYEKLTDIISSQFITLLLFKLVYFTFLLIFSLLSTSAIVYTTASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRV-FAD  701
             +T++D+SFKKV+ +VPKVWKRLM+TFL  ++ FF YNF+    F + I LA++  +    
Sbjct  121   FTSKDVSFKKVMKIVPKVWKRLMITFLCAYVAFFAYNFI---TFFVIILLAITISIKSGG  177

Query  700   IPLWVGVAV-YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
             I L V + + Y +GF+Y+++IWQLA+ V+VLED YG KAM KSK+L++GKM L +  FL 
Sbjct  178   IVLLVFIMIFYFIGFVYLTLIWQLASVVTVLEDFYGIKAMVKSKELIKGKMGLSIFIFLV  237

Query  523   LHFALFLVNLIFKRFVVNG-WDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
             L+ +  L+ L+FK  VVNG W F        G+     L    L    L  QTV+Y VCK
Sbjct  238   LNVSFVLIRLVFKVVVVNGRWCFGYVDRTGYGILCFLFLSCLFLFGLVL--QTVLYLVCK  295

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             S+ HENIDKSAL+DHLEVYLGEYVPL +KDVQLE Y+V
Sbjct  296   SHHHENIDKSALADHLEVYLGEYVPLTAKDVQLENYRV  333



>gb|KEH35396.1| transmembrane protein, putative [Medicago truncatula]
Length=332

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 192/335 (57%), Positives = 248/335 (74%), Gaps = 3/335 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLGLF IY ESYK+I   RKIFSQI L+L+LPL+ IFL   ++S ++F  +
Sbjct  1     MDREQEEMQFLGLFGIYKESYKIIISWRKIFSQITLTLILPLSFIFLIHIQISNILFRKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              +  +++  +Q G+P+YQ+LSD +TS++   LLFK  YFT LL+FSLLSTSAVVYT+A +
Sbjct  61    MNNTNEILETQQGTPQYQKLSDIITSEWTTFLLFKLVYFTSLLIFSLLSTSAVVYTIASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTAR+++FK+V  VVPKVWKRLMVTFL TF  FFVYN LA   F+IW  L+++++     
Sbjct  121   YTAREVTFKRVFGVVPKVWKRLMVTFLCTFFAFFVYNTLAILVFIIWA-LSINYKSGGVA  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L +   +Y VG LY++IIWQLA+ V+VLEDSYGFKAM KS  L++GK+ L  + FLKL+
Sbjct  180   ILVIIGILYFVGILYLTIIWQLASVVTVLEDSYGFKAMMKSNNLIKGKIGLSTLIFLKLN  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              + F +  +F + VV  W     +V R   G+LC ++L  L +FGLV QTV+YFVCKSY 
Sbjct  240   VSFFGIQFLFTKLVVKAWGL--TLVDRTAYGILCFVLLSHLFLFGLVIQTVLYFVCKSYH  297

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             H++IDKSALSDHLEVY GEY PLK KDVQLE Y V
Sbjct  298   HQSIDKSALSDHLEVYHGEYEPLKDKDVQLENYHV  332



>ref|XP_011075019.1| PREDICTED: uncharacterized protein LOC105159603 [Sesamum indicum]
Length=330

 Score =   291 bits (744),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 249/333 (75%), Gaps = 4/333 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG F IY ESYK+I+R RKIF Q+ L+L+LPL+ IFLA +E S++++  +
Sbjct  1     MDREQEEMQFLGFFGIYAESYKLIFRWRKIFFQVTLALILPLSFIFLAHQEASEILYWRI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             R+T  +L  ++ G+P+Y +LSD +TS++A  LL K  YF  L++FSLL TSAVVYTVA V
Sbjct  61    RYTRFRLHWTKAGTPKYHKLSDLVTSEWAEYLLLKAVYFVFLIIFSLLCTSAVVYTVASV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT+R+++FKKV+SVVPKVWKRLMVTFL TF  F  YN   A A  +W            +
Sbjct  121   YTSREVTFKKVLSVVPKVWKRLMVTFLCTFFAFCAYNAAFALALYLWGATIADSTTGGAV  180

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
                + + +Y VGF+YM+IIWQLA+ VSVLED++G KAM KSK L++GK  + +V FL L+
Sbjct  181   VFVIVLTLYAVGFVYMTIIWQLASVVSVLEDAHGIKAMMKSKGLIKGKRGVAIVIFLMLN  240

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              +L ++N +F+ FVV G     G +  +G+G + LL+L KL++FGLV QTVIYFVCKSY 
Sbjct  241   LSLGIINFVFRVFVVYG----KGALPVLGLGAVSLLLLSKLILFGLVVQTVIYFVCKSYH  296

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQY  239
             HENIDKSALSDHLEVY+G+YVPLK KD+QL++Y
Sbjct  297   HENIDKSALSDHLEVYVGDYVPLKGKDIQLKEY  329



>ref|XP_002307472.2| hypothetical protein POPTR_0005s20850g [Populus trichocarpa]
 gb|EEE94468.2| hypothetical protein POPTR_0005s20850g [Populus trichocarpa]
Length=331

 Score =   291 bits (744),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 194/336 (58%), Positives = 259/336 (77%), Gaps = 6/336 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG+F IY E+Y++I+  RKIFSQI L+L+LPL+ IFLA  EVS ++F+ +
Sbjct  1     MDREQEEMQFLGVFGIYREAYRIIFSWRKIFSQITLALILPLSFIFLAHIEVSNVLFTKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              + E +L+ +Q G+ +Y+++SD ++S++    LFK AYFT LL+FSLLST+AVVYT+AC+
Sbjct  61    IYNEVELDETQVGTRKYEKISDMISSEWVYFWLFKAAYFTFLLIFSLLSTAAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTAR+++FKKV+SVVPKVWKRLMVTFLS FL  F YNF++    +  +FL    +V   +
Sbjct  121   YTAREVTFKKVMSVVPKVWKRLMVTFLSIFLAVFAYNFVSIFVAITCVFLVGPDKV---V  177

Query  697   P-LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
             P L+  + VY +G +YMSIIWQLA+ VSVLE++ GFKAM KS +LL+GKM + ++ F KL
Sbjct  178   PLLFFLLMVYFLGLVYMSIIWQLASVVSVLEEASGFKAMMKSGELLKGKMWVAIIIFFKL  237

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
             + +   ++++F+  VV+G      ++ R   G+L LL+L  L +FGLV QTVIYFVCKSY
Sbjct  238   NLSSVALHILFENKVVHGSSLG--ILNRASFGILSLLMLLVLYLFGLVIQTVIYFVCKSY  295

Query  340   QHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ+ V
Sbjct  296   HHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQFDV  331



>ref|XP_010999841.1| PREDICTED: uncharacterized protein LOC105107569 [Populus euphratica]
Length=331

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 261/336 (78%), Gaps = 6/336 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG+F IY E+Y++I+  RKIFSQI L+L+LPL+ IFLA  EVS ++F+ +
Sbjct  1     MDREQEEMQFLGVFGIYREAYRIIFSWRKIFSQITLALILPLSFIFLAHIEVSNVLFAKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              + E +L+ +Q G+ +Y+++SD ++S++ +  LFK AYFT LL+FSLLST+AVVYT+AC+
Sbjct  61    IYNEEELDETQVGTRKYEKISDMISSEWVSFWLFKAAYFTFLLIFSLLSTAAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTAR+++FKKV+SVVPKVWKRLMVTFLS FL  F YNF++    +  +FL    +V   +
Sbjct  121   YTAREVTFKKVMSVVPKVWKRLMVTFLSIFLAVFAYNFVSILVVITCVFLVGPNKV---V  177

Query  697   P-LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
             P L   + +Y +G +YMSIIWQLA+ VSVLE++ GFKAM KS++L++GKM + ++ F KL
Sbjct  178   PLLLFLLILYFMGLVYMSIIWQLASVVSVLEEASGFKAMMKSRELIKGKMWVAIIIFFKL  237

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
             + +   ++++F++ VV+G      ++ R   G+L LLVL  L +FGLV QTVIYFVCKSY
Sbjct  238   NLSSVALHILFEKKVVHGSSLG--ILNRASFGILSLLVLLVLYLFGLVIQTVIYFVCKSY  295

Query  340   QHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ+ V
Sbjct  296   HHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQFDV  331



>ref|XP_004498373.1| PREDICTED: uncharacterized protein LOC101496539 [Cicer arietinum]
Length=333

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 181/338 (54%), Positives = 249/338 (74%), Gaps = 8/338 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD+EQE+MQFLG F  Y ES+ +I+  RKIF++I L+L+LPL+ IFL   EVS LIF  +
Sbjct  1     MDKEQEDMQFLGFFGCYKESFNIIFSWRKIFTKITLTLLLPLSFIFLFHIEVSNLIFKKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E Q+ +++ G+P+Y++L+D ++S+F  LLLFK  YFT LL+FSLLSTSA+VYT A +
Sbjct  61    EHNEEQINHTEQGTPKYEKLTDMVSSEFITLLLFKLVYFTFLLIFSLLSTSAIVYTTASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRV-FAD  701
             +T++D+S+KKV+ +VPKVWKRLM+TFL  +  FF YN +    F++ I LAL+F +    
Sbjct  121   FTSKDVSYKKVMKIVPKVWKRLMLTFLCAYAAFFAYNVI---TFIVIILLALTFGIKNGM  177

Query  700   IPLWVGVA-VYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
             + L++ +  +Y +GF+Y+++IWQLA+ V+VLED YG KAM KSK+L++GKM L ++ FL 
Sbjct  178   LVLFIFLMLLYFIGFVYLTLIWQLASVVTVLEDFYGIKAMVKSKELIKGKMGLSILLFLV  237

Query  523   LHFALFLVNLIFKRFVVNG-WDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
             L+ +  L+ LIFK  VVNG W F        G+  L LL  F L+   L  QTV+YFVCK
Sbjct  238   LNVSFVLIRLIFKVVVVNGRWSFGYVDRIGYGILCLMLLSCFFLIGLVL--QTVLYFVCK  295

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY HENIDKSAL+DHLEVYLGEYVPL +KDVQ+E Y++
Sbjct  296   SYHHENIDKSALADHLEVYLGEYVPLTAKDVQMENYRL  333



>gb|EYU32463.1| hypothetical protein MIMGU_mgv1a018498mg [Erythranthe guttata]
Length=334

 Score =   286 bits (731),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 256/335 (76%), Gaps = 1/335 (0%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDRE EEMQFLGLF IY E+YK+I++ RKIF+QI L+L+LPL++IFL  +++S++++  +
Sbjct  1     MDRELEEMQFLGLFGIYAEAYKLIFKLRKIFTQITLALILPLSLIFLGHEKISEVLYWRI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             R+TE +L  +  G+PR+  LSD ++S+++  +LFK  Y T LLV +LL+TSAVVYTVACV
Sbjct  61    RYTEYKLHRTPAGTPRFDSLSDLVSSEWSLYVLFKAVYVTSLLVLALLATSAVVYTVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT R+++FKKV+SVVPKVWKRLMVTFL T+L FF YN   A    +W        +   +
Sbjct  121   YTNREITFKKVMSVVPKVWKRLMVTFLCTYLGFFAYNVAFAVTLYLWFVTLCEVSIVGPV  180

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              LW+    Y +GF+Y+S+IWQLA+ V+VLEDS GFKAM KSK L++GK+++ ++ F KL+
Sbjct  181   VLWIIFVSYAIGFVYVSVIWQLASVVTVLEDSCGFKAMIKSKNLIKGKILVSILIFFKLN  240

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              +L +++  F+ +VV  W F +G++  +G+G+LC L+L KL++F LV QTVIYFVCKS  
Sbjct  241   LSLGVIDSYFRMYVVYEW-FEIGIIKVIGIGVLCFLLLLKLILFVLVVQTVIYFVCKSLH  299

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HEN+DKSALSD+LE Y G+YVPLK+KDVQLE+Y +
Sbjct  300   HENVDKSALSDYLEGYFGDYVPLKAKDVQLEEYHL  334



>ref|XP_010042860.1| PREDICTED: uncharacterized protein LOC104432060 [Eucalyptus grandis]
Length=332

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 247/336 (74%), Gaps = 5/336 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG F IY ESYKVI+  RKIF+QI L+L+LPLA +FL   EVS ++ S +
Sbjct  1     MDREQEEMQFLGFFGIYKESYKVIFSWRKIFTQITLALILPLAFVFLLHMEVSDILLSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E QL+ ++P + R  R+S  L+ ++A  LL K  YFT LLVFSLLSTSAVVYT+AC+
Sbjct  61    VHNEIQLDETRPNTSRSDRISSVLSKEWAVFLLIKALYFTALLVFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIW-IFLALSFRVFAD  701
             YT R+++F+KV+SVVP+VW+RLMVTFL  FL  F+YN +A    +   IF+  S   F  
Sbjct  121   YTGREVAFRKVMSVVPRVWRRLMVTFLCIFLAMFLYNVIAGVILLTCAIFVGDS--NFGI  178

Query  700   IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
             + L + V  Y VGF+YM+ +WQLA+ VSVLE+ YG KAM KS  L++GK+++ ++ F KL
Sbjct  179   LILILLVIAYLVGFMYMTAVWQLASVVSVLEEDYGVKAMIKSTNLIKGKIIVSIIIFFKL  238

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
               +L LV   F++ VV G     G +GR G G+LC  +L  L+VFGLV QTVIYFVCKSY
Sbjct  239   STSLHLVQFAFEKLVVYGRS--AGTLGRCGYGVLCFFLLSMLMVFGLVVQTVIYFVCKSY  296

Query  340   QHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQY +
Sbjct  297   HHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYDI  332



>ref|XP_002262838.1| PREDICTED: uncharacterized protein LOC100255146 [Vitis vinifera]
Length=332

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 243/335 (73%), Gaps = 3/335 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD EQEE+QFLG F I  ES K+IY  RKIFSQI L+L+LPL  IFLA  EVS  +F  +
Sbjct  1     MDVEQEELQFLGFFGIIKESVKIIYSWRKIFSQITLALILPLTFIFLAHIEVSDFLFFKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E +L+ ++ G+P+Y++LSD ++S++    L K AYFT LL+FSLL TSAVVY VACV
Sbjct  61    LRNEDKLDRTRAGTPKYEKLSDVISSEWIVFWLLKVAYFTFLLIFSLLCTSAVVYAVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y+A+ ++FK+V+SVVPKVWKRLMVTF+  F++ F YN +A     +W  L +   VF  +
Sbjct  121   YSAKQITFKRVLSVVPKVWKRLMVTFIWNFVIVFCYNVVAGVVLFMWAIL-IGNNVFGLV  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L + + +Y +GF+Y+S++W LA+ VSVLEDSYG +AM KSK L++GK  + V  FL L+
Sbjct  180   ILLLLLIIYVMGFVYISVVWHLASVVSVLEDSYGIQAMVKSKALIKGKTGVAVAIFLILN  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                F++ L F+  VV G+        R+ + ++  L LFKL++FGLV QTVIYFVCKSY 
Sbjct  240   ICYFIIQLAFENLVVLGYPLS--TPNRILLAIIFFLFLFKLILFGLVIQTVIYFVCKSYH  297

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENIDKS+LSDHLEVYLGEYVPLKSKDVQLEQ+ V
Sbjct  298   HENIDKSSLSDHLEVYLGEYVPLKSKDVQLEQFDV  332



>ref|XP_002267135.1| PREDICTED: uncharacterized protein LOC100243726 [Vitis vinifera]
Length=332

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 194/335 (58%), Positives = 247/335 (74%), Gaps = 3/335 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD EQEEMQFLG+F IY E+YK+I+  +KIFSQI ++L+LPL  IFLA  EVS  +F  +
Sbjct  1     MDLEQEEMQFLGIFGIYKEAYKIIFSWKKIFSQITVALILPLCFIFLAYIEVSDYLFQKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E +L+ ++  S +Y ++SD L+S+  A  L K AY    L+FSLLSTSAVVYT+AC+
Sbjct  61    VIHEFELDGTRVDSAKYNKISDLLSSELIAFWLLKLAYLVFTLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT R+++FKKV+SVVP+VWKRLMVTFL  F+  F YN  A    ++W       ++   +
Sbjct  121   YTGREVTFKKVMSVVPRVWKRLMVTFLCIFVAVFAYNIFALLILILWALCIGPVKI-GIL  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              LWV   +Y VG  YMSIIWQLA+ VSVLED YGF+AM KS+ L+RGK+V+ +V FLKL+
Sbjct  180   ILWVMFILYLVGLSYMSIIWQLASVVSVLEDLYGFRAMVKSRALIRGKLVVAIVIFLKLN  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              +LF++ + F+R VV G      M  RVG G+LC L+LFKL +FGLV QT+IYFVCKSY 
Sbjct  240   ISLFVIKIAFERLVVYGASLG--MANRVGYGILCFLLLFKLFLFGLVLQTIIYFVCKSYH  297

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENIDKSALSDHLEVY+GEYVPLK+KDVQLEQY V
Sbjct  298   HENIDKSALSDHLEVYMGEYVPLKAKDVQLEQYDV  332



>ref|XP_002309916.2| hypothetical protein POPTR_0007s04180g [Populus trichocarpa]
 gb|EEE90366.2| hypothetical protein POPTR_0007s04180g [Populus trichocarpa]
Length=334

 Score =   277 bits (709),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 185/341 (54%), Positives = 254/341 (74%), Gaps = 13/341 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEE+QFLG F I+ ES+K+I   RKIFSQI L+L+LPL+ IFLA  ++SQ+IF N+
Sbjct  1     MDREQEELQFLGFFGIFKESFKIILTWRKIFSQITLALILPLSFIFLAHMQISQMIFFNI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               +E  L+ +Q G+P++ +LSD++++++ A  LFKFAYFT LL+FSLLSTSAVVYT+AC+
Sbjct  61    LDSEDALDFTQSGTPKHDKLSDNISAEWTAFWLFKFAYFTFLLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAF------VIWIFLALSF  716
             YT + ++FKK++SVVPKVWKRLMVTF+ +FLV  +YN +AA  F      V++   A+ F
Sbjct  121   YTVKPITFKKIMSVVPKVWKRLMVTFIWSFLVVVLYNIIAAVVFLTLWTQVVFHVNAVGF  180

Query  715   RVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
             R+   + L   + +Y+VG LY++I+W LA+ VSVLED YG KAM KSK L++G+M + V 
Sbjct  181   RIAVLVAL---IIIYSVGMLYITIVWHLASVVSVLEDFYGIKAMIKSKNLIKGQMGVTVA  237

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
              F+ +      + L+++ FVV     H  +  R+GVG++C  +L   ++F LV QTV+YF
Sbjct  238   VFIVVGVCFVGIQLLYEIFVV----LHKPLGVRIGVGIVCFFLLCFFLLFDLVIQTVLYF  293

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY HENI+KS+LSDHLEVYLGEYV LKSKDVQ+EQ QV
Sbjct  294   VCKSYHHENINKSSLSDHLEVYLGEYVALKSKDVQMEQLQV  334



>ref|XP_010089328.1| hypothetical protein L484_021860 [Morus notabilis]
 gb|EXB37653.1| hypothetical protein L484_021860 [Morus notabilis]
Length=334

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 197/340 (58%), Positives = 253/340 (74%), Gaps = 11/340 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDRE EE+QFLG F IY E+YK+I+  RKIFSQI L+L+LP+++IFL  KE+S  +F  +
Sbjct  1     MDREPEELQFLGAFGIYKEAYKIIFSLRKIFSQITLALILPMSLIFLIHKEISNALFRKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                ES L+ +  GSP+Y +LS  ++++   L LFK AYFT LL+FSLLSTSAVVYT+AC+
Sbjct  61    LINESNLDQTIVGSPKYNKLSHLISTELITLWLFKVAYFTFLLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLA-LSFRVFAD  701
             YT ++ +FKKV+SVVPKVWKRLMVTFL TFL F  YN  A    VI +F A LS     D
Sbjct  121   YTGKEATFKKVMSVVPKVWKRLMVTFLWTFLAFSAYNIAA----VIVLFAALLSVNSTYD  176

Query  700   IPLWVGVAV---YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
               L +G+ +   Y +GF+Y+S+IW LA  VSVLED  G +AM+KSK L+RGK  + ++ F
Sbjct  177   ADLVIGIVLVIAYLLGFVYLSLIWHLACVVSVLEDIRGIEAMNKSKGLIRGKTGVAMIIF  236

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
              KL F++F++   F+R VV+GW     +V RVG G++CLLVL KLV+F LV QTV+YFVC
Sbjct  237   SKLAFSVFVLQFAFQRLVVDGWSLG--VVDRVGYGIICLLVLLKLVLFALVIQTVLYFVC  294

Query  349   KSYQHENIDKSALSDHLEVY-LGEYVPLKSKDVQLEQYQV  233
             KSY HE IDKSALSDHL+VY LGEYVPLK+KDVQLEQ++V
Sbjct  295   KSYHHEGIDKSALSDHLDVYQLGEYVPLKAKDVQLEQFEV  334



>ref|XP_007161389.1| hypothetical protein PHAVU_001G064700g [Phaseolus vulgaris]
 gb|ESW33383.1| hypothetical protein PHAVU_001G064700g [Phaseolus vulgaris]
Length=332

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 251/337 (74%), Gaps = 7/337 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQF+G F +Y E+ K+I   RKIFS I L+L+LPL+ IFL   EVS L+F  +
Sbjct  1     MDREQEEMQFVGFFGVYKEASKIILSWRKIFSYITLTLILPLSFIFLIHIEVSTLLFRKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              +    ++ ++P +P+Y +LSD ++S++  L+LFK AYFT LL+FSLLSTSAVVYTVA V
Sbjct  61    LYNSIVMDETKPDTPQYNKLSDMISSEWITLVLFKLAYFTLLLIFSLLSTSAVVYTVASV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRV-FAD  701
             YTA++++FK+V+SVVPKVWKRLM+TFL  F  FF YN +      +W   A+S  +    
Sbjct  121   YTAKEVTFKRVMSVVPKVWKRLMLTFLCAFAAFFAYNIVTMLVIFLW---AISIGLNTGS  177

Query  700   IPLWVGVAV-YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
             + ++V +AV Y +GF+Y++++WQLA+ V+VLEDS+G +AM KSK+L++GKMVL +  FL 
Sbjct  178   VVVFVFIAVLYFIGFVYLTVVWQLASVVTVLEDSWGVRAMLKSKELIKGKMVLSIFVFLT  237

Query  523   LHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
             L  +L L+ ++FK+ VV+GW  +   + +   G+LC L+L  L +FGLV QTVIYFVCKS
Sbjct  238   LVGSLVLIRVLFKQTVVDGWTVN--SLDKTAYGVLCFLLLSCLFLFGLVVQTVIYFVCKS  295

Query  343   YQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             + H+NIDKSAL+DHLE Y GEY PL +KDVQLEQYQV
Sbjct  296   FHHQNIDKSALADHLEGYRGEYEPLTAKDVQLEQYQV  332



>ref|XP_006596263.1| PREDICTED: uncharacterized protein LOC102660467 [Glycine max]
 gb|KHN21061.1| hypothetical protein glysoja_048773 [Glycine soja]
Length=332

 Score =   275 bits (703),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 245/337 (73%), Gaps = 7/337 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG F IY E+ K+I   R+IF+QI  +L+LPL+ IFL   E+S L+F  +
Sbjct  1     MDREQEEMQFLGFFGIYKEASKIILSWRRIFTQITSTLILPLSFIFLIHMEISNLLFRKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  ++ ++P +P+Y +L   ++S+   L++FK AYFT LL+FSLLSTSAVVYT+A +
Sbjct  61    LINEIVMDETKPNTPQYNKLDHMISSEMVTLVVFKIAYFTLLLIFSLLSTSAVVYTIASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAA-SAFVIWIFLALSFRVFAD  701
             YTA+D++FK+V+SVVPKVWKRLM+TFL  F  FF YN + A   F+  + + LS      
Sbjct  121   YTAKDVTFKRVMSVVPKVWKRLMLTFLCAFAAFFAYNIMTALVMFLSIVTIGLS---SGG  177

Query  700   IPLWVGVAV-YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
             + + V + V Y +GF+Y++++WQLA+ V+VLEDS+G +AM+KSK+L+RGKMVL +  F  
Sbjct  178   LAVLVSITVLYFIGFVYLTVVWQLASVVTVLEDSWGVRAMAKSKELIRGKMVLSIFIFFT  237

Query  523   LHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
             L  +   + ++FK  VV+GW   +  + +   G+LC L+L  L +FGLV QTV+YFVCKS
Sbjct  238   LVASFVSIRVLFKVMVVDGW--RVSSLDKTAYGVLCFLLLSCLFLFGLVLQTVLYFVCKS  295

Query  343   YQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             Y HENIDKSAL+DHLE Y GEYVPL +KDVQLEQYQV
Sbjct  296   YHHENIDKSALADHLEGYRGEYVPLTAKDVQLEQYQV  332



>ref|XP_002309917.1| hypothetical protein POPTR_0007s04191g [Populus trichocarpa]
 gb|EEE90367.1| hypothetical protein POPTR_0007s04191g [Populus trichocarpa]
Length=334

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 186/342 (54%), Positives = 255/342 (75%), Gaps = 17/342 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEE+QFLG F I+ ES+K+I   RKIFS+I L+L+LPL+ IFLA  ++SQ+IF  +
Sbjct  1     MDREQEELQFLGFFGIFKESFKIILTWRKIFSKITLALILPLSFIFLAHMQISQMIFFKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +  L+ +Q G+P++ +LSD +++++ A  LFKFAYFT LL+FSLLSTSAVVYT+AC+
Sbjct  61    LDNQDTLDFTQSGTPKHDKLSDTISAEWTAFWLFKFAYFTFLLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA+ ++FKK++SVVPKVWKRLMVTF+ +F V  +YN ++    +I     LSF +   +
Sbjct  121   YTAKPITFKKIMSVVPKVWKRLMVTFIWSFAVVVLYNIVSIVVLII-----LSFTLINHV  175

Query  697   P--------LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLG  542
             P        L V V +Y+VG LY++I+W LA+ +SVLED YG KAM KS++L++GKM + 
Sbjct  176   PAAGFRILFLVVLVILYSVGLLYITIVWHLASVISVLEDFYGIKAMMKSRELIKGKMGIA  235

Query  541   VVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVI  362
             V  F+ +      +  +F+ FVV  W        R+G+GLLCLL+LFK+++FGLV QTV+
Sbjct  236   VAIFIVVGICFVGIQFLFETFVVLEWTME----IRIGMGLLCLLLLFKVILFGLVIQTVL  291

Query  361   YFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             YFVCKSY HENIDKS+LSDHLEVYLGEY+PLKSKDVQ+EQ++
Sbjct  292   YFVCKSYHHENIDKSSLSDHLEVYLGEYIPLKSKDVQMEQFE  333



>ref|XP_008373300.1| PREDICTED: uncharacterized protein LOC103436635 [Malus domestica]
Length=330

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 256/335 (76%), Gaps = 9/335 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQ+E+QFLG+F IY E+YK+++  RKIFSQI L+L+LPL+ IFLA  E+S ++ S +
Sbjct  1     MDREQDELQFLGIFGIYKEAYKIVFSWRKIFSQITLALILPLSFIFLAHIELSNILLSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L+ +   +PRY+++SD ++S++A   LFK AYFT LL+FSLLSTSAVVYT+AC+
Sbjct  61    IRNEIALDGTSTNNPRYEKISDVISSEWATFWLFKAAYFTFLLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA++++FKKV+SVVPKVWKR+MVTFL TF+ FF YN +A    ++W+    +    +D 
Sbjct  121   YTAKEITFKKVMSVVPKVWKRVMVTFLCTFMAFFCYNIVAFLVLILWVVSMGN----SDA  176

Query  697   PLWVG---VAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              + +G   + VY +GF+Y+++IWQLA+ VSVLE++ G KAM+KSK LL+G M +  + F 
Sbjct  177   GVIIGFFLLIVYFIGFVYLTLIWQLASVVSVLEEARGIKAMAKSKALLKGNMWVATIIFF  236

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
             KL+    L+   F++ VV G  F   +V RV  G++CLL+LFKL++FGLV QTV+YFVCK
Sbjct  237   KLNVLAALLQFGFQQLVVRGRSFG--LVDRVAYGVICLLLLFKLILFGLVIQTVLYFVCK  294

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             SY HENIDKSALSDHLEVYLG+YVPL+SKDVQLEQ
Sbjct  295   SYHHENIDKSALSDHLEVYLGDYVPLRSKDVQLEQ  329



>ref|XP_011023091.1| PREDICTED: uncharacterized protein LOC105124685 [Populus euphratica]
Length=334

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 183/341 (54%), Positives = 256/341 (75%), Gaps = 13/341 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEE+QFLG   I+ ES+K+++  RKIFSQI L+L+LPL+ IFLA  ++SQLIF N+
Sbjct  1     MDREQEELQFLGFCGIFKESFKIVFTWRKIFSQITLALILPLSFIFLAHMQISQLIFFNI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +  L+ +Q G+P++ +LSD++++++ A  LFKFAYFT LL+FSLLSTSAVVYT+AC+
Sbjct  61    LVNQDALDFTQSGTPKHDKLSDNISAEWTAFWLFKFAYFTFLLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAF------VIWIFLALSF  716
             YTA+ ++FKK++SVVPKVWKRLMVTF+ +F+V  +YN +AA  F      V++   A+ F
Sbjct  121   YTAKPITFKKIMSVVPKVWKRLMVTFIWSFVVVVLYNIIAAVVFLTLWTQVVFHVNAVGF  180

Query  715   RVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
             R+   + L   + +Y+VG LY++I+W LA+ VSVLED YG KAM KSK L++G+M + V 
Sbjct  181   RIAVLVAL---IIIYSVGMLYITIVWHLASVVSVLEDFYGIKAMIKSKNLIKGQMGVTVA  237

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
              F+ +      + L+++ FVV     H  +  R+GVG++C  +L K+++F LV QTV+YF
Sbjct  238   VFIVVGVCFVGIQLLYEIFVV----LHKPLGVRIGVGIVCFFLLCKVMLFDLVIQTVLYF  293

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY HENI+KS+LSDHLEVYLG+YV LKSKDVQ+EQ QV
Sbjct  294   VCKSYHHENINKSSLSDHLEVYLGKYVALKSKDVQMEQIQV  334



>ref|XP_007137514.1| hypothetical protein PHAVU_009G133500g [Phaseolus vulgaris]
 gb|ESW09508.1| hypothetical protein PHAVU_009G133500g [Phaseolus vulgaris]
Length=332

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 230/347 (66%), Gaps = 27/347 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG   +Y ESY +I+ CRKIFS+I L+L+LPL+ IFL   EVS ++FS +
Sbjct  1     MDREQEEMQFLGFCGVYRESYNIIFACRKIFSKITLTLILPLSFIFLIHIEVSNILFSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  Q+  +   +P+Y  LS+ L+S++A L+LFK  YFT LL+FSLLSTSAVVYTVA +
Sbjct  61    IKNSQQMMETPQDTPQYHNLSNMLSSEWATLMLFKLFYFTFLLIFSLLSTSAVVYTVASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIW------------I  734
             YT R+L+F KV++VVPKVWKRLMVTFL TF   FVYN +A   F+IW            I
Sbjct  121   YTERELTFSKVMTVVPKVWKRLMVTFLCTFGALFVYNVMAVFVFIIWALTVGGRSGGVGI  180

Query  733   FLALSFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK  554
             F+ L+F  FA             GF+Y++++W LA+ V+VLE+S G  AM KS +L+RGK
Sbjct  181   FVVLTFFYFA-------------GFVYLTVVWNLASVVTVLEESCGVGAMVKSNELIRGK  227

Query  553   MVLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVT  374
             M L V+ FLKL  +  L+  +FK+ VV+GW          G+  L L     L    +  
Sbjct  228   MGLSVLIFLKLVVSFGLIQFLFKKTVVHGWRLGSVDRTLYGIVCLVLFSQLYLFQLVI--  285

Query  373   QTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             QTV+YFVCKSY H+NIDKS LSDHLEVY GEY PLK KDVQ+E+  V
Sbjct  286   QTVLYFVCKSYHHQNIDKSVLSDHLEVYHGEYEPLKVKDVQMEECHV  332



>ref|XP_007200390.1| hypothetical protein PRUPE_ppa008434mg [Prunus persica]
 gb|EMJ01589.1| hypothetical protein PRUPE_ppa008434mg [Prunus persica]
Length=332

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 250/335 (75%), Gaps = 3/335 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQ+E+QFLG+F I  E+YK+++  RKIFSQI L+L+LPL+ IFLA  E+S ++   +
Sbjct  1     MDREQDELQFLGIFGICKEAYKIVFSWRKIFSQITLTLILPLSFIFLAHIELSNILLLKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E  L+ +   SPRYQR+SD ++S++A   LFK  YFT LL+FSLLSTSAVVYT+AC+
Sbjct  61    IHNERVLDRTNTNSPRYQRVSDVISSEWATFWLFKAVYFTFLLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT R+++++KV+SVVPKVWKR+MVTF  TF+ FF YN +A    +IW+ ++++      I
Sbjct  121   YTGREITYRKVMSVVPKVWKRVMVTFFCTFMAFFAYNIVAFIVLIIWL-VSVALTDAGGI  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
               +  +  Y +GF+Y+S+IW LA+ VSVLE++ G KAM+KSK LL+G M +  + F  L+
Sbjct  180   IGFFLLIFYFIGFVYLSLIWLLASVVSVLEEARGIKAMTKSKALLKGNMWVAAIIFFMLN  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                 L+   F++ VV+G+ F   +VGRV  G +CLL+LFKL++F LV QTV+YFVCKSY 
Sbjct  240   VLGGLLQFAFQKLVVHGYSFG--VVGRVAYGFICLLLLFKLILFWLVIQTVLYFVCKSYH  297

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENIDKSALSDHLEVYLG+YVPL +KDVQLEQ  V
Sbjct  298   HENIDKSALSDHLEVYLGDYVPLTAKDVQLEQVNV  332



>ref|XP_007019305.1| Uncharacterized protein TCM_035327 [Theobroma cacao]
 gb|EOY16530.1| Uncharacterized protein TCM_035327 [Theobroma cacao]
Length=332

 Score =   270 bits (689),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 250/342 (73%), Gaps = 17/342 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG   IY ESY VI+  RK+FS+IAL+L+LPL  I+LA+ EVS L F  +
Sbjct  1     MDREQEEMQFLGFVGIYKESYNVIFAWRKVFSKIALALILPLTFIYLARIEVSNLFFRKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E +L++++ G+P+Y++LSD ++ ++A   LFK AYFT   +FSLLST+AVVYT+AC+
Sbjct  61    IHNEIELDHTRSGTPKYKKLSDVISDEWAYFWLFKAAYFTLFFIFSLLSTAAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT R+L+F+KV+SVVPKVWKRLMVTFLS F+  F Y+ +     V+W   ALS       
Sbjct  121   YTGRELTFRKVMSVVPKVWKRLMVTFLSIFVAMFFYHVVFVFIVVVW---ALSIGASN--  175

Query  697   PLWVGVAVYT-------VGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
                VG AV+         G LY++IIW LA+ VSVLE++YGF+AM K K L+ GK+ + V
Sbjct  176   ---VGFAVFVILIILYLGGLLYLTIIWHLASVVSVLEEAYGFQAMVKGKNLIEGKLWVAV  232

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             V F KL  +LF++ + F+  VV+G  F   +V RV   ++C L+L KL++FGLV QTVIY
Sbjct  233   VIFFKLSVSLFIIQIAFQNLVVHGSTFG--VVSRVAYAIICFLLLCKLILFGLVIQTVIY  290

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             FVCKSY HENIDKSALSDHLEVYLGEYVPLK+KDVQLEQY V
Sbjct  291   FVCKSYHHENIDKSALSDHLEVYLGEYVPLKAKDVQLEQYHV  332



>ref|XP_010264907.1| PREDICTED: uncharacterized protein LOC104602788 [Nelumbo nucifera]
Length=332

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 180/335 (54%), Positives = 243/335 (73%), Gaps = 3/335 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDRE EE+QFLG F IY E+YK+I     IF++I LSL+LPL+ IFLA  ++S+ +F+ +
Sbjct  1     MDREPEELQFLGFFGIYREAYKIISSWWTIFTKITLSLILPLSFIFLAHIQISEFLFAKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L+ +   SPRY  + D L+S++    LFK AYF  +L+FSLLSTSAVVYTVACV
Sbjct  61    LRNEDSLDTTPVDSPRYNVILDRLSSEWTTYWLFKAAYFVFVLIFSLLSTSAVVYTVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA++++F+K++SVVPKVWKRLMVTFL  F++ F YN +A   F++   +A+       +
Sbjct  121   YTAKEITFRKIMSVVPKVWKRLMVTFLWNFIIVFAYNVVALLIFIL-TSIAVGPGAARTV  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L V +AVY VG +Y++++W LA+ VSVLEDSYG +AM KSK L++GKM +   F L  +
Sbjct  180   VLLVFLAVYLVGLVYITVVWHLASVVSVLEDSYGIQAMIKSKALIKGKMWVASAFILLFN  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              A  L+ ++F++ VV+GW     +  RVG G++C+++LF L + GLV QTVIYFVCKSY 
Sbjct  240   LAYLLIQIVFEKLVVHGWSMG--VASRVGYGIVCVMLLFFLDLLGLVVQTVIYFVCKSYH  297

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENID+S L+DHLEVYLGEYVP K KDVQLEQY V
Sbjct  298   HENIDQSCLADHLEVYLGEYVPFKGKDVQLEQYYV  332



>ref|XP_006434342.1| hypothetical protein CICLE_v10001753mg [Citrus clementina]
 gb|ESR47582.1| hypothetical protein CICLE_v10001753mg [Citrus clementina]
Length=338

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 242/340 (71%), Gaps = 7/340 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG+F IY E+ KVI   R+IFS+I L+L+LPL+ IFLA  E++ L+   +
Sbjct  1     MDREQEEMQFLGIFGIYREACKVIITWRRIFSKITLALILPLSFIFLAHVELTDLLHRKV  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H + +   +  GS R+ +L+D ++ D      FK AY T  LV SLLSTSAVVYTVACV
Sbjct  61    VHDKMERHFTPAGSARFNKLTDVISEDRTLYWFFKVAYLTFYLVLSLLSTSAVVYTVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT +D+SFKKV+SVVPKVWKRLMVTFL TFL +F+YNF A     +W+ L        DI
Sbjct  121   YTGKDVSFKKVMSVVPKVWKRLMVTFLCTFLAYFLYNFAAIVVVSLWVVLWGILTAGGDI  180

Query  697   P-----LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
                   L+V +  Y  G  Y+S+IW LA+ VSVLE+S GF AM KS+ L++GKM++  V 
Sbjct  181   KFMLSILYVILVFYVAGHFYLSVIWHLASVVSVLEESCGFAAMIKSQALIKGKMLVTAVI  240

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
                ++ +LF V LIF R VV+GW    G   RV  G++CLL+LFKL++F LV QTVIYFV
Sbjct  241   LFIMNISLFAVQLIFWRLVVHGWSL--GTGTRVLFGVICLLLLFKLMLFALVIQTVIYFV  298

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             CKSY HENIDKSALSDHLEVYLGEYVPLKSKD+QLE Y+V
Sbjct  299   CKSYHHENIDKSALSDHLEVYLGEYVPLKSKDIQLEHYEV  338



>ref|XP_011022935.1| PREDICTED: uncharacterized protein LOC105124568 [Populus euphratica]
Length=334

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 173/340 (51%), Positives = 240/340 (71%), Gaps = 13/340 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEE+QFLG F I+ ES+K+I   RKIFS+I L+L+LPL+ IFLA  ++SQ+IF  +
Sbjct  1     MDREQEELQFLGFFGIFKESFKIILTWRKIFSKITLALILPLSFIFLAHMQISQMIFFKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +  L+ +Q G+P++ +LSD ++S++ A  LFKFAYFT LL+FSLLSTSAVVYT+AC+
Sbjct  61    LDNQDTLDGTQVGTPKHDKLSDIISSEWTAFWLFKFAYFTFLLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFL------ALSF  716
             YTA+ ++FKK++SVVPKVWKRLMVTF+ +F+V  +YN ++    +I          A  F
Sbjct  121   YTAKPITFKKIMSVVPKVWKRLMVTFIWSFVVVVLYNIVSIVVLIILSVTLINHVSAAGF  180

Query  715   RVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
             R+   + L   V +Y+VG LY++I+W LA+ +SVLED YG KAM KSK+L++GKM +   
Sbjct  181   RILFLVVL---VILYSVGLLYITIVWHLASVISVLEDFYGIKAMMKSKELIKGKMGIAAA  237

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
              F+ +      +  +F+ FVV  W   + +   +   LL   V+   +V     QTV+YF
Sbjct  238   TFVVVGICFVGIQFLFETFVVLEWTMEIRIGMGLLCLLLLFKVILFGLVI----QTVLYF  293

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             VCKSY HENIDKS+LSDHLEVYLGEY+PLKSKDVQ+E ++
Sbjct  294   VCKSYHHENIDKSSLSDHLEVYLGEYIPLKSKDVQMEHFE  333



>ref|XP_008237718.1| PREDICTED: uncharacterized protein LOC103336454 [Prunus mume]
Length=332

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 249/332 (75%), Gaps = 3/332 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQ+E+QFLG+F I  E+YK+++  RKIFSQI L+L+LPL+ IFLA  E+S ++   +
Sbjct  1     MDREQDELQFLGIFGICKEAYKIVFSWRKIFSQITLTLILPLSFIFLAHIELSNILLLRI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E  L  +   SPRYQR+SD ++S++A   LFK  YFT  L+FSLLSTSAVVYT+AC+
Sbjct  61    IHNERVLGRTNTNSPRYQRVSDVISSEWAYYWLFKAVYFTFALIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT R+++++KV+SVVPKVWKR+MVTFL TFL FF YN +A    +IW+ ++++F     I
Sbjct  121   YTGREITYRKVMSVVPKVWKRVMVTFLCTFLAFFAYNIVAFIVLIIWL-VSVAFTDAGGI  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
               +  + +Y +GF+Y+S+IW LA+ VSVLE++ G KAM+KSK LL+G M +  + +  L+
Sbjct  180   IGFFLLILYAIGFVYLSLIWLLASVVSVLEEARGIKAMTKSKALLKGNMWVAAIIYFMLN  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                 L+   F++ VV G+ F   +V RV  GL+CLL+LFKL++F LV QTV+YFVCKSY 
Sbjct  240   VLGALLQFAFQKLVVRGYSFG--VVDRVAYGLICLLLLFKLILFWLVIQTVLYFVCKSYH  297

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             HENIDKSALSDHLEVYLG+YVPL +KDVQL+Q
Sbjct  298   HENIDKSALSDHLEVYLGDYVPLTAKDVQLQQ  329



>ref|XP_008381733.1| PREDICTED: uncharacterized protein LOC103444562 [Malus domestica]
Length=339

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 250/340 (74%), Gaps = 10/340 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQ+E+QFLG+F IY E+YK+++  RKIFSQI L+L+LPL+ +FL+  E+S ++ S +
Sbjct  1     MDREQDELQFLGIFGIYKEAYKIVFSRRKIFSQITLALILPLSFLFLSHIELSNILLSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E  L+ +   +P+Y+++SD ++S++A   LFK AYFT LL+FSLLSTSAVVYT+AC+
Sbjct  61    IHNEIVLDGTSANNPKYEKVSDAISSEWATYWLFKAAYFTFLLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFL----ALSFRV  710
             YT R+++FKKV+SVVPKVWKR+MVTFL  F+  F YN +A    +IW+ +    ALS   
Sbjct  121   YTKREITFKKVMSVVPKVWKRVMVTFLCIFMAIFCYNIVAFLILIIWVLIWVLAALSMAK  180

Query  709   FADIPLWVGV---AVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
                I   +GV    VY +GF+Y+++IWQLA  VSVLE++ G KAM KSK LL+G M +  
Sbjct  181   SDAIEKIIGVFLLIVYFIGFVYLTLIWQLAAVVSVLEEARGIKAMVKSKALLKGNMWVAX  240

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             + + KL+    L+   F++ VV+G  F   +  RV  G++C L+LFKLV+FGLV QTV+Y
Sbjct  241   IIYCKLNVLAALLQFGFQQLVVSGRSF--VVAERVAYGVICFLLLFKLVLFGLVIQTVLY  298

Query  358   FVCKSYQHENIDKSALSDHLEVYL-GEYVPLKSKDVQLEQ  242
             FVCKSY HE IDKSALSDHLEVYL G+YVPL SK+VQLEQ
Sbjct  299   FVCKSYHHEKIDKSALSDHLEVYLPGDYVPLSSKNVQLEQ  338



>ref|NP_001241069.1| uncharacterized protein LOC100819866 [Glycine max]
 gb|ACU18343.1| unknown [Glycine max]
Length=332

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 242/335 (72%), Gaps = 3/335 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG FDIY E+ K+I   RKIF+QI  +L+LPL+ IFL   E+S L+F  +
Sbjct  1     MDREQEEMQFLGFFDIYKEASKIILSWRKIFTQITSTLILPLSFIFLIHMEISNLLFRKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  ++ ++  +P+Y +L   ++S+   L+LFK AYFT LL+FSLLSTSAVVYT+A +
Sbjct  61    LINEIVMDETRRNTPQYNKLDRMISSELITLVLFKIAYFTLLLIFSLLSTSAVVYTIASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA++++FK+V+SVVPKVWKRLM+TFL  F  FF+YN +      + I + +       +
Sbjct  121   YTAKEVTFKRVMSVVPKVWKRLMLTFLCAFAAFFIYNIVTMLVMFLSI-VTIGISSGGVV  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L +   +Y +GF+Y++++WQLA+ V+VLEDS+G +AM+KSK+L++GKMVL +  F  L 
Sbjct  180   VLVLITVLYFIGFVYLTVVWQLASVVTVLEDSWGIRAMAKSKELIKGKMVLSIFVFFTLV  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              +   + ++FK  VV+GW   +  V +   G+LC L+L  L +FGLV QTV+YFVCKSY 
Sbjct  240   ASFVSIRVLFKVMVVDGW--RVSSVDKTAYGVLCFLLLSCLFLFGLVLQTVLYFVCKSYH  297

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENIDKSAL+DHLE Y GEYVPL +KDVQLEQYQV
Sbjct  298   HENIDKSALADHLEGYRGEYVPLTAKDVQLEQYQV  332



>gb|KDO83562.1| hypothetical protein CISIN_1g019636mg [Citrus sinensis]
Length=338

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 242/340 (71%), Gaps = 7/340 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG+F IY E+ KVI   R+IFS+I L+L+LPL+ IFLA  E++ L+   +
Sbjct  1     MDREQEEMQFLGIFGIYREACKVIITWRRIFSKITLALILPLSFIFLAHVELTDLLHRKV  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H + +   +  GS R+ +L+D ++ D      FK AY T  LV SLLSTSAVVYTVACV
Sbjct  61    VHDKMERHFTPAGSARFNKLTDVISEDRTLYWFFKVAYLTFYLVLSLLSTSAVVYTVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT +D+SFKKV+SVVPKVWKRLMVTFL TFL +F+YNF A     +W+ L        DI
Sbjct  121   YTGKDVSFKKVMSVVPKVWKRLMVTFLCTFLAYFLYNFAAIVVVSLWVVLWGILTAGGDI  180

Query  697   P-----LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
                   L+V +  Y  G  Y+S+IW LA+ VSVLE+S GF AM KS+ L++GKM++  V 
Sbjct  181   KFMLSILYVILVFYVAGHFYLSVIWHLASVVSVLEESCGFAAMIKSQALIKGKMLVTAVI  240

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
                ++ +LF V LIF R VV+GW   LG   RV  G++CLL+LFKL++F LV QTVIYFV
Sbjct  241   LFIMNISLFAVQLIFWRLVVHGW--WLGTGSRVLFGVICLLLLFKLMLFALVIQTVIYFV  298

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             CKSY HENIDKS LSDHLEVYLGEYVPLKSKD+QLE Y+V
Sbjct  299   CKSYHHENIDKSELSDHLEVYLGEYVPLKSKDIQLEHYEV  338



>ref|XP_010041277.1| PREDICTED: uncharacterized protein LOC104430213 [Eucalyptus grandis]
Length=332

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 188/337 (56%), Positives = 239/337 (71%), Gaps = 7/337 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLGL  I  ES KVI+  RKIF+QI  +L+LPLA +FL   EVS +++  +
Sbjct  1     MDREQEEMQFLGLVGICKESCKVIFSWRKIFTQITSALILPLAFVFLLHIEVSDVLYWRI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E +L  ++P S R+ R+S  L+ ++A  LLF   YFT LLVFSLLSTSA+VYT+AC+
Sbjct  61    VRNEIRLNETRPDSSRHDRISSVLSKEWAVYLLFNALYFTALLVFSLLSTSAIVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASA-FVIWIFLA-LSFRVFA  704
             YT  +++F+KV+SVVP+VW+RLMVTF+  FL  FVY+ +A    F   IF+   +F +  
Sbjct  121   YTGCEVTFRKVMSVVPRVWRRLMVTFVCIFLAMFVYHLVAMMILFTCAIFIGDTNFGILI  180

Query  703   DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
               PL  G+A Y VGF+YM+I+WQLA+ VSVLE+ YG KAM KSK L++GKMV  ++ F  
Sbjct  181   LFPL--GIA-YLVGFVYMTIVWQLASVVSVLEEDYGVKAMIKSKNLIKGKMVACIIIFFV  237

Query  523   LHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
             L  + FL+   F+R VV G      M+GR G G LC   L  L++ GLV +TVIYFVCKS
Sbjct  238   LTISYFLIQFAFRRLVVYGRS--AEMLGRSGYGALCFFFLSLLMLLGLVVKTVIYFVCKS  295

Query  343   YQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             Y HENIDKS LSDHLEV+LGEYVPLKSKDVQLEQ  V
Sbjct  296   YHHENIDKSVLSDHLEVFLGEYVPLKSKDVQLEQSDV  332



>ref|XP_004502568.1| PREDICTED: uncharacterized protein LOC101512421 [Cicer arietinum]
Length=332

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 187/342 (55%), Positives = 246/342 (72%), Gaps = 17/342 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+REQEEMQFLGLF IY ESY +I   RKIFSQI L+L+LPL  IFL   E+S ++F+ +
Sbjct  1     MEREQEEMQFLGLFSIYKESYNIIISWRKIFSQITLTLILPLTFIFLIHIELSNILFTKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  ++ ++   +P+YQ+LSD ++S++A   LFK  YFT LL+FS LSTSAVVYT+A +
Sbjct  61    LINTQEIIDTPQNTPQYQKLSDMISSEWAIFFLFKLVYFTFLLIFSFLSTSAVVYTIASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTAR+++F +V++VVPKVWK+LMVTFL TFL FFVYN +A    +IW   A+S    +  
Sbjct  121   YTAREVTFNRVMTVVPKVWKKLMVTFLCTFLAFFVYNIMAIVVLIIW---AISIGTQSG-  176

Query  697   PLWVGVAV-------YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
                 GVA+       Y +G LY+++IWQLA+ V+VLEDSYG KAM KS +L++GKM L +
Sbjct  177   ----GVAILVILGTLYFLGTLYLTVIWQLASVVTVLEDSYGVKAMMKSNELIKGKMGLSI  232

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             + FLKL+ + F +  +F + VV   +  L +V R G G+LC L+L  L +FGLV QTV+Y
Sbjct  233   LIFLKLNVSFFGIQYLFSKVVVQ--NMGLSLVNRTGYGILCFLLLSHLFLFGLVIQTVLY  290

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             FVCKSY H++IDKSALSDHLEVY G Y PLKSKDVQLE Y V
Sbjct  291   FVCKSYHHQSIDKSALSDHLEVYQGVYEPLKSKDVQLEHYDV  332



>ref|XP_010041278.1| PREDICTED: uncharacterized protein LOC104430214 [Eucalyptus grandis]
Length=311

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 233/335 (70%), Gaps = 24/335 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLG F IY ESYKVI+  RKIF+QI L+L+LPLA +FL   EVS ++ S +
Sbjct  1     MDREQEEMQFLGFFGIYKESYKVIFSWRKIFTQITLALILPLAFVFLLHMEVSDILLSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E QL+ ++P + R  R+S  L+ ++A  LL K  YFT LLVFSLLSTSAVVYT+AC+
Sbjct  61    VHNEIQLDETRPNTSRSDRISSVLSKEWAVFLLIKALYFTALLVFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT R+++F+KV+SVVP+VW+RLMVTFL  FL  F+YN +A         + L+  +F   
Sbjct  121   YTGREVAFRKVMSVVPRVWRRLMVTFLCIFLAMFLYNVIAG-------VILLTCAIFVGD  173

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
                 G                LA+ VSVLE+ YG KAM KSK L++GK+++ ++ F KL 
Sbjct  174   STSCG---------------NLASVVSVLEEDYGVKAMIKSKNLIKGKIIVSIIIFFKLS  218

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              +L LV   F++ VV G     G +GR G G+LC  +L  L+VFGLV QTVIYFVCKSY 
Sbjct  219   TSLHLVQFAFEKLVVYGRS--AGTLGRCGYGVLCFFLLSMLMVFGLVVQTVIYFVCKSYH  276

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQY V
Sbjct  277   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYDV  311



>ref|XP_003526666.1| PREDICTED: uncharacterized protein LOC100798371 [Glycine max]
Length=333

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 233/336 (69%), Gaps = 4/336 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD EQEEMQF+GL+ +Y ESYK+I+   K+F++I L+L+LPL+ IFL   EVS ++F  +
Sbjct  1     MDTEQEEMQFMGLYGVYRESYKIIFAWSKVFNKITLTLILPLSFIFLIHIEVSNILFGKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H   Q+  +   +P+Y  L++ L+S++A  +LFK  YFT LLVFSLLSTSA VYTVA +
Sbjct  61    LHNTQQMMETPQDTPQYHNLTNMLSSEWAIFILFKLLYFTFLLVFSLLSTSAAVYTVASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT+R+++F KV++VVPKVWKRLMVTFL TF+ FF YN +    FVIW  LA+  R    +
Sbjct  121   YTSREVTFSKVMNVVPKVWKRLMVTFLCTFVAFFAYNVMTLVVFVIWA-LAIGLRNGGVV  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVL-EDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
              L V   +Y  GF+Y++++WQLA+ V+VL ED+ G +AM K+ +L++G++ L V+ FLKL
Sbjct  180   VLVVLGMLYFAGFVYLTVVWQLASVVTVLEEDTCGVRAMMKTNELIKGRIGLTVLIFLKL  239

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
               +  L+  +FK+ VV GW          GV  L L     L    +  QTV+YFVCKSY
Sbjct  240   VISFGLIQFLFKKTVVQGWKLGSVDRTIYGVVCLVLFSQLYLFQLVI--QTVLYFVCKSY  297

Query  340   QHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              H+NIDKSALSDHLEVY GEY PLK+KDVQ+E+  V
Sbjct  298   HHQNIDKSALSDHLEVYHGEYEPLKAKDVQMEECHV  333



>ref|XP_009368431.1| PREDICTED: uncharacterized protein LOC103957931 [Pyrus x bretschneideri]
Length=316

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 181/332 (55%), Positives = 244/332 (73%), Gaps = 17/332 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQ+E+QFLG+F IY E+YK+++  RKIFSQI L+L+LPL+ IFLA  E+S ++ S +
Sbjct  1     MDREQDELQFLGIFGIYKEAYKIVFSWRKIFSQITLALILPLSFIFLAHIELSNILLSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +  L+ +   +PRY+++SD ++S++A   LFK AYFT LL+F LLSTSAVVYT+AC+
Sbjct  61    IRNQIALDGTSTNNPRYEKISDVISSEWATFWLFKAAYFTFLLIFGLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA++++FKKV+SVVPKVWKR++VTFL TFL FF YN +A    +IW+            
Sbjct  121   YTAKEITFKKVMSVVPKVWKRVVVTFLCTFLAFFCYNIVAFLVLIIWL------------  168

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
                + +     GF+Y+++IW LA+ VSVLE++ G KAM+KSK LL+G M +  + F KL 
Sbjct  169   ---LSMGNSDAGFVYLTLIWHLASVVSVLEEARGIKAMAKSKALLKGNMWVASIIFFKLT  225

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                 L+   F+  VV G  F   ++ RV  G++CLL+LFKL++FGLV QTV+YFVCKSY 
Sbjct  226   VLAGLLQFGFQELVVRGRSFG--VIDRVAYGVICLLLLFKLILFGLVIQTVLYFVCKSYH  283

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             HENIDKSALSDHLEVYLG+YVPL+SKDVQLEQ
Sbjct  284   HENIDKSALSDHLEVYLGDYVPLRSKDVQLEQ  315



>ref|XP_011100146.1| PREDICTED: uncharacterized protein LOC105178379 [Sesamum indicum]
Length=331

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 177/341 (52%), Positives = 243/341 (71%), Gaps = 16/341 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEE+QFLG F I  ESY ++    KIF+ I LS++LPL++I+LA  ++S+L+F+N+
Sbjct  1     MDREQEEIQFLGFFGILKESYNIVSSWTKIFTHITLSMILPLSLIYLAHIQISELLFTNI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E  L+ +  GS  Y ++SD LTS+++A  LFK AYF   ++ +LLSTSAVVYT+AC+
Sbjct  61    MHNEWVLDRTPVGSRSYNKVSDVLTSEWSAFFLFKIAYFVFFIILALLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA++++  KV+SVVPKVWKRLMVTF+  F++ F YN ++   F++ + L      F  I
Sbjct  121   YTAKEITLAKVMSVVPKVWKRLMVTFIWNFIIVFAYNIVSLLVFIVGVIL------FGAI  174

Query  697   PLWV--GVAVYTV----GFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
             P  V   V V+TV    GFLY+++IW LA  VSVLEDSYG  AM+KS+ L++GKM + V 
Sbjct  175   PALVIAFVVVFTVLYLAGFLYVTMIWHLATVVSVLEDSYGLNAMAKSQDLIKGKMGISVA  234

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
              F+ L    F +   F+  VV    F  G   R+GVG+LCL+++   ++FGL+ QT++YF
Sbjct  235   LFIVLLLCFFAIQTTFEFLVV----FGHGTGTRIGVGILCLILMSISMLFGLIIQTIVYF  290

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY HENIDKS+L+DHL  YLGEYVPLKSKDVQLEQ++V
Sbjct  291   VCKSYHHENIDKSSLADHLGGYLGEYVPLKSKDVQLEQFEV  331



>emb|CDP10982.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 245/337 (73%), Gaps = 7/337 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD+EQEE+QFLG F I  ES  ++   RKIFSQI+L+L+ PL+ I+LA  ++SQ +F+N+
Sbjct  1     MDKEQEEIQFLGFFGIIKESINIVPAWRKIFSQISLALIFPLSFIYLAHIQISQSLFTNI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                ES L+    G+P Y ++SD L+S++   +LFK  YF   LV +LLSTSAVVYT+AC+
Sbjct  61    VRDESILDRIPRGTPTYDKISDILSSEWTVFMLFKIGYFIFFLVLALLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA+D++FKK++SVVPKVWKRL+VTFL  F++ F Y+  A   F +++ L +   VF+  
Sbjct  121   YTAKDIAFKKIMSVVPKVWKRLIVTFLWNFVIIFGYHIAAILVFFVFMTL-IPPGVFSGA  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L++   VY VGF+Y+S+IW LA+ VSVLE+SYG  AM KS+ L++GK  + +V F+  +
Sbjct  180   VLFILFMVYLVGFVYISVIWHLASVVSVLEESYGLNAMIKSQDLIKGKAGVSMVIFVIHN  239

Query  517   FALFLVNLIFKRFVV--NGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
             F  F + + F+ FVV  NG       V R+G G+LCL +L  L++FGL+ QT+IYF+CKS
Sbjct  240   FCFFGIQMAFEWFVVLGNGGGL----VLRIGYGMLCLALLSMLILFGLIVQTIIYFICKS  295

Query  343   YQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             Y HENIDKS+L+DHLEVYLGEYVPLKSKDVQLE + V
Sbjct  296   YHHENIDKSSLADHLEVYLGEYVPLKSKDVQLEHFDV  332



>emb|CDP21521.1| unnamed protein product [Coffea canephora]
 emb|CDP11989.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 251/333 (75%), Gaps = 12/333 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLGLF IY E+YKV++R RKIFS+IALSL+LPL++IFLA  E+S L+   +
Sbjct  1     MDREQEEMQFLGLFGIYAEAYKVVFRWRKIFSKIALSLILPLSLIFLAHIELSHLLKIKV  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              HTE+QL  +Q    + ++L+D        L  +   Y T LL+FSLLST+AVVYT+AC+
Sbjct  61    IHTENQLHRAQSEPQKSKKLTD--------LNWYNITYLTFLLIFSLLSTAAVVYTIACI  112

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT R+++FKKV+SVVPKVW+RL+ TFL   L FF YN +A    +I + + L   +   +
Sbjct  113   YTGREITFKKVMSVVPKVWQRLVGTFLCASLAFFAYNLIALLVLMI-LTMTLGETLIGAV  171

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L + + VY + F+YM+IIWQLA  VSVLEDSYG KAM KS++L++GKM + +V F KL+
Sbjct  172   LLILLLIVYILVFVYMTIIWQLACVVSVLEDSYGIKAMMKSQELIKGKMPISIVIFFKLN  231

Query  517   FALFLVNLIFKRFVVN-GWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
              +L  + L+F   VV+ GW F  G++ R+G+G+LCLL+LFKL++FGLV QT++YFVCKSY
Sbjct  232   LSLAAIQLLFYAHVVHGGWRF--GVLHRLGLGMLCLLLLFKLILFGLVIQTIVYFVCKSY  289

Query  340   QHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
              HENI+KSALSDHLE YLGE+VPLKSKDVQLEQ
Sbjct  290   HHENIEKSALSDHLEAYLGEHVPLKSKDVQLEQ  322



>ref|XP_010270454.1| PREDICTED: uncharacterized protein LOC104606785 [Nelumbo nucifera]
Length=329

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 173/335 (52%), Positives = 239/335 (71%), Gaps = 6/335 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE QFLG+  I+ ES K+I   R+IF +I L+L+LPLA IFLA  +V++  F+N+
Sbjct  1     MDADAEEFQFLGIVGIFKESIKIILSWREIFIKITLALILPLAFIFLAHIQVTEFFFANI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              + +  L+N+   SP Y  + D L+S++ A  LFK  Y   +L+FSLLSTSAVVYTVAC+
Sbjct  61    TNNQDSLDNTPEDSPTYNTILDRLSSEWTAFWLFKAVYLLAVLIFSLLSTSAVVYTVACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA++++FKKV+SVVPKVWKRLMVTFL  F++ F YN +A    +I++ L  S    A +
Sbjct  121   YTAKEITFKKVMSVVPKVWKRLMVTFLWNFIIVFAYNIVAVLIILIFLILFGS----ATM  176

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              ++V + +Y+VG +Y++++W LA+ VSVLEDSYG +AM KSK L++GK  +    FL L+
Sbjct  177   IIFVLLVLYSVGLVYITVVWHLASVVSVLEDSYGMQAMVKSKDLIKGKTQVASAIFLVLN  236

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
             F    ++  F++ VV+G  F LG+  RV  G++C + LF +++  LV QTVIYFVCKSY 
Sbjct  237   FGFAAIHSAFEKLVVHG--FSLGIGDRVVFGIICCMFLFVMMLLALVVQTVIYFVCKSYH  294

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENIDKS L+DHLEVYLGEYVPL  KD+QLE Y V
Sbjct  295   HENIDKSCLADHLEVYLGEYVPLHGKDIQLENYYV  329



>ref|XP_010065112.1| PREDICTED: uncharacterized protein LOC104452333 [Eucalyptus grandis]
Length=333

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 235/337 (70%), Gaps = 6/337 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLGL  I  ES KVI+  RKIF+QI  +L+LPLA +FL   EVS +++ ++
Sbjct  1     MDREQEEMQFLGLVGICKESCKVIFSWRKIFTQITSALILPLAFVFLLHIEVSDVLYWHI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E +L+ S P +  + R+S  L+ ++A  LLF   Y T  LV SLLSTSAVVYT+AC+
Sbjct  61    VSNEIRLDMSYPKTALHDRISSVLSKEWAVYLLFNALYLTAFLVLSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT R++ F KV+SVV +VWKRLMVTFL  FL  FVYN +AA   V  +  A    +   I
Sbjct  121   YTGREVVFGKVMSVVLRVWKRLMVTFLCIFLAMFVYNLVAAVILVRCLIFAGDTNL--GI  178

Query  697   PLWV-GVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
             P+ +  V  Y VGF+YMSI+WQLA+ VSVLE+ YG KAM KSK L++GK+V  ++ F  L
Sbjct  179   PILILAVIAYLVGFVYMSIVWQLASVVSVLEEDYGVKAMIKSKNLIKGKIVASIIIFFVL  238

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
             + + FL+   F+R VV  +D   G + R G G+LC  +L  L++ GLV QTVIYFVCKSY
Sbjct  239   NISFFLIQFAFRRRVV--YDRLAGTLSRSGYGILCFFLLSMLMLLGLVFQTVIYFVCKSY  296

Query  340   QHENIDKSALSDHLEVY-LGEYVPLKSKDVQLEQYQV  233
              HENIDKS LSDHL+VY LGEYVPLKSKDVQLEQ  V
Sbjct  297   HHENIDKSVLSDHLDVYLLGEYVPLKSKDVQLEQCDV  333



>ref|XP_004292550.1| PREDICTED: uncharacterized protein LOC101297805 [Fragaria vesca 
subsp. vesca]
Length=335

 Score =   249 bits (637),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 184/336 (55%), Positives = 248/336 (74%), Gaps = 6/336 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQ+E+QFLG+  IY ES+K+IY  RKIFSQI L+L+LPL+ IFLA  E+S ++ S +
Sbjct  1     MDREQDELQFLGIIGIYKESFKIIYNWRKIFSQITLTLILPLSFIFLAHIEISNILLSRI  60

Query  1057  RHTESQLENSQPG--SPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytva  884
              H+E  L+ ++    + R ++LSD +  ++A   LFK AY T +L+F LLSTSAVVYT+A
Sbjct  61    LHSELVLDETRGADSASRQKKLSDVINKEWATYWLFKAAYLTSMLIFGLLSTSAVVYTIA  120

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA  704
              VYT+R+++F+K++ VVP+VWKR+M+TFL TFL FF+YN LA    V+++    + +  A
Sbjct  121   SVYTSREITFQKIMRVVPRVWKRVMITFLCTFLAFFLYNLLAIVVLVLFVIFNGNGQSNA  180

Query  703   -DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              DI  +  + +Y +GF+YM+IIWQLA+ VSVLE++ G KAM KS +LLRG M +  + F 
Sbjct  181   GDIIGFFLLILYVIGFVYMTIIWQLASVVSVLEETRGIKAMIKSMKLLRGNMWVATIIFF  240

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
             KL+    ++   F+  VV G  F    +GRVG G+LCLL+LFKL++F LV QTV+YFVCK
Sbjct  241   KLNVLAAVLQFAFQALVVRGGMFG--TMGRVGFGVLCLLLLFKLILFALVIQTVLYFVCK  298

Query  346   SYQHENIDKSALSDHLEV-YLGEYVPLKSKDVQLEQ  242
             SY HE IDKSALSDHLEV YLG+YVPLKSKDVQLEQ
Sbjct  299   SYHHEIIDKSALSDHLEVIYLGDYVPLKSKDVQLEQ  334



>gb|KHN25585.1| hypothetical protein glysoja_050259 [Glycine soja]
Length=326

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 165/329 (50%), Positives = 228/329 (69%), Gaps = 4/329 (1%)
 Frame = -3

Query  1216  MQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNLRHTESQL  1037
             MQF+GL+ +Y ESYK+I+   K+F++I L+L+LPL+ IFL   EVS ++F  + H   Q+
Sbjct  1     MQFMGLYGVYRESYKIIFAWSKVFNKITLTLILPLSFIFLIHIEVSNILFGKILHNTQQM  60

Query  1036  ENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacvytARDLS  857
               +   +P+Y  L++ L+S++A  +LFK  YFT LL+FSLLSTSAVVYTVA +YT+R+++
Sbjct  61    METPQDTPQYHNLTNMLSSEWAIFILFKLLYFTFLLIFSLLSTSAVVYTVASIYTSREVT  120

Query  856   FKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADIPLWVGVA  677
             F KV++VVPKVWKRLMVTFL TF+ FF YN +    FVIW  LA+  R    + L V   
Sbjct  121   FSKVMNVVPKVWKRLMVTFLCTFVAFFAYNVMTLVVFVIWA-LAIGLRNGGVVVLVVLGM  179

Query  676   VYTVGFLYMSIIWQLANTVSVL-EDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLV  500
             +Y  GF+Y++++WQLA+ V+VL ED+ G +AM K+ +L++G++ L V+ FLKL  +  L+
Sbjct  180   LYFAGFVYLTVVWQLASVVTVLEEDTCGVRAMMKTNELIKGRIGLTVLIFLKLVISFGLI  239

Query  499   NLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDK  320
               +FK+ VV GW          GV  L L     L    +  QTV+YFVCKSY H+NIDK
Sbjct  240   QFLFKKTVVQGWKLGSVDRTIYGVVCLVLFSQLYLFQLVI--QTVLYFVCKSYHHQNIDK  297

Query  319   SALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SALSDHLEVY GEY PLK+KDVQ+E+  V
Sbjct  298   SALSDHLEVYHGEYEPLKAKDVQMEECHV  326



>ref|XP_007048406.1| Uncharacterized protein TCM_001500 [Theobroma cacao]
 gb|EOX92563.1| Uncharacterized protein TCM_001500 [Theobroma cacao]
Length=346

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 187/342 (55%), Positives = 251/342 (73%), Gaps = 18/342 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEE+QFLG F I  ES K+I+  RKIFSQ+ L+L+ PL+ IFLA  ++SQL+F+N+
Sbjct  16    MDREQEELQFLGFFGILKESIKIIFSWRKIFSQVTLALIFPLSFIFLAHIQISQLLFTNI  75

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +  L  ++ GS RY +LSD L+S+++A  LFK AYFT LL+ SLLSTSAVVYT+AC+
Sbjct  76    LRDQDALNYTRVGSSRYTKLSDILSSEWSAFWLFKAAYFTFLLILSLLSTSAVVYTIACI  135

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA+++SFKKV+SVVPKVWKRL+VTFL +F++  VYN LAA    + +  +++F   ++ 
Sbjct  136   YTAKEISFKKVMSVVPKVWKRLVVTFLWSFVIVMVYNVLAA----VLLLSSVAFLGLSN-  190

Query  697   PLWVGVAVYTV-------GFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
                VGVA++ V       GF+Y++++W LA+ VSVLED YG KAM KSK L++GKM +  
Sbjct  191   ---VGVAIFVVLFILYLSGFVYITLVWHLASVVSVLEDVYGIKAMIKSKALIKGKMGVAA  247

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
               FL L      + L+F+  VV      +    ++ +G LC L+LFK+++FGLV QTVIY
Sbjct  248   AIFLLLVLCFVGIQLLFEVGVVFA---PVSTEIKIVIGFLCFLLLFKVILFGLVAQTVIY  304

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             FVCKSY HENIDKS+L+DHLEVYLGEYVPLK+KDVQLEQ+ V
Sbjct  305   FVCKSYHHENIDKSSLADHLEVYLGEYVPLKAKDVQLEQFHV  346



>ref|XP_010260469.1| PREDICTED: uncharacterized protein LOC104599567 [Nelumbo nucifera]
Length=333

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 177/335 (53%), Positives = 237/335 (71%), Gaps = 2/335 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD E EE+QFLG F IY E+YK+I    KIF++I LSL+LPL+ IFLA  ++S+ +F+ +
Sbjct  1     MDTEPEELQFLGFFGIYREAYKIICSWSKIFTKITLSLILPLSFIFLAHIQISEFLFAKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L+ +   SPRY  + D L+S++ A  LFK AY   +L+FSLLSTSAVVY VACV
Sbjct  61    LRNEDSLDTTPVDSPRYNLILDRLSSEWTAFWLFKAAYLLIVLIFSLLSTSAVVYMVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA++++F+K++SVVPKVWKRLMVTFL  F++ F YN +A    ++  F           
Sbjct  121   YTAKEITFRKIMSVVPKVWKRLMVTFLWNFIIVFAYNMVALLIVILIAFAVGPAGAAGAA  180

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L + + VY VG +Y++++W LA+ VSVLEDSYG +AM KSK L++GKM +     L  +
Sbjct  181   VLLILLVVYLVGLVYITVVWHLASVVSVLEDSYGIQAMIKSKALIKGKMWVAGAIVLLFN  240

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              A  L+ + F++ VV+GW     +  RVG G++C+++LF L++ GLV QTVIYFVCKSY 
Sbjct  241   LAFLLIQIAFEKLVVHGWSLG--VASRVGYGIVCVMLLFFLILLGLVVQTVIYFVCKSYH  298

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENIDKS L+DHLEVYLGEYVPLK KDVQLEQY V
Sbjct  299   HENIDKSCLADHLEVYLGEYVPLKGKDVQLEQYYV  333



>ref|XP_011027398.1| PREDICTED: uncharacterized protein LOC105127717 isoform X1 [Populus 
euphratica]
Length=344

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 179/339 (53%), Positives = 248/339 (73%), Gaps = 10/339 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+REQEEMQFLG+F IY E+YK+I+  RKIFSQIAL+L+LPL+ I LA  EVS ++   +
Sbjct  6     MEREQEEMQFLGVFGIYKEAYKIIFSWRKIFSQIALALILPLSFISLAHIEVSNVLSGKI  65

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              + + +L  ++ G+ RY +LSDH++S+ A   LF+ AY    L+FSLLS++AVVYT+A +
Sbjct  66    INNQVELLGTEAGTKRYNKLSDHVSSELAYFWLFEAAYLILSLIFSLLSSAAVVYTIASI  125

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLA--ASAFVIWI--FLALSF--  716
             YT R++SFKKV+SVVPKVWKRLMVTFLS  + FF Y  +A   S+ V+ I  F+   F  
Sbjct  126   YTNREVSFKKVMSVVPKVWKRLMVTFLSVSVAFFAYTVVAILVSSLVLIIAWFVFTGFHY  185

Query  715   -RVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
              +VF    + V + +Y +GF+YM I+WQLA++VSVLE++ GFKAM+KS+ L++GKM   +
Sbjct  186   LKVFYSFGI-VLLVLYFMGFVYMIIVWQLASSVSVLEEACGFKAMTKSRALIKGKMWTAI  244

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             + F +L+    ++ + F+  VV+G   +  M  RV  G++CL +   L++FGLVTQTVIY
Sbjct  245   IIFFELNLFSAVILMAFQNLVVHGVSMN--MATRVLYGVICLSLFLGLLLFGLVTQTVIY  302

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             FVCKS  HENI+KSALSDHL+VY GE+VPL SKDVQLE+
Sbjct  303   FVCKSNHHENIEKSALSDHLDVYHGEHVPLNSKDVQLEE  341



>ref|XP_010680207.1| PREDICTED: uncharacterized protein LOC104895408 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 238/340 (70%), Gaps = 6/340 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEE+QFL  F I  ES  +I++  KIF++I  +L++PL+ IFLA +  S  I + +
Sbjct  1     MDREQEELQFLNFFGICKESTNIIFKWSKIFTKITFTLIIPLSCIFLANQGFSTFITNKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                 + L+    GS  Y ++S+ +TS++ A  L K AYF  LL+FSLL TSA+VYTVAC+
Sbjct  61    ITNATTLDYIPQGSAAYNKISNLITSEWTAFWLIKLAYFMFLLIFSLLCTSAIVYTVACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNF----LAASAFVIWIFLAL-SFR  713
             YT ++++FKK++SVVPKVWKRLMVT L  F + F YNF    ++  A +IW+ L   +  
Sbjct  121   YTGKEITFKKIMSVVPKVWKRLMVTLLWNFAIMFAYNFVWFIISMIAILIWLILFFPNGE  180

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
             V  ++   + + +Y +GF Y+SIIWQLA+ VSVLED+YG +AM+KSK L++GKM +    
Sbjct  181   VVGNVGSCIMLLLYLIGFTYISIIWQLASVVSVLEDTYGIQAMTKSKDLIKGKMGISSAM  240

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
             FL     L  + ++F++  V  W  + G++ ++G G+LCLL+L  L +FGLV QTVIYFV
Sbjct  241   FLIFTICLVGIEMLFQQSEVIDWRIN-GVLVKLGYGILCLLLLTLLFLFGLVVQTVIYFV  299

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             CKSY HENIDKS+L+DHLE YLGEY+PL SK++QLE+Y V
Sbjct  300   CKSYHHENIDKSSLADHLEGYLGEYIPLNSKNIQLEEYHV  339



>ref|XP_008466696.1| PREDICTED: uncharacterized protein LOC103504045 [Cucumis melo]
Length=338

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 169/342 (49%), Positives = 227/342 (66%), Gaps = 11/342 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD EQEEMQFLG++ I+ E+ K+I+  R+IFSQI L+L+LPL+ +FLA  E+S L    +
Sbjct  1     MDVEQEEMQFLGVYGIFRETTKLIFTWRRIFSQITLALILPLSFLFLAHMEISDLFLRKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L+ +Q  +P + +LSD ++S+     LF+  Y    +V SLLSTSAVVYTVA +
Sbjct  61    MFDEYVLDQTQTSTPTFDKLSDVVSSEKVYYFLFQIMYLVIFIVLSLLSTSAVVYTVASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVI---WIFLALSFRVF  707
             YT RD++FK V+SVVPKVWKRL++TFL  F+ F  Y+   AS  VI     F+ L+FR  
Sbjct  121   YTGRDVAFKPVMSVVPKVWKRLLLTFLCVFISFVGYSI--ASLLVITFLLFFIILAFRTA  178

Query  706   AD---IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
                  + L+V   +Y  G  Y++ IWQL+N +SVLEDSYGFKAM KS  L++GK+ + VV
Sbjct  179   GAGVFLFLYVVQILYLAGAFYLTAIWQLSNVISVLEDSYGFKAMGKSYGLVKGKLGISVV  238

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
               L L   L     +F   VV        ++ +  +G+ C L+ F   +  LVT+TV+YF
Sbjct  239   IILCLSLPLGTARFVFGHLVVRTASLG--ILSKGTLGIFCFLLFFIFFLLKLVTETVLYF  296

Query  355   VCKSYQHENIDKSALSDHLEVY-LGEYVPLKSKDVQLEQYQV  233
             VCKSY HENIDKSALSDHLEVY LGEYVPL+ +DVQLE++QV
Sbjct  297   VCKSYHHENIDKSALSDHLEVYLLGEYVPLRPRDVQLEKFQV  338



>ref|XP_010105097.1| hypothetical protein L484_000477 [Morus notabilis]
 gb|EXC49700.1| hypothetical protein L484_000477 [Morus notabilis]
Length=334

 Score =   241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 174/338 (51%), Positives = 237/338 (70%), Gaps = 15/338 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDR Q E+QFLG    + +S+K++ + RKIFSQI L+L+LPL+ IFLA  E+SQL+F  +
Sbjct  1     MDRGQHELQFLGFCGTFKQSFKIVLQWRKIFSQITLALILPLSFIFLAHFEISQLLFFKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L  +   S  + +L   ++S++    LFK AYFT LLVFSLLSTSAVVYT+AC+
Sbjct  61    ITNEDDLSYTDINSRDHAKLRRAISSEWTFFWLFKAAYFTFLLVFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWI-FLALSFRVFAD  701
             +TA+ +SF KV+ +VPKVWKRL VTFL +F +  VYN LA    V+ I  L +S      
Sbjct  121   FTAKPISFVKVMRIVPKVWKRLAVTFLWSFAIVLVYNVLAIGVLVLCIVLLGIS------  174

Query  700   IPLWVGVAV-----YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
              P  + + +     Y  GF+Y+ I+W LA+ +SVLE+SYG KAM KS+ L++GK+ L V 
Sbjct  175   -PAGIAIGILFLIAYLAGFVYIGIVWHLASVISVLEESYGIKAMKKSRDLIKGKLGLAVA  233

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
             +FL + F   ++ LIF+ FVV G     G+  R+ VG++C L+LFK+++FGLV QT+IYF
Sbjct  234   YFLLIGFCFVVIELIFEHFVVIG--IVGGLAVRIVVGIVCFLLLFKVILFGLVIQTIIYF  291

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             +CKSY HENIDKS+LS+HLEVYLG+YVPLKSKDVQL +
Sbjct  292   ICKSYHHENIDKSSLSEHLEVYLGDYVPLKSKDVQLGE  329



>ref|XP_003522558.1| PREDICTED: uncharacterized protein LOC100817862 [Glycine max]
Length=334

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 180/333 (54%), Positives = 230/333 (69%), Gaps = 4/333 (1%)
 Frame = -3

Query  1237  MDR-EQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             MD  EQE MQFLG   IY ESYK+I+  RKIF+QI  +L+LPL+ IFL   +VS L+F  
Sbjct  1     MDTIEQENMQFLGFLGIYKESYKLIFSWRKIFTQITFTLILPLSFIFLIHIQVSDLLFGK  60

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             + H    L  + PG+P++Q+L D  +SD+A   LFK  YF  LL+FSLLSTSA+VYTVA 
Sbjct  61    ITHDAKDLTETLPGTPQHQKLLDTFSSDWATFFLFKLLYFISLLIFSLLSTSAIVYTVAS  120

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFAD  701
              YT ++++FKKV+SVVPKVWKRLMVTFL T + FFVYN +A     IW  L +  R    
Sbjct  121   FYTGKEVTFKKVLSVVPKVWKRLMVTFLCTVVAFFVYNVMAVLVLGIWA-LTIGVRNGGG  179

Query  700   IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
               L V   +Y VG +Y++++W LA+ V+VLEDSYG++AM KSK+L++GKM L V+  LKL
Sbjct  180   AILSVLAILYLVGSVYLTVVWLLASVVTVLEDSYGYEAMMKSKELIKGKMGLSVMIVLKL  239

Query  520   HFALFLVNLIFKRFVVNGWD-FHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
             +F  FL   +F   VVNGW  F LG V R   G++C L+L  L +  LV QTV+YFVCKS
Sbjct  240   NFLFFLTQFLFSMVVVNGWKVFGLGSVDRTVFGIVCFLLLSHLFLLMLVIQTVMYFVCKS  299

Query  343   YQHENIDKSALSDHLEVYLGEYVPLKSKDVQLE  245
             Y  E +DKSALS HLEVY   Y PLK+KDVQL+
Sbjct  300   YHREIVDKSALSYHLEVY-ECYEPLKAKDVQLD  331



>ref|XP_002526640.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35752.1| conserved hypothetical protein [Ricinus communis]
Length=336

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 244/337 (72%), Gaps = 12/337 (4%)
 Frame = -3

Query  1228  EQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNLRHT  1049
             EQ+E++F+G   I  +S+++I+  RKIFSQI L+L+LPL+ IFLA  +VSQL+F  +   
Sbjct  5     EQQEIKFIGFIGILKQSFRIIFTWRKIFSQITLALILPLSFIFLAHIQVSQLLFFKILLN  64

Query  1048  ESQLENS-QPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacvyt  872
             +  L N+ Q G+P Y +LSD ++S++    LFK AYFT LLVFSLLSTSAVVY +AC+YT
Sbjct  65    QDTLYNNLQEGTPDYAKLSDIISSEWTVFWLFKIAYFTFLLVFSLLSTSAVVYAIACIYT  124

Query  871   ARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR-----VF  707
             ++ ++FKKV+SVVP+VWKRLMVTFL +F + FVYN +AA   +I + +          VF
Sbjct  125   SKPITFKKVLSVVPRVWKRLMVTFLWSFAIVFVYNIIAAVVLIILLVVVNIGNSSIKFVF  184

Query  706   ADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
               IPL     VY VG LY++I+W LA+ VSVLE+ YG KAM KSK L++G + + V  F+
Sbjct  185   IAIPL----IVYFVGLLYITIVWHLASVVSVLEEIYGIKAMIKSKNLIKGNIGVAVALFI  240

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              L      + L+F+ ++V GW    G+  R+ VG+LCLL+LFKL++FGLV QTV+YFVCK
Sbjct  241   MLGICFLGIQLLFEIYMVFGWP--EGLGIRIVVGILCLLLLFKLILFGLVIQTVLYFVCK  298

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             S+ +ENIDKS LSDHLE YLG+YVPLK+ +VQ+EQYQ
Sbjct  299   SHHNENIDKSILSDHLEAYLGDYVPLKAANVQMEQYQ  335



>ref|XP_006842394.1| hypothetical protein AMTR_s00209p00027350 [Amborella trichopoda]
 gb|ERN04069.1| hypothetical protein AMTR_s00209p00027350 [Amborella trichopoda]
Length=330

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 171/339 (50%), Positives = 228/339 (67%), Gaps = 13/339 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDRE EEMQFLG F IY E++K+I   RKIF++I L+L+LPL+ IFLA   V+  IFS++
Sbjct  1     MDREPEEMQFLGCFGIYKEAFKIILSWRKIFTRITLALILPLSFIFLAHNFVTDRIFSSI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L ++ P S    ++ D +TS++ +L LFK  Y  C+L+FSLLSTSA+VYTVAC+
Sbjct  61    HRNEQAL-DTHPQSK--HKIIDKITSEWISLFLFKAVYLVCVLIFSLLSTSAIVYTVACI  117

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLAL-SFRVFAD  701
             YTA++++F+KV+SVVPKVWKRLMVTFL  F++   YN +     V + FL L S      
Sbjct  118   YTAKEINFRKVLSVVPKVWKRLMVTFLWNFVILLCYNTVCIVIIVCFAFLVLQSDDSILS  177

Query  700   IPLW-VGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
             +  W V +  Y VG  Y+S++W LA+ VSVLED YG  AM KS+ L++GK+ +    F+K
Sbjct  178   VLFWIVLIGFYLVGLAYISVVWHLASVVSVLEDKYGISAMQKSRNLIKGKIWVAAFIFVK  237

Query  523   LHFALFLVNLIFKRFVV--NGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
             L      + ++F   V+   GW +       +G G+L + VL  L++ GLV QTV+YFVC
Sbjct  238   LSAIYIGIQVLFGAIVLKGGGWVWR------LGFGVLMVGVLCLLILLGLVVQTVVYFVC  291

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             KSY HE+IDKS LSDHLEVYLGEYVPLK   VQLEQ  V
Sbjct  292   KSYHHESIDKSCLSDHLEVYLGEYVPLKGSAVQLEQLYV  330



>gb|KGN47743.1| hypothetical protein Csa_6G398200 [Cucumis sativus]
Length=338

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 168/342 (49%), Positives = 222/342 (65%), Gaps = 11/342 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD EQEEMQFLG++ I+ E+ K+I+  R+IFSQI L+L+LPL+ +FLA  E+S L    +
Sbjct  1     MDVEQEEMQFLGIYGIFRETTKLIFTWRRIFSQITLALILPLSFLFLAHMEISDLFLRKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L+ +Q  +P + +LSD ++S+     LF+  Y    +V SLLSTSAVVYTVA +
Sbjct  61    MFDEFVLDQTQTSTPSFDKLSDVVSSEKVYFFLFQIMYLVIFIVLSLLSTSAVVYTVASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT RD++FK V+SVVPKVWKRL++TFL  F+ F  Y+   AS  VI          F   
Sbjct  121   YTGRDVAFKPVMSVVPKVWKRLLLTFLCVFISFVGYSI--ASLLVITFLFFFIILAFRTA  178

Query  697   P------LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
                    L+V   +Y  G  Y++ IWQL+N +SVLEDSYGFKAM KS  L++GK+   VV
Sbjct  179   GGGVFLFLYVVQILYLAGAFYLTAIWQLSNVISVLEDSYGFKAMGKSYGLVKGKLGTSVV  238

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
               L L   L  V  +F   VV        ++ +  +G+LC L+ F   +  LVT+TV+YF
Sbjct  239   IILCLSLPLGTVRFVFGHLVVRTSSLG--ILSKGTLGILCFLLFFIFFLLKLVTETVLYF  296

Query  355   VCKSYQHENIDKSALSDHLEVY-LGEYVPLKSKDVQLEQYQV  233
             VCKSY HENIDKSALSDHLEVY LGEYVPL+ +DVQLE++QV
Sbjct  297   VCKSYHHENIDKSALSDHLEVYLLGEYVPLRPRDVQLEKFQV  338



>ref|XP_004146074.1| PREDICTED: uncharacterized protein LOC101219186 [Cucumis sativus]
 ref|XP_004169022.1| PREDICTED: uncharacterized protein LOC101229182 [Cucumis sativus]
 gb|KGN55008.1| hypothetical protein Csa_4G621200 [Cucumis sativus]
Length=330

 Score =   233 bits (595),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 168/335 (50%), Positives = 232/335 (69%), Gaps = 9/335 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQE++QFLG F I+ ES+ ++   RKIFS+I L+L+LPL ++FLA  +V++L+F  +
Sbjct  1     MDREQEDLQFLGFFGIFTESFNIVLSWRKIFSKITLTLILPLTVVFLAHIQVTELLFFKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L +    S +Y +LSD +TS++ +  LFK AYFT  L+ +LLS++AVVYTVACV
Sbjct  61    LKNEDSLNSIPKNSSKYTKLSDIITSEWISFWLFKAAYFTFFLILALLSSAAVVYTVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT ++++F KVI VVPKVW+RLMVTFL  F++  +YN     AF + I L  +   F  I
Sbjct  121   YTGKEITFSKVIGVVPKVWRRLMVTFLWNFVIVLIYNM----AFGVLIVLWSAIFGFGGI  176

Query  697   PLWV--GVAV-YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              + V  G++V Y VGF+Y+S++W LA+ VSVLED YG +AM K K+L++GKMVL    F 
Sbjct  177   GVLVISGLSVSYVVGFVYISVVWHLASVVSVLEDVYGIQAMLKGKELIKGKMVLSCGVFF  236

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
                       L+F+  VV G   +     R+ +G+LC L+LFK+ +FGLV QT++YFVCK
Sbjct  237   TFTVLFLGGQLVFQTLVVLGSSKY--YGLRIVLGILCFLLLFKVFLFGLVAQTILYFVCK  294

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             SY H+NIDK  LSDHLEVY G+YVPLK +DVQL +
Sbjct  295   SYHHQNIDKPLLSDHLEVYHGDYVPLKEQDVQLGE  329



>ref|XP_008463672.1| PREDICTED: uncharacterized protein LOC103501766 [Cucumis melo]
Length=330

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 231/332 (70%), Gaps = 3/332 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQ  +QFLG F I+ ES+ ++   RKIFS+I L+L+LPL I+F+A  +V++L+F  +
Sbjct  1     MDREQGALQFLGFFGIFTESFNIVLSWRKIFSKITLTLILPLTIVFVAHIQVTELLFFKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L +    S +Y +LSD +TS++ +  LFK AYFT  L+ +LLS++AVVYTVACV
Sbjct  61    LKNEDSLNSIPKNSSKYTKLSDIITSEWISFWLFKAAYFTFFLILALLSSAAVVYTVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT ++++F+KV++VVPKVW+RLMVTFL  F++  VYN       V+W  +     +   I
Sbjct  121   YTGKEITFRKVVAVVPKVWRRLMVTFLWNFVIVLVYNVAFGVLIVLWAAIFGFGGIGILI  180

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
                + V+ Y +GF+Y+S++W LA+ VSVLED YG +AM K K+L++GKMVL    FL   
Sbjct  181   ISGLSVS-YVLGFVYISVVWHLASVVSVLEDVYGIQAMLKGKELIKGKMVLSCGVFLTFT  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                    L+F+  VV G   +     R+ +G+LC L+LFK+ +FGLV QT++YFVCKSY 
Sbjct  240   VLFLGGQLVFQTLVVLGSSKY--YGLRIVLGILCFLLLFKVFLFGLVAQTILYFVCKSYH  297

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             H+NIDKS+LSDHLEVYLG+YVPLK +DVQL +
Sbjct  298   HQNIDKSSLSDHLEVYLGDYVPLKEQDVQLGE  329



>gb|EYU23743.1| hypothetical protein MIMGU_mgv1a026174mg [Erythranthe guttata]
Length=334

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 171/335 (51%), Positives = 234/335 (70%), Gaps = 1/335 (0%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEE+QFLG F I  ES  ++   RKIF+QI L+L+LPL+ I+LA  ++S+L+FS +
Sbjct  1     MDREQEEIQFLGFFGILKESITIVSSWRKIFTQITLALILPLSFIYLAHIQISELLFSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L+ +  G+  + R+S  L+S++ A  LFK  YF   +V SLLSTSAVVYT+AC+
Sbjct  61    MLNEFILDRTAEGTRTHDRISGALSSEWTAFFLFKIGYFVFFIVLSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA++++FKKV+SVVPKVWKRL+VTF+  F++ F YN  +  A  +   L  S  V   +
Sbjct  121   YTAKEIAFKKVMSVVPKVWKRLVVTFIWNFVIVFAYNVASLIALFLGAVLFGSVPVIGTL  180

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L +    Y VGF Y++I+W LA  VSVLE+SYG  AM+KS+ L++GKM +    F  + 
Sbjct  181   FLILFGVCYFVGFFYITIVWHLATVVSVLEESYGLNAMAKSQALIKGKMWVSFAVFFVVG  240

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                F + LIF+ F+V       G+  RVG G+ CL+++   ++FGL+TQT+IYFVCKSY 
Sbjct  241   VFFFGIQLIFE-FLVVVGGDGEGVGARVGFGIFCLVLMSIWMLFGLITQTIIYFVCKSYH  299

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENIDKS+L+DHL  YLGEYVPLKSKDVQLEQ++V
Sbjct  300   HENIDKSSLADHLGGYLGEYVPLKSKDVQLEQFEV  334



>gb|KHN44271.1| hypothetical protein glysoja_024491 [Glycine soja]
Length=326

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 175/325 (54%), Positives = 225/325 (69%), Gaps = 3/325 (1%)
 Frame = -3

Query  1216  MQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNLRHTESQL  1037
             MQFLG   IY ESYK+I+  RKIF+QI  +L+LPL+ IFL   +VS L+F  + H    L
Sbjct  1     MQFLGFLGIYKESYKLIFSWRKIFTQITFTLILPLSFIFLIHIQVSDLLFGKITHDAKDL  60

Query  1036  ENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacvytARDLS  857
               + PG+P++Q+L D  +SD+A   LFK  YF  LL+FSLLSTSA+VYTVA  YT ++++
Sbjct  61    TETLPGTPQHQKLLDTFSSDWATFFLFKLLYFISLLIFSLLSTSAIVYTVASFYTGKEVT  120

Query  856   FKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADIPLWVGVA  677
             FKKV+SVVPKVWKRLMVTFL T + FFVYN +A     IW  L +  R      L V   
Sbjct  121   FKKVLSVVPKVWKRLMVTFLCTVVAFFVYNVMAVLVLGIWA-LTIGVRNGGGAILSVLAI  179

Query  676   VYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVN  497
             +Y VG +Y++++W LA+ V+VLEDSYG++AM KSK+L++GKM L V+  LKL+F  FL  
Sbjct  180   LYLVGSVYLTVVWLLASVVTVLEDSYGYEAMMKSKELIKGKMGLSVMIVLKLNFLFFLTQ  239

Query  496   LIFKRFVVNGWD-FHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDK  320
              +F   VVNGW  F LG V R   G++C L+L  L +  LV QTV+YFVCKSY  E +DK
Sbjct  240   FLFSMVVVNGWKVFGLGSVDRTVFGIVCFLLLSHLFLLMLVIQTVMYFVCKSYHREIVDK  299

Query  319   SALSDHLEVYLGEYVPLKSKDVQLE  245
             SALS HLEVY   Y PLK+KDVQL+
Sbjct  300   SALSYHLEVY-ECYEPLKAKDVQLD  323



>ref|XP_010027648.1| PREDICTED: uncharacterized protein LOC104418115 [Eucalyptus grandis]
Length=336

 Score =   231 bits (590),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 233/338 (69%), Gaps = 5/338 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDR+Q E+QFLG   +Y ES K+I + RKIF+QI L+L+LPL ++FLA   VSQL+ S +
Sbjct  1     MDRDQHELQFLGFPGVYRESSKIILKWRKIFAQITLALILPLCVVFLAHSLVSQLLTSRI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E+       GS  Y+ LS  L  ++ A  L    YF  + +FSLLSTSAVVYTVAC+
Sbjct  61    VDHENDQNYVSEGSQSYRDLSHVLKKEWVAFWLTMLGYFIFVFIFSLLSTSAVVYTVACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y A+ ++FKK++SVVP+VWKRLMVTFL TF+ F  +  +A +  + W+ +  +F V +++
Sbjct  121   YAAKQITFKKIMSVVPRVWKRLMVTFLWTFVTFVAFLVVAVALLIGWVVIVSAFLVGSEL  180

Query  697   P---LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
                 L + + +Y V F+Y+++IWQLA+ +SVLED YG KAM KS++L++GKM + V  FL
Sbjct  181   AIAMLVILLILYVVVFVYLTMIWQLASVISVLEDVYGRKAMMKSRRLIKGKMGMSVGCFL  240

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              +     LV  +F+  VV   D   G+  ++  GL+CLL+L  +V+F LV QTVIYFVCK
Sbjct  241   GVMLWSALVEALFECLVVL--DLVQGIGIKIAGGLICLLLLLMVVLFDLVVQTVIYFVCK  298

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY HENIDKS+LS+HLEVYLG+YVPLK+  VQLEQ  V
Sbjct  299   SYHHENIDKSSLSEHLEVYLGDYVPLKANSVQLEQLHV  336



>ref|XP_010089323.1| hypothetical protein L484_021855 [Morus notabilis]
 gb|EXB37648.1| hypothetical protein L484_021855 [Morus notabilis]
Length=327

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 239/333 (72%), Gaps = 11/333 (3%)
 Frame = -3

Query  1216  MQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNLRHTESQL  1037
             MQFLG   I  ESYK I  CR++ SQI L L+LPLA++ L   EVS ++ + + + E  L
Sbjct  1     MQFLGPIGILEESYKTIMSCRRVLSQITLFLILPLALLILIHIEVSDVVLNKIVNNEVDL  60

Query  1036  ENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacvytARDLS  857
              ++Q GSP+Y +LSD ++S++  L+LFK AYFT LL+FSLLSTSAVVYT+ACVYTARD+S
Sbjct  61    SDAQVGSPKYDKLSDLVSSEWTFLILFKLAYFTFLLIFSLLSTSAVVYTIACVYTARDVS  120

Query  856   FKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADIPLWVG-V  680
             FKKV+SVVPKVWKRLMVTFL T L FFVYN +A     I++F+A+ F         +G +
Sbjct  121   FKKVMSVVPKVWKRLMVTFLWTILAFFVYNVVAT----IFLFVAVLFIFSISYKAGLGFI  176

Query  679   AV----YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFA  512
             AV    Y VGF+Y+S++WQ A+ VSVLE++ G +AM+KS+ LL+GK+   +  +  L   
Sbjct  177   AVFSVLYVVGFVYLSLVWQSASVVSVLEEARGIQAMNKSRALLKGKVWTAIFVYGILTLL  236

Query  511   LFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHE  332
              F +   F++ VV G  F    + RV  G++CLLV  KL++  LV QTV+YFVCKSY HE
Sbjct  237   SFGLQYAFQKLVVYGGRFG--NLERVFYGMICLLVSVKLILSALVIQTVLYFVCKSYHHE  294

Query  331   NIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             NIDKSALSDHLEVYLGEYVPL +KDVQLEQY V
Sbjct  295   NIDKSALSDHLEVYLGEYVPLTAKDVQLEQYHV  327



>ref|XP_010921707.1| PREDICTED: uncharacterized protein LOC105045215 [Elaeis guineensis]
Length=334

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 170/335 (51%), Positives = 229/335 (68%), Gaps = 1/335 (0%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDRE EE+QFLG   IY E+ K++   R++FSQI L+LVLPL+ +F     VS L+FS +
Sbjct  1     MDREPEELQFLGPVGIYHEASKIVLSWRRLFSQITLALVLPLSTLFFVHIYVSHLLFSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L+++  GSP    +   LTS++   LLFK AY   LLV SLLSTSAVVY+VA +
Sbjct  61    DRNEVALDDAPTGSPSESAILSRLTSEWYGFLLFKAAYLLALLVLSLLSTSAVVYSVASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA+DLSF KV+SVVPKVW+RLMVTF+  FL+   YN +A    V+ + L L       +
Sbjct  121   YTAKDLSFPKVLSVVPKVWRRLMVTFICAFLLLLAYNTVAIFVIVLAVLL-LGPATLGAV  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              + +   +Y  G +++S+IW +A+ VSVLED+ G +AM KS+ L++GK    V  F+ L+
Sbjct  180   AVALIFLLYAAGLVWISVIWHVASVVSVLEDTCGIEAMRKSRVLIKGKTWTAVAIFVLLN  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                  V + FK  VV+G   +LG+V RVG  +L L +L  +++F LV QTV+YFVCKSY 
Sbjct  240   LCFVGVEVGFKLLVVDGSYMNLGVVLRVGYAVLMLSILCMVILFALVAQTVVYFVCKSYH  299

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HE+IDKS+L+DHLEVYLGEYVPLK+KDVQLEQ+ V
Sbjct  300   HESIDKSSLADHLEVYLGEYVPLKAKDVQLEQFHV  334



>ref|XP_010041179.1| PREDICTED: uncharacterized protein LOC104430114 [Eucalyptus grandis]
Length=336

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 235/338 (70%), Gaps = 5/338 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+R+Q E+QFLG   +Y ES K+I + RKIF+QI L+L+LPL ++FL+   VS L+ S +
Sbjct  1     MERDQHELQFLGFLGVYRESSKIILKWRKIFAQITLALILPLCVVFLSHSLVSHLLTSRI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E   +++  GS  Y+ LS  L  ++ A  L K  YF  + +FSLLSTSAVVYTVAC+
Sbjct  61    VDHEYDRDDASEGSQSYRDLSHVLKKEWVAFWLTKLGYFIFVFIFSLLSTSAVVYTVACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y A+ ++FKK++SVVP+VWKRLMVTFL TF+ F  +  +A +  + W+ +  +F V + +
Sbjct  121   YAAKQITFKKIMSVVPRVWKRLMVTFLWTFVTFVAFFVVAVALLIGWVAIVRAFLVGSGL  180

Query  697   P---LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
                 L + + +Y V F+Y+++IWQLA+ +SVLED YG KAM KS++L++GKM + V  FL
Sbjct  181   AIAMLVILLILYVVVFVYLTMIWQLASVISVLEDVYGRKAMVKSRRLIKGKMGMSVGCFL  240

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              +     LV  +F+  VV   D   G+  R+ VGL+CLL+L  +V+F LV QTVIYFVCK
Sbjct  241   GVLLWSALVEALFECLVVL--DLVQGIGIRIAVGLICLLLLQMMVLFDLVVQTVIYFVCK  298

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY HENIDKS+LS+HLEVYLG+YVPLK+  VQLEQ  V
Sbjct  299   SYHHENIDKSSLSEHLEVYLGDYVPLKANSVQLEQLHV  336



>emb|CBI19944.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 165/346 (48%), Positives = 225/346 (65%), Gaps = 7/346 (2%)
 Frame = -3

Query  1261  PASILLDAMDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEV  1082
             P  IL   M+ E EEM+ LG+  IY E+YK+I+  RKIF+QI L+ +LPL+ IFLA  EV
Sbjct  13    PMKILKHIMEVEPEEMKCLGVVGIYREAYKIIFSWRKIFTQITLAFILPLSFIFLAHIEV  72

Query  1081  SQLIFSNLRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsa  902
             S  + +N+   E+ L  +Q G+ +Y +++  L S+   L LFK AY    L+FSLLSTSA
Sbjct  73    SDYLLANIIDNENNLVETQIGTLKYNKIAHLLFSELVTLCLFKAAYLLFTLIFSLLSTSA  132

Query  901   vvytvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWI-FLA  725
             VVYT+AC+YT + ++F KV++VVPKVWKRL++TFL+   VFF Y+ +AA   + WI F+A
Sbjct  133   VVYTIACIYTGQKVTFTKVLTVVPKVWKRLILTFLTILAVFFAYHIVAALFLISWIAFMA  192

Query  724   LSFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVL  545
              S   F  + L   V  Y VG +YMSI+WQLANTVSVLEDSYG +AM KS++L++GK+ +
Sbjct  193   PSNTGF--LILLFLVIFYLVGLVYMSIVWQLANTVSVLEDSYGIEAMKKSRELIKGKVGV  250

Query  544   GVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTV  365
              V  F KL F   ++   F+R VV+G    +       +  + L V+  L    L   T+
Sbjct  251   AVFIFFKLGFFNIIIQAAFQRLVVHGESLDMINRAEYAIICVLLHVMLVLFGHAL--HTI  308

Query  364   IYFVCKSYQHENIDKSALSDHLEVYLG--EYVPLKSKDVQLEQYQV  233
             IY VCKSY +ENIDK ALSDHLE Y    ++VPLK +DV+  Q  V
Sbjct  309   IYLVCKSYHNENIDKLALSDHLEAYSDHQDHVPLKGEDVKPGQLLV  354



>ref|XP_010030341.1| PREDICTED: uncharacterized protein LOC104420146 [Eucalyptus grandis]
Length=336

 Score =   224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 234/338 (69%), Gaps = 5/338 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+R+Q E+QFLG   +Y ES K+I + RKIF+QI L+L+LPL ++FL+   VS L+ S +
Sbjct  1     MERDQHELQFLGFLGVYRESSKIILKWRKIFAQITLALILPLCVVFLSHSLVSHLLTSRI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E   + +  GS  Y+ LS  L  ++ A  L K  YF  + +FSLLSTSAVVYTVAC+
Sbjct  61    VDHEYDRDYASEGSQSYRDLSHVLKKEWVAFWLTKLGYFIFVFIFSLLSTSAVVYTVACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y A+ ++FKK++SVVP+VWKRLMVTFL TF+ F  +  +A +  + W+ +  +F V + +
Sbjct  121   YAAKQITFKKIMSVVPRVWKRLMVTFLWTFVTFVAFFVVAVALLIGWVAIVRAFLVGSGL  180

Query  697   P---LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
                 L + + +Y V F+Y+++IWQLA+ +SVLED YG KAM KS++L++GKM + V  FL
Sbjct  181   AIAMLVILLILYVVVFVYLTMIWQLASVISVLEDVYGRKAMVKSRRLIKGKMGMSVGCFL  240

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              +     LV  +F+  VV   D   G+  R+ VGL+CLL+L  +V+F LV QTVIYFVCK
Sbjct  241   GVLLWSALVEALFECLVVL--DLVQGIGIRIAVGLICLLLLQMMVLFDLVVQTVIYFVCK  298

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY HENIDKS+LS+HLEVYLG+YVPLK+  VQLEQ  V
Sbjct  299   SYHHENIDKSSLSEHLEVYLGDYVPLKANSVQLEQLHV  336



>ref|XP_002278755.1| PREDICTED: uncharacterized protein LOC100245483 [Vitis vinifera]
Length=334

 Score =   223 bits (568),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 161/335 (48%), Positives = 221/335 (66%), Gaps = 7/335 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ E EEM+ LG+  IY E+YK+I+  RKIF+QI L+ +LPL+ IFLA  EVS  + +N+
Sbjct  1     MEVEPEEMKCLGVVGIYREAYKIIFSWRKIFTQITLAFILPLSFIFLAHIEVSDYLLANI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E+ L  +Q G+ +Y +++  L S+   L LFK AY    L+FSLLSTSAVVYT+AC+
Sbjct  61    IDNENNLVETQIGTLKYNKIAHLLFSELVTLCLFKAAYLLFTLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWI-FLALSFRVFAD  701
             YT + ++F KV++VVPKVWKRL++TFL+   VFF Y+ +AA   + WI F+A S   F  
Sbjct  121   YTGQKVTFTKVLTVVPKVWKRLILTFLTILAVFFAYHIVAALFLISWIAFMAPSNTGF--  178

Query  700   IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
             + L   V  Y VG +YMSI+WQLANTVSVLEDSYG +AM KS++L++GK+ + V  F KL
Sbjct  179   LILLFLVIFYLVGLVYMSIVWQLANTVSVLEDSYGIEAMKKSRELIKGKVGVAVFIFFKL  238

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
              F   ++   F+R VV+G    +       +  + L V+  L    L   T+IY VCKSY
Sbjct  239   GFFNIIIQAAFQRLVVHGESLDMINRAEYAIICVLLHVMLVLFGHAL--HTIIYLVCKSY  296

Query  340   QHENIDKSALSDHLEVYLG--EYVPLKSKDVQLEQ  242
              +ENIDK ALSDHLE Y    ++VPLK +DV+  Q
Sbjct  297   HNENIDKLALSDHLEAYSDHQDHVPLKGEDVKPGQ  331



>gb|EYU24100.1| hypothetical protein MIMGU_mgv1a024728mg [Erythranthe guttata]
Length=333

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 157/341 (46%), Positives = 225/341 (66%), Gaps = 16/341 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD+EQ+E+QFLG F I  ES  ++   RKIF+QI + L+LPL+ I+LA  ++S++IF+ +
Sbjct  1     MDKEQDEIQFLGFFGILKESCTIVSSWRKIFTQITIFLILPLSFIYLAHIQISKIIFTQI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E  L N   GS  Y ++ + LT+++    LFK  Y    ++ SLLSTSAVVYT+AC+
Sbjct  61    DHNEFMLLNFSKGSKSYNKIDNTLTTEWMTFWLFKIGYLLFFVILSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSF-RVFAD  701
             YTA++ +  KV+SVVPKVWKRLM+TF   F+  FVYNFL      I I  ++ F + F  
Sbjct  121   YTAKETTLNKVLSVVPKVWKRLMITFTWNFVFVFVYNFLC-----ILILFSIMFSKGFEH  175

Query  700   IPLWVGVAV-------YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLG  542
             +    G A        Y +G LY+++IW LA+ VSVLE+SYG  AM KS+ L++GKM + 
Sbjct  176   MGYVSGTAFLLVLSIPYFMGLLYITVIWHLASVVSVLEESYGLNAMRKSQGLIKGKMGIS  235

Query  541   VVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVI  362
                F+ L  + F +  +FK  VV G   H G+  R+  G++CL++L   ++F L+ +T++
Sbjct  236   AAVFVVLGLSFFGIQHMFKIHVVFG---HEGIGKRIVYGIICLVLLSISMLFQLIMETIV  292

Query  361   YFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQY  239
             YFVCKSY HENIDKS+L+DHL  YLGEY PL+ KD+Q E++
Sbjct  293   YFVCKSYHHENIDKSSLADHLGGYLGEYTPLQHKDIQFEEF  333



>ref|XP_010030352.1| PREDICTED: uncharacterized protein LOC104420156 [Eucalyptus grandis]
Length=336

 Score =   221 bits (562),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 168/339 (50%), Positives = 228/339 (67%), Gaps = 7/339 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDR+Q E+QFLG   IY E+ K+I + RKIF+QI L+L+LP  +IFLA   VSQL+   +
Sbjct  1     MDRDQNELQFLGFLGIYRETSKIILKWRKIFAQITLALILPFCVIFLAHSLVSQLLSFKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E    ++    P Y+ LS  L  ++ A  L +  YF  + +FSLLST+AVVYTVACV
Sbjct  61    LDHEITRSDTWKDDPEYRDLSRTLKKEWVAFWLVRVGYFIFIFIFSLLSTAAVVYTVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
               A+ +SFK+++S++P+VWKRLMVTF   F +F VYN +A    ++W+ +   F V   +
Sbjct  121   RAAKQISFKEIMSILPRVWKRLMVTFFWCFALFLVYNVVAVGLLIVWLVVVRQFSVGPAL  180

Query  697   PLWVGV---AVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              + V V    +Y VGF+Y+++IWQLA+ +SVLED+YG KAM+KSK+L++GK+ L V  FL
Sbjct  181   GIAVAVILLILYIVGFVYITMIWQLASVISVLEDAYGRKAMAKSKRLIKGKIGLSVWCFL  240

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              +     +V  +F+ FVV   DF + +  R+GVGL+CLL+L  LV+F LV QTVIYFVCK
Sbjct  241   GVLVCSVMVQALFEFFVVL--DF-VPIGIRIGVGLICLLLLSMLVLFDLVVQTVIYFVCK  297

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKS-KDVQLEQYQV  233
             SY HENID S LSDHLE  LG   P +  K VQLEQ QV
Sbjct  298   SYHHENIDGSCLSDHLEGCLGGDCPSEGQKAVQLEQLQV  336



>ref|XP_006386332.1| hypothetical protein POPTR_0002s07480g [Populus trichocarpa]
 gb|ERP64129.1| hypothetical protein POPTR_0002s07480g [Populus trichocarpa]
Length=339

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 243/339 (72%), Gaps = 10/339 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+REQEEMQFLG+F IY E+YK+I+  RKIFSQI L+L+LPL++I LAQ EVS ++   +
Sbjct  1     MEREQEEMQFLGVFGIYKEAYKIIFSWRKIFSQITLALILPLSLISLAQIEVSNVLSGKV  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              + +++L  ++ G+ RY +LS H++S+ A   LF+ AY    L+FSLLST+AVVYT+A +
Sbjct  61    INNKAELLGTEAGTKRYNKLSHHISSELAYFWLFEVAYLILSLIFSLLSTAAVVYTIASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLA--ASAFVI----WIFLALSF  716
             YT R++SFKKV+SVVPKVWKRLMVTFLS F+ FF Y+ +A   S+ V+    ++F+   +
Sbjct  121   YTDREVSFKKVMSVVPKVWKRLMVTFLSIFVAFFAYSVVAILVSSLVLIIASFVFIGFPY  180

Query  715   -RVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
              +VF    + V + +Y +G +YM+I+WQLA+ VSVLE++ GFKAM+KS+ L++GKM    
Sbjct  181   LKVFYSFGI-VLLVLYFMGVVYMTIVWQLASAVSVLEEACGFKAMTKSRALIKGKMWTAR  239

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             + F  L+ +  ++ + F+  VV+G   +     RV  G++CL +   L +FGLV QTVIY
Sbjct  240   IIFFMLYLSYGVICMAFQNLVVHGVSMN--TATRVLFGVICLPLFLGLFLFGLVIQTVIY  297

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             FVCKS  HE I+KSALSDHL+VY  E VPL SKDVQ EQ
Sbjct  298   FVCKSNHHEKIEKSALSDHLDVYHEENVPLNSKDVQFEQ  336



>ref|XP_002278720.1| PREDICTED: uncharacterized protein LOC100255793 [Vitis vinifera]
Length=334

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 217/338 (64%), Gaps = 7/338 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ E EEM+ LG+  IY E+YK+I+  RKIF+ I L+ +LPL+ IFLA  EVS  + +N+
Sbjct  1     MEVEPEEMKCLGVVGIYREAYKIIFSWRKIFTHITLAFILPLSFIFLAHIEVSDYLLANI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E+ L  +Q G+ +Y ++S  L S +A L LFK AY    L+FSLLSTSA+VYT+AC+
Sbjct  61    IDNENNLVETQIGTLKYNKISHLLFSKYATLCLFKAAYLLFTLIFSLLSTSAMVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWI-FLALSFRVFAD  701
             Y+ + ++F KV++VVPKVWKRL++TFL+   V FVY+ +AA   + WI F+A +   F  
Sbjct  121   YSGQKVTFTKVLTVVPKVWKRLILTFLTILAVVFVYHIIAALFLISWIAFMAPTNTGF--  178

Query  700   IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
             + L+  V  Y VG +YMSI+WQLANT+SVLEDSYG +AM +S +L++GK  + V  F KL
Sbjct  179   LILFFLVVFYLVGLVYMSIVWQLANTISVLEDSYGIEAMKRSSELIKGKTGVTVFIFFKL  238

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
              F+  ++   F+R VV+G    +       +      V   L    L   T+IY VCKSY
Sbjct  239   GFSYIIIQAAFQRLVVHGESLDMINRAVYAIICFLFHVKLVLFGHAL--HTIIYLVCKSY  296

Query  340   QHENIDKSALSDHLEVYLG--EYVPLKSKDVQLEQYQV  233
              +ENI K ALSDHLE Y    +Y PLK +DV+  Q  V
Sbjct  297   HNENIYKLALSDHLEAYSDHQDYAPLKGEDVKPGQLSV  334



>gb|ACU21517.1| unknown [Glycine max]
Length=303

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 148/306 (48%), Positives = 207/306 (68%), Gaps = 4/306 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD EQEEMQF+GL+ +Y ESYK+I+   K+F++I L+L+LPL+ IFL   EVS ++F  +
Sbjct  1     MDTEQEEMQFMGLYGVYRESYKIIFAWSKVFNKITLTLILPLSFIFLIHIEVSNILFGKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H   Q+  +   +P+Y  L++ L+S++A  +LFK  YFT LLVFSLLSTSA VYTVA +
Sbjct  61    LHNTQQMMETPQDTPQYHNLTNMLSSEWAIFILFKLLYFTFLLVFSLLSTSAAVYTVASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT+R+++F KV++VVPKVWKRLMVTFL TF+ FF YN +    FVIW  LA+  R    +
Sbjct  121   YTSREVTFSKVMNVVPKVWKRLMVTFLCTFVAFFAYNVMTLVVFVIWA-LAIGLRNGGVV  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVL-EDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
              L V   +Y  GF+Y++++WQLA+ V+VL ED+ G +AM K+ +L++G++ L V+ FLKL
Sbjct  180   VLVVLGMLYFAGFVYLTVVWQLASVVTVLEEDTCGVRAMMKTNELIKGRIGLTVLIFLKL  239

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
               +  L+  +FK+ VV GW          GV  L L     L    +  QTV+YFVCKSY
Sbjct  240   VISFGLIQFLFKKTVVQGWKLGSVDRTIYGVVCLVLFSQLYLFQLVI--QTVLYFVCKSY  297

Query  340   QHENID  323
              H+NID
Sbjct  298   HHQNID  303



>gb|EYU23744.1| hypothetical protein MIMGU_mgv1a019112mg [Erythranthe guttata]
Length=325

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 167/337 (50%), Positives = 234/337 (69%), Gaps = 14/337 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+RE+EE+QFLG F I  ESY ++   + IF++I L L+LPL+ I+LA  ++S+L+FS +
Sbjct  1     MNREEEEIQFLGFFGIIQESYDIVSSWKIIFTKITLFLILPLSFIYLAHIQISELLFSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                   L+ +   +  ++++SD L S++ A  LFK  YF   ++ SLLSTSAVVYTVAC+
Sbjct  61    -----MLDETPQRTGSHKKISDVLCSEWTAFFLFKIGYFIFFVILSLLSTSAVVYTVACI  115

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA+ ++ KKV++VVPKV KRL+VTF+ +F++F  YN    S  V+ I   +SF     +
Sbjct  116   YTAKRITLKKVMTVVPKVCKRLVVTFVWSFIIFSAYN--VVSILVLLILGPVSFS--GPL  171

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L +    Y +GF Y+++IW LA+ VSVLE+SYG  AM++S  L++GKM  GV F L   
Sbjct  172   FLTLYAVSYLIGFFYITVIWHLASVVSVLEESYGLNAMARSHALIKGKM--GVCFALFFV  229

Query  517   FALFLVN--LIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
               LF +   LIFK +VV G +   G+  RVG+G+LCL++    ++FGL+ QT+IYFVCKS
Sbjct  230   MGLFFIEIQLIFKVYVVVGTN-EEGIGRRVGIGILCLVLSSITMLFGLIMQTIIYFVCKS  288

Query  343   YQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             Y HENIDKS+L+DHL  YLGEYVPLKSKDVQLE +QV
Sbjct  289   YHHENIDKSSLADHLGGYLGEYVPLKSKDVQLEHFQV  325



>ref|XP_008810898.1| PREDICTED: uncharacterized protein LOC103722200 [Phoenix dactylifera]
Length=334

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 165/335 (49%), Positives = 232/335 (69%), Gaps = 1/335 (0%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDRE EE+QFLG+  I  E+ K+++  +++F+QIAL+LVLPL+++FLA   VS L+FS +
Sbjct  1     MDREPEELQFLGIVGICHEASKILHSWQRLFAQIALALVLPLSVLFLAHIYVSHLLFSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               +E  L+ + PGSP    +   L+++++A LLFK AY   LLV SLLSTSAVVY+VA +
Sbjct  61    DRSEVALDVATPGSPSESAILSRLSAEWSAFLLFKAAYLLALLVLSLLSTSAVVYSVASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA+DLSF KV++VVPKVW+RLM+TFL  FL+   YN  A    V+   L L       +
Sbjct  121   YTAKDLSFAKVLAVVPKVWRRLMITFLWAFLLLVAYNTAALILAVL-AVLLLGPHTAGLV  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              + +   VY  G +++S++W +A+ VSVLED+ G +AM KS+ L+RGK    V  F+ L+
Sbjct  180   AIALIALVYAAGLVWISVVWHVASVVSVLEDACGIEAMRKSRALIRGKTWTAVAIFVVLN  239

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                  V + F+  VV G   +LG+  RVG  +L L  L  +++F LV QTV+YFVCKSY 
Sbjct  240   LCFVGVEVGFRLAVVRGNYLNLGVGSRVGYSVLMLSFLCAVILFALVAQTVVYFVCKSYH  299

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HE+IDKS+L+DHLEVYLG+Y+PLK++DVQLEQ+ V
Sbjct  300   HESIDKSSLADHLEVYLGDYMPLKARDVQLEQFHV  334



>emb|CAN61489.1| hypothetical protein VITISV_042682 [Vitis vinifera]
Length=334

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 155/338 (46%), Positives = 213/338 (63%), Gaps = 7/338 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ E EEM+ LG+  IY E+YK I+  RKIF+ I L+ +LPL+ IFLA  EVS  + +N+
Sbjct  1     MEVEPEEMKXLGVVGIYREAYKXIFSWRKIFTHITLAFILPLSFIFLAHIEVSDYLLANI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E+ L  +Q G+ +Y ++S  L S +A L LFK AY    L+FSLLSTSA VYT+AC+
Sbjct  61    IDNENNLVETQIGTLKYNKISHLLFSKYAXLCLFKAAYLLFTLIFSLLSTSAXVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWI-FLALSFRVFAD  701
             Y  + ++F KV++VVPKVWKRL++TFL+   V FVY+ +AA   + WI F+  +   F  
Sbjct  121   YXGQKVTFTKVLTVVPKVWKRLILTFLTILAVVFVYHIIAALFLISWIAFMXPTNTGF--  178

Query  700   IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
             + L+  V  Y VG +YMSI+WQLANT+SVLEDSYG +AM +S +L++GK  + V  F KL
Sbjct  179   LILFFLVVFYLVGLVYMSIVWQLANTISVLEDSYGIEAMKRSSELIKGKTGVTVFIFFKL  238

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
              F+  ++   F+R VV+G    +       +      V   L    L   T+IY VCKSY
Sbjct  239   GFSYIIIQAAFQRLVVHGESLDMINRAVYAIICFLFHVKLVLFGHAL--HTIIYLVCKSY  296

Query  340   QHENIDKSALSDHLEVYLG--EYVPLKSKDVQLEQYQV  233
              +ENI K ALSDHLE Y    +Y PLK +DV+  Q  V
Sbjct  297   HNENIYKLALSDHLEAYSDHQDYAPLKGEDVKPGQLSV  334



>gb|EYU23845.1| hypothetical protein MIMGU_mgv1a009636mg [Erythranthe guttata]
Length=336

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 236/340 (69%), Gaps = 9/340 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD +Q+ M+FLGL  +Y ES K+I+R RK+FS I L+L+LPL I+FLA++ VS++++  +
Sbjct  1     MDMDQDNMRFLGLIGVYKESCKLIFRWRKLFSLITLTLILPLLIVFLAEEPVSEILYDKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             R  E  L +S  G+P Y +LSD +++++   +L K  YF  +LVFSLL+TSAVVYTVA  
Sbjct  61    RFNEFMLMDSAAGTPSYHKLSDLVSAEWTEFILLKAFYFAFVLVFSLLATSAVVYTVASA  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALS-FRVFAD  701
             YTA++++F+KVI VVP+VW+RL +TFL  F  FF YN +  +A   W   ++S       
Sbjct  121   YTAKEVTFRKVIGVVPRVWRRLALTFLCIFFAFFAYNAVFGAAVYWWTHTSMSDSTAATV  180

Query  700   IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
             +   V +A Y VGF+YM+I+WQLA+ VSVLED+ G KAM KS  L++GK+V+ VV F+KL
Sbjct  181   VFFVVVIAAYVVGFVYMTIVWQLASVVSVLEDTCGVKAMVKSADLIKGKLVVAVVVFVKL  240

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
               A+  + ++F    +N       +  ++G G LCL+ L  +V+FGLV QTVIYFVCKSY
Sbjct  241   LAAVVGLYIVFVVVCLN----MPVVAKKIGFGGLCLVALVAVVLFGLVVQTVIYFVCKSY  296

Query  340   QHENIDKSALSDHLEVYLGEYVPLKS----KDVQLEQYQV  233
               +NIDKSALSDHLE Y G YV LK+    KDVQLE+Y+V
Sbjct  297   HRQNIDKSALSDHLEAYSGGYVRLKASPAEKDVQLEEYRV  336



>ref|XP_006386334.1| hypothetical protein POPTR_0002s07500g [Populus trichocarpa]
 gb|ERP64131.1| hypothetical protein POPTR_0002s07500g [Populus trichocarpa]
Length=290

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 157/335 (47%), Positives = 209/335 (62%), Gaps = 45/335 (13%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+REQEEMQFLG+F IY E+YK+I+  RKIFSQI L+L+LPL+ I LA       IF+N 
Sbjct  1     MEREQEEMQFLGVFGIYKEAYKIIFSWRKIFSQITLALILPLSFILLAH------IFNN-  53

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                + +L  ++ G+ RY +LS  ++S+ A   LF+ AY     +FSLLST+AVVYT+A +
Sbjct  54    ---QVELLGTEAGTKRYNKLSHRISSELAYFWLFEVAYLILSHIFSLLSTAAVVYTIASI  110

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT R++SFKKV+SVVPKVWKRLMVTFLS F+ FF YN                       
Sbjct  111   YTDREVSFKKVMSVVPKVWKRLMVTFLSIFVAFFAYN-----------------------  147

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
                       V  L  S+++ +A  V+VLE++ GFKAM+KS+ L++GKM   ++ F KL 
Sbjct  148   ---------AVAILVFSLVF-IACAVTVLEEACGFKAMTKSRALIKGKMWTTIIIFFKLK  197

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              +  +++  F+  VV+G   +       GV  L L +   L    +  QTVIYFVCKS  
Sbjct  198   LSFAVIHKAFQNLVVHGVSMNTATRVLYGVICLSLFLGLFLFELVI--QTVIYFVCKSNH  255

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HE I+K ALSDHL+VY GEYVPL SKDVQLEQ+ V
Sbjct  256   HEKIEKLALSDHLDVYHGEYVPLNSKDVQLEQHYV  290



>ref|XP_010911549.1| PREDICTED: uncharacterized protein LOC105037605 [Elaeis guineensis]
Length=334

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 237/339 (70%), Gaps = 9/339 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDRE EE+QFLGL  IY E+YK++   R++F+QIAL+LVLPL+++FLA   VS L+FS +
Sbjct  1     MDREPEELQFLGLVGIYHEAYKILLSWRRLFAQIALALVLPLSLLFLAHIYVSHLLFSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               +E+ L+ + PGSP    +   L+++++A +LFK AY   LLV SLLSTSAVVY+VA +
Sbjct  61    DRSEAALDVAPPGSPSQSAILSRLSAEWSAFILFKAAYLLALLVLSLLSTSAVVYSVASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA+DLSF KV++VVPKVW+RLM+TFL  FL+   YN   A+ FV    + L F    DI
Sbjct  121   YTAKDLSFAKVLAVVPKVWRRLMITFLWAFLLLVAYN--TATLFVA---ILLVFIFGPDI  175

Query  697   PLWVGVA----VYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
             P  V +A    +Y  G +++S++W +A+ VSVLED+ G +AM KS+ L+RGK    V  F
Sbjct  176   PGAVAIALVAVLYAAGLVWISVVWHVASVVSVLEDACGIEAMRKSRALIRGKTWTAVAIF  235

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
             + L+       L F+R VV G  F LG+  RVG  ++ L  L  +++F LV QT++YFVC
Sbjct  236   VMLNLCFVGAELGFRRQVVWGDYFGLGVGSRVGYAVVWLSFLCLVILFALVAQTLVYFVC  295

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             KSY HE+IDKS+L+DHLEVYLG+YVPLK++DVQL Q  V
Sbjct  296   KSYHHESIDKSSLADHLEVYLGDYVPLKAEDVQLGQLHV  334



>ref|XP_008813041.1| PREDICTED: uncharacterized protein LOC103723786 [Phoenix dactylifera]
Length=328

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 172/335 (51%), Positives = 229/335 (68%), Gaps = 7/335 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD E EE+QFLG   IY E+ K++   R++FSQIA +LVLPL+I++LA   V+ L+FS +
Sbjct  1     MDLEPEELQFLGPVGIYHEASKIVLSWRRLFSQIAFALVLPLSILYLAHIYVTHLLFSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L ++ PGSP    +   L+S+++A LLFK  Y   LLV SLLSTSAVVY+VA +
Sbjct  61    DRNEDALNDAPPGSPSQSAILSRLSSEWSAFLLFKAGYLLALLVLSLLSTSAVVYSVASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA++LSF KV+SVVPKVW+RLMVTFL  FL+ F YN   A+ FV  I LA+ F   A  
Sbjct  121   YTAKELSFSKVLSVVPKVWRRLMVTFLWAFLLLFTYNI--AAVFV--IVLAVLFLGPAAA  176

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L +  A   V   ++S++W +A+ +SVLED+ G +AM KS  L++GK    +  F+ L+
Sbjct  177   LLLLLYAAGLV---WISVVWHVASVISVLEDACGIEAMRKSLILIKGKTWTAIAIFVLLY  233

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
              +   V L FK  VV G   +LG+  RVG  +L L  L  +++F LV QTV+YFVCKSY 
Sbjct  234   VSYLGVELGFKFLVVEGSYKNLGVGFRVGSAVLMLSFLCLVLLFALVAQTVVYFVCKSYH  293

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HE+IDKS+L+DHLEVYLGEYVPLK +DVQLEQ+ V
Sbjct  294   HESIDKSSLADHLEVYLGEYVPLKPRDVQLEQFHV  328



>ref|XP_010030350.1| PREDICTED: uncharacterized protein LOC104420154 [Eucalyptus grandis]
Length=335

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 219/338 (65%), Gaps = 6/338 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDR+  E+QFLG   +Y E  ++I + RKIF+QI L+L+LPL IIFLA   VSQL+  N+
Sbjct  1     MDRDLNELQFLGFLGVYREVSEIIVKWRKIFAQITLTLILPLCIIFLAHSLVSQLLSFNI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E    + +     Y+ LS  L +++ A    +  YF  + +FSLLST+AVVYTVACV
Sbjct  61    LDHEITQNDIREEDTNYRDLSPMLENEWVAFWFGRLGYFVLVFIFSLLSTAAVVYTVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y ++ ++FKK+ISVVP+VWKRLMVTF   F  FF YN +A    ++W+ +   F V   +
Sbjct  121   YASKQITFKKIISVVPRVWKRLMVTFFWCFAFFFGYNNVAVGLLIVWLVMVRQFAVGPAL  180

Query  697   PLWVGVAVY---TVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              + V V +     VG +Y+++IWQ+A+ +SVLED+YG KAM KSK+L++GKM L V  FL
Sbjct  181   GIAVAVILLILSVVGLVYITMIWQMASVISVLEDAYGRKAMVKSKRLVKGKMGLSVWCFL  240

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              +     LV  +F+  V    D  + +  ++G+GL+CL++L  LV+F +V QTVIYFVCK
Sbjct  241   GVLVCSVLVQALFESHVF--LDL-VPIGVKIGIGLICLMLLSMLVLFDMVVQTVIYFVCK  297

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY  ENID S LSDHL+  LG+      K VQLEQ QV
Sbjct  298   SYHGENIDSSCLSDHLDGCLGDGPSEGQKAVQLEQLQV  335



>ref|XP_009360779.1| PREDICTED: uncharacterized protein LOC103951194 [Pyrus x bretschneideri]
Length=292

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/261 (51%), Positives = 193/261 (74%), Gaps = 1/261 (0%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQ+E+QFLG+F IY E+YK+++  RKIFSQI L+L+LPL+I+FLA   +S +I S +
Sbjct  1     MDREQDELQFLGIFGIYKEAYKIVFSRRKIFSQITLALILPLSIVFLAHIALSNIILSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H E  L+ +   +PRY+++SD ++S++A   LF  AYFT +L+FSLLSTSAVVYT+AC+
Sbjct  61    IHNEIVLDGTSTNNPRYEKISDVISSEWATYWLFNAAYFTFVLIFSLLSTSAVVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTAR+++FKKV+SVVPKVWK +MVTFL TF+ FF YN +A    +IW+ L++     + I
Sbjct  121   YTAREITFKKVMSVVPKVWKPVMVTFLCTFMAFFCYNIVALIVLIIWV-LSMGISGASVI  179

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
               ++ + VY +GF Y+++IWQLA+ VSVLE++ G KAM+KSK+LL+G M +  + + KL+
Sbjct  180   IGFLLLIVYFIGFGYLTLIWQLASVVSVLEEARGIKAMAKSKELLKGNMWVATIIYFKLN  239

Query  517   FALFLVNLIFKRFVVNGWDFH  455
                 L+   F++ VV+G  F 
Sbjct  240   VLAALLQFGFQQLVVSGRSFS  260



>gb|EYU18030.1| hypothetical protein MIMGU_mgv1a017782mg [Erythranthe guttata]
Length=335

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 150/341 (44%), Positives = 221/341 (65%), Gaps = 12/341 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD+EQ+E+QFLG F I  ES  +I   RKIF+QI + L+ PL+ I+LA  ++++ +F+++
Sbjct  1     MDKEQDEIQFLGFFGILKESCTIISSWRKIFTQITIFLIFPLSFIYLAHIQITKTLFTSI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDf--aalllfkfAYFTCLLVFSLLstsavvytva  884
              H E  L N   GS  +  + + L+S+        FK  Y     + SLL+TSAVV+T+A
Sbjct  61    IHNEFMLLNVLKGSRSFNEIDNMLSSNSEWVTFFRFKIGYLVVFAIVSLLTTSAVVHTIA  120

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLAL----SF  716
             CVYTA++ +  KV+S+VPKVWKRLM+TF   F+  F YNF+    F++ + L L      
Sbjct  121   CVYTAKETTLNKVLSLVPKVWKRLMITFTWHFVFVFAYNFI----FLVIVILVLLDNGDI  176

Query  715   RVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
              +     L +   VY +G LY+++IW LA+ VSVLEDSYG  AM KS+ L++GK+ +   
Sbjct  177   GIGCMTFLIILFIVYFMGLLYITMIWHLASVVSVLEDSYGLNAMMKSRGLIKGKVGISTA  236

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
              F  L  + F +  +FK FVV G     G+  R+  G++CL++L   ++F L+ +T++YF
Sbjct  237   VFFVLGLSFFGIQHMFKIFVVLGHG--DGIGKRIVYGIICLILLSISILFQLIMETMVYF  294

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY HENIDKS+L+DHL  YL E++PL+ KDVQLEQ++V
Sbjct  295   VCKSYHHENIDKSSLADHLGGYLEEFIPLQFKDVQLEQFEV  335



>ref|XP_002278947.1| PREDICTED: uncharacterized protein LOC100243642 [Vitis vinifera]
Length=338

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 217/345 (63%), Gaps = 18/345 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ +Q+EM+ LG+FDIY E+YK+I   RKIF+QI  +L+LPL+ I LA   +S  +F  +
Sbjct  1     MEVQQQEMKSLGVFDIYREAYKIILSRRKIFTQITFALILPLSFISLAHTILSNTLFPKI  60

Query  1057  R-HTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
                 +  L  +Q  +  Y  + D L S  A+  L + AY     +  LLSTSA+VYT+AC
Sbjct  61    TDQNQKDLAETQVPTSNYANIFDLLPSTSASYWLLQAAYTIFSFILFLLSTSAIVYTMAC  120

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFAD  701
             +Y+ R+++F+ V+SVVPKVWKRLMVTF + FL    Y+ +A      ++ LAL   + A 
Sbjct  121   IYSGREVTFRLVMSVVPKVWKRLMVTFFTIFLALCTYHVVA------FLVLALVAVLIAF  174

Query  700   IP--------LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVL  545
              P        L V V +Y +GFLYMSI+WQLA+T+SVLEDSYGF+AM KS QL+RGK+ +
Sbjct  175   GPNTNVGLVILSVVVVLYLMGFLYMSIVWQLASTISVLEDSYGFQAMKKSNQLIRGKVGM  234

Query  544   GVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTV  365
                 FLKL    ++++   +R V++G    +          L LL L  L    +  QTV
Sbjct  235   ATFIFLKLGLVYYMLHKALERVVLHGEPLGMVNRVAFANVCLSLLSLLSLFERVI--QTV  292

Query  364   IYFVCKSYQHENIDKSALSDHLEVYLGE-YVPLKSKDVQLEQYQV  233
             IYFVCKS+ HENIDK ALSDHL+VY  E Y+PLK  ++QL+Q+ V
Sbjct  293   IYFVCKSHHHENIDKLALSDHLQVYTQEYYIPLKGDNLQLKQFNV  337



>ref|XP_009382943.1| PREDICTED: uncharacterized protein LOC103970755 [Musa acuminata 
subsp. malaccensis]
Length=334

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 157/336 (47%), Positives = 224/336 (67%), Gaps = 3/336 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD E EE+QFLG+  IY E+ K++ R R++F +IA +LVLPL+I+F     +S  +FS +
Sbjct  1     MDCEPEELQFLGVVGIYREAAKILARWRRLFVKIAGALVLPLSILFFVHIAISHRLFSTI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                ES L+++ PGS         L SD++A LLFK  Y   LLV +LLST+AVVY+VA +
Sbjct  61    DSDESALDDAPPGSTSESSALQRLVSDWSAFLLFKGFYLVALLVLALLSTAAVVYSVASI  120

Query  877   ytAR-DLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFAD  701
             YTAR DL+F+KV++VVP+VW+RLMVTFL  FLV    N    +  V  + +  +      
Sbjct  121   YTARGDLAFRKVLTVVPRVWRRLMVTFLWAFLVLLALNSATIALLVFILLMGGNSSTGPV  180

Query  700   IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
             + + V + +Y V  +Y+S++W LA+ VSVLED+ G +AM +S++L++GK++   V F+ L
Sbjct  181   LTILVVIPLYLVALVYVSVVWHLASVVSVLEDARGLEAMRRSRRLIQGKLLTASVIFVML  240

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
             +    LV   F+  +V       G    +G+GLL LL+L  +++F L  QTV+YFVCKSY
Sbjct  241   NLGFGLVEWAFRGLLVR--GRGGGPGLSLGLGLLLLLLLCLVILFALAVQTVVYFVCKSY  298

Query  340   QHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              HE+IDKS L+DHLE YLGEYVPLKS+DVQ+EQ +V
Sbjct  299   HHESIDKSNLADHLEAYLGEYVPLKSQDVQMEQLRV  334



>gb|KEH35395.1| transmembrane protein, putative [Medicago truncatula]
Length=327

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 211/329 (64%), Gaps = 13/329 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M  EQE+MQFLGLF +Y ESYK+++  RK+ SQI L L++PL   FL Q E+S  +   +
Sbjct  1     MAIEQEKMQFLGLFGVYKESYKLMFSWRKLLSQITLILIIPLTFNFLIQIELSDFVLGKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLL---stsavvytv  887
              H  +Q+ N    + + Q L++ +T ++A   L K AYF  +L+FSL    +++ V    
Sbjct  61    LHHSNQMTNHHLDTAQPQNLTEIITKEWAIFFLIKIAYF--ILIFSLYLFSTSAIVYTVA  118

Query  886   acvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSF--R  713
             +     +D++F KV+SV+  + KRLMVTFL T    F YN +A    VI I  AL+F  R
Sbjct  119   SIYTGNKDIAFNKVMSVITNLSKRLMVTFLCTLTAGFFYNIIAM---VIAIIFALTFGVR  175

Query  712   VFADIPLWVGVAV-YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
                 +  ++ + + Y VG +Y++++WQLAN V+VLEDSYGF+AM KSK+L++GKM L + 
Sbjct  176   NGGSVAGFIIIGILYFVGLVYLNVVWQLANVVTVLEDSYGFEAMMKSKELIKGKMGLSIF  235

Query  535   FFLKLHFALFLVNLIFKRFVVNGWD-FHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
               L+ +F  F++  +F   VVNGW  F L ++ R+ +G +C L L  L +  L+ QTV+Y
Sbjct  236   ITLQFNFCFFVIRFLFGMLVVNGWKWFELSLMSRITIGFVCFLFLSHLFLLILIMQTVLY  295

Query  358   FVCKSYQHENIDKSALS-DHLEVYLGEYV  275
             FVCKSYQ+E+IDK + S +H++V+ GEYV
Sbjct  296   FVCKSYQNESIDKCSPSLEHVKVHQGEYV  324



>ref|XP_003573268.1| PREDICTED: uncharacterized protein LOC100828305 [Brachypodium 
distachyon]
Length=337

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 147/337 (44%), Positives = 216/337 (64%), Gaps = 2/337 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ E EE+QFLG   I  ES  ++   R ++ +IA + VLPL+ +FLA   +S  +F+ +
Sbjct  1     MECEPEELQFLGAVGIARESVAILRAHRPLYGRIAAAFVLPLSALFLAHIAISHALFTTI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                ++ L++S PG+    R+   L +D++AL+LFK AY   LL+ SLLST+A V++VA V
Sbjct  61    DSDDTALDSSSPGTASQDRILRRLAADWSALVLFKSAYLLALLLLSLLSTAAAVFSVASV  120

Query  877   ytAR--DLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA  704
             Y+A+   L+F +V+SVVP+VW+RL  TFL+ F +  VYN  A + F+  +    +    A
Sbjct  121   YSAKYDALTFPRVLSVVPRVWRRLAATFLAAFALLAVYNLAAVAVFLALLVATENGSGLA  180

Query  703   DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
              +  +  +A Y  G +Y+ +IW LA+ VSVLED  GF AM KSK L++GK+      F  
Sbjct  181   AVVFFPILAAYVAGLVYLGVIWHLASVVSVLEDYKGFHAMRKSKDLIKGKLRTASAIFFT  240

Query  523   LHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
             L+    +V L F+ +VV G    +G   R+ +GL  L +L  +V+  LV QTV+Y VCKS
Sbjct  241   LNLVFIVVELAFRAWVVQGARHGIGAGARLLLGLALLALLCAVVMVALVVQTVVYLVCKS  300

Query  343   YQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             Y HE+IDKS +SDHLEVYLG+YVPLK+ DVQ+E ++V
Sbjct  301   YHHESIDKSNISDHLEVYLGDYVPLKASDVQMEHFEV  337



>ref|XP_010030348.1| PREDICTED: uncharacterized protein LOC104420152 [Eucalyptus grandis]
Length=335

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 218/338 (64%), Gaps = 6/338 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDR+  E++FLG   +Y E+ ++I + RKIF+QI  +L+LPL IIFLA   VSQL+  N+
Sbjct  1     MDRDLNELRFLGFLGVYRETSEIIVKWRKIFAQITFTLILPLCIIFLAHSLVSQLLSFNI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E    + +     Y+ LS  L +++ A    +  YF  + +FSLLST+AVVYTVACV
Sbjct  61    LDHEITQNDIREEDTNYRDLSPMLENEWVAFWFVRLGYFVLVFIFSLLSTAAVVYTVACV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             + A+ ++FKK++SVVP+VWKRLMVTF   F +FF YN +A    + W+ +   F V   +
Sbjct  121   FAAKQITFKKIMSVVPRVWKRLMVTFFWCFALFFGYNDVAVGLLIAWLVMVRQFAVGPAL  180

Query  697   PLWVGVAVY---TVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              + V V +     VG +Y+++IWQ+A+ +SVLED+YG KAM KSK L++GKM L V  FL
Sbjct  181   GIAVAVILLILSVVGLVYITMIWQMASVISVLEDAYGRKAMVKSKGLIKGKMDLSVWCFL  240

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              +     LV  +F+  V   +D  + +  ++GVGL+CL++L  LV+F LV QTVIYFVCK
Sbjct  241   GVLVYSVLVQALFESLVF--FDL-VPIGVKIGVGLICLMLLSMLVLFDLVVQTVIYFVCK  297

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY  ENID S LSDHLE  L +      K +QLEQ QV
Sbjct  298   SYHRENIDSSCLSDHLEGCLVDCPSEGQKAIQLEQLQV  335



>dbj|BAJ96330.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 152/335 (45%), Positives = 221/335 (66%), Gaps = 2/335 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ E EE+QFLG   IY ES  ++   R ++++IA + VLPL+ +FLA   +S  +FS +
Sbjct  1     MECEPEELQFLGPVGIYRESVAILRAHRPLYARIAAAFVLPLSALFLAHIAISHALFSTI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +S LE+S PG+   QR+   L +D+AAL+LFK AY   LL+FSLLST+A V++VA V
Sbjct  61    DSDDSALESSAPGTASQQRILQRLGADWAALVLFKAAYLLALLLFSLLSTAAAVFSVASV  120

Query  877   ytARD--LSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA  704
             Y+A+   L+F +V+SVVP+VW+RL  TFL+ F + F Y+ +    F+  +    +    A
Sbjct  121   YSAKHDALTFPRVLSVVPRVWRRLAATFLAAFALLFAYHLVFVVVFIALLVATDNGSTLA  180

Query  703   DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
              +  +V    Y VG +Y+S++W LA+ VSVLED  GF+AM KSK L++GK+   V  F+ 
Sbjct  181   GLLAFVVAIAYLVGLVYLSVVWHLASVVSVLEDYKGFQAMRKSKALIQGKLWTVVFIFVT  240

Query  523   LHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
             L+    +V   F+ ++V G    LG  GR+ +GL+ L  L  +V+  LV QTV+Y VCKS
Sbjct  241   LNLVFVVVEFAFRAWIVQGARHGLGAGGRLLLGLVILAALCSVVMVALVVQTVVYLVCKS  300

Query  343   YQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQY  239
             Y HE+IDKS +SDHLEVYLG+YVPLK+ DVQ++ +
Sbjct  301   YHHESIDKSNISDHLEVYLGDYVPLKASDVQMQHF  335



>gb|EYU20214.1| hypothetical protein MIMGU_mgv1a0238521mg, partial [Erythranthe 
guttata]
Length=328

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 209/338 (62%), Gaps = 20/338 (6%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD+EQEE+QFLG F I  ES  +I   RKIF+QI + L+ PL+ I+LA  ++++ +F+ +
Sbjct  1     MDKEQEEIQFLGFFGILKESCTIISSWRKIFTQITIFLIFPLSFIYLAHIQITKTLFTTI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDf--aalllfkfAYFTCLLVFSLLstsavvytva  884
              H E  L N   GS  +  + +  +S+        FK  Y     + SLL+TS VV+T+A
Sbjct  61    IHNEFMLLNVLKGSKSFNEMDNMFSSNSEWVTFFRFKIGYLVFFAIVSLLTTSVVVHTIA  120

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA  704
             C+Y A++ +  KV+S+VPKVWKRLM+TF   F+  F YNFL          L + F +  
Sbjct  121   CIYIAKETTLNKVLSLVPKVWKRLMITFTWHFVFIFAYNFL--------FLLTVIFVLLD  172

Query  703   DIPLWVG--------VAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMV  548
             +  + +G          VY +G LY+++IW LA+ VSVLEDSYG  AM KS+ L++GKM 
Sbjct  173   NGDIGIGRMAFLIVLFIVYFMGLLYITMIWHLASVVSVLEDSYGLSAMMKSRGLIKGKME  232

Query  547   LGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
             +    F  L  + F +  +FK FVV G     G+  R+  G++CL++L   ++F L+ +T
Sbjct  233   ISSAVFFVLGLSFFGIQHMFKIFVVLGHG--DGIGKRIVYGIICLVLLSICILFQLIMET  290

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDV  254
             +IYFVCKSY HENIDKS+L+DHL  YL E++PL+ KDV
Sbjct  291   IIYFVCKSYHHENIDKSSLADHLGGYLEEFIPLQFKDV  328



>ref|XP_010030351.1| PREDICTED: uncharacterized protein LOC104420155 [Eucalyptus grandis]
Length=316

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 159/344 (46%), Positives = 213/344 (62%), Gaps = 37/344 (11%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD +Q E+Q LG   IY E+ K+I + RKIF+QI L+L+LP  +IFLA   VSQL+  + 
Sbjct  1     MDGDQNELQVLGFLGIYRETSKIILKWRKIFAQITLALILPFCVIFLADPFVSQLL--SF  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +         Q G                        YF  L +FSLLST+AVVYTVACV
Sbjct  59    KKEPVAFCLVQVG------------------------YFIFLFIFSLLSTAAVVYTVACV  94

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
               A+ +SFKK++S++P+VWKRLMVTF   F +FFVYN +A    ++W+ +   F V   +
Sbjct  95    RAAKQISFKKIMSILPRVWKRLMVTFFWCFALFFVYNVVAVVLLIVWLVMVRQFSVGPAL  154

Query  697   PLWVGVAV---YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              + V V +   Y VGF+Y+++IWQLA+ +SVLED+YG KAM+KSK L++GKM L V  FL
Sbjct  155   GIAVAVILLILYIVGFVYITMIWQLASVISVLEDAYGRKAMAKSKGLIKGKMGLSVWCFL  214

Query  526   KLHFALFLVNLIFKRFVV-----NGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVI  362
              +     LV  +F+  VV     NG    + +  R+GVGL+CLL++  L +F LV QT+I
Sbjct  215   GVLVCSVLVQALFEFLVVLDLVPNG--IRVPIGIRIGVGLICLLLVTMLGLFDLVVQTMI  272

Query  361   YFVCKSYQHENIDKSALSDHLEVYLGEYVPLKS-KDVQLEQYQV  233
             YFVCKS+ HENID S +SDHLE  LG   P +  K VQLEQ QV
Sbjct  273   YFVCKSHHHENIDGSCVSDHLEGCLGGDCPSEGQKAVQLEQLQV  316



>ref|XP_008352648.1| PREDICTED: uncharacterized protein LOC103416171 [Malus domestica]
Length=268

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 192/270 (71%), Gaps = 9/270 (3%)
 Frame = -3

Query  1039  LENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacvytARDL  860
             L+ +   +PRY+++SD ++S++A   LF  AYFT LL+FSLLSTSA+VYT+AC+YTAR++
Sbjct  3     LDGTSTNNPRYEKMSDVISSEWATYWLFNAAYFTFLLIFSLLSTSAIVYTIACIYTAREI  62

Query  859   SFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADIPLWVG-  683
             +FKKV+SVVPKVWKR+MVTFL TF+ FF YN +A    +IW+   LS  + +D  + +G 
Sbjct  63    TFKKVMSVVPKVWKRVMVTFLCTFMAFFCYNIVALLVLIIWV---LSMGISSDASVIIGF  119

Query  682   --VAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFAL  509
               + VY +GF Y+++IWQLA+ VSVLE++ G KAM+KSK+LL+G M +  + + +L+   
Sbjct  120   LLLIVYFIGFGYLTLIWQLASVVSVLEEARGIKAMAKSKELLKGNMWVATIIYFRLNVLA  179

Query  508   FLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHEN  329
              L+   F++ VV+G  F +      GV  L LL+   L    +  QTV+YFVCKS+ HEN
Sbjct  180   ALLQFGFQQLVVSGRSFSVAERVAYGVICLLLLLKLILFGLVI--QTVLYFVCKSHHHEN  237

Query  328   IDKSALSDHLEVYL-GEYVPLKSKDVQLEQ  242
             IDKS LSDHLEVYL G Y+PL SKDVQ E+
Sbjct  238   IDKSELSDHLEVYLMGGYMPLSSKDVQFEK  267



>gb|AFW74213.1| hypothetical protein ZEAMMB73_246875 [Zea mays]
Length=421

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 207/354 (58%), Gaps = 12/354 (3%)
 Frame = -3

Query  1285  TPTCCGEQPASILLDAMDREQEEMQFLGLFDIYIESYKVIYRC-RKIFSQIALSLVLPLA  1109
              P   G QPA      M+ E EE+QFLG+  IY  S +++    R +F++IA +  LPL+
Sbjct  77    NPRQAGSQPA------MECEPEELQFLGVVGIYRFSAEILRGPHRPLFARIAAAFALPLS  130

Query  1108  IIFLAQKEVSQLIFSNLRHTESQLENSQPGSPRYQRLSDHLTSD-faalllfkfAYFTCL  932
              +FL    +S  +F+++   ++ L+ S PG+   +RL   L SD  A LL         L
Sbjct  131   ALFLLHVAISHALFTHIDSDDTALDASSPGTDTQRRLLSRLASDWLALLLFKSAYLLALL  190

Query  931   LVFSLLstsavvytvacvytARD-LSFKKVISVVPKVWKRLMvtflstflvffVYNFLAA  755
             L+  L   ++V    +     RD L+F +V+SVVP+VW+RL  TFL+ F + F Y+ +A 
Sbjct  191   LLSLLSVAASVFSVASVYSAKRDALTFPRVLSVVPRVWRRLAATFLAAFALLFAYHAVAV  250

Query  754   SAFVIWIFLALSFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKS  575
               FV  +  A +    A +  ++    Y +G +Y+ ++W LA+ VSVLED  GF AM KS
Sbjct  251   LVFVGLLVAADNGSGLAGLLAFLVAVAYLLGLVYLGVVWHLASVVSVLEDHKGFAAMRKS  310

Query  574   KQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfkl  395
             K L+RGK+V     F  L+     V L F+ +VV G         R+ +GL+ L  L  +
Sbjct  311   KDLIRGKLVTAGAIFFTLNVVFAAVELGFRAWVVRG---SGAASSRLLLGLIMLAALCCV  367

Query  394   vvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             V+  LVTQTV+Y VCKSY HE++DK+ +SDHLEVYLG+YVPLK+ DVQ+EQ+QV
Sbjct  368   VMLALVTQTVVYLVCKSYHHESLDKANISDHLEVYLGDYVPLKASDVQMEQFQV  421



>ref|NP_001143962.1| uncharacterized protein LOC100276777 [Zea mays]
 gb|ACG36757.1| hypothetical protein [Zea mays]
Length=335

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 137/338 (41%), Positives = 202/338 (60%), Gaps = 6/338 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRC-RKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             M+ E EE+QFLG+  IY  S +++    R +F++IA +  LPL+ +FL    +S  +F++
Sbjct  1     MECEPEELQFLGVVGIYRFSAEILRGPHRPLFARIAAAFALPLSALFLLHVAISHALFTH  60

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSD-faalllfkfAYFTCLLVFSLLstsavvytva  884
             +   ++ L+ S PG+   +RL   L SD  A LL         LL+  L   ++V    +
Sbjct  61    IDSDDTALDASSPGTDTQRRLLSRLASDWLALLLFKSAYLLALLLLSLLSVAASVFSVAS  120

Query  883   cvytARD-LSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVF  707
                  RD L+F +V+SVVP+VW+RL  TFL+ F + F Y+ +A   FV  +  A +    
Sbjct  121   VYSAKRDALTFPRVLSVVPRVWRRLAATFLAAFALLFAYHAVAVLVFVGLLVAADNGSGL  180

Query  706   ADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
             A +  ++    Y +G +Y+ ++W LA+ VSVLED  GF AM KSK L+RGK+V     F 
Sbjct  181   AGLLAFLVAVAYLLGLVYLGVVWHLASVVSVLEDHKGFAAMRKSKDLIRGKLVTAGAIFF  240

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              L+     V L F+ +VV G         R+ +GL+ L  L  +V+  LVTQTV+Y VCK
Sbjct  241   TLNVVFAAVELGFRAWVVRG---SGAASSRLLLGLIMLAALCCVVMLALVTQTVVYLVCK  297

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY HE++DK+ +SDHLEVYLG+YVPLK+ DVQ+EQ+QV
Sbjct  298   SYHHESLDKANISDHLEVYLGDYVPLKASDVQMEQFQV  335



>ref|XP_008647663.1| PREDICTED: uncharacterized protein LOC100276777 isoform X1 [Zea 
mays]
Length=424

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 141/353 (40%), Positives = 206/353 (58%), Gaps = 12/353 (3%)
 Frame = -3

Query  1285  TPTCCGEQPASILLDAMDREQEEMQFLGLFDIYIESYKVIYRC-RKIFSQIALSLVLPLA  1109
              P   G QPA      M+ E EE+QFLG+  IY  S +++    R +F++IA +  LPL+
Sbjct  77    NPRQAGSQPA------MECEPEELQFLGVVGIYRFSAEILRGPHRPLFARIAAAFALPLS  130

Query  1108  IIFLAQKEVSQLIFSNLRHTESQLENSQPGSPRYQRLSDHLTSD-faalllfkfAYFTCL  932
              +FL    +S  +F+++   ++ L+ S PG+   +RL   L SD  A LL         L
Sbjct  131   ALFLLHVAISHALFTHIDSDDTALDASSPGTDTQRRLLSRLASDWLALLLFKSAYLLALL  190

Query  931   LVFSLLstsavvytvacvytARD-LSFKKVISVVPKVWKRLMvtflstflvffVYNFLAA  755
             L+  L   ++V    +     RD L+F +V+SVVP+VW+RL  TFL+ F + F Y+ +A 
Sbjct  191   LLSLLSVAASVFSVASVYSAKRDALTFPRVLSVVPRVWRRLAATFLAAFALLFAYHAVAV  250

Query  754   SAFVIWIFLALSFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKS  575
               FV  +  A +    A +  ++    Y +G +Y+ ++W LA+ VSVLED  GF AM KS
Sbjct  251   LVFVGLLVAADNGSGLAGLLAFLVAVAYLLGLVYLGVVWHLASVVSVLEDHKGFAAMRKS  310

Query  574   KQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfkl  395
             K L+RGK+V     F  L+     V L F+ +VV G         R+ +GL+ L  L  +
Sbjct  311   KDLIRGKLVTAGAIFFTLNVVFAAVELGFRAWVVRG---SGAASSRLLLGLIMLAALCCV  367

Query  394   vvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             V+  LVTQTV+Y VCKSY HE++DK+ +SDHLEVYLG+YVPLK+ DVQ+EQ+Q
Sbjct  368   VMLALVTQTVVYLVCKSYHHESLDKANISDHLEVYLGDYVPLKASDVQMEQFQ  420



>ref|XP_006659031.1| PREDICTED: uncharacterized protein LOC102709862 [Oryza brachyantha]
Length=337

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 154/337 (46%), Positives = 223/337 (66%), Gaps = 2/337 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ E EE+QFLG+  IY E+  ++   R +F++IA + VLPL+++FLA   +S  +FS++
Sbjct  1     MECEAEELQFLGMVGIYREAAAILRAHRPLFARIAAAFVLPLSLLFLAHIAISHALFSHI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +S L+++ PG+P  +RL   L  D+ ALLLFK AY   LL+ SLLST+A V++VA V
Sbjct  61    DSDDSALDSAAPGTPAQRRLLHRLADDWLALLLFKAAYLLALLLLSLLSTAAAVFSVASV  120

Query  877   ytARD--LSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA  704
             Y+A+   LSF +V+SVVP+VW+RL  TFL+ FL+ F Y+ L  + FV  +  A S    A
Sbjct  121   YSAKHDALSFPRVLSVVPRVWRRLAATFLAAFLLLFAYHLLFLAIFVALLVAADSGSGLA  180

Query  703   DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
              +  ++    Y  G +Y+S++W LA+ VSVLED  GF AM +SK+L++GK+      F  
Sbjct  181   ALLAFLLALAYLAGLVYLSVVWHLASVVSVLEDYKGFHAMRRSKELIQGKLWTASAIFFL  240

Query  523   LHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
             L+    +V + F+ +VV G    +G   R+ +G+  L  L  +V+  LV QTV+Y VCKS
Sbjct  241   LNLVFVVVEVAFRAWVVRGATHGIGAGARLLLGIAMLAALCAVVMLALVVQTVVYLVCKS  300

Query  343   YQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             Y HE+IDKS LSDHLEVYLGEYVPLK+ DVQ+EQ+ +
Sbjct  301   YHHESIDKSNLSDHLEVYLGEYVPLKASDVQMEQFNL  337



>ref|XP_010041111.1| PREDICTED: uncharacterized protein LOC104430023 [Eucalyptus grandis]
Length=314

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 155/341 (45%), Positives = 208/341 (61%), Gaps = 33/341 (10%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQ E+QFLG   +Y E+ K+I + R IF+QI L L+LPL ++ LA  E+ QL+   +
Sbjct  1     MDREQHELQFLGFLGVYRETTKIILKWRTIFAQITLVLILPLCVVSLAAFEILQLLTFMI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +  L+N+   SPRY+ LS  +  ++ A  L++  YF  + +FSLLST AVVYTVAC+
Sbjct  61    ---DFDLDNAWKYSPRYRDLSRMIKKEWIAFCLYELGYFIFVFIFSLLSTLAVVYTVACI  117

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y A+ ++FKK++SVVP+VWKRLM              FL A    +W         FA  
Sbjct  118   YAAKQITFKKIMSVVPRVWKRLM-------------GFLIAWLVTVW--------QFAVC  156

Query  697   P-LWVGVAVY-----TVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
             P L + VAV       VGF+Y+++IW +A+ +SVLED+YG KAM KS++L++GKM L V 
Sbjct  157   PALGIAVAVILLILSIVGFVYIAMIWLMASVISVLEDAYGRKAMVKSRRLIKGKMGLWVW  216

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
              FL +     LV   F+  +V G      +   +GVGL+CLL+L  L +F LV QTVIYF
Sbjct  217   CFLGVLVWSVLVQAFFESLLVLGLP---PIRVTIGVGLICLLLLSMLTLFNLVMQTVIYF  273

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY HENI    LSDHLE  LG+      K VQLEQ  V
Sbjct  274   VCKSYHHENIISFCLSDHLEGRLGDRPSEGQKAVQLEQLHV  314



>ref|XP_010030342.1| PREDICTED: uncharacterized protein LOC104420147 [Eucalyptus grandis]
Length=409

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 208/322 (65%), Gaps = 9/322 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQ E+ FLG   +Y E+ K+I + R IF+QI L L+LPL ++ LA  EV QL+   +
Sbjct  1     MDREQHELHFLGFLGVYRETTKIILKWRTIFAQITLVLILPLCVVSLAAFEVLQLLTFKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +  L+++   SPRY  LS  L  ++  L LF+  YF  + +FSLLST AVVYTVAC+
Sbjct  61    ---DLDLDDAWKHSPRYSDLSRMLKKEWIVLCLFELGYFIFVFIFSLLSTLAVVYTVACI  117

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y A+ ++FKK++SVVP+ WKRLMVTF   F  FFVYN +A    + W+     F V   +
Sbjct  118   YAAKQITFKKIMSVVPRKWKRLMVTFFWCFAPFFVYNVVAVGLLIAWLATVWQFAVCPAL  177

Query  697   PLWVGVAVYT---VGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              + V V +     VGF+Y+++IW +A+ +SVLED+YG KAM KS++L++GKM L V  FL
Sbjct  178   GIAVAVILLILSIVGFVYITMIWLMASVISVLEDAYGRKAMVKSRRLIKGKMGLWVWCFL  237

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              +     LV  +F+  +V G      +   +GVGL+CLL+L  L +F LV QTVIYFVCK
Sbjct  238   GVLVWSVLVQALFESLLVLGLP---PIGVTIGVGLICLLLLSMLTLFNLVVQTVIYFVCK  294

Query  346   SYQHENIDKSALSDHLEVYLGE  281
             SY HENID   LSDHLE  LG+
Sbjct  295   SYHHENIDSFCLSDHLEGRLGD  316


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = -3

Query  376  TQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQL  248
             QT IY VCKSY HENID S L DHLE  LG+      K V L
Sbjct  367  VQTAIYVVCKSYHHENIDSSCLPDHLEGRLGDCPSEGQKAVHL  409



>ref|XP_010063901.1| PREDICTED: uncharacterized protein LOC104450888 [Eucalyptus grandis]
Length=296

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 134/259 (52%), Positives = 175/259 (68%), Gaps = 5/259 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFL  F IY ESYK I+  RKIF+QI  +L+LPLA +FL   EVS ++ S +
Sbjct  27    MDREQEEMQFLSFFGIYKESYKDIFSWRKIFTQINTALILPLAFVFLIHMEVSDILLSKI  86

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E QL+ ++P + R+ R+S  L+ ++A  LL K  YFT LL FSLLSTSAVVYT+AC+
Sbjct  87    VSNEIQLDETRPYTSRHDRISRVLSKEWAVFLLIKALYFTALLKFSLLSTSAVVYTIACI  146

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAF-VIWIFLA-LSFRVFA  704
             YT R ++F KV+SVVP+VW+RLMVTFL  F   FVYN +A        IF+  L+F +  
Sbjct  147   YTGRKVAFGKVMSVVPRVWRRLMVTFLRFFPAMFVYNVIAGVILHTCAIFVGDLNFGILI  206

Query  703   DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
              I L      Y VGF+YM+ +W+LA+ VSVLE+ YG KAM KSK L++GK+ +  + F K
Sbjct  207   LILL---GLAYLVGFMYMTAVWRLASVVSVLEEDYGVKAMIKSKNLIKGKLFVSTIIFFK  263

Query  523   LHFALFLVNLIFKRFVVNG  467
             L  +L LV   F+R VV G
Sbjct  264   LSTSLHLVQFAFERLVVYG  282



>gb|KHN06024.1| hypothetical protein glysoja_050104 [Glycine soja]
Length=250

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 176/238 (74%), Gaps = 3/238 (1%)
 Frame = -3

Query  946  YFTCLLVFSLLstsavvytvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN  767
            YFT LL+FSLLSTSAVVYT+A +YTA++++FK+V+SVVPKVWKRLM+TFL  F  FF+YN
Sbjct  16   YFTLLLIFSLLSTSAVVYTIASIYTAKEVTFKRVMSVVPKVWKRLMLTFLCAFAAFFIYN  75

Query  766  FLAASAFVIWIFLALSFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKA  587
             +      + I + +       + L +   +Y +GF+Y++++WQL++ V+VLEDS+G +A
Sbjct  76   IVTMLVMFLSI-VTIGISSGGVVVLVLITVLYFIGFVYLTVVWQLSSVVTVLEDSWGIRA  134

Query  586  MSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllv  407
            M+KSK+L++GKMVL +  F  L  +   + ++FK  VV+GW   +  V +   G+LC L+
Sbjct  135  MAKSKELIKGKMVLSIFVFFTLVASFVSIRVLFKVMVVDGW--RVSSVDKTAYGVLCFLL  192

Query  406  lfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
            L  L +FGLV QTV+YFVCKSY HENIDKSAL+DHLE Y GEYVPL +KDVQLEQYQV
Sbjct  193  LSCLFLFGLVLQTVLYFVCKSYHHENIDKSALADHLEGYRGEYVPLTAKDVQLEQYQV  250



>ref|NP_001060795.1| Os08g0107100 [Oryza sativa Japonica Group]
 dbj|BAD09388.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22709.1| Os08g0107100 [Oryza sativa Japonica Group]
 dbj|BAG89353.1| unnamed protein product [Oryza sativa Japonica Group]
Length=337

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 138/344 (40%), Positives = 199/344 (58%), Gaps = 18/344 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ E EE+QFLG+  IY E+  ++   R +F++IA + VLPL+++FL    +S  +FS++
Sbjct  1     MECEPEELQFLGMVGIYREAASILRAHRPLFARIAAAFVLPLSLLFLLHIAISHALFSHI  60

Query  1057  RHTESQLENSQPGSPRYQRL----------SDHLTSDfaalllfkfAYFTCLLVFSLLst  908
                +S L+++ PG+P  +RL               + +   LL      T   VFS+   
Sbjct  61    DSDDSALDSAAPGTPAQRRLLHRLADDWLALLLFKAAYLLALLLFSLLSTAAAVFSV---  117

Query  907   savvytvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFL  728
                            LSF +V+SVVP+VW+RL  TFL+ FL+ F Y+ L  + FV  +  
Sbjct  118   -----ASVYSAKHDALSFPRVLSVVPRVWRRLAATFLAAFLLLFAYHLLFVAVFVALLVA  172

Query  727   ALSFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMV  548
             A S    A +  ++    Y  G +Y+S++W LA+ VSVLED  GF+AM KSK L++GK+ 
Sbjct  173   ADSGSGLAALLAFLLALAYIAGLVYLSVVWHLASVVSVLEDYKGFEAMRKSKALIQGKLW  232

Query  547   LGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
                  F  L+    +V + F+ +VV G    LG   R+ +GL  L  L  +V+  LV QT
Sbjct  233   TASAIFFVLNVVFIVVEVAFRAWVVRGATHGLGAGSRLLLGLAMLAALCAVVMLALVVQT  292

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             V+Y VCKSY HE+IDKS LSDHLEVYLGEYVPLK+ DVQ+EQ+ 
Sbjct  293   VVYLVCKSYHHESIDKSNLSDHLEVYLGEYVPLKASDVQMEQFN  336



>ref|XP_010041974.1| PREDICTED: uncharacterized protein LOC104430968, partial [Eucalyptus 
grandis]
Length=338

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 217/338 (64%), Gaps = 22/338 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDR Q E+QFLG   +Y  + ++I + RKIF +I LSL+LPL II LA   VSQL+F  +
Sbjct  1     MDRHQNELQFLGSLGVYRGTSEIIVKSRKIFVRITLSLILPLCIILLAHSLVSQLLFYKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  L +++   P Y+ LS  L  ++ A  L + +YF  + +FSLLST+AVVYTVA V
Sbjct  61    LTDEITLYDTRKRGPEYRDLSRMLEKEWVAFSLVRISYFVLVFIFSLLSTAAVVYTVASV  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y A+ ++FKK++SV+P+VWKRLMVTF   F +FFVYN +A    ++W+   ++ R F+  
Sbjct  121   YAAKQITFKKIMSVMPRVWKRLMVTFFWCFALFFVYNAVAVGLLIVWL---ITVRQFSVG  177

Query  697   PLWVGVAVY------TVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
             P               VG +Y+++IWQ+A+ +SVLED+YG KAM KSK L++GKM L V 
Sbjct  178   PALGIALAAILLILSVVGLVYITMIWQMASVISVLEDAYGMKAMLKSKGLIKGKMGLSVW  237

Query  535   FFLKLHFALFLVNLIFKRFVV-----NGWDFHlgmvgrvgvgllcllvlfklvvfglVTQ  371
              FL +     LV  +F+  VV     NG         R+GVGL+CLL+L  LV+F LV Q
Sbjct  238   CFLGVLVCSVLVQALFESLVVLDLVPNG--------VRIGVGLVCLLLLSMLVLFDLVVQ  289

Query  370   TVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKD  257
             TVIYFVCKSY +ENID S LSDHLE  LG+  PLK+K 
Sbjct  290   TVIYFVCKSYHYENIDSSFLSDHLEGCLGDCPPLKAKG  327



>ref|XP_004972432.1| PREDICTED: uncharacterized protein LOC101755585 [Setaria italica]
Length=337

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 148/338 (44%), Positives = 219/338 (65%), Gaps = 4/338 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRC-RKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             M+ E EE+QFLG   IY  S  ++    R +F+++A + VLPLA +FL    +S  +F++
Sbjct  1     MECEPEELQFLGAAGIYAASASILRGPHRPLFARVAAAFVLPLAALFLLHVAISHALFTH  60

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             +   ++ L++S PG+   +RL   L SD+ ALLLFK AY   LL+ SLL+T+A V++VA 
Sbjct  61    IDTDDTALDSSAPGTDAQRRLLSRLASDWLALLLFKAAYLLALLLLSLLATAAAVFSVAS  120

Query  880   vytARD--LSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVF  707
             VY+A+   L+F +V+SVVP+VW+RL  TFL+ F + F Y+ +    F+  +  A +    
Sbjct  121   VYSAKHDALTFPRVLSVVPRVWRRLAATFLAAFALLFAYHAVFVVVFLGLLVAADNGSGL  180

Query  706   ADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
             A +  ++ +  Y VG +Y+S++W LA+ VSVLED  GF AM KS+ L+RGK+      F+
Sbjct  181   AGLLAFLLLVAYLVGLVYISVVWHLASVVSVLEDYKGFAAMRKSRDLIRGKLPTAAAIFV  240

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              L+    +V L F+ +VV         + R+ VGLL L  L  +V+  LV QT++Y VCK
Sbjct  241   TLNLVFAVVELAFRAWVVKAGG-SSPALARLLVGLLALAALSCVVMLALVAQTLVYLVCK  299

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY HE+IDK+ +SDHLEVYLG+YVPLK+ DVQ+EQ+QV
Sbjct  300   SYHHESIDKAGISDHLEVYLGDYVPLKASDVQMEQFQV  337



>ref|XP_008664724.1| PREDICTED: uncharacterized protein LOC103643340 [Zea mays]
Length=325

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 128/339 (38%), Positives = 194/339 (57%), Gaps = 18/339 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRC-RKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             M+ E EE+QFLG+  IY  S +++    R +F++IA +  LPL+ +FL    +S   F++
Sbjct  1     MECEPEELQFLGVVVIYRFSAEILRGPHRPLFARIAAAFALPLSALFLLHVAISHAFFTH  60

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             +   ++ L+ S PG+   + L   L SD           +  LL+F      A++     
Sbjct  61    IDSDDTALDASSPGTDTQRHLLSRLASD-----------WLALLLFKSAYLLALLLLSLL  109

Query  880   vytA--RD-LSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRV  710
                +  RD L+F +V+SVVP+VW+RL  TFL+ F + F Y+ +    F+  +  A +   
Sbjct  110   SVVSDKRDALTFPRVLSVVPRVWRRLTATFLAAFALLFAYHVVVVLVFIGLLVAADNGSA  169

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
              A +  ++ V  Y +G   + ++W LAN VSVLED  GF  M KSK L+RGK+V     F
Sbjct  170   LAGLLAFLVVVAYLLGLGDLGVVWHLANVVSVLEDHKGFAVMRKSKDLIRGKLVTAGAIF  229

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
               L+     V L F+ +VV G         R+ +GL+ L+V   +V+  LVTQT++Y VC
Sbjct  230   FTLNVVFAAVELGFRAWVVRG---SGAASSRLLLGLIMLVVRCCVVMLALVTQTIVYLVC  286

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             KSY HE++D + +SDHLEVYLG+YVPL + DVQ+EQ+QV
Sbjct  287   KSYHHESLDNANISDHLEVYLGDYVPLNASDVQMEQFQV  325



>gb|ABK26963.1| unknown [Picea sitchensis]
Length=344

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 140/342 (41%), Positives = 214/342 (63%), Gaps = 13/342 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDRE E++QFLG+  I   ++K++  C K+   + L+L+LPL    L  + VS+ +   +
Sbjct  1     MDREPEDLQFLGIVGIIGSAFKILRSCAKLLGSLTLTLILPLCFAILGHQLVSEYLLYKI  60

Query  1057  RHTES--QLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytva  884
                E   Q+EN   G+P  +R+   LT +   L +F+ AY   +LVFSLLST+AVVYTVA
Sbjct  61    HWNEMFYQVEN---GTPAGERIMKELTWERTELFIFQAAYLLFVLVFSLLSTAAVVYTVA  117

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVY--NFLAASAFVIWIFLAL----  722
              +YT +++S+ +V+S+VP+VWKRLM TFL  F++ F Y   F+  +AFV+++FL +    
Sbjct  118   SIYTGKEISYARVMSIVPRVWKRLMGTFLWFFIILFAYWMAFVLITAFVVFLFLLMFPVE  177

Query  721   --SFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMV  548
                F +   I   + + V+  G++Y+S++W LA  +SVLED YG  AM KS  L++G  +
Sbjct  178   GNKFNLAGFIFSLIIITVFFCGYVYISMVWHLACVISVLEDKYGLGAMQKSWNLIKGNRI  237

Query  547   LGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
               +V  +     + ++   F  +V++G     G  GR   G + + +L    + GL+TQ+
Sbjct  238   TALVLDILYLVFVGIIGWFFGYYVLHGNRHGAGSTGRGAYGTVLVGLLCFAHLMGLLTQS  297

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             V YFVCKSY HE+IDKS+LSDHLEVYLG+Y PLKS ++Q+E 
Sbjct  298   VFYFVCKSYHHESIDKSSLSDHLEVYLGDYEPLKSSNIQMEN  339



>ref|XP_008464345.1| PREDICTED: uncharacterized protein LOC103502253 [Cucumis melo]
Length=335

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 157/335 (47%), Positives = 223/335 (67%), Gaps = 10/335 (3%)
 Frame = -3

Query  1216  MQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNLRHTESQL  1037
             M  L + DI+ E+Y++I   +KIFSQIALSL+LPL  IFLA  E+S L+F N  +  S L
Sbjct  1     MVLLEIVDIFQETYEIILTWKKIFSQIALSLILPLTFIFLAHMEISNLLFGNFFYHVSFL  60

Query  1036  --ENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacvytARD  863
                N    + +Y  LS+ +T       LF  +Y   L VFSLLSTSAVVYTVAC++T R+
Sbjct  61    HKNNQDQDARKYNELSELITPKLTLFWLFNISYIVFLFVFSLLSTSAVVYTVACIHTGRE  120

Query  862   LSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLAL-SFRVFADIPLWV  686
             +SFK++IS+VPKVWKRL+VTF   F  FF YN LA  AF++ +F+ L  +  F D+   +
Sbjct  121   ISFKQIISIVPKVWKRLVVTFFCVFASFFAYNLLAVFAFILLLFILLLQYGPFGDVNGSI  180

Query  685   GVA---VYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHF  515
              V    +Y +G LY+S++ QL++ V+VLE+SYGFKAM+KSK LL+GKM++  +  L ++ 
Sbjct  181   FVVFFIIYFIGLLYLSVVVQLSSVVTVLEESYGFKAMAKSKALLKGKMLVATLMLLLINI  240

Query  514   ALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQH  335
             +L ++   F + VV+G  F +   G +G+  L LL+ F L    L  +TV+YFVCK +  
Sbjct  241   SLVIIQQAFVKLVVHGVWFGIVGRGILGIVCLFLLLNFFLWQLVL--ETVLYFVCKEHHQ  298

Query  334   ENIDKSALSDHLEVY-LGEYVPLK-SKDVQLEQYQ  236
             ENIDKSALS+HL+VY L  Y+PL  +K+V+LE+ +
Sbjct  299   ENIDKSALSNHLQVYLLNGYIPLTPTKNVELEKLE  333



>gb|ABR16362.1| unknown [Picea sitchensis]
Length=335

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 143/336 (43%), Positives = 207/336 (62%), Gaps = 3/336 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             +DRE EE+QFLG+  I  E+ K++  C K    I L+L+LPL+   L    VS  +   +
Sbjct  2     LDREPEELQFLGVVGILAEAIKILRSCVKQLGAITLTLILPLSFAILGHTLVSDPLIHKI  61

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E   E  Q GSP   R    + S++   LLF+  Y   LL FSLLST+AVVYTVAC+
Sbjct  62    ERNEDTFEK-QAGSPDADRTMALIYSEWTRFLLFQGGYLVFLLAFSLLSTAAVVYTVACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIF-LALSFRVFAD  701
             YT + +++ KV+SVVP+VWKRLM+TFL  FL+   YN      FV+ I  + +   V   
Sbjct  121   YTGKQITYAKVMSVVPRVWKRLMLTFLWYFLIMIGYNTAVMVTFVVVILTVGVDNTVAFG  180

Query  700   IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
             + + V +AV+    +Y+S IW +A+ +SVLED YG  A+ KS+ L++GK ++  V     
Sbjct  181   LCVVVLLAVFLAVHVYISAIWHVASVISVLEDRYGIGAIKKSRDLIKGKRLVAFVLIFFY  240

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
                  ++  IF++ VV+      G+  RVG G+L + +L  + + GL+ Q+V+Y+VCKSY
Sbjct  241   FVVWAVIQGIFRKKVVHV-SGGGGIGSRVGFGVLLVGLLVYVNLIGLLVQSVLYYVCKSY  299

Query  340   QHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              H++IDKSALSDHLE YLGEYVPLKS ++Q+E   +
Sbjct  300   HHQSIDKSALSDHLEEYLGEYVPLKSSNIQMENLDI  335



>ref|XP_003543959.1| PREDICTED: uncharacterized protein LOC100776586 [Glycine max]
 gb|KHN21703.1| hypothetical protein glysoja_048089 [Glycine soja]
Length=336

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 148/342 (43%), Positives = 204/342 (60%), Gaps = 20/342 (6%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFD-IYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             MDREQEEMQ LGLF  +Y E+ K+    RKI +QI L L++PL+ IFL   EVS L FS 
Sbjct  1     MDREQEEMQSLGLFGFLYEEASKITLSWRKILTQITLKLIIPLSFIFLIHIEVSNLFFSK  60

Query  1060  LR-HT-ESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytv  887
             +R HT E    N  P  P+Y +LSD ++S+   +  F+ AYFT LL+ SLLSTS+V YT+
Sbjct  61    IRSHTKEMHGTNPNPNLPQYVKLSDKISSELITVSTFQIAYFTFLLIISLLSTSSVAYTI  120

Query  886   acvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVF  707
             A +YT  D++FKKV++VVP VWKR M+ FL     FF+YNF +     +W   A +F + 
Sbjct  121   ASIYTPEDVTFKKVMNVVPMVWKRFMLAFLFALAFFFLYNFGSMIVICLW---ANTFGIM  177

Query  706   AD---IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
             +    I  ++GV +Y +G  + +++ QL   ++ L DS+   AM K+ +L++ K    VV
Sbjct  178   SGGGAIFDFIGV-IYFIGLAHFTVVVQLT-IMTDLHDSWETLAMEKNYKLIKEK----VV  231

Query  535   FFLKLHFALFLVNLIFKRFVVNG----WDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
             F +   FA  +VNL+      +G                  LL  L++  L +FG +   
Sbjct  232   FLIFTIFAQ-MVNLVSIMVSSSGKMPILKERRASSVNKTAILLSFLLVTCLFLFGFLLHA  290

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             VIYFVCKSY HEN+D  AL D+LEVY GEYV L+  DVQ EQ
Sbjct  291   VIYFVCKSYYHENVDMPALPDNLEVYGGEYVQLEVNDVQQEQ  332



>gb|EEC82781.1| hypothetical protein OsI_27526 [Oryza sativa Indica Group]
Length=296

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/334 (39%), Positives = 187/334 (56%), Gaps = 39/334 (12%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ E EE+QFLG+  IY E+  ++   R +F++IA + VLPL+++FL    +S  +FS++
Sbjct  1     MECEPEELQFLGMVGIYREAASILRAHRPLFARIAAAFVLPLSLLFLLHIAISHALFSHI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E  ++   PG+P    L                                       +
Sbjct  61    DSVEFAVDCDVPGTPLQPGL---------------------------------------L  81

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             +    LSF +V+SVVP+VW+RL  TFL+ FL+ F Y+ L  + FV  +  A S    A +
Sbjct  82    HPHDALSFPRVLSVVPRVWRRLAATFLAAFLLLFAYHLLFVAVFVALLVAADSGSGLAAL  141

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
               ++    Y  G +Y+S++W LA+ VSVLED  GF+AM KSK L++GK+      F  L+
Sbjct  142   LAFLLALAYIAGLVYLSVVWHLASVVSVLEDYKGFEAMRKSKALIQGKLWTASAIFFVLN  201

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                 +V + F+ +VV G    LG   R+ +GL  L  L  +V+  LV QTV+Y VCKSY 
Sbjct  202   VIFIVVEVAFRAWVVRGATHGLGAGSRLLLGLAMLAALCAVVMLALVVQTVVYLVCKSYH  261

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             HE+IDKS LSDHLEVYLGEYVPLK+ DVQ+EQ+ 
Sbjct  262   HESIDKSNLSDHLEVYLGEYVPLKASDVQMEQFN  295



>tpg|DAA49205.1| TPA: hypothetical protein ZEAMMB73_866262 [Zea mays]
Length=528

 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 193/339 (57%), Gaps = 18/339 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRC-RKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             M+ E EE+QFLG+  IY  S +++    R +F++IA +  LPL+ +FL    +S   F++
Sbjct  1     MECEPEELQFLGVVVIYRFSAEILRGPHRPLFARIAAAFALPLSALFLLHVAISHAFFTH  60

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             +   ++ L+ S PG+   + L   L SD           +  LL+F      A++     
Sbjct  61    IDSDDTALDASSPGTDTQRHLLSRLASD-----------WLALLLFKSAYLLALLLLSLL  109

Query  880   vyt--ARD-LSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRV  710
                   RD L+F +V+SVVP+VW+RL  TFL+ F + F Y+ +    F+  +  A +   
Sbjct  110   SVVSDKRDALTFPRVLSVVPRVWRRLTATFLAAFALLFAYHVVVVLVFIGLLVAADNGSA  169

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
              A +  ++ V  Y +G   + ++W LAN VSVLED  GF  M KSK L+RGK+V     F
Sbjct  170   LAGLLAFLVVVAYLLGLGDLGVVWHLANVVSVLEDHKGFAVMRKSKDLIRGKLVTAGAIF  229

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
               L+     V L F+ +VV G         R+ +GL+ L+V   +V+  LVTQT++Y VC
Sbjct  230   FTLNVVFAAVELGFRAWVVRG---SGAASSRLLLGLIMLVVRCCVVMLALVTQTIVYLVC  286

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             KSY HE++D + +SDHLEVYLG+YVPL + DVQ+EQ+Q+
Sbjct  287   KSYHHESLDNANISDHLEVYLGDYVPLNASDVQMEQFQL  325



>emb|CBI19938.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 147/199 (74%), Gaps = 3/199 (2%)
 Frame = -3

Query  850  KVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADIPLWVGVAVY  671
            KV+SVVP+VWKRLMVTFL  F+  F YN  A    ++W       ++   + LWV   +Y
Sbjct  61   KVMSVVPRVWKRLMVTFLCIFVAVFAYNIFALLILILWALCIGPVKI-GILILWVMFILY  119

Query  670  TVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLI  491
             VG  YMSIIWQLA+ VSVLED YGF+AM KS+ L+RGK+V+ +V FLKL+ +LF++ + 
Sbjct  120  LVGLSYMSIIWQLASVVSVLEDLYGFRAMVKSRALIRGKLVVAIVIFLKLNISLFVIKIA  179

Query  490  FKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSAL  311
            F+R VV G      M  RVG G+LC L+LFKL +FGLV QT+IYFVCKSY HENIDKSAL
Sbjct  180  FERLVVYGASLG--MANRVGYGILCFLLLFKLFLFGLVLQTIIYFVCKSYHHENIDKSAL  237

Query  310  SDHLEVYLGEYVPLKSKDV  254
            SDHLEVY+GEYVPLK+KD+
Sbjct  238  SDHLEVYMGEYVPLKAKDI  256


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD EQEEMQFLG+F IY E+YK+I+  +KIFSQI ++L+LPL  IFLA  EVS  +F  +
Sbjct  1     MDLEQEEMQFLGIFGIYKEAYKIIFSWKKIFSQITVALILPLCFIFLAYIEVSDYLFQKI  60

Query  1057  R  1055
             +
Sbjct  61    K  61



>ref|XP_010030343.1| PREDICTED: uncharacterized protein LOC104420148 [Eucalyptus grandis]
Length=351

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 160/358 (45%), Positives = 215/358 (60%), Gaps = 44/358 (12%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+R Q E+QFLG   +Y E+ ++I +CRKIF++I L+L+LPL II LA   VSQL+F  +
Sbjct  2     MNRHQNELQFLGSLGVYRETSEIIVKCRKIFARITLTLILPLCIILLAHSLVSQLLFYKI  61

Query  1057  RHTESQLEN----------------------------SQPGSPRYQRLSDHLTSDfaall  962
              + E  L +                            +    P Y+ LS  L  ++ A  
Sbjct  62    LNDEITLNDIIYKILNDEITLKDIIYKILKNEITLIDTWKDDPEYRDLSRMLQKEWGAFG  121

Query  961   lfkfAYFTCLLVFSLLstsavvytvacvytARDLSFKKVISVVPKVWKRLMvtflstflv  782
             L + +YF  + +FS LST+AVVYTVA VY A+ ++FKK++SVVP+VWKRLMVTF   F +
Sbjct  122   LVRLSYFFLVFIFSPLSTAAVVYTVASVYAAKQITFKKIMSVVPRVWKRLMVTFFWCFAL  181

Query  781   ffVYNFLAASAFVIWIFLALSFRVFADIPLWVGVAV---YTVGFLYMSIIWQLANTVSVL  611
             FF YN +A    ++W+     F V   + + + V +   Y VGF+Y+++I QLA+ +SVL
Sbjct  182   FFEYNAVAVGLLIVWLITVRQFSVGPALGIALAVILLILYVVGFVYITMICQLASVISVL  241

Query  610   EDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVV-----NGWDFHlgm  446
             ED+YG KAM KSK L++GKM L V  FL +     LV  +F+  VV     NG       
Sbjct  242   EDAYGRKAMLKSKGLIKGKMGLPVWCFLGVLVFSVLVQALFESLVVLDLVPNG-------  294

Query  445   vgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVP  272
               R+GVGL+CLL L  LV+F LV QTVIYFVCKSY HENID S LSDHLE  LG+  P
Sbjct  295   -VRIGVGLVCLLSLSMLVLFDLVVQTVIYFVCKSYHHENIDSSFLSDHLEGCLGDCGP  351



>ref|XP_011027693.1| PREDICTED: uncharacterized protein LOC105127910 [Populus euphratica]
Length=265

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 173/234 (74%), Gaps = 8/234 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+R+QEEMQFLG+F IY E+YK+I+  RKIFSQIAL+L+LPL+ I LA  EVS ++   +
Sbjct  1     MERKQEEMQFLGVFGIYKEAYKIIFSWRKIFSQIALALILPLSFISLAHIEVSNVLSGKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              + + +L  ++ G+ RY +LSDH++S+ A   LF+ AY    L+FSLLS++AVVYT+A +
Sbjct  61    INNQVELLGTEAGTKRYNKLSDHVSSELAYFWLFEAAYLILSLIFSLLSSAAVVYTIASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLA--ASAFVI---W-IFLALSF  716
             YT R++SFKKV+SVVPKVWKRLMVTFLS  + FF Y  +A   S+ V+   W +F    +
Sbjct  121   YTNREVSFKKVMSVVPKVWKRLMVTFLSVSVAFFAYTVVAILVSSLVLIIAWFVFTGFHY  180

Query  715   -RVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG  557
              +VF    + V + +Y +GF+YM I+WQLA++VSVLE++ GFKAM+KS+ L++G
Sbjct  181   LKVFYSFGI-VLLVLYFMGFVYMIIVWQLASSVSVLEEACGFKAMTKSRALIKG  233



>ref|XP_001762332.1| predicted protein [Physcomitrella patens]
 gb|EDQ72799.1| predicted protein [Physcomitrella patens]
Length=338

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 136/334 (41%), Positives = 198/334 (59%), Gaps = 2/334 (1%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD E +EM+ LG+  I  E + ++    ++F  +A +LVLPL ++      VS  + + +
Sbjct  1     MDGEPDEMRSLGVVGICKEVFNLLRSHLRLFVSLAFTLVLPLGLVIFCHTLVSDPLMNKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                E++     PGSP   R  + L ++F AL +    YF  +L FSLLST+A+VY+VAC+
Sbjct  61    GRNENEKATEIPGSPAAVRTQNRLDAEFFALAIITILYFVFVLAFSLLSTAAIVYSVACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA+ LS+ KVISVVP+VWKRL+ TFL   ++ F+Y       FVI +FL+    V   I
Sbjct  121   YTAKGLSYAKVISVVPRVWKRLLFTFLWANVLIFLYYVALFFIFVILLFLSAILNVNLLI  180

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
                  V ++    +Y +++W LA+ +SVLE+SYG  A+ KS +L++GK  +  V F+   
Sbjct  181   LFIPVVILFYCLLIYFNLVWHLASVISVLEESYGIGALKKSAELIKGKRRVACVVFVVYG  240

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                  V  +F  F VN  D      GR   GL  LL+   + + G++ QTV+YFVCKSY 
Sbjct  241   MCTIFVVSLFNIF-VNSNDHVNNYFGRFFFGLFLLLLWTCVHLIGILIQTVVYFVCKSYH  299

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             +ENID+ ALS+HL+ YLGEYVPLK   V LE  +
Sbjct  300   NENIDRYALSEHLDGYLGEYVPLKGP-VSLEALE  332



>ref|XP_011027399.1| PREDICTED: uncharacterized protein LOC105127717 isoform X2 [Populus 
euphratica]
Length=282

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 172/233 (74%), Gaps = 8/233 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+REQEEMQFLG+F IY E+YK+I+  RKIFSQIAL+L+LPL+ I LA  EVS ++   +
Sbjct  6     MEREQEEMQFLGVFGIYKEAYKIIFSWRKIFSQIALALILPLSFISLAHIEVSNVLSGKI  65

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              + + +L  ++ G+ RY +LSDH++S+ A   LF+ AY    L+FSLLS++AVVYT+A +
Sbjct  66    INNQVELLGTEAGTKRYNKLSDHVSSELAYFWLFEAAYLILSLIFSLLSSAAVVYTIASI  125

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLA--ASAFVI----WIFLALSF  716
             YT R++SFKKV+SVVPKVWKRLMVTFLS  + FF Y  +A   S+ V+    ++F    +
Sbjct  126   YTNREVSFKKVMSVVPKVWKRLMVTFLSVSVAFFAYTVVAILVSSLVLIIAWFVFTGFHY  185

Query  715   -RVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLR  560
              +VF    + V + +Y +GF+YM I+WQLA++VSVLE++ GFKAM+KS+ L++
Sbjct  186   LKVFYSFGI-VLLVLYFMGFVYMIIVWQLASSVSVLEEACGFKAMTKSRALIK  237


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -3

Query  367  VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
            VIYFVCKS  HENI+KSALSDHL+VY GE+VPL SKDVQLE+
Sbjct  238  VIYFVCKSNHHENIEKSALSDHLDVYHGEHVPLNSKDVQLEE  279



>ref|XP_010041279.1| PREDICTED: uncharacterized protein LOC104430215 [Eucalyptus grandis]
Length=220

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 156/223 (70%), Gaps = 5/223 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEEMQFLGL  I  ES KVI+  RKIF QI L+L+LPLA +FL   EVS +++  +
Sbjct  1     MDREQEEMQFLGLVGICKESCKVIFSWRKIFIQITLALILPLAFVFLLHIEVSDVLYWRI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  QL  ++P S R+ R+S  L+ +    LLF   YFT LLVFSLLSTSA+VYT+AC+
Sbjct  61    VRNAIQLNETRPDSSRHDRISSVLSKELTVYLLFNALYFTVLLVFSLLSTSAIVYTIACI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASA-FVIWIFLA-LSFRVFA  704
             YT R+++F+KV+SVVP+VW+RLMVTF+  FL   VY  +A    F   IF++  +F +  
Sbjct  121   YTGREVTFRKVMSVVPRVWRRLMVTFVCIFLAMLVYTSVAMMILFTCAIFISDTNFGIL-  179

Query  703   DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKS  575
              I   +G+A Y VGF++M+I+WQLA+ VSVLE+ YG KAM KS
Sbjct  180   -ILFLLGIA-YLVGFVFMTIVWQLASVVSVLEEDYGVKAMIKS  220



>ref|XP_011016504.1| PREDICTED: uncharacterized protein LOC105120011, partial [Populus 
euphratica]
Length=232

 Score =   164 bits (415),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 170/233 (73%), Gaps = 8/233 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+R+QEEMQFLG+F IY E+YK+I+  RKIFSQI L+L+LPL+ I LA  E+S +++  +
Sbjct  1     MERKQEEMQFLGVFGIYKEAYKIIFSWRKIFSQITLALILPLSFILLAHIEMSNVLYGKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              + + +L  ++ G+ RY +LSD ++S+ A   LF+ AY    L+FSLLST+AVVYT+A +
Sbjct  61    INNQVELLGTEAGTKRYNKLSDRISSELAYFWLFEVAYLILSLIFSLLSTAAVVYTIASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLA--ASAFVIWI--FLALSF--  716
             YT R++SFKKV+S VPKVWKRLMVTFLS  + FF Y  +A   S+ V+ I  F+   F  
Sbjct  121   YTNREVSFKKVMSAVPKVWKRLMVTFLSISVAFFAYTVVAILVSSLVLIIAWFVFTGFHY  180

Query  715   -RVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLR  560
              +VF    + V + +Y +GF+YM+I+WQLA+ V+VLED+ GFKAM+KS+ L++
Sbjct  181   LKVFYSFGI-VLLVLYFMGFVYMTIVWQLASAVTVLEDACGFKAMTKSRALIK  232



>ref|XP_002306664.1| hypothetical protein POPTR_0005s20680g [Populus trichocarpa]
 gb|EEE93660.1| hypothetical protein POPTR_0005s20680g [Populus trichocarpa]
Length=324

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 205/331 (62%), Gaps = 10/331 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD +QEEMQFLGLF IY E++K+I+  + IFSQI L  +LP + +F+A  +VS  +F+ +
Sbjct  1     MDSKQEEMQFLGLFGIYKEAFKIIFSRKTIFSQITLVFILPTSFVFIANMKVSNALFAKI  60

Query  1057  RHTESQLENSQP--GSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytva  884
                  Q+   QP  G+P    L    ++ +  LL FK AY T LL+FS LST+AVVYT+A
Sbjct  61    IEV-VQVPRMQPQAGTPEQIELCLPNSTGWTQLLFFKAAYITFLLLFSPLSTAAVVYTIA  119

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA  704
             C+ T ++++FK V+  VPK WKRL++     F     +         +     ++  + A
Sbjct  120   CISTGQEVTFKMVMRAVPKFWKRLVIISACAFAAIIAFTMGTLLTIAVTRIFMINRYILA  179

Query  703   DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKM-VLGVVFFL  527
                 +V + ++ +GF+Y+S++WQ A+ VSV E++Y   AM KSK L+RGK  V+GV+ FL
Sbjct  180   I--GFVLLVLFFMGFVYISLVWQTASVVSVSEEAYVMTAMIKSKALVRGKTKVMGVI-FL  236

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              +  +  ++ + F + V       LG+V RV  G++C L+L  L++F LV QTV YFVCK
Sbjct  237   TMTISYVIMKIEFSKLVEGS---SLGIVNRVSCGIICFLLLVLLILFELVIQTVTYFVCK  293

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDV  254
             SY HENIDKS   DHL+    +YVPLK+KDV
Sbjct  294   SYHHENIDKSTTLDHLDAGYNDYVPLKAKDV  324



>ref|XP_011006316.1| PREDICTED: uncharacterized protein LOC105112334 [Populus euphratica]
Length=324

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 140/333 (42%), Positives = 209/333 (63%), Gaps = 14/333 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD+++EEMQFLGLF IY E+ K+I+  + IFSQI L  +LP + +F+A  +VS  +F+ +
Sbjct  1     MDKKREEMQFLGLFGIYKEACKIIFSRKTIFSQITLVFILPTSFVFIANMKVSNALFAKI  60

Query  1057  RH-TESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
                 +     +Q G+P    LS   ++ +  LL +K AY T LL+FS LST+AVVYT+AC
Sbjct  61    IEVVQVPRMQTQAGTPEQIELSLPNSTGWIQLLFYKAAYITFLLLFSPLSTAAVVYTIAC  120

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFAD  701
             + T ++++FK V+ VVP+ WKRL++     F   F        A ++ I +  +F +   
Sbjct  121   ISTGQEVTFKMVMRVVPRFWKRLVIISACAFAAIFACTM----ATLLTIAVTRTFMINRY  176

Query  700   IPLWVG---VAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKM-VLGVVF  533
             I L +G   + ++ +GF+Y+S++WQ A+ VSV E++    AM KSK L+RGK  V+GV+ 
Sbjct  177   I-LAIGFFLLVLFFMGFVYISLVWQTASVVSVSEEASAMTAMIKSKALVRGKTKVMGVI-  234

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
             FL +  +  ++ + F + V       LG+V RV  G++C L+L  L++F LV QTV YFV
Sbjct  235   FLTMTISYVIMKIEFSKLVEGS---SLGIVNRVSYGIICFLLLVLLILFELVIQTVTYFV  291

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDV  254
             CKSY HENIDKS   D L+    +YVPLK+KDV
Sbjct  292   CKSYHHENIDKSTTLDRLDAGYDDYVPLKAKDV  324



>ref|XP_002300951.2| hypothetical protein POPTR_0002s07480g [Populus trichocarpa]
 gb|EEE80224.2| hypothetical protein POPTR_0002s07480g [Populus trichocarpa]
Length=294

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 142/291 (49%), Positives = 197/291 (68%), Gaps = 12/291 (4%)
 Frame = -3

Query  1093  QKEVSQLIFSNLRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLL  914
             Q + S L  S + H  S   N + G+ RY +LS H++S+ A   LF+ AY    L+FSLL
Sbjct  6     QSDNSCLDSSPIAHLPSS--NREAGTKRYNKLSHHISSELAYFWLFEVAYLILSLIFSLL  63

Query  913   stsavvytvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLA--ASAFVI  740
             ST+AVVYT+A +YT R++SFKKV+SVVPKVWKRLMVTFLS F+ FF Y+ +A   S+ V+
Sbjct  64    STAAVVYTIASIYTDREVSFKKVMSVVPKVWKRLMVTFLSIFVAFFAYSVVAILVSSLVL  123

Query  739   ----WIFLALSF-RVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKS  575
                 ++F+   + +VF    + V + +Y +G +YM+I+WQLA+ VSVLE++ GFKAM+KS
Sbjct  124   IIASFVFIGFPYLKVFYSFGI-VLLVLYFMGVVYMTIVWQLASAVSVLEEACGFKAMTKS  182

Query  574   KQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfkl  395
             + L++GKM    + F  L+ +  ++ + F+  VV+G   +     RV  G++CL +   L
Sbjct  183   RALIKGKMWTARIIFFMLYLSYGVICMAFQNLVVHGVSMN--TATRVLFGVICLPLFLGL  240

Query  394   vvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
              +FGLV QTVIYFVCKS  HE I+KSALSDHL+VY  E VPL SKDVQ EQ
Sbjct  241   FLFGLVIQTVIYFVCKSNHHEKIEKSALSDHLDVYHEENVPLNSKDVQFEQ  291



>ref|XP_010030346.1| PREDICTED: uncharacterized protein LOC104420151 [Eucalyptus grandis]
Length=311

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 138/341 (40%), Positives = 198/341 (58%), Gaps = 36/341 (11%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDR++ E+QFLG   +Y E+ K+I + RKIF++I L+L+LPL I+F   + +  L F   
Sbjct  1     MDRDEHELQFLGFLGVYRETSKIILKWRKIFAEITLTLILPLWIVFALSEVLQSLSFKTN  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +  + + G                        +F  + VFS L TSAVVYTVAC+
Sbjct  61    WDNAWKFWSVELG------------------------FFVFIFVFSQLLTSAVVYTVACI  96

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y  + ++FKK++S   +VWKRLMVTF   F + FVYN +A    ++W+ + + F     +
Sbjct  97    YATKQITFKKIMSAWLRVWKRLMVTFFWCFALSFVYNVVAVGFLIVWLVILIKF---PGV  153

Query  697   P-LWVGVAV-----YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
             P L + +AV     Y VG +Y+++IWQLA+ +SVLED+YG KAM+KSK L++GK+ L V 
Sbjct  154   PALMIALAVILLILYLVGLVYITMIWQLASVISVLEDAYGRKAMAKSKGLIKGKIGLWVW  213

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
              FL +     LV  +F   V       + +   +GVGL+C+++L  LV+F LV QTVIYF
Sbjct  214   CFLGVLVCFVLVQALFGSLVFFD---VVHIGVEIGVGLICMMLLSMLVLFDLVMQTVIYF  270

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY HENID +  SDH EV L +         Q+EQ  V
Sbjct  271   VCKSYHHENIDSACFSDHPEVCLDDRPSEGQNAFQIEQLHV  311



>ref|XP_004164698.1| PREDICTED: uncharacterized protein LOC101229535 [Cucumis sativus]
Length=242

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 158/245 (64%), Gaps = 11/245 (4%)
 Frame = -3

Query  946  YFTCLLVFSLLstsavvytvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN  767
            Y    +V SLLSTSAVVYTVA +YT RD++FK V+SVVPKVWKRL++TFL  F+ F  Y+
Sbjct  2    YLVIFIVLSLLSTSAVVYTVASIYTGRDVAFKPVMSVVPKVWKRLLLTFLCVFISFVGYS  61

Query  766  FLAASAFVIWIFLALSFRVFADIP------LWVGVAVYTVGFLYMSIIWQLANTVSVLED  605
               AS  VI          F          L+V   +Y  G  Y++ IWQL+N +SVLED
Sbjct  62   I--ASLLVITFLFFFIILAFRTAGGGVFLFLYVVQILYLAGAFYLTAIWQLSNVISVLED  119

Query  604  SYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvg  425
            SYGFKAM KS  L++GK+   VV  L L   L  V  +F   VV        ++ +  +G
Sbjct  120  SYGFKAMGKSYGLVKGKLGTSVVIILCLSLPLGTVRFVFGHLVVRTSSLG--ILSKGTLG  177

Query  424  llcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVY-LGEYVPLKSKDVQL  248
            +LC L+ F   +  LVT+TV+YFVCKSY HENIDKSALSDHLEVY LGEYVPL+ +DVQL
Sbjct  178  ILCFLLFFIFFLLKLVTETVLYFVCKSYHHENIDKSALSDHLEVYLLGEYVPLRPRDVQL  237

Query  247  EQYQV  233
            E++QV
Sbjct  238  EKFQV  242



>gb|EYU23745.1| hypothetical protein MIMGU_mgv1a025495mg [Erythranthe guttata]
Length=312

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 134/339 (40%), Positives = 201/339 (59%), Gaps = 33/339 (10%)
 Frame = -3

Query  1237  MDREQE-EMQFLGLFDIYIESYKVIYRCR-KIFSQIALSLVLPLAIIFLAQKEVSQLIFS  1064
             M++E+E  +QFLG + I+ ES+ + + CR K+F QI ++ + PL++IFL + +     F 
Sbjct  1     MEKEEEIRIQFLGFYGIFRESFTIAFFCRNKLFGQITIATIFPLSLIFLLRAQ-----FF  55

Query  1063  NLRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytva  884
                 T   LE          ++   L            AYF   +  S+LST  VVY VA
Sbjct  56    EFMETLISLE----------KIGISLIK---------IAYFIFFIALSMLSTCVVVYAVA  96

Query  883   cvytAR-DLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVF  707
             C YT + D++F +VISVVPKVW+R+ VT + +F++  VYN +A S  + W+  +L+  + 
Sbjct  97    CSYTKKADITFVEVISVVPKVWRRVTVTLIWSFILVLVYNMIAFSILLPWL-ASLNPSMT  155

Query  706   ADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
               + L    A+Y +GF+Y+SI+W LA+ VSVLE+  G +AM K K L++GK V+    F 
Sbjct  156   KPVVLGSLFAIYMMGFVYISIVWHLASVVSVLEEDCGIEAMIKGKALVKGKTVISFAVFF  215

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              +     L+ ++F+RFVV+G  F       +G G++C  +L    + GLV QT++Y VCK
Sbjct  216   FMSSCFVLIEMVFQRFVVHGESFW----SEIGYGIICFFLLSGFTLLGLVVQTLVYMVCK  271

Query  346   SYQHENIDKSA-LSDHLEVYLGEYVPLKSKDVQLEQYQV  233
                 E ID+S  L++HLEVYLG+YV L+SKDVQLEQ  V
Sbjct  272   LNHREIIDESCLLANHLEVYLGDYVSLRSKDVQLEQVYV  310



>ref|XP_001779672.1| predicted protein [Physcomitrella patens]
 gb|EDQ55468.1| predicted protein [Physcomitrella patens]
Length=339

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 195/328 (59%), Gaps = 7/328 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD E +EM+ LG+  I  E+Y ++    ++F  ++L+LVLPL  +      ++  ++  +
Sbjct  2     MDSEPDEMRSLGVVGICKEAYNILQVHLRLFLSLSLTLVLPLGAVIFCHDLITHPLWRKI  61

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L   Q GS    +    L S+   L +    Y   +L FSLLST+A+VY+VA +
Sbjct  62    HWDSEKLGTEQMGSAARAQTQSSLDSELFGLGVITVIYVIFILAFSLLSTAAIVYSVASI  121

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + LS+ KVISVVPKVWKRL  TF+   ++ F+Y    A   VI++ LAL      ++
Sbjct  122   YTGKGLSYVKVISVVPKVWKRLFFTFVWAHILIFLYY--VALFVVIFLLLALQSATGMNV  179

Query  697   PLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              L++G+ V  V +    Y +++W LA+ VSVLEDSYG  A+ KS +L++GK  +G   FL
Sbjct  180   -LFLGIPVLIVFYTFLFYFNVVWHLASVVSVLEDSYGINALKKSTELIKGKRWVGCCVFL  238

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
                   F+V  ++   V +    H  + GRV  GL+ LL+   + + G++ QTV+YFVCK
Sbjct  239   IYTVCTFVVLFMYNVTVRSHHHVH-SLFGRVFFGLVLLLLWTAVTLIGILVQTVVYFVCK  297

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKS  263
             SY HE+ID+ ALS+HL+ YLGEY+PLK 
Sbjct  298   SYHHESIDRYALSEHLDGYLGEYMPLKG  325



>ref|XP_010664867.1| PREDICTED: uncharacterized protein LOC100259232 [Vitis vinifera]
Length=371

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 130/336 (39%), Positives = 198/336 (59%), Gaps = 8/336 (2%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ E EEM+ LG F IY +++++I   RKIF+QI L+ +LPL  I L    +S  +   +
Sbjct  1     MEVEHEEMKSLGAFGIYRKAFQIILPWRKIFTQIILAYILPLFFISLVNTHLSNSLLPKI  60

Query  1057  RHTESQ-LENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
                + + L  +Q  +     + D L+   A+  L +  Y     +FSL+STSA+VYT+AC
Sbjct  61    VDQDKKDLAETQVPTSNLTNIFDLLSFPSASYWLLQVTYTIYSFIFSLVSTSAIVYTMAC  120

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFAD  701
             +Y+ R+++F+ V SVVP V KRLM+T  + FLV   Y+ +A   F +   L ++F    +
Sbjct  121   IYSGREVTFRMVTSVVPNVLKRLMLTSFTIFLVVCTYHVVAFLVFALAAVL-IAFGPNTN  179

Query  700   IPLWVGVAVYTVGFL---YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
             + + + + V  +  +   YMS++WQLA+T+SVLEDSYGF+AM +S QL++GK+ +  + F
Sbjct  180   VGMSILLVVVVLYLMGLLYMSVVWQLASTISVLEDSYGFQAMKRSNQLIKGKVGVSTLIF  239

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
             L L    +++    +R VVNG    +          L L +L  L    +  QT+IYFVC
Sbjct  240   LNLGLLHYVLQKALERVVVNGESLGMVNRVAYANVCLSLFLLLGLFERVI--QTIIYFVC  297

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             KSY HE +DK ALSDHL+VY  EY  L SK   L++
Sbjct  298   KSYHHERVDKLALSDHLQVYTQEY-SLPSKGDNLDE  332



>ref|XP_001768541.1| predicted protein [Physcomitrella patens]
 gb|EDQ66692.1| predicted protein [Physcomitrella patens]
Length=338

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 133/333 (40%), Positives = 193/333 (58%), Gaps = 15/333 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDRE +EM+ LG+  I  E+Y ++    ++F  +AL+LVLPL  +      ++  ++  +
Sbjct  1     MDREPDEMRSLGVVGICKEAYNILQLHLRLFFSLALTLVLPLGAVIFCHDLITHPLWRKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                 ++L+  Q GS    +    L ++   L +    Y   +L FSLLST+A+VY+VA +
Sbjct  61    HWDSNELDMEQAGSAARAQTQSRLDAELFGLGVITVVYVIFVLAFSLLSTAAIVYSVASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR-----  713
             YT + LS+ KVISVVPKVWKRL  TFL   ++     FL   AF   +FL L+       
Sbjct  121   YTGKGLSYLKVISVVPKVWKRLFFTFLWAHVLI----FLYYVAFFTVLFLLLALEHATGM  176

Query  712   --VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
               +F  IP  V +  YT  F Y +++W LA+ VSVLE SYG  A+ KS +L++GK  +G 
Sbjct  177   NVLFLGIP--VLIVFYTFLF-YFNVVWHLASVVSVLEGSYGIDALKKSSELVKGKRWIGC  233

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
               FL      FLV L     +V        +VGRV  GL+ LL+   + + G++ QTV+Y
Sbjct  234   CVFLIYTVCTFLV-LFMYNLMVRTHHHVQSLVGRVFFGLMLLLLWTAVTLIGILVQTVVY  292

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSK  260
             FVCKSY +E+ID+ ALS+HL+ YLGEY+PLK  
Sbjct  293   FVCKSYHNESIDRYALSEHLDGYLGEYMPLKGP  325



>ref|XP_002278929.1| PREDICTED: uncharacterized protein LOC100249009 [Vitis vinifera]
Length=362

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 132/340 (39%), Positives = 202/340 (59%), Gaps = 11/340 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ EQEEM+ LG F IY +++++I   RKIF+QI L+ +LPL  I L    +S  +   +
Sbjct  1     MEVEQEEMKSLGAFGIYRKAFQIILPWRKIFTQIILAYILPLFFISLVNTHLSNSLLPKI  60

Query  1057  -RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCL-LVFSLLstsavvytva  884
                 +  L  +Q  +  +  + D L+   A+  L +   +T    +FSLLSTSA+VYT+A
Sbjct  61    VDQDKKDLAETQVPTSNHTNIFDLLSFPSASYWLLQQVTYTIYSFLFSLLSTSAIVYTMA  120

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA  704
             C+Y+ R ++F+ V SVVP V KRLM+T  + FLV   Y+ +A   F +   L ++F    
Sbjct  121   CIYSGRKVTFRMVTSVVPNVLKRLMLTSFTIFLVVCTYHVVAFLVFALAAVL-IAFGPNT  179

Query  703   DIPLWVGVAVYTVGFL---YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
             ++ + + + V  +  +   YMS++WQLA+T+SVLEDSYGF+AM +S QL++GK+ +  + 
Sbjct  180   NVGMSILLVVVVLYLMGLLYMSVVWQLASTISVLEDSYGFQAMKRSNQLIKGKVGVSTLI  239

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
             FL L    +++    +R VVNG    +          L L +L  L    +  QT+IYFV
Sbjct  240   FLNLGLLHYVLQKALERVVVNGESLGMVNRVAYANVCLSLFLLLGLFERVI--QTIIYFV  297

Query  352   CKSYQHENIDKSALSDHLEVYLGE--YVPLKSKDV-QLEQ  242
             CKSY HE +DK ALSDHL+VY  E   +PLK  ++ +L+Q
Sbjct  298   CKSYHHERVDKLALSDHLQVYTQEEYSLPLKGDNLGELKQ  337



>gb|KGN45907.1| hypothetical protein Csa_6G020210 [Cucumis sativus]
Length=292

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 136/289 (47%), Positives = 188/289 (65%), Gaps = 9/289 (3%)
 Frame = -3

Query  1087  EVSQLIFSNLRHTESQL-ENSQPGSPR-YQRLSDHLTSDfaalllfkfAYFTCLLVFSLL  914
             E+S L+F N  +  S L +N+Q    R Y  LSD +T       LF  +Y   L VFSLL
Sbjct  2     EISNLLFGNFFYQVSFLHKNNQDHDARKYNELSDLITPKLTFFWLFNISYIVFLFVFSLL  61

Query  913   stsavvytvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWI  734
             STSAVVYTVAC++T R++SFK++IS+VPKVWKRL+VTF   F  FFVYN LA  AF++ +
Sbjct  62    STSAVVYTVACIHTGREISFKQIISIVPKVWKRLVVTFFCVFASFFVYNLLAVFAFILLL  121

Query  733   FLA-LSFRVFADIPLWVGVA---VYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQL  566
             F+  + +  F D+   + V    +Y +G LY+S+I QL++ V+VLE+SYGFKAM KSK L
Sbjct  122   FILLVQYGPFGDVNGSIFVVFFILYFIGLLYLSVIVQLSSVVTVLEESYGFKAMVKSKAL  181

Query  565   LRGKMVLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvf  386
             L+G M++  +  L ++ +L ++   F + VV+G  F +   G +G+  L LL+ F L   
Sbjct  182   LKGNMLVATLMLLLINISLVIIQQAFVKLVVHGVWFGILGRGILGIVCLFLLLNFFLWQL  241

Query  385   glVTQTVIYFVCKSYQHENIDKSALSDHLEVY-LGEYVPLKSKDVQLEQ  242
              L  +TV+YFVCK    ENIDKSALS+HL+VY L  Y+PL  K V+LE 
Sbjct  242   VL--ETVLYFVCKEQHQENIDKSALSNHLQVYLLNGYIPLTPKSVELEN  288



>emb|CAG27628.1| hypothetical protein [Populus deltoides x Populus maximowiczii]
Length=138

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 111/140 (79%), Gaps = 2/140 (1%)
 Frame = -3

Query  652  MSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVV  473
            MSIIWQLA+ VSVLE++ GFKAM KS++LL+GKM + ++ F KL+ +   ++++F+  VV
Sbjct  1    MSIIWQLASVVSVLEEASGFKAMMKSRELLKGKMWVAIIIFFKLNLSSLALHILFENKVV  60

Query  472  NGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEV  293
            +G     G++ R   G+L LL+L  L +FGLV QTVIYFVCKSY HENIDKSALSDHLEV
Sbjct  61   HGSSL--GILNRASFGILSLLMLLVLYLFGLVIQTVIYFVCKSYHHENIDKSALSDHLEV  118

Query  292  YLGEYVPLKSKDVQLEQYQV  233
            YLGEYVPLKSKDVQLEQ+ V
Sbjct  119  YLGEYVPLKSKDVQLEQFDV  138



>ref|XP_010030338.1| PREDICTED: uncharacterized protein LOC104420144 [Eucalyptus grandis]
Length=339

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 142/338 (42%), Positives = 207/338 (61%), Gaps = 14/338 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + E++Q +G   I+ ES+K+I   +KIF+QI L  +LPL+IIFL + +V     S+ 
Sbjct  1     MDSDGEKLQHIGFLGIFKESFKIISSWKKIFTQITLLFILPLSIIFLVKVQV-----SDQ  55

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                    E    G     RL+  LT       L   AY   LLV SLLSTSAVVYTVAC 
Sbjct  56    MEQRIDWERHDYGRCGDNRLNVILTYQRLVYWLINIAYLVLLLVLSLLSTSAVVYTVACN  115

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + ++FKK++SVVPKVWK++ +TF+ +FL+   Y       FV+ + L + F  F  +
Sbjct  116   YTGKPITFKKIMSVVPKVWKQVSLTFIWSFLIHLAYGLCMLGTFVMGVVL-IGFSPFG-L  173

Query  697   PLWVG-VAVYTVGFLYMSIIWQLANTVSVL-EDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
              +W+  + V+ VGF+Y++I+WQLA+ VSVL E++YG KAM KS  L+ GK  +    FL 
Sbjct  174   AIWIILLIVFLVGFVYLNIVWQLASVVSVLEEENYGIKAMVKSINLIEGKRRVTSFIFLL  233

Query  523   LHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
             L      + ++++ F+ +GW+       ++ VG+ CL++L  L +F LV QTVIYFVCKS
Sbjct  234   LVLFYGGIMIVYQIFLPDGWNL----AFQLVVGIPCLVLLTFLFLFSLVIQTVIYFVCKS  289

Query  343   YQHENIDKSALSDHLEVYL-GEYVPLKSKDVQLEQYQV  233
             Y  E+ID+ AL++HLE Y   E     ++DVQ+EQ +V
Sbjct  290   YHGESIDRLALANHLEAYFQPEPQREATRDVQMEQGRV  327



>gb|AFK48911.1| unknown [Lotus japonicus]
Length=152

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 109/147 (74%), Gaps = 2/147 (1%)
 Frame = -3

Query  673  YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNL  494
            Y  G +Y+++IWQLA+ V+VLEDSYGFKAM KS +L++GKM L ++  L L+   FL+ L
Sbjct  8    YIAGLVYLTVIWQLASVVTVLEDSYGFKAMMKSNELMKGKMGLSILIILTLNVPSFLIYL  67

Query  493  IFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSA  314
            +  + VV G     G V +   G+LCL++L  L++FG V  +V+YFVCKSY H+NIDKSA
Sbjct  68   LSNKLVVQGLRL--GYVEKTAYGILCLILLSHLILFGHVIHSVLYFVCKSYHHQNIDKSA  125

Query  313  LSDHLEVYLGEYVPLKSKDVQLEQYQV  233
            LSDHLEVY GEY PLK+KDVQLE YQV
Sbjct  126  LSDHLEVYHGEYEPLKAKDVQLEHYQV  152



>ref|XP_010041176.1| PREDICTED: uncharacterized protein LOC104430112 [Eucalyptus grandis]
Length=323

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 122/335 (36%), Positives = 190/335 (57%), Gaps = 30/335 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + E++Q +G   I+ ES+K+I   +KIF+QI L  +LPL+IIFL + +VS  +   +
Sbjct  1     MDSDGEKLQHIGFLGIFKESFKIISSWKKIFTQITLLFILPLSIIFLVKVQVSDQMEQRI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                    E    G     RL+   +S  A   L+      C   ++              
Sbjct  61    -----DWERHDYGRCGDNRLNHTWSSSGAFPSLYFCGRIHCGCNYT--------------  101

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
                + ++FKK++SVVPKVWKR+ +TF+ +FL+   Y       FV+ + L + F  F  +
Sbjct  102   --GKPITFKKIMSVVPKVWKRVSLTFIWSFLIHLAYGLCMLGTFVMGVVL-IGFSPFG-L  157

Query  697   PLWVGV-AVYTVGFLYMSIIWQLANTVSVL-EDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
              +W+ +  V+ VGF+Y++I+WQLA+ VSVL E++YG KAM KS  L+ GK  +    FL 
Sbjct  158   AIWIILLIVFLVGFVYLNIVWQLASVVSVLEEENYGIKAMVKSINLIEGKRRVTSFIFLL  217

Query  523   LHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
             L      + ++++ F+ +GW+       ++ VG+ CL++L  L +F LV QTVIYFVCKS
Sbjct  218   LVLFYGGIMIVYQIFLPDGWNL----AFQLVVGIPCLVLLTFLFLFSLVIQTVIYFVCKS  273

Query  343   YQHENIDKSALSDHLEVYL-GEYVPLKSKDVQLEQ  242
             Y  E+ID+ AL++HLE Y   E     ++DVQ+EQ
Sbjct  274   YHGESIDRLALANHLEAYFQPEPQREATRDVQMEQ  308



>ref|XP_007041069.1| Polyadenylate-binding protein 1-B-binding protein [Theobroma 
cacao]
 gb|EOX96900.1| Polyadenylate-binding protein 1-B-binding protein [Theobroma 
cacao]
Length=321

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 136/342 (40%), Positives = 186/342 (54%), Gaps = 28/342 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  R  K F  I L+L+ PL+   LA    +  I +  
Sbjct  1     MDLAPEELQFLSIPDILRESIAIPKRSPKTFYLITLALIFPLSFAILAHSLFTHPILA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  QLE+     P   R       ++  L  F+F Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----QLESRPFADPAQTR------HEWTLLFTFQFFYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIF------LALSF  716
             YT++ +SF   IS +PKV+KRL +TF    ++ FVYN L  +  VI++         LSF
Sbjct  108   YTSKPVSFSSTISAIPKVFKRLFITFTWVSILMFVYNALLIAFLVIFVIAIDSRNTILSF  167

Query  715   RVFADIP-LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
               F  I  L++GV VY      ++ +W LA+ VSVLE  YGF AM KS +LL+G++ +  
Sbjct  168   LAFMVIVVLFLGVHVY------ITALWHLASVVSVLEPVYGFAAMKKSYELLKGRVKMAF  221

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             V          L+  IF   VV+G + +      V  G L  +++   +V  L  Q+V Y
Sbjct  222   VLVFGYLAICALIGGIFGMVVVHGGESYGVFGRIVVGGFLVGVLVIVNLVGLL-VQSVFY  280

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             +VCKSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E   V
Sbjct  281   YVCKSYHHQGIDKSALHDHLGGYLGEYVPLKS-SLQMENLDV  321



>ref|XP_011085153.1| PREDICTED: uncharacterized protein LOC105167226 [Sesamum indicum]
Length=317

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 132/339 (39%), Positives = 189/339 (56%), Gaps = 32/339 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  +  K FS + L+L+ PL+   LA    +  I S L
Sbjct  1     MDLGAEELQFLCISDILKESISIPKQSPKTFSLVTLTLIFPLSFAILAHSLFTHPILSEL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +        + P +P          SD+  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    Q--------TDPTAP---------ASDWTKLLIFQFCYLIFLFAFSLLSTAAVVFTVASL  103

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAAS-------AFVIWIFLALS  719
             YT++ +SF   I+ +P V+KRL +TFL   L   VYN +          A  +   L L 
Sbjct  104   YTSKPVSFSSTIAAIPTVFKRLFITFLWVSLSMLVYNIVLLGFLILLIIAMDMQNILLLL  163

Query  718   FRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
             F V   + L++G+ VY      ++ +W LA+ VSVLE  YG  AM KS +LL+GK+ +G 
Sbjct  164   FSVMVVLLLFLGIHVY------INALWHLASVVSVLEPVYGLAAMKKSYELLKGKIGMGF  217

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             V          ++N+ F   VV+G +    ++ R+ VG   + +L  + + GL+ Q+V Y
Sbjct  218   VLVFCYLAVCGVINMFFGGIVVHGGN-DYRVLTRIMVGGFLVGLLVIVNLVGLLVQSVFY  276

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             +VCKSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E 
Sbjct  277   YVCKSYHHQGIDKSALYDHLGGYLGEYVPLKS-SIQMEN  314



>emb|CDY69846.1| BnaAnng31730D [Brassica napus]
Length=321

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 138/337 (41%), Positives = 194/337 (58%), Gaps = 24/337 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q I S L
Sbjct  1     MDLQPEELQFLTIPQLVQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPILSKL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               ++       P S R    S H   D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  61    SSSD------PPNSDR----SRH---DWTVLLIFEFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + +SF   IS +PKV+KRL++TFL   L+ F YN      F++ +F+AL       +
Sbjct  108   YTGKTVSFSSTISAIPKVFKRLLITFLWVALLMFAYN-AVFFVFLVILFIALDMNS-VGL  165

Query  697   PLWVGVAV---YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVVF  533
              +  GV +   Y V  +Y + +W L + +SVLE  YG  AM K+ +LL+G  KM +G+VF
Sbjct  166   AVIAGVIISVLYFVVHVYFTALWHLGSVISVLEPVYGLAAMRKAYELLKGKAKMAMGLVF  225

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
                  F   L+   F   VV+G     G + R  VG L + VL  + + GL+ Q+V Y+V
Sbjct  226   VYL--FVCALIGGTFGSIVVHGGG-KFGTLTRTLVGGLLVGVLVMVNLVGLLVQSVFYYV  282

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             CKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE 
Sbjct  283   CKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLEN  318



>emb|CDX98243.1| BnaC07g08550D [Brassica napus]
Length=321

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 141/340 (41%), Positives = 196/340 (58%), Gaps = 30/340 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q I S L
Sbjct  1     MDLQPEELQFLTIPQLVEESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPILSKL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               ++       P S R    S H   D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  61    ASSD------PPNSDR----SRH---DWTVLLIFEFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + +SF   IS +PKV+KRL++TFL   L+ F YN      F++ +F+AL       +
Sbjct  108   YTGKTVSFSSTISAIPKVFKRLLITFLWVALLMFAYN-AVFFVFLVILFIALDMNS-VGL  165

Query  697   PLWVGVAV---YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVVF  533
              +  GV +   Y V  +Y + +W L + +SVLE  YG  AM K+ +LL+G  KM +G+VF
Sbjct  166   AVIAGVIISVLYFVVHVYFTALWHLGSVISVLEPVYGLSAMRKAYELLKGKTKMAMGLVF  225

Query  532   FLKLHFALFLVNLI---FKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVI  362
                    LFL  LI   F   VV+G     G + R  VG L + VL  + + GL+ Q+V 
Sbjct  226   VY-----LFLCALIGGTFGSIVVHGGG-KFGTLTRTLVGGLLVGVLVMVNLVGLLVQSVF  279

Query  361   YFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             Y+VCKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE 
Sbjct  280   YYVCKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLEN  318



>emb|CDX77557.1| BnaA07g06950D [Brassica napus]
Length=321

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 141/340 (41%), Positives = 196/340 (58%), Gaps = 30/340 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q I S L
Sbjct  1     MDLQPEELQFLTIPQLVEESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPILSKL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               ++       P S R    S H   D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  61    ASSD------PPNSDR----SRH---DWTVLLIFEFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + +SF   IS +PKV+KRL++TFL   L+ F YN      F++ +F+AL       +
Sbjct  108   YTGKTVSFSSTISAIPKVFKRLLITFLWVALLMFAYN-AVFFVFLVILFIALDMNS-VGL  165

Query  697   PLWVGVAV---YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVVF  533
              +  GV +   Y V  +Y + +W L + +SVLE  YG  AM K+ +LL+G  KM +G+VF
Sbjct  166   AVIAGVIISVLYFVVHVYFTALWHLGSVISVLEPVYGLAAMRKAYELLKGKAKMAMGLVF  225

Query  532   FLKLHFALFLVNLI---FKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVI  362
                    LFL  LI   F   VV+G     G + R  VG L + VL  + + GL+ Q+V 
Sbjct  226   VY-----LFLCALIGGTFGSIVVHGGG-KFGTLTRTLVGGLLVGVLVMVNLVGLLVQSVF  279

Query  361   YFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             Y+VCKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE 
Sbjct  280   YYVCKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLEN  318



>ref|XP_010260589.1| PREDICTED: uncharacterized protein LOC104599665 [Nelumbo nucifera]
Length=319

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 123/335 (37%), Positives = 186/335 (56%), Gaps = 18/335 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL L DI  ES  +     + FS I L+L+ PL+   LA    +  +    
Sbjct  1     MDLAAEELQFLTLKDIVKESVSIPKSSPRTFSLITLTLIFPLSFAILAHSLFTHPLLK--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  Q++   P  P+ +        ++  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----QIDTLSPSDPQARH-------EWTLLLIFQFCYLIFLFAFSLLSTAAVVFTVASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF   +S +P+V++RL +TF+   L+  VYN +  +A V  I    +      +
Sbjct  107   YTSKPVSFTSTLSAIPRVFRRLFITFIYVSLLMIVYNVVFVAALVALIIAIDTQNALLFL  166

Query  697   PLWVGV-AVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
                + + A++ V  +Y++ +W LA+ +SVLE  YGF AM KS++LL+GK  +  V     
Sbjct  167   FSLLAIFALFLVVHVYITALWHLASVISVLEPVYGFAAMKKSRELLKGKTQMAAVLVFAY  226

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
                  ++  +F   VV+G D+   +    G  L+ +LV+  LV      Q+V Y+VCKSY
Sbjct  227   LSICGVIGGVFGSIVVHGGDYGAFVRIVAGGFLVGVLVIVNLVGLL--VQSVFYYVCKSY  284

Query  340   QHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
              H+ IDKSAL DHL  YLGEYVPLKS  +Q+E  +
Sbjct  285   HHQGIDKSALYDHLGGYLGEYVPLKS-SIQMESLE  318



>ref|XP_010042509.1| PREDICTED: uncharacterized protein LOC104431600 [Eucalyptus grandis]
Length=300

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 129/335 (39%), Positives = 183/335 (55%), Gaps = 35/335 (10%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDR+Q E+QFLG   +Y ES K+I + R+IF+QI L+L+L L  +  + +  +  +   +
Sbjct  1     MDRDQHELQFLGFLGVYRESSKIILKGREIFAQITLTLILHLHRLPRSLQGFTAPLL-QV  59

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             R    +L   Q   P  Q L   L +      L +   F  + +FSLLSTSAV+YT AC+
Sbjct  60    RQVRDRLRQRQEAQPEVQDLCRMLKN----FWLIELGSFISVFIFSLLSTSAVLYTGACI  115

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y  + ++  K++SVVP+                     +    F +   L ++  V   I
Sbjct  116   YATKQITITKMMSVVPR--------------------LIVVRQFSVGPALGIALGVILLI  155

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
                    +Y VGF+Y+++I Q A+ +SVLED+YG KA++KSK L  GKM L V  FL + 
Sbjct  156   -------LYVVGFVYITMICQSASVISVLEDAYGRKAIAKSKGLTNGKMGLRVWCFLGVF  208

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
                 LV  +F    V   D  + +  ++GVGL+C ++L  LV+F LV QTVIYFVCKSY 
Sbjct  209   VCSVLVQALFGSLGV--LDV-VPIGVKIGVGLICTMLLSMLVLFDLVVQTVIYFVCKSYH  265

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             HENID S LSDHLE   G       K  Q+EQ+QV
Sbjct  266   HENIDSSCLSDHLEFCRGYCHSEGQKAAQVEQFQV  300



>ref|XP_009115016.1| PREDICTED: uncharacterized protein LOC103840270 [Brassica rapa]
Length=321

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 139/345 (40%), Positives = 198/345 (57%), Gaps = 34/345 (10%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q + +  
Sbjct  1     MDLQPEELQFLTIPQLLQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPLLA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L++S P +      SD    D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----KLDSSDPPN------SDRSRHDWTKLLIFQFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLAL-----SFR  713
             YT + +SF   IS +PKV+KRL++TFL   L+ F YN      F++ +F+AL        
Sbjct  108   YTGKPVSFSSTISAIPKVFKRLLITFLWVALLMFAYN-AVFFVFLVILFVALDMNSVGLA  166

Query  712   VFADI---PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMV  548
             VFA +    L+ GV VY       + +W L + +SVLE  YG  AM K+ +LL+G  KM 
Sbjct  167   VFAGLLIAVLYFGVHVY------FTALWHLGSVISVLEPVYGLAAMRKAYELLKGKVKMA  220

Query  547   LGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
              G+VF   L  A  L+ + F   VV+G     G   R  VG L + VL  + + GL+ Q+
Sbjct  221   TGLVFVYLLLCA--LIGVTFGSIVVHGGG-KYGTFTRTLVGGLLVGVLVVVNLVGLLVQS  277

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             V Y+VCKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE  ++
Sbjct  278   VFYYVCKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLENLEI  321



>gb|KFK44925.1| hypothetical protein AALP_AA1G320500 [Arabis alpina]
Length=321

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 129/338 (38%), Positives = 192/338 (57%), Gaps = 20/338 (6%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  ++ ES  +  R  + F  I L+L+ PL+   LA    +Q I S  
Sbjct  1     MDLQPEELQFLSIPQLFQESISIKKRSPRTFYLITLTLIFPLSFAILAHSLFTQPILS--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L+ S P +    R       D+  LL+F+F+Y   L  FSLLST+A+V+TVA +
Sbjct  59    -----KLDKSDPPNSEKSR------HDWTLLLIFQFSYLIFLFAFSLLSTAAIVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + +SF   IS +PKV+KRL +TFL   L+ F YN      F++ + +AL    F  +
Sbjct  108   YTGKPVSFSSTISAIPKVFKRLFITFLWVALLMFAYN-AVFFVFLVILLVALDLNSFG-L  165

Query  697   PLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              +  G+ +  + F   ++ + +W L + +SVLE  YG  AM K  +LL+GK  + +V   
Sbjct  166   AVLAGIVISVLYFGVHVFFTALWHLGSVISVLEPVYGLAAMRKGYELLKGKTKMAMVLVF  225

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
                    L+ ++F   VV+G     G + R  VG L + VL  + + GL+ Q+V Y+VCK
Sbjct  226   VYLVICGLIGVVFGSVVVHGGG-KYGTLSRTLVGGLLVGVLVMVNLVGLLIQSVFYYVCK  284

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY H+NIDK+AL DHL  YLGEYVPLKS ++QLE   +
Sbjct  285   SYHHQNIDKTALYDHLGGYLGEYVPLKS-NIQLENLDI  321



>ref|XP_011100147.1| PREDICTED: uncharacterized protein LOC105178380 [Sesamum indicum]
Length=335

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 144/345 (42%), Positives = 204/345 (59%), Gaps = 20/345 (6%)
 Frame = -3

Query  1237  MDREQE-EMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             MDREQ  ++Q LG + I  ES+ + +  RKIFSQI    + PL ++FLA  +VS  +F+N
Sbjct  1     MDREQSHQLQLLGFYGILRESFTITFSKRKIFSQITFLTIFPLCLLFLAHLQVSNFLFAN  60

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             + H E  L ++Q     +  +S  L S+     L K AY    L  SLLSTSAVV TVAC
Sbjct  61    IIHNEEALHHAQD----FSSISGALPSEIVLFWLIKTAYLIFFLALSLLSTSAVVCTVAC  116

Query  880   vytARDLSFKKVIS-VVPKVWKRLMvtflstflvffVYNFLA-----ASAFVIWIFLALS  719
              YT ++     V++ VVP VWKRL+VTF  +F++   YN +A      S  V     + +
Sbjct  117   DYTRKETMLTDVMTAVVPNVWKRLLVTFAWSFIIVLSYNVVAFLVLLPSPLVSSTSPSPA  176

Query  718   FRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
               VF+ +       VY VGF+Y+SIIW LA  VSVLE   G +AM +SK+L+RGK+V+  
Sbjct  177   RAVFSGVLF----VVYVVGFVYVSIIWHLATVVSVLEQECGIEAMMRSKELVRGKVVISG  232

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
               FL L+    L+ + F+RFVV   D      GR+G G++ LL+L  L + GL+ QTV+Y
Sbjct  233   GVFLFLNSCFVLIQVGFERFVVV--DVGGSFWGRIGSGIVGLLLLCGLTLLGLIVQTVVY  290

Query  358   FVCKSYQHENIDKSALSDH--LEVYLGEYVPLKS-KDVQLEQYQV  233
             FVC++ Q E++     S H  +EVYLG+Y  L+S +DV+ +Q  V
Sbjct  291   FVCRTCQGEDVVGKMWSGHDEVEVYLGDYALLRSDEDVRFQQLYV  335



>gb|EYU43665.1| hypothetical protein MIMGU_mgv1a026880mg [Erythranthe guttata]
Length=317

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 134/341 (39%), Positives = 194/341 (57%), Gaps = 36/341 (11%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  +  K F  I L+L+ PL+   LA    +  I S L
Sbjct  1     MDLAAEELQFLSIPDILKESISIPKQSPKTFYLITLTLIFPLSFAILAHSLFTHPILSQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                              Q  +   TSD++ LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    -----------------QADTTAATSDWSKLLVFQFFYLIFLFAFSLLSTAAVVFTVASL  103

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALS-------  719
             YT++ +SF   I+ +P V++RL +TF+    +  VYN +    F++ + +A+        
Sbjct  104   YTSKPVSFSSTIAAIPSVFRRLFLTFMWVSTLMVVYN-IVFLVFLVLLIIAVDTQNVFLF  162

Query  718   -FRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLG  542
              F +     L++GV VY      +S +W LA+ VSVLE  YG  AM KS +LL+GK  +G
Sbjct  163   LFSIIVVFLLFLGVHVY------ISALWHLASVVSVLEPIYGIDAMKKSYELLKGKTRMG  216

Query  541   -VVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTV  365
               + F+ L     ++N IF   VV+G D   G++ R+ VG   + VL  + + GL+ Q+V
Sbjct  217   FAIVFVYLAIC-GVINGIFGSIVVHGGD-DYGVLVRIVVGGFLVGVLVIVNLVGLLVQSV  274

Query  364   IYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
              Y+VCKSY H++IDKSAL DHL  YLGEYVPLKS ++Q+E 
Sbjct  275   FYYVCKSYHHQSIDKSALCDHLGGYLGEYVPLKS-NIQMEN  314



>ref|XP_008383297.1| PREDICTED: uncharacterized protein LOC103446015 [Malus domestica]
 ref|XP_008383298.1| PREDICTED: uncharacterized protein LOC103446015 [Malus domestica]
 ref|XP_009353976.1| PREDICTED: uncharacterized protein LOC103945165 [Pyrus x bretschneideri]
Length=320

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 130/340 (38%), Positives = 195/340 (57%), Gaps = 25/340 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI+ ES  +  +  K F  I L+L+ PL+   LA       +F++ 
Sbjct  1     MDLAPEELQFLTIPDIFRESTSIPKQSPKTFYLITLTLIFPLSFAILAHS-----LFTHP  55

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                + Q  ++ P    ++          + LLLF+F Y   L  FSLLST+AVV+T A +
Sbjct  56    LLNQLQASSTDPAQLHHKW---------SLLLLFQFCYLIFLFAFSLLSTAAVVFTAASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALS-----FR  713
             YT++ +SF   +S +PKV+KRL +TFL   L+   YNF+    F+I + LA+        
Sbjct  107   YTSKPVSFSNTLSAIPKVFKRLFITFLWVSLLMVCYNFVFV-GFLILLILAIDTHNPFLL  165

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
             +F+ I +++   ++ V  +Y++ +W LA+ VSVLE  YGF AM KS +LL+GK+ +  V 
Sbjct  166   LFSAIVIFL---LFLVVHVYITALWHLASVVSVLEPVYGFAAMKKSYELLKGKVGMAFVL  222

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
                      ++  +F   VV+G +   G+  R+ VG   + VL  + + GL+ Q+V Y+V
Sbjct  223   VFGYLTLCAVIGAVFGSVVVHGGE-DYGVFVRIVVGGFLVGVLVIVNLVGLLLQSVFYYV  281

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             CKSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E   V
Sbjct  282   CKSYHHQEIDKSALHDHLGGYLGEYVPLKS-SIQMENLDV  320



>ref|XP_009102672.1| PREDICTED: uncharacterized protein LOC103828788 [Brassica rapa]
Length=356

 Score =   137 bits (346),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 194/339 (57%), Gaps = 24/339 (7%)
 Frame = -3

Query  1243  DAMDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFS  1064
               MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q I S
Sbjct  34    QGMDLQPEELQFLTIPQLVQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPILS  93

Query  1063  NLRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytva  884
              L  ++       P S R    S H   D+  LL+F+F+Y   L  FSL ST+AVV+TVA
Sbjct  94    KLASSD------PPNSDR----SRH---DWTVLLIFEFSYLIFLFAFSLFSTAAVVFTVA  140

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA  704
              +YT + +SF   IS +PKV+KRL++TFL   L+ F YN +    F++ +F+AL      
Sbjct  141   SLYTGKTVSFSSTISAIPKVFKRLLITFLWVALLMFAYNAVFF-VFLVILFIALDMNS-V  198

Query  703   DIPLWVGVAV---YTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGV  539
              + +  GV +   Y V  +Y + +W L + +SVLE  YG  AM K+ +LL+G  KM +G+
Sbjct  199   GLAVIAGVIISVLYFVVHVYFTALWHLGSVISVLEPVYGLAAMRKAYELLKGKAKMAMGL  258

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             VF     F   L+   F   VV+G     G + R  VG L + VL  + + GL+ Q+V Y
Sbjct  259   VFVYL--FVCALIGGTFGSIVVHGGG-KFGTLTRTLVGGLLVGVLVMVNLVGLLVQSVFY  315

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             +VCKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE 
Sbjct  316   YVCKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLEN  353



>gb|KDP30542.1| hypothetical protein JCGZ_15251 [Jatropha curcas]
Length=321

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 130/342 (38%), Positives = 191/342 (56%), Gaps = 28/342 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD  QEE+QFL L DI  ES  +  R  K F  I L+L+ PL+   LA    +  + ++L
Sbjct  1     MDLAQEELQFLTLPDILRESISIPKRSPKTFYLITLTLIFPLSFAILAHSLFTHPLLAHL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                 S  EN           + H   ++  LL+ +F Y   L  FSLLST+AVV+TVA +
Sbjct  61    EDHPSADENQ----------TRH---EWTLLLIIQFCYVIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR---  713
             YT++ +SF   I+ +PKV+KRL +TF    L+  +YN  FL    F++ + +A+  +   
Sbjct  108   YTSKPVSFSSTIAAIPKVFKRLFITFFWVSLLMLLYNSIFLI---FLVILIIAIDTQNPI  164

Query  712   --VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
               VF+ I ++V   ++ V  ++++ +W LA+ VSVLE  YGF AM KS +LL+GK  +  
Sbjct  165   LVVFSLIVIFV---LFLVVHVFITALWHLASVVSVLEPVYGFAAMKKSYELLKGKTRVAA  221

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             V          ++  IF   VV+G + +      V  G L  +++   +V  L  Q+V Y
Sbjct  222   VLVFGYLAICGVIGGIFGSVVVHGGESYGVFTRIVVGGFLVGVLVIVNLVGLL-VQSVFY  280

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             +VCKSY H+ IDKSAL +HL  YLGEYVPLKS  VQ+E   +
Sbjct  281   YVCKSYHHQGIDKSALHEHLGGYLGEYVPLKS-SVQMENLDI  321



>emb|CDY43164.1| BnaCnng10920D [Brassica napus]
Length=321

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 134/340 (39%), Positives = 197/340 (58%), Gaps = 24/340 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q + +  
Sbjct  1     MDLQPEELQFLTIPQLLQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPLLA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L++S P +      SD    D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----KLDSSDPPN------SDRSRHDWTKLLIFQFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + +SF   IS +PKV+KRL++TFL   L+ F YN      F++ +F+AL       +
Sbjct  108   YTGKPVSFSSTISAIPKVFKRLLITFLWVALLMFAYN-AVFFVFLVILFVALDMNS-VGL  165

Query  697   PLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVVF  533
              +  G+ +  + F   +Y + +W L + +SVLE  YG  AM K+ +LL+G  KM  G+VF
Sbjct  166   AVIAGLLIAVLYFGVHVYFTALWHLGSVISVLEPVYGLAAMRKAYELLKGKVKMATGLVF  225

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
                L  A  L+ + F   VV+G     G + R  VG L + VL  + + GL+ Q+V Y+V
Sbjct  226   VYLLLCA--LIGITFGSIVVHGGG-KYGTLTRTLVGGLLVGVLVVVNLVGLLVQSVFYYV  282

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             CKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE   +
Sbjct  283   CKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLENLDI  321



>ref|XP_010540664.1| PREDICTED: uncharacterized protein LOC104814356 [Tarenaya hassleriana]
Length=321

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 130/343 (38%), Positives = 187/343 (55%), Gaps = 36/343 (10%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD E EE+QFL +  + +ES  +  R  K F  + L+L+ PL+   LA    +  I   L
Sbjct  1     MDLEPEELQFLTIPQVLVESISITKRSPKTFYFVTLTLIFPLSFAILAHSLFTHPILVKL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +S        S R +        D+  LL+F+F Y   L VFSLLST+AVV+TVA +
Sbjct  61    DSVDSF------NSARARH-------DWTVLLIFQFCYLIFLFVFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFL--------AL  722
             YTA+ +SF   IS +PKV+KRL +TFL   L+   YN    S F +++ +         L
Sbjct  108   YTAKPVSFSSAISAIPKVFKRLFITFLWIALLMLAYN----SVFFVFLVILLVAIDKNKL  163

Query  721   SFRVFADIP---LWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKM  551
                V A +    L+ GV VY      ++ +W L + VSVLE  YG+ AM K  +LL+G+ 
Sbjct  164   GLAVLAGLVISVLYFGVHVY------ITALWHLGSVVSVLEPIYGYAAMKKGYELLKGRA  217

Query  550   VLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQ  371
              +G++          L+  +F+  VV G + H      V  GLL  +++   +V  L  Q
Sbjct  218   QMGMILVFVYLILCTLIGGVFRSVVVYGGEKHGIWARIVIGGLLVGVLVIVNLVALL-IQ  276

Query  370   TVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             +V Y+VCKSY HE+IDK+AL DHL  YLGEY+PLKS ++Q+E 
Sbjct  277   SVFYYVCKSYHHESIDKTALYDHLGGYLGEYLPLKS-NIQMED  318



>emb|CDY02362.1| BnaA09g25400D [Brassica napus]
Length=321

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 134/340 (39%), Positives = 196/340 (58%), Gaps = 24/340 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q + +  
Sbjct  1     MDLQPEELQFLTIPQLLQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPLLA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L++S P +      SD    D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----KLDSSDPPN------SDRSRHDWTKLLIFQFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + +SF   IS +PKV+KRL++TFL   L+ F YN      F++ +F+AL       +
Sbjct  108   YTGKPVSFSSTISAIPKVFKRLLITFLWVALLMFAYN-AVFFVFLVILFVALDMNS-VGL  165

Query  697   PLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVVF  533
              +  G+ +  + F   +Y + +W L + +SVLE  YG  AM K+ +LL+G  KM  G+VF
Sbjct  166   AVIAGLLIAVLYFGVHVYFTALWHLGSVISVLEPVYGLAAMRKAYELLKGKVKMATGLVF  225

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
                L  A  L+ + F   VV+G     G   R  VG L + VL  + + GL+ Q+V Y+V
Sbjct  226   VYLLLCA--LIGVTFGSIVVHGGG-KYGTFTRTLVGGLLVGVLVVVNLVGLLVQSVFYYV  282

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             CKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE   +
Sbjct  283   CKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLENLDI  321



>emb|CDP20309.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 125/306 (41%), Positives = 180/306 (59%), Gaps = 22/306 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAI-IFLAQKEVSQLIFSN  1061
             M+ + EEM  +GL DIY E+Y++I R RK F  I   L+LPL+  I +A K++S L F++
Sbjct  1     MNTKVEEMHLMGLADIYTEAYRIISRSRKTFRDITFILILPLSCFILIASKDLSALTFTS  60

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
                         P  P +          +     F   Y +CL+++  +STS VV+T + 
Sbjct  61    --------SGDLPDFPSF---------GWDFFWFFMVVYLSCLIIYYNMSTSTVVFTASS  103

Query  880   vytARD--LSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVF  707
             VY + D   SFKKV +VVP+ W+RL VTFL  F  F VY+   A        + +    F
Sbjct  104   VYGSGDNQPSFKKVRNVVPQAWERLTVTFLCNFFSFLVYSVTIAMITTFLSAITIGKYQF  163

Query  706   ADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
                 L V + VY VGF+YM++I QLA+ VSVLEDSYGF+AM KSKQL++G++V+ +  F 
Sbjct  164   TQKLLLVVLPVYAVGFVYMTVICQLASVVSVLEDSYGFEAMIKSKQLIKGRLVMTMFIFC  223

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
             +L+ +  L++++F + VV G      M+ RV  GL+CL  L  L++FGLV QT++YFVCK
Sbjct  224   QLNCSFALLHILFAKTVVYGHSL--LMLQRVAFGLICLWSLCTLILFGLVVQTIVYFVCK  281

Query  346   SYQHEN  329
             SY  E 
Sbjct  282   SYHLET  287



>ref|XP_002523654.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38740.1| conserved hypothetical protein [Ricinus communis]
Length=321

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 188/341 (55%), Gaps = 26/341 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  R  K F  I L+L+ PL+   LA    +  + S  
Sbjct  1     MDLAPEELQFLTIPDILRESISIPKRSPKAFYLITLTLIFPLSFAILAHSLFTHPLLS--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  QLE+     P   R       ++  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----QLEDHPSADPSQTR------HEWTLLLIFQFCYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF   IS +PKV+KRL VTFL   L+  +YN    S F++++ + L   + A  
Sbjct  108   YTSKPVSFSSTISAIPKVFKRLFVTFLWVSLLMVLYN----SVFLVFLVI-LVIAIDAQN  162

Query  697   PLWV------GVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
             PL V         ++ V  +Y++ +W LA+ VSVLE  YG  AM KS +LL+G++ + V+
Sbjct  163   PLLVIFSLLVIFLLFLVVHVYITALWHLASVVSVLEPLYGVAAMKKSYELLKGRIRVAVI  222

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
                       ++  IF   VV+G D +      V  G L  +++   +V  L  Q+V Y+
Sbjct  223   LVFGYLAICGVIGGIFGSVVVHGGDSYGVFTRIVVGGFLVGVLVIINLVGLL-VQSVFYY  281

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY H+ IDK AL +HL  YLGEYVPLKS ++Q+E   V
Sbjct  282   VCKSYHHQGIDKIALHEHLGGYLGEYVPLKS-NIQMENLDV  321



>ref|XP_010538302.1| PREDICTED: uncharacterized protein LOC104812705 [Tarenaya hassleriana]
Length=323

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 124/338 (37%), Positives = 188/338 (56%), Gaps = 26/338 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD E EE+QFL +  + +ES  +  R  + F  I L+L+ PL++  LA    +  I   L
Sbjct  1     MDLEPEELQFLTIPQVLVESISITKRSPRSFYLITLTLIFPLSLAILAHSLFTHPIIVKL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +S        S R +        D+  LL+ +F Y   L  FSLLST+A V+TVA +
Sbjct  61    DSVDSY------NSARARH-------DWTVLLVIQFCYLIFLFAFSLLSTAAAVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN---FLAASAFVIWIFLALSFRVF  707
             YTA  +SF   I  +PKV+KRL +TFL   L+ F YN   FL    F++ + +A+   + 
Sbjct  108   YTASPVSFSSTIYAIPKVFKRLFITFLWIALLMFAYNAVFFL----FLVMLLIAIDMNML  163

Query  706   ADIPLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
               + ++ G+ +  + F   +Y++ +W L + VSVLE  YG+ AM K  +LL+G+  +G+V
Sbjct  164   G-LAIFAGLVISLLYFGVHVYITALWHLGSVVSVLEPIYGYAAMKKGYELLKGRTQMGMV  222

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
                       L+  +F+  VV+G + H      V  G L  +++   +V  L+ Q+V Y+
Sbjct  223   LVFVYLILCTLIGGVFRSVVVHGGENHGIWTRIVIGGSLVGVLVIVNLVGLLI-QSVFYY  281

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             VCKSY  E+IDK+AL DHL  YLGEYVPLKS ++Q+E 
Sbjct  282   VCKSYHRESIDKTALHDHLGGYLGEYVPLKS-NIQMEN  318



>ref|XP_006415365.1| hypothetical protein EUTSA_v10008216mg [Eutrema salsugineum]
 gb|ESQ33718.1| hypothetical protein EUTSA_v10008216mg [Eutrema salsugineum]
Length=321

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 131/335 (39%), Positives = 191/335 (57%), Gaps = 20/335 (6%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q I +  
Sbjct  1     MDLQPEELQFLTIPHLLQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPILA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L++S P +      SD    D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----KLDSSDPPN------SDRSRHDWTVLLIFQFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + +SF   IS +PKV+KRL++TFL   L+ F YN      F++ +F+AL       +
Sbjct  108   YTGKPVSFSSTISAIPKVFKRLLITFLWVALLMFAYN-AVFFVFLVILFVALDLNSIG-L  165

Query  697   PLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              +  G+ +  + F   +Y + +W L + +SVLE  YG  AM K+ +LL+GK  + +V   
Sbjct  166   AVIAGILISVLYFGVHVYFTALWHLGSVISVLEPVYGLAAMRKAYELLKGKTKMAMVLVF  225

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
                    L+   F   VV+G     G + R  VG L + VL  + + GL+ Q+V Y+VCK
Sbjct  226   VYLLVCGLIGGAFGGIVVHGGG-KFGTLTRTLVGGLLVGVLVMVNLVGLLVQSVFYYVCK  284

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             SY H+ IDKSAL DHL  YLG+YVPLKS ++QLE 
Sbjct  285   SYHHQAIDKSALYDHLGGYLGDYVPLKS-NIQLEN  318



>ref|XP_008371897.1| PREDICTED: uncharacterized protein LOC103435294 [Malus domestica]
Length=320

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 131/340 (39%), Positives = 196/340 (58%), Gaps = 25/340 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  +  K F  I L+L+ PL+   LA       +F++ 
Sbjct  1     MDLAPEELQFLTIPDILRESTSIPKQSPKTFYLITLTLIFPLSFAILAHS-----LFTHP  55

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                + Q  ++ P           L  ++  LLLF+F Y   L  FSLLST+AVV+T A +
Sbjct  56    LLNQLQGPSTDPA---------QLHQEWTLLLLFQFCYLIFLFAFSLLSTAAVVFTAASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR-----  713
             YT++ +SF   +S +PKV+KRL +TFL   L+ F YN L    F++ + LA+  +     
Sbjct  107   YTSKPVSFSNTLSAIPKVFKRLFITFLWVSLLMFCYN-LVFVGFLVLLILAIDTQNSFLL  165

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
             +F+ I +++   ++ V  +Y++ +W LA+ VSVLE  YGF AM KS +LL+GK+ +  V 
Sbjct  166   LFSGIVIFL---LFLVVHVYITALWHLASVVSVLEPIYGFAAMKKSYELLKGKVGMAFVL  222

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
                      +++ +F   VV+G +   G+  R+ VG   + VL  + + GL+ Q+V Y+V
Sbjct  223   VFGYLTICGVISAVFGSVVVHGGE-DYGVFVRIVVGGFXVCVLVIVNLVGLLLQSVFYYV  281

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             CKSY H+ IDK AL DHL  YLGEYVPLKS +VQ+E   V
Sbjct  282   CKSYHHQGIDKGALHDHLGGYLGEYVPLKS-NVQMENLDV  320



>emb|CDP11268.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 132/340 (39%), Positives = 193/340 (57%), Gaps = 33/340 (10%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  +  K F  I LSL+ PL+   LA    +  I S  
Sbjct  1     MDLSLEELQFLTIPDILKESVSIPKQSPKTFYLITLSLIFPLSFAILAHSLFTHPILS--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  QL+    GS        H TS +  LL F+F Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----QLQADPAGS--------H-TSQWTKLLTFQFCYLIFLFAFSLLSTAAVVFTVASL  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF   ++ +P V+KRL VTF+   L   +YN +    F++ + +A+      ++
Sbjct  105   YTSKPVSFSSTMAAIPSVFKRLFVTFMWVTLTMVIYNVIFI-GFLVLLIIAVDTE---NV  160

Query  697   PLWV-----GVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--MVLGV  539
             PL++        ++ V  +Y+S +W LA+ VSVLE  YGF AM KS +LL+G+  +  G+
Sbjct  161   PLFLFSMVVVFVLFLVVHVYISALWHLASVVSVLEPVYGFAAMKKSYELLKGRTRIAFGL  220

Query  538   VF-FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVI  362
             VF +L +     ++N +F   VV+G D +  +   +  G L  +++   +V  L  Q+V 
Sbjct  221   VFGYLAI---CGVINALFGSIVVHGGDSYGVLPRILVGGFLVGVLVIVNLVGLL-VQSVF  276

Query  361   YFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             Y+VCKSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E 
Sbjct  277   YYVCKSYHHQGIDKSALYDHLGGYLGEYVPLKS-SIQMEN  315



>ref|XP_010058033.1| PREDICTED: uncharacterized protein LOC104445812 [Eucalyptus grandis]
Length=322

 Score =   134 bits (336),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 131/337 (39%), Positives = 192/337 (57%), Gaps = 21/337 (6%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + D+  ES  +  R  K F  I LSL+ PL+   LA    +  + +  
Sbjct  1     MDLAPEELQFLTISDVLRESVAIPKRSPKTFYLITLSLIFPLSFAILAHSLFTHPLVA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L++     P   R       ++AAL  F+F Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----RLQDPAGDDPARTR------REWAALFAFQFGYLLFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR-----  713
             YTA+ +SF   ++ +PKV+KRL VTFL   L+  VYN L  +AFV+ + +A+  R     
Sbjct  108   YTAKPVSFASTLAAIPKVFKRLFVTFLWVTLLMVVYN-LVFAAFVVLLVIAIDTRSAALG  166

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
             +F+   ++V   ++ V  +Y++ +W +A+ VSVLE   GF AM KS +LL+G+ ++  V 
Sbjct  167   LFSLFVIFVIFLLFLVVHVYITALWHMASVVSVLEPILGFAAMKKSYELLKGRTLMAAVL  226

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
                     +L+N +F   VV+G D H      V  G L  +++   +V  L  Q+V Y+V
Sbjct  227   VFVYLVICWLINGVFAGVVVHGGDSHGVFGRIVVGGFLVGVLVIVNLVGLL-VQSVFYYV  285

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             CKSY H+ IDK+AL DHL  YLGEYVPLKS  +Q+E 
Sbjct  286   CKSYHHQGIDKTALHDHLGGYLGEYVPLKS-SIQMED  321



>ref|XP_008245148.1| PREDICTED: uncharacterized protein LOC103343260 [Prunus mume]
Length=320

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 135/342 (39%), Positives = 196/342 (57%), Gaps = 29/342 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  +  K F  I L+L+ PL+   LA       +F++ 
Sbjct  1     MDLAPEELQFLTIPDILRESTSIPKQSPKTFYLITLTLIFPLSFAILAHS-----LFTHP  55

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                + Q  ++ P           L   +  LLLF+F Y   L  FSLLST+AVV+TVA +
Sbjct  56    LLNQLQGPSTDPA---------QLHHKWTVLLLFQFCYLIFLFAFSLLSTAAVVFTVASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR-----  713
             YT++ +SF   +S +PKV+KRL +TFL   L+   YNF+   AF+I + LA+  +     
Sbjct  107   YTSKPVSFSSTLSAIPKVFKRLFITFLWVSLLMVCYNFVFV-AFLILLILAIDTQNPLLL  165

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
             +F+ + L++   V  V   Y++++W LA+ VSVLE  YGF AM KS +LL+GK+  G+ F
Sbjct  166   LFSGVVLFLLFLVVHV---YITVVWHLASVVSVLEPVYGFAAMKKSYELLKGKI--GMAF  220

Query  532   FLKLHF--ALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
              L   +     ++  +F   VV+G + +   V  V  G L  +++   +V  L+ Q+V Y
Sbjct  221   LLVFGYLSICGVIGGVFGTVVVHGGEDYGVFVRIVVGGFLVGVLVIVNLVGLLL-QSVFY  279

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             +VCKSY H+ IDKSAL DHL  YLGEYVPLKS  VQ+E   V
Sbjct  280   YVCKSYHHQGIDKSALHDHLGGYLGEYVPLKS-SVQMENLDV  320



>ref|XP_003621678.1| hypothetical protein MTR_7g021620 [Medicago truncatula]
 gb|ABN08773.1| hypothetical protein MtrDRAFT_AC160516g6v2 [Medicago truncatula]
 gb|ACJ85434.1| unknown [Medicago truncatula]
 gb|AES77896.1| transmembrane protein, putative [Medicago truncatula]
 gb|AFK45977.1| unknown [Medicago truncatula]
Length=320

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 128/339 (38%), Positives = 183/339 (54%), Gaps = 23/339 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD  QEE+QFL + +I  ES  +     K F  I L+L+ PL+   LA    +  + S L
Sbjct  1     MDLAQEELQFLNIPNILKESISIPKISPKTFYLITLTLIFPLSFAILAHSLFTHPLISQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +          P +   Q      + D+  LL+ +F Y   L  FSLLST+AVV+TVA +
Sbjct  61    Q---------SPFTDPSQT-----SHDWTLLLIIQFFYLIFLFAFSLLSTAAVVFTVASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF   IS +PKV+KRL +TFL   L+   YNFL     V+   + ++      +
Sbjct  107   YTSKPVSFSNTISAIPKVFKRLFITFLWVTLLMICYNFLFVLCLVL---MVVAIDTDNSV  163

Query  697   PLWVGVAVYTVGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
              L+  V    V FL    Y++ +W LA+ VSVLE  YGF AM KS +LL+G++    +  
Sbjct  164   LLFFSVVFIFVLFLVVHVYITALWHLASVVSVLEPLYGFAAMKKSYELLKGRVRYAALLV  223

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
                     +++ +F   VV+G D +      V  G L  +++   +V  L  Q+V Y+VC
Sbjct  224   CGYLLICAVISGMFSVVVVHGGDGYGVFSRIVIGGFLVGVLVIVNLVGLL-VQSVFYYVC  282

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             KSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E   V
Sbjct  283   KSYHHQGIDKSALHDHLGGYLGEYVPLKS-SIQMENLDV  320



>ref|XP_006304027.1| hypothetical protein CARUB_v10009765mg [Capsella rubella]
 gb|EOA36925.1| hypothetical protein CARUB_v10009765mg [Capsella rubella]
Length=321

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 138/344 (40%), Positives = 196/344 (57%), Gaps = 32/344 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q I + L
Sbjct  1     MDLQPEELQFLTIPQLLQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPILAKL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               T+       P S R    S H   D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  61    DKTD------PPNSDR----SRH---DWTVLLIFQFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA-D  701
             YT + +SF   +S +PKV+KRL +TFL   L+ F YN   A  FV  + L ++  + +  
Sbjct  108   YTGKPVSFSSTLSAIPKVFKRLFITFLWVALLMFAYN---AVFFVFLVILLVALDLNSVG  164

Query  700   IPLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVV  536
             + +  G+ +  + F   +Y + +W L + +SVLE  YG  AM K+ +LL+G  KM +G+V
Sbjct  165   LAVVAGIIISVLYFGVHVYFTALWHLGSVISVLEPVYGIAAMRKAYELLKGKVKMAMGLV  224

Query  535   FFLKLHFALFLVNLI---FKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTV  365
             F       LFL  LI   F   VV+G     G   R  VG L + VL  + + GL+ Q+V
Sbjct  225   FVY-----LFLCGLIGISFGAVVVHGGG-KYGTFTRTFVGGLLVGVLVMVNLVGLLVQSV  278

Query  364   IYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              Y+VCKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE   +
Sbjct  279   FYYVCKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLENLDI  321



>ref|XP_002321825.1| hypothetical protein POPTR_0015s14940g [Populus trichocarpa]
 gb|EEF05952.1| hypothetical protein POPTR_0015s14940g [Populus trichocarpa]
Length=318

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 131/336 (39%), Positives = 191/336 (57%), Gaps = 25/336 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD E EE+QF  + +I  ES  +  +  K F  I L+L+ PL+   LA    +  +FS +
Sbjct  1     MDLETEELQFFTIPEILKESISIPKQSPKTFKLITLALIFPLSFAILAHSLFTHPLFSQI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +   S+    Q                +  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    QDHPSRQHTHQ----------------WTLLLVFQFFYLIFLFAFSLLSTAAVVFTVASL  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN---FLAASAFVIWIFLALSFRVF  707
             YT++ +SF   +S +P+V+KRL +TFL   L+  VY    FL     +I I +  +  V 
Sbjct  105   YTSKPVSFSSTMSAIPRVFKRLFMTFLWVSLLMLVYYSVFFLFLVILIIGIDIQNALLVL  164

Query  706   ADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKM-VLGVVFF  530
               + + +GV ++ V  +Y++ +W LA+ VSVLE  YGF AM KS +LL+GK+ V GV+ F
Sbjct  165   FSL-VVIGV-LFLVVHVYITGLWHLASVVSVLEPIYGFAAMKKSYELLKGKIRVAGVLVF  222

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
               L     LV++IF   VV+G D H      +  G L  +++   +V  L  Q+V Y+VC
Sbjct  223   GYLSIC-GLVSVIFSTVVVHGGDNHGVFTRIIVGGFLVGVLVIVNLVGLL-VQSVFYYVC  280

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             KSY H+ IDK+AL +HL  YLGEYVPLKS  +Q+E 
Sbjct  281   KSYHHQGIDKTALHEHLGGYLGEYVPLKS-SIQMEN  315



>ref|XP_007211639.1| hypothetical protein PRUPE_ppa008766mg [Prunus persica]
 gb|EMJ12838.1| hypothetical protein PRUPE_ppa008766mg [Prunus persica]
Length=320

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 196/342 (57%), Gaps = 29/342 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  +  K F  I L+L+ PL+   LA       +F++ 
Sbjct  1     MDLAPEELQFLTIPDILRESTSIPKQSPKTFYLITLTLIFPLSFAILAHS-----LFTHP  55

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                + Q  ++ P           L   +  LLLF+F Y   L  FSLLST+AVV+TVA +
Sbjct  56    LLNQLQGPSTDPA---------QLHHKWTVLLLFQFCYLIFLFAFSLLSTAAVVFTVASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR-----  713
             YT++ +SF   +S +PKV+KRL +TFL   L+   YNF+   AF+I + LA+  +     
Sbjct  107   YTSKPVSFSSTLSAIPKVFKRLFITFLWVSLLMVCYNFVFV-AFLILLILAIDTQNPLLL  165

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
             +F+ + L++   V  V   Y++++W LA+ VSVLE  YGF AM KS +LL+GK+  G+ F
Sbjct  166   LFSGVVLFLLFLVVHV---YITVVWHLASVVSVLEPVYGFAAMKKSYELLKGKI--GMAF  220

Query  532   FLKLHF--ALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
              L   +     ++  +F   VV+G + +   V  V  G L  +++   +V  L+ Q+V Y
Sbjct  221   LLVFGYLSICGVIGGVFGTVVVHGGEDYGVFVRIVVGGFLVGVLVIVNLVGLLL-QSVFY  279

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             +VCKSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E   V
Sbjct  280   YVCKSYHHQGIDKSALHDHLGGYLGEYVPLKS-SIQMENLDV  320



>ref|XP_009108135.1| PREDICTED: uncharacterized protein LOC103833829 [Brassica rapa]
Length=321

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 130/339 (38%), Positives = 191/339 (56%), Gaps = 24/339 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q I +  
Sbjct  1     MDLQPEELQFLTIPQLLQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPILA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L++S P +      SD    D+  LL F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----KLDSSDPPN------SDRSRHDWTVLLTFQFSYLIFLFSFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + +SF   I+ +PKV+KRLM+TFL   L+ F YN    S F++++ + +       +
Sbjct  108   YTGKPVSFSSTITAIPKVFKRLMITFLWVALLMFAYN----SVFLVFLAILILALYLNSV  163

Query  697   PLWV--GVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
              L +  GV +  + F   +Y + +W L + VSVLE  YG  AM K+ +LL+GK  + +V 
Sbjct  164   GLAIIAGVIISVLYFGVHVYFTALWHLGSVVSVLEPVYGLAAMRKAYELLKGKTKMAMVL  223

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
                      L+   F   VV+G     G + R  VG L + +L  + + GL+ Q+V Y+V
Sbjct  224   VFVYLLLCALIGGAFGGIVVHGGG-KFGTLTRTLVGGLLVGLLVMVNLVGLLVQSVFYYV  282

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             CKSY H+ IDK+ L DHL  YLGEYVPLKS ++QLE  +
Sbjct  283   CKSYHHQTIDKTVLYDHLGGYLGEYVPLKS-NIQLENLE  320



>ref|XP_010478556.1| PREDICTED: uncharacterized protein LOC104757507 [Camelina sativa]
Length=321

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 132/341 (39%), Positives = 196/341 (57%), Gaps = 26/341 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q I +  
Sbjct  1     MDLQPEELQFLTIPQLLQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPILA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L+ S P +      SD    D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----KLDKSDPPN------SDRSRHDWTVLLIFQFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA-D  701
             YT + +SF   +S +PKV+KRL +TFL   L+ F YN   A  FV  + L ++  + +  
Sbjct  108   YTGKPVSFSSTLSAIPKVFKRLFITFLWVALLMFAYN---AVFFVFLVILLVALDLNSVG  164

Query  700   IPLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVV  536
             + +  G+ +  + F   ++ + +W L + +SVLE  YG  AM K+ +LL+G  KM +G+V
Sbjct  165   LAVVAGIIISVLYFGVHVFFTALWHLGSVISVLEPVYGLAAMRKAYELLKGKTKMAMGLV  224

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
             F   L     L+ ++F   VV+G     G   R  VG L + VL  + + GL+ Q+V Y+
Sbjct  225   FVYLLLCG--LIGVVFGAVVVHGGG-KYGTFTRTLVGGLLVGVLVMVNLVGLLVQSVFYY  281

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE   +
Sbjct  282   VCKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLENLDI  321



>ref|XP_010499664.1| PREDICTED: uncharacterized protein LOC104777151 [Camelina sativa]
Length=321

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 132/341 (39%), Positives = 195/341 (57%), Gaps = 26/341 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q I +  
Sbjct  1     MDLQPEELQFLTIPQLLQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPILA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L+ S P +      SD    D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----KLDKSDPPN------SDRSRHDWTVLLIFQFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA-D  701
             YT + +SF   +S +PKV+KRL  TFL   L+ F YN   A  FV  + L ++  + +  
Sbjct  108   YTGKPVSFSSTLSAIPKVFKRLFFTFLWVALLMFGYN---AVFFVFLVILLVALDLNSVG  164

Query  700   IPLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVV  536
             + +  G+ +  + F   ++ + +W L + +SVLE  YG  AM K+ +LL+G  KM +G+V
Sbjct  165   LAIVAGIIISVLYFGVHVFFTALWHLGSVISVLEPVYGLAAMRKAYELLKGKIKMAMGLV  224

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
             F   L     L+ ++F   VV+G     G   R  VG L + VL  + + GL+ Q+V Y+
Sbjct  225   FVYLLLCG--LIGVVFGAVVVHGGG-KYGTFTRTLVGGLLVGVLVMVNLVGLLVQSVFYY  281

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE   +
Sbjct  282   VCKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLENLDI  321



>ref|XP_010460912.1| PREDICTED: uncharacterized protein LOC104741705 [Camelina sativa]
Length=321

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 132/341 (39%), Positives = 195/341 (57%), Gaps = 26/341 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LSL+ PL+   LA    +Q I +  
Sbjct  1     MDLQPEELQFLTIPQLLQESISIKKRSPRTFYLITLSLIFPLSFAILAHSLFTQPILA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L+ S P +      SD    D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----KLDKSDPPN------SDRSRHDWTVLLIFQFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA-D  701
             YT + +SF   +S +PKV+KRL  TFL   L+ F YN   A  FV  + L ++  + +  
Sbjct  108   YTGKPVSFSSTLSAIPKVFKRLFFTFLWVALLMFGYN---AVFFVFLVILLVALDLNSVG  164

Query  700   IPLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVV  536
             + +  G+ +  + F   ++ + +W L + +SVLE  YG  AM K+ +LL+G  KM +G+V
Sbjct  165   LAIVAGIIISVLYFGVHVFFTALWHLGSVISVLEPVYGLAAMRKAYELLKGKTKMAMGLV  224

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
             F   L     L+ ++F   VV+G     G   R  VG L + VL  + + GL+ Q+V Y+
Sbjct  225   FVYLLLCG--LIGVVFGAVVVHGGG-KYGTFTRTLVGGLLVGVLVMVNLVGLLVQSVFYY  281

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY H+ IDK+AL DHL  YLG+YVPLKS ++QLE   +
Sbjct  282   VCKSYHHQTIDKTALYDHLGGYLGDYVPLKS-NIQLENLDI  321



>gb|EPS73552.1| hypothetical protein M569_01204, partial [Genlisea aurea]
Length=316

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 185/339 (55%), Gaps = 32/339 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   E++QFL + +I  ES  +  R  K F  + L+LV PL+   LA    +  I + L
Sbjct  1     MDLAPEQLQFLSIPEILKESIAIPNRSPKTFYLVTLTLVSPLSFAILAHSLFTHPILTQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                       Q GS          +SD++   + +F Y   L  FSLLST+AVV+TVA +
Sbjct  61    ----------QDGSAA-------ASSDWSKFFVIQFCYLIFLFAFSLLSTAAVVFTVASL  103

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIF-------LALS  719
             Y ++ +SF   I+ +P V++RL +TFL   L+  VYN    +A V+ I        L   
Sbjct  104   YASKPVSFSSTIAAIPSVFRRLFITFLWVSLLMVVYNIFFLAALVLLIVAVDTDSVLLFF  163

Query  718   FRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
             F +   + L++GV VY      +S +W LA+T+SVLE  YGF AM +S +LL+GK  +G 
Sbjct  164   FSLIVVLALFLGVHVY------ISAVWHLASTISVLEPVYGFAAMRRSYELLKGKTSVGF  217

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
                        +++ +F   VV+G D    +  RV VG   + VL  + + GL+ Q+V Y
Sbjct  218   SMVFAYLAVCGVISGMFGSIVVHGGD-DYSVWARVVVGGFLVAVLVIVNLIGLLVQSVFY  276

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             +VCKSY +E ID++AL DHL  YLGEYVPLKS  +Q+E 
Sbjct  277   YVCKSYHNEVIDRAALHDHLGGYLGEYVPLKSS-IQMEN  314



>ref|XP_011000166.1| PREDICTED: uncharacterized protein LOC105107810 [Populus euphratica]
 ref|XP_011015735.1| PREDICTED: uncharacterized protein LOC105119305 [Populus euphratica]
Length=318

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 128/337 (38%), Positives = 187/337 (55%), Gaps = 27/337 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD E EE+QF  + +I  ES  ++ +  K F  I L+L+ PL+   LA    +  + S +
Sbjct  1     MDLETEELQFFTIPEILRESISILKQSPKTFKLITLALIFPLSFAILAHSLFTHPLLSQI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +   S+    Q                +  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    QDHPSRQHTHQ----------------WTLLLVFQFFYLIFLFAFSLLSTAAVVFTVASL  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF   +S +P+V+KRL +TFL   L+  VY    +  F+  + L +   +   I
Sbjct  105   YTSKPVSFSSTMSAIPRVFKRLFMTFLWVSLLMLVYY---SVFFLFLVILIIGIDIQNAI  161

Query  697   PLWVGVAVYTVGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKM-VLGVVF  533
              +   + V  V FL    Y++ +W LA+ VSVLE  YGF AM KS +LL+GK+ V GV+ 
Sbjct  162   LVLFSLVVIGVLFLVVHVYITGLWHLASVVSVLEPIYGFAAMKKSYELLKGKIRVAGVLV  221

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
             F  L     LV++IF   VV+G D H      +  G L  +++   +V  L  Q+V Y+V
Sbjct  222   FGYLTIC-GLVSVIFSTVVVHGGDNHGVFTRIIVGGFLVGVLVIVNLVGLL-VQSVFYYV  279

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             CKSY H+ IDK+ L +HL  YLGEYVPLKS  +Q+E 
Sbjct  280   CKSYHHQGIDKTTLHEHLGGYLGEYVPLKS-SIQMEN  315



>ref|XP_010093191.1| hypothetical protein L484_013314 [Morus notabilis]
 gb|EXB53679.1| hypothetical protein L484_013314 [Morus notabilis]
Length=320

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 127/337 (38%), Positives = 193/337 (57%), Gaps = 25/337 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QF+ + DI  E+  +  +  K F  I L+L+ PL+   LA    +  + + L
Sbjct  1     MDLASEELQFMTIPDIVREAISIPKQSPKTFYLITLTLLFPLSFAILAHSLFTHPLLAQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             ++  +  + +Q G  R+  L           L+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    QNPYA--DPTQAGH-RWTVL-----------LVFQFCYLIFLFAFSLLSTAAVVFTVASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR-----  713
             YT++ +SF    S +PKV KRL +TFL   L+  VYNF+    F++ +  A+  +     
Sbjct  107   YTSKSVSFSSTFSAIPKVLKRLFITFLWVTLLMVVYNFVFV-GFLVLLIAAIDIQNAFLV  165

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
             VF+ + +++   ++ V  ++++ +W LA+ VSVLE  YGF AM KS +LL+GK  +  V 
Sbjct  166   VFSLLAIFL---LFLVVHVFITALWHLASVVSVLEPIYGFAAMKKSYELLKGKTRVAAVL  222

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
                      ++  IF   VV+G D   G+  R+ VG   + VL  + + GL+ Q+V Y+V
Sbjct  223   VFVYLATCMVIGGIFGAIVVHGGD-KYGVFMRIVVGGFLVGVLVIVNLVGLLVQSVFYYV  281

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             CKSY H+ IDK+AL DHL  YLGEYVPLKS  +Q+E 
Sbjct  282   CKSYHHQGIDKTALYDHLGGYLGEYVPLKS-SIQMEN  317



>ref|XP_010434346.1| PREDICTED: uncharacterized protein LOC104718320 [Camelina sativa]
Length=321

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 133/340 (39%), Positives = 193/340 (57%), Gaps = 24/340 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL   DI+ ES  +     K F  I L+L+ PL+   LA   V+Q I + +
Sbjct  1     MDLAPEELQFLNEKDIFHESTSIPKYSPKTFYLITLTLIFPLSFAILAHSLVTQPIVAKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               T S+   +Q         + H   ++  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    D-TYSRANQAQ---------TQH---EWTILLIFQFCYVIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR--V  710
             YT + +SF   +S VP V KRL++TFL   L+   YN  FL    F++ + +A+     V
Sbjct  108   YTGKPVSFSSTMSAVPLVLKRLLITFLWVSLLMLAYNTVFLI---FLVTLIVAVDLHKVV  164

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV-VF  533
              A   L V   ++    +YM+ +W LA+ VSVLE  YGF AM KS +LL+GK ++   + 
Sbjct  165   LAAFSLVVICVLFLGVHVYMTALWHLASVVSVLEPVYGFAAMKKSYELLKGKTLMACSMV  224

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
             F+ L    F+  +     V  G D+  G+  R+  G   + VL  + + GL+ Q+V Y+V
Sbjct  225   FIYLAHCGFIAGVFGAVVVRGGEDY--GIFARIVAGGFLVGVLVIVNLIGLLVQSVFYYV  282

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             CKS+ H+ IDKSAL D L  YLGEYVPLKS ++Q+E ++V
Sbjct  283   CKSFHHQEIDKSALHDQLGGYLGEYVPLKS-NIQMENFEV  321



>ref|NP_564374.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK17164.1|AF325096_1 unknown protein [Arabidopsis thaliana]
 gb|AAD21694.1| ESTs gb|T20423, gb|AA712864, gb|H76323 and gb|Z25560 come from 
this gene [Arabidopsis thaliana]
 gb|AAL91147.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47888.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62660.1| unknown [Arabidopsis thaliana]
 gb|AEE31315.1| uncharacterized protein AT1G31130 [Arabidopsis thaliana]
Length=321

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 194/341 (57%), Gaps = 26/341 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL +  +  ES  +  R  + F  I LS + PL+   LA    +Q I +  
Sbjct  1     MDLQPEELQFLTIPQLLQESISIKKRSPRTFYLITLSFIFPLSFAILAHSLFTQPILA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L+ S P +      SD    D+  LL+F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----KLDKSDPPN------SDRSRHDWTVLLIFQFSYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA-D  701
             YT + +SF   +S +PKV+KRL +TFL   L+ F YN   A  FV  + L ++  + +  
Sbjct  108   YTGKPVSFSSTLSAIPKVFKRLFITFLWVALLMFAYN---AVFFVFLVMLLVALDLNSLG  164

Query  700   IPLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVV  536
             + +  GV +  + F   +Y + +W L + +SVLE  YG  AM K+ +LL+G  KM +G++
Sbjct  165   LAIVAGVIISVLYFGVHVYFTALWHLGSVISVLEPVYGIAAMRKAYELLKGKTKMAMGLI  224

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
             F     F   L+ ++F   VV+G     G   R  VG L + VL  + + GL+ Q+V Y+
Sbjct  225   FVYL--FLCGLIGVVFGAVVVHGGG-KYGTFTRTLVGGLLVGVLVMVNLVGLLVQSVFYY  281

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY H+ IDK+AL D L  YLG+YVPLKS ++QLE   +
Sbjct  282   VCKSYHHQTIDKTALYDQLGGYLGDYVPLKS-NIQLEDLDI  321



>ref|XP_010519002.1| PREDICTED: uncharacterized protein LOC104798556 [Tarenaya hassleriana]
Length=318

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 125/335 (37%), Positives = 180/335 (54%), Gaps = 23/335 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD E EE+QFL +  + +ES  +  R  K F  I L+L+ PL+   LA    +  I   L
Sbjct  1     MDVEPEELQFLTIPQVLVESISITKRSPKTFYFITLTLIFPLSFAILAHSLFTHPIIVKL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +S                     D+  LL+ +F Y   L VFSLLST+AVV+TVA +
Sbjct  61    DSVDSSRARH----------------DWTILLVIEFCYLIFLFVFSLLSTAAVVFTVASL  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA+ +SF   IS +P+V+KRL +TFL   L+ F YN  A     + I L       A +
Sbjct  105   YTAKPVSFSSTISAIPRVFKRLFITFLWIALLMFAYN--ALLVLFLVILLVAVDMGKAGL  162

Query  697   PLWVGVAVYTVGF---LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
              ++ G+ +  + F   +Y++ +W L + VSVLE  YG+ AM K  +LL+G+  +G++   
Sbjct  163   AVFAGLVISVLYFGVHVYITALWHLGSVVSVLEPIYGYAAMKKGYELLKGRTQMGMILVF  222

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
                    L    F   VV G + H      +  GLL  +++   +V  L  Q+V Y+VCK
Sbjct  223   VYLALCALTGGFFGSVVVYGGEKHGAWTRILVGGLLVGVLVMVNLVGLL-VQSVFYYVCK  281

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             SY HE+IDK+AL+DHL  YLGEYVPLKS  +Q+E 
Sbjct  282   SYHHESIDKTALNDHLGGYLGEYVPLKS-TIQMEN  315



>gb|EMT33780.1| hypothetical protein F775_30040 [Aegilops tauschii]
Length=196

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = -3

Query  679  AVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLV  500
            A   VG +Y+S++W LA+ VSVLED  GF+AM KSK L++GK+   V+ F+ L+    +V
Sbjct  46   ASSVVGLVYLSVVWHLASVVSVLEDYKGFQAMRKSKALIQGKLWTVVIIFVTLNIVFVVV  105

Query  499  NLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDK  320
               F+ ++V G    LG  GR+ +GL+ L  L  +V+  LV QTV+Y VCKSY HE+IDK
Sbjct  106  EFAFRAWIVQGARHGLGAGGRLLLGLVILAALCSVVMVALVVQTVVYLVCKSYHHESIDK  165

Query  319  SALSDHLEVYLGEYVPLKSKDVQLEQY  239
            S +SDHLEVYLG+YVPLK+ DVQ++ +
Sbjct  166  SNISDHLEVYLGDYVPLKASDVQMQHF  192



>ref|XP_010439634.1| PREDICTED: uncharacterized protein LOC104723041 [Camelina sativa]
Length=321

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 132/341 (39%), Positives = 190/341 (56%), Gaps = 26/341 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL    I+ ES  +     K F  I L+L+ PL+   LA   V+Q I + +
Sbjct  1     MDLDPEELQFLNERGIFHESTSIPKYSPKTFYLITLTLIFPLSFAILAHSLVTQPILAKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTS-DfaalllfkfAYFTCLLVFSLLstsavvytvac  881
                             YQR     T  ++  LL+F+F Y   L  FSLLST+AVV+TVA 
Sbjct  61    D--------------TYQRADQAQTQHEWTILLIFQFCYVIFLFAFSLLSTAAVVFTVAS  106

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR--  713
             +YT + +SF   +S VP V KRL++TFL   L+   YN  FL    F++ + +A+     
Sbjct  107   LYTGKPVSFSSTMSAVPLVLKRLLITFLWVSLLMLAYNTVFLI---FLVTLIVAVDLHKV  163

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV-V  536
             V A   L V   ++    +YM+ +W LA+ VSVLE  YGF AM KS +LL+GK ++   +
Sbjct  164   VLAAFSLVVICVLFLGVHVYMTALWHLASVVSVLEPVYGFAAMKKSYELLKGKTLMACSM  223

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
              F+ L    F+  +     V  G D+  G+  R+  G   + VL  + + GL+ Q+V Y+
Sbjct  224   VFVYLAHCGFIAGVFGAVVVRGGEDY--GIFARIVAGGFLVGVLVIVNLIGLLVQSVFYY  281

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKS+ H+ IDKSAL D L  YLGEYVPLKS ++Q+E ++V
Sbjct  282   VCKSFHHQEIDKSALHDQLGGYLGEYVPLKS-NIQMENFEV  321



>ref|XP_006413920.1| hypothetical protein EUTSA_v10026779mg [Eutrema salsugineum]
 gb|ESQ55373.1| hypothetical protein EUTSA_v10026779mg [Eutrema salsugineum]
Length=321

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 137/346 (40%), Positives = 195/346 (56%), Gaps = 36/346 (10%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     K F  I L L+ PL+   LA    +Q IF+ +
Sbjct  1     MDLAPEELQFLSIRGILRESTSIPKFSPKTFYLITLILIFPLSFAILAHSLFTQPIFAQI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                     ++ P  P  Q  + H   ++  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    --------DTYP--PADQAQTQH---EWTVLLVFQFCYVIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + +SF   +S +P V KRL +TFL   L+   YN    + F+I++   ++  V  D+
Sbjct  108   YTGKPVSFSSTMSAIPLVLKRLFITFLWVSLLMLAYN----TVFLIFL---VALIVAVDL  160

Query  697   PLWVGVAVYT-----VGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--M  551
                VG+AV++     V FL    YM+ +W LA+ VSVLE  YG  AM KS +LL+GK  M
Sbjct  161   Q-NVGLAVFSLLVILVLFLGVHVYMTALWHLASVVSVLEPVYGLAAMKKSYELLKGKTFM  219

Query  550   VLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQ  371
                +VF    H    L+  +F   VV+G +   G+  R+  G   + VL  + + GL+ Q
Sbjct  220   ACSMVFIYLAHCG--LIAGVFGSVVVHGGE-DNGIFTRIVAGGFLVGVLVIVNLIGLLVQ  276

Query  370   TVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             +V Y+VCKS+ H+ IDKSAL DHL  YLGEYVPLKS ++Q+E + V
Sbjct  277   SVFYYVCKSFHHQEIDKSALHDHLGGYLGEYVPLKS-NIQMENFDV  321



>ref|XP_003608510.1| hypothetical protein MTR_4g096890 [Medicago truncatula]
 gb|AES90707.1| transmembrane protein, putative [Medicago truncatula]
Length=320

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 126/339 (37%), Positives = 181/339 (53%), Gaps = 23/339 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + +I  ES  +     K F  I L L+ PL+   LA    +  + S  
Sbjct  1     MDLAPEELQFLNIPNILKESISIPKISPKTFYLITLILIFPLSFAILAHSLFTHPLIS--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H ES   +    S            D+  LL+ +F Y   L  FSLLST+AVV+TVA +
Sbjct  59    -HIESPFTDPAQTS-----------HDWTLLLIIQFFYLIFLFAFSLLSTAAVVFTVASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF   IS +P V+KRL +TFL   L+ F YNF+     V+   + ++      +
Sbjct  107   YTSKPVSFSNTISAIPNVFKRLFITFLWVTLLMFCYNFVFILCLVL---MVIAVDTDNSV  163

Query  697   PLWVGVAVYTVGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
              L+  V +  V FL    Y++ +W LA+ VSVLE  YGF AM KS +LL+G++    +  
Sbjct  164   LLFFSVVLIFVLFLVVHVYITALWHLASVVSVLEPLYGFAAMKKSYELLKGRVRYASLLV  223

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
                 F   +++ +F   VV+G D +         G L  +++   +V  L  Q+V Y+VC
Sbjct  224   CGYLFLCAVISGMFSVIVVHGGDGYDVFSRIFIGGFLVGVLVIVNLVGLL-VQSVFYYVC  282

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             KSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E   +
Sbjct  283   KSYHHQEIDKSALHDHLGGYLGEYVPLKSS-IQMENLDI  320



>gb|KGN47744.1| hypothetical protein Csa_6G398210 [Cucumis sativus]
Length=349

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 128/355 (36%), Positives = 198/355 (56%), Gaps = 30/355 (8%)
 Frame = -3

Query  1237  MDREQ-EEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             MD  + E ++F+G+F I  E++K+I + RKIF+QI L  +LPL+++  A  EVS+     
Sbjct  1     MDEVKLENLKFVGIFGILHETFKLISQWRKIFTQITLLFILPLSLLIFANNEVSKFFLQK  60

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             +   ++ L+ +Q  +P++ +LS  ++S      LF FA+     +FSLLSTSA VYTVAC
Sbjct  61    ISQEKTILQQTQESTPQFLKLSHLISSQNLYYSLFNFAFLIFSPIFSLLSTSATVYTVAC  120

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLAL-------  722
             +Y ARD+SF  V++V+PK+WK+L++TFL      F + F+A     +   +A+       
Sbjct  121   IYAARDISFTLVMAVLPKLWKQLLITFLCYLASIFAFTFVAIGVLCLIPLIAILIYGLNT  180

Query  721   --SFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMV  548
                F +   I  +  +  Y +G  Y + IWQL++ VSVLE S GFKA+ KSK LL+GKM 
Sbjct  181   GQDFILGNKIIFFFFIISYCIGIWYFTTIWQLSSVVSVLEKSCGFKALEKSKNLLKGKMK  240

Query  547   LGVVFFLKLHFALFLVNLIFKRFVVN-----GWDFHlgmvgrvgvgllcllvlfklvvfg  383
             + +  ++ L F L ++      + V      GW           +G+  +L     V+  
Sbjct  241   MVIKLWVLLDFPLGVIQFALLHYFVTRSTWVGWSI---------LGICWVLSFMVFVLVK  291

Query  382   lVTQTVIYFVCKSYQHENIDKSALSDHLEVYL--GEYVPLKSKD----VQLEQYQ  236
             LV +TV+YFVCK +  E +D   L +HL+ Y+    Y  LK  D    VQLE+ Q
Sbjct  292   LVLETVVYFVCKLHHGEMVDMMPLWNHLQGYVLPHHYDQLKVDDDNNSVQLEKIQ  346



>ref|XP_006387906.1| hypothetical protein POPTR_0487s002102g, partial [Populus trichocarpa]
 gb|ERP46820.1| hypothetical protein POPTR_0487s002102g, partial [Populus trichocarpa]
Length=192

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+REQEEMQFLG+F IY E+YK+I+  +KIFSQI L+L+LPL +I LAQ EVS ++   +
Sbjct  1     MEREQEEMQFLGVFGIYKEAYKIIFSWKKIFSQITLALILPLTLISLAQIEVSNVLSGKV  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              + +++L  ++ G+ RY +LS H++S+ A   LF+ AY    L+FSLLST+AVV T+A +
Sbjct  61    INNKAELLGTEAGTKRYNKLSHHISSELAYFWLFEVAYLILSLIFSLLSTAAVVNTIASI  120

Query  877   ytARDLSFKKVISVVPKVWKRLM  809
             YT R++SFKKV+SVVPKVWKRLM
Sbjct  121   YTDREVSFKKVMSVVPKVWKRLM  143



>ref|XP_006465008.1| PREDICTED: uncharacterized protein LOC102615061 [Citrus sinensis]
Length=326

 Score =   128 bits (321),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 184/307 (60%), Gaps = 8/307 (3%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD  QE M+ LG   I  E++K+I+  +K+F+QI L+ ++PL++IF A    S L+ S +
Sbjct  1     MDTNQE-MKLLGFCGILKETFKLIFSHKKLFTQITLAFIIPLSLIFQANMITSHLLISKI  59

Query  1057  RHTESQLENSQPGSPRYQRLS-DHLTSDfaal--llfkfAYFTCLLVFSLLstsavvytv  887
                +  LE +     +Y  L   +L S   A   +L + AYF  +L+ SLL  S V Y+V
Sbjct  60    FEEKDSLEPTDFNIYKYSNLKFSNLKSFKWAAYWVLTQIAYFIPILILSLLCASTVAYSV  119

Query  886   acvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVF  707
              C YTA+D++FKK I++VPK+WK+++ TFL +F + F+Y ++  +  ++   L   F+ F
Sbjct  120   FCNYTAKDVTFKKTIAIVPKIWKKVLCTFLVSFGIVFLYEYVLGA--ILAFILGFLFKGF  177

Query  706   ADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDS-YGFKAMSKSKQLLRGKMVLGVVFF  530
               I   V + +Y  G +Y+++IW L   VSVLE + YG KA+ KSK L++GK  + V   
Sbjct  178   TTIIAVVILILYLAGSIYITVIWHLGIVVSVLEQNVYGSKAIKKSKNLVKGKFGVAVAML  237

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
             L        ++ +F+ FVV   D  L    R+G+G+   ++L  L++FGLV QTVIYFVC
Sbjct  238   LVFSVCSVAIDAVFQNFVVRD-DLSLDWGIRIGIGIFGFILLLLLILFGLVVQTVIYFVC  296

Query  349   KSYQHEN  329
             KSY +E+
Sbjct  297   KSYLNED  303



>ref|XP_010536691.1| PREDICTED: uncharacterized protein LOC104811630 [Tarenaya hassleriana]
Length=321

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 131/345 (38%), Positives = 190/345 (55%), Gaps = 34/345 (10%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     K F  I L+L+ PL+   LA    +  I +  
Sbjct  1     MDLAPEELQFLSIRGILRESTSIPKFSLKTFYLITLTLIFPLSFAILAHSLFTHPILA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  QL++  P  P   R       ++  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----QLDSYPPSDPAQTR------HEWTVLLVFQFCYVIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIF-------LALS  719
             YT + +SF   +S +P V KRL +TFL   L+   YN +     V+ I        L   
Sbjct  108   YTGKPVSFSSTMSAIPLVLKRLFITFLWVSLLMLAYNTVFLIFLVVLIVAIDLQNVLLAV  167

Query  718   FRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--MVL  545
             F +     L++GV VY      M+ +W LA+ VSVLE  YGF AM KS +LL+G+  M  
Sbjct  168   FSMLVIFALFLGVHVY------MTALWHLASVVSVLEPVYGFAAMKKSYELLKGRTWMAC  221

Query  544   GVVFFLKLHFALF-LVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
              +VF   ++ A+  ++  +F   VV+G +   G+  R+ +G   + VL  + + GL+ Q+
Sbjct  222   SMVF---VYMAMCGVIGGVFGAVVVHGGE-DYGLFTRIVIGGFLVGVLVIVNLVGLLVQS  277

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             V Y+VCKS+ H+ IDK+AL DHL  YLGEYVPLKS  +Q+E ++V
Sbjct  278   VFYYVCKSFHHQGIDKTALHDHLGGYLGEYVPLKS-SIQMENFEV  321



>ref|XP_011096819.1| PREDICTED: uncharacterized protein LOC105175883 [Sesamum indicum]
Length=317

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 131/338 (39%), Positives = 193/338 (57%), Gaps = 24/338 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   E++QFL + D+  ES  +  +  K F  I L+L+ PL+   LA    +  I + L
Sbjct  1     MDLAPEQLQFLSIPDVLKESISIPKQSPKTFYLITLTLIFPLSFAILAHSLFTHPILAQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +        + P +          +SD++ LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    Q--------TDPAAS---------SSDWSKLLIFQFFYLIFLFAFSLLSTAAVVFTVASL  103

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF   IS +P V+KRL +TFL   L+  VYN +     V+ I    +  +    
Sbjct  104   YTSKPVSFSSTISAIPSVFKRLFITFLWVSLLMVVYNIVFLGFLVLLIIAVDTQNLVLFF  163

Query  697   PLWVGVAVYTVGF-LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
                V V V  +G  +++S +W LA+ VSVLE  YGF AM KS +LL+GK  +G  FF+  
Sbjct  164   FSLVVVFVLFLGVHVFISALWHLASVVSVLEPVYGFAAMKKSYELLKGKTRMG--FFIVF  221

Query  520   HFALF--LVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
              +     ++N +F   VV+G +   G++ R+ VG   + VL  + + GL+ Q+V Y+VCK
Sbjct  222   GYLAICGVINGLFGSIVVHGGE-DYGVLTRIVVGGFLVGVLVIVNLVGLLVQSVFYYVCK  280

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY ++ IDKSAL DHL  YLGEYVPLKS  +Q+E   V
Sbjct  281   SYHNQGIDKSALYDHLGGYLGEYVPLKS-SIQMENLDV  317



>ref|NP_193728.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAT71917.1| At4g19950 [Arabidopsis thaliana]
 gb|AAU15139.1| At4g19950 [Arabidopsis thaliana]
 gb|AEE84250.1| uncharacterized protein AT4G19950 [Arabidopsis thaliana]
Length=321

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 135/341 (40%), Positives = 190/341 (56%), Gaps = 26/341 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL    I  ES  +     K F  I L+L+ PL+   LA    +Q I + +
Sbjct  1     MDLAPEELQFLNKRGILRESTSIPQYSLKTFYLITLTLIFPLSFAILAHSLFTQPILAQI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               T  Q + SQ            L  ++  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    D-TYPQADQSQ------------LQHEWTVLLVFQFCYIIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR--V  710
             YT + +SF   +S +P V KRL +TFL   L+   YN  FL    F++ + +A+  +  V
Sbjct  108   YTGKPVSFSSTMSAIPLVLKRLFITFLWVSLLMLAYNTVFLI---FLVTLIVAVDLQNVV  164

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--MVLGVV  536
              A   L V   ++ V  +YM+ +W LA+ VSVLE  YG  AM KS +LL+GK  M   +V
Sbjct  165   LAVFSLVVIFVLFLVVHVYMTALWHLASVVSVLEPIYGLAAMKKSYELLKGKTLMACSMV  224

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
             F   +H     +  +F   VV G D   G+  R+  G   + VL  + + GL+ Q+V Y+
Sbjct  225   FIYLVHCGF--IAGVFGAVVVRGGD-DYGIFARIVAGGFLVGVLVIVNLIGLLVQSVFYY  281

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKS+ H+ IDKSAL DHL  YLGEYVPLKS ++Q+E ++V
Sbjct  282   VCKSFHHQEIDKSALHDHLGGYLGEYVPLKS-NIQMENFEV  321



>ref|XP_006468502.1| PREDICTED: uncharacterized protein LOC102615278 [Citrus sinensis]
Length=321

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 132/353 (37%), Positives = 186/353 (53%), Gaps = 50/353 (14%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD    E+QFL + DI  ES  +  R  + F  I L L+ PL+   LA    +  I   L
Sbjct  1     MDLSPGELQFLSIPDILRESISIPRRAARTFYFITLILIFPLSFAILAHSLFTHPI---L  57

Query  1057  RHTESQLENSQPGSPRYQ--RLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytva  884
             R  E       P   R+Q  RL           L+F+F Y   L  FSLLST+AVV+TVA
Sbjct  58    RQLEDH-PTYDPTETRHQWTRL-----------LVFQFCYLIFLFAFSLLSTAAVVFTVA  105

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR--V  710
              +YT++ +SF   +S +PKV KRL +TFL   L+  +YN +  S F+I + +A+  +  +
Sbjct  106   SLYTSKPVSFSSTMSAIPKVLKRLFITFLWVSLLMIIYNAVFLS-FLILLIIAIDTQSAL  164

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKM-VLGVVF  533
                  + V   ++ V  +Y++ +W LA+ VSVLE  YGF AM KS +LL+GK  + GV+ 
Sbjct  165   LVLFCMLVIFLLFLVVHVYITALWHLASVVSVLEPLYGFAAMKKSYELLKGKTRMAGVLV  224

Query  532   FLKLHFALFLVNL-------------IFKRFVVNGWDFHlgmvgrvgvgllcllvlfklv  392
             F  L     + ++             +F R VV G+                + VL  + 
Sbjct  225   FGYLAICAAIGSVFGVVVVHGGDRYGVFTRIVVGGF---------------LVGVLVIVN  269

Query  391   vfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             + GL+ Q+V Y+VCKSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E   V
Sbjct  270   LVGLLVQSVFYYVCKSYHHQEIDKSALHDHLGGYLGEYVPLKS-SIQMENMDV  321



>ref|XP_010696334.1| PREDICTED: uncharacterized protein LOC104908866 [Beta vulgaris 
subsp. vulgaris]
Length=320

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 116/342 (34%), Positives = 178/342 (52%), Gaps = 29/342 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+QFL L DI  ES  +     + F  I LSL+ PL+   LA    +  I ++L
Sbjct  1     MDLQPEELQFLSLTDIVKESISIPKLSPRTFYLITLSLIFPLSFAILAHSLFTHPILTHL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +   + +++          L       +   L       T  +VF++          A +
Sbjct  61    QDPSTPIQSQS----HEWVLLLVFQFFYLLFLFTFSLLSTAAVVFTV----------ASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLAL-------S  719
             YT++ +SF   I+ +P V++RL  TFL   L+   YN +    F+I + L +       +
Sbjct  107   YTSKQVSFTSTIAAIPSVFRRLFNTFLWVSLLMLCYNLV----FIILLVLIIVAVDTNST  162

Query  718   FRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
             F +F  + L  G+ ++    +Y++ +W LA+ VSVLE  YGF AM KS +LL+GK+++  
Sbjct  163   FLLFFSMLLAFGLFLFV--HVYITALWHLASVVSVLEPIYGFAAMKKSYELLKGKVLMAG  220

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             VF         L++  F   VV+G D    +  R+ VG   + VL  + + GL+ Q+V Y
Sbjct  221   VFVFGYLLICGLISGTFAAVVVHG-DSSTSVFVRILVGGFLVGVLVIVNLVGLLVQSVFY  279

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             +VCKSY H+ IDK AL DHL  YLGEYVPLKS ++QLE   +
Sbjct  280   YVCKSYHHQGIDKIALHDHLGGYLGEYVPLKS-NIQLESLDI  320



>ref|XP_010648978.1| PREDICTED: uncharacterized protein LOC100252459 [Vitis vinifera]
 emb|CBI27191.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 120/341 (35%), Positives = 179/341 (52%), Gaps = 29/341 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  +  K F  I L+L+ PL+   LA    +  ++S +
Sbjct  1     MDLANEELQFLSIPDILKESTSIPKQSPKAFYLITLTLIFPLSFAILAHSLFTHPLYSQI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                       Q   PR      H    +  LL F+  Y   L   SLLST+AVV+TVA +
Sbjct  61    ----------QASDPR------HTHHQWTLLLTFQLCYLIFLFALSLLSTAAVVFTVASL  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF   ++ +P+V+KRL +TF+   L+   Y  + ++A V+ I       V    
Sbjct  105   YTSKPVSFASTMAAIPRVFKRLFITFIWVSLLMITYYAVFSAAVVLLII-----AVDVQS  159

Query  697   PLWVGVAVYTVGF------LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVV  536
             PL    A+  +        +Y++ +W LA+ VSVLE  YGF AM KS +LL+GK  +   
Sbjct  160   PLLFFFALVVIFLLFVVVHVYITALWHLASVVSVLEPVYGFAAMKKSYELLKGKTRMAAA  219

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
                       +++ +F   VV+G + +      V  G L  +++   ++  L  Q+V Y+
Sbjct  220   LVFVYLVICGVISGVFGAVVVHGGEMYGVFFRIVVGGFLVGVLVIVNLIGLL-VQSVFYY  278

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E  +V
Sbjct  279   VCKSYHHQGIDKSALLDHLGGYLGEYVPLKS-SIQMENLEV  318



>ref|XP_010449275.1| PREDICTED: uncharacterized protein LOC104731548 [Camelina sativa]
Length=321

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 129/340 (38%), Positives = 192/340 (56%), Gaps = 24/340 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL    I+ ES  +     K F  I L+L+ PL+   LA   V+Q I + +
Sbjct  1     MDLAPEELQFLNKRGIFHESTSIPKYSPKTFHLITLTLIFPLSFAILAHSLVTQPILTQI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                     ++ P + + Q  + H   ++  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    --------DTYPRANQAQ--TQH---EWTILLIFQFCYVIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR--V  710
             YT + +SF   +  VP V KRL++TFL   L+   YN  FL    F++ + +A+     V
Sbjct  108   YTGKPVSFSSTMYAVPLVLKRLLITFLWVSLLMLAYNTVFLI---FLVTLIVAVDLHKVV  164

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV-VF  533
              A   L V   ++    +Y++ +W LA+ VSVLE  YGF AM KS +LL+GK ++   + 
Sbjct  165   LAAFSLVVICVLFLGVHVYITALWHLASVVSVLEPVYGFAAMKKSYELLKGKTLMACSMV  224

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
             F+ L    F+  +     V  G D+  G+  R+  G   + VL  + + GL+ Q+V Y+V
Sbjct  225   FIYLAHCGFIAGVFGAVVVRGGEDY--GIFARIVAGGFLVGVLVIVNLIGLLVQSVFYYV  282

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             CKS+ H+ IDKSAL D L  YLGEYVPLKS ++Q+E ++V
Sbjct  283   CKSFHHQEIDKSALHDQLGGYLGEYVPLKS-NIQMENFEV  321



>ref|XP_004293771.1| PREDICTED: uncharacterized protein LOC101293075 [Fragaria vesca 
subsp. vesca]
Length=320

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 184/336 (55%), Gaps = 23/336 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL L DI  ES  +     K F  I L+L+ PL+   LA       +F++ 
Sbjct  1     MDLAPEELQFLSLPDILRESTSIPKLSPKTFYLITLTLIFPLSFAILAHS-----LFTHP  55

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                + Q  ++ P           L   +  LLLF+F Y   L  FSLLST+AVV+T A +
Sbjct  56    LLNQLQGPSTDPA---------QLHHKWTLLLLFQFFYLIFLFAFSLLSTAAVVFTAASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALS----FRV  710
             YT++ +SF   +S +PKV+KRL +TFL   L+   YN L     V+ I    S      +
Sbjct  107   YTSKPVSFSNTLSAIPKVFKRLFITFLWVSLLMVAYNLLFLGFLVLLIIAVDSQNPLLLL  166

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
             F+ + ++V   ++ V  +Y++ +W LA+ VSVLE  YGF AM KS +L++GK  +  V  
Sbjct  167   FSGLAIFV---LFLVVHVYITALWHLASVVSVLEPVYGFAAMRKSYELMKGKTGMAFVLV  223

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
                  +  ++  +F   VV+G   +   V  V  G L  L++   +V  L+ Q+V Y+VC
Sbjct  224   FGYLTSCGIIGWVFGTVVVHGGSDYGVFVRIVVGGFLVGLLVIVNLVGLLL-QSVFYYVC  282

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             KSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E 
Sbjct  283   KSYHHQGIDKSALHDHLGGYLGEYVPLKS-SIQMEN  317



>ref|XP_004231583.1| PREDICTED: uncharacterized protein LOC101247571 [Solanum lycopersicum]
 ref|XP_010315668.1| PREDICTED: uncharacterized protein LOC101247571 [Solanum lycopersicum]
 ref|XP_010315669.1| PREDICTED: uncharacterized protein LOC101247571 [Solanum lycopersicum]
 ref|XP_010315670.1| PREDICTED: uncharacterized protein LOC101247571 [Solanum lycopersicum]
Length=323

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 115/341 (34%), Positives = 173/341 (51%), Gaps = 31/341 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI+ ES  +  R  K F  I L+L+ PL+   LA    +  I + L
Sbjct  1     MDLPAEELQFLTIPDIFQESISIPKRSPKTFYLITLTLLFPLSFAILAHSLFTHPILTQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +   +    SQ       +    L     +LL      FT   +++              
Sbjct  61    QENPNSSHASQWTKLIVFQFFYLLFLFAFSLLSTAAVVFTVASIYT--------------  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
                + +SF   ++ +P V+KRL +TF+   L    YN    + F+I++ L +      ++
Sbjct  107   --TKPVSFSSTLAAIPSVFKRLFITFIWVSLSMLAYN----TVFLIFLVLLIVAADTQNV  160

Query  697   PLW-----VGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
              L+     V   ++ V  +Y S +W LA+ VSVLE  YG  AM KS QLL+GK   G+ F
Sbjct  161   VLFLFSFLVVFILFLVVHVYFSALWHLASVVSVLEPIYGIGAMKKSYQLLKGKT--GMAF  218

Query  532   FLKLHF--ALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             F    +     ++N  F   VV+G D + G++ R+ +G   + VL  + + GL+ Q+V Y
Sbjct  219   FFVFGYLSICGVINGFFGSVVVHGGD-NYGVISRILIGGFLVGVLVIVNLVGLLMQSVFY  277

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             +VCKSY H+ IDK+AL DHL  YLGEYVPLKS  VQ+E  +
Sbjct  278   YVCKSYHHQEIDKTALYDHLGGYLGEYVPLKS-SVQMENLE  317



>ref|XP_006284127.1| hypothetical protein CARUB_v10005259mg [Capsella rubella]
 gb|EOA17025.1| hypothetical protein CARUB_v10005259mg [Capsella rubella]
Length=321

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 133/346 (38%), Positives = 196/346 (57%), Gaps = 36/346 (10%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL    I  ES  +     K F  I L+L+ PL+   LA    +Q I   +
Sbjct  1     MDLSPEELQFLNKRGILHESTSIPKYSPKTFYLITLTLIFPLSFAILAHSLFTQPILDQI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                     ++ P + + Q  + H   ++  LL+F+F+YF  L  FSLLST+AVV+TVA +
Sbjct  61    --------DTYPRADQAQ--TQH---EWTILLVFQFSYFIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + +SF    S +P V KRL +TFL   L+   YN    + F+I++   ++  V  D+
Sbjct  108   YTGKPVSFSSTFSAIPLVLKRLFITFLWVSLLMLAYN----TVFLIFL---VTLIVAVDL  160

Query  697   PLWVGVAVYT-----VGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVL  545
                V +AV++     V FL    YM+ +W LA+ VSVLE  YG  AM KS +LL+GK ++
Sbjct  161   Q-KVALAVFSLVLIFVMFLGVHVYMTALWHLASVVSVLEPVYGLAAMKKSYELLKGKTIM  219

Query  544   G--VVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQ  371
                +VF   +H     +  +F   VV G +   G+  R+  G + + VL  + + GL+ Q
Sbjct  220   ACSMVFIYLVHCGF--IAGVFGAVVVRGGE-DYGIFARLVAGGVLVGVLVIVNLIGLLVQ  276

Query  370   TVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             +V Y+VCKS+ H+ IDKSAL DHL  YLGEYVPLKS ++Q+E ++V
Sbjct  277   SVFYYVCKSFHHQEIDKSALHDHLGGYLGEYVPLKS-NIQMENFEV  321



>ref|XP_010030339.1| PREDICTED: uncharacterized protein LOC104420145 [Eucalyptus grandis]
Length=293

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 121/319 (38%), Positives = 179/319 (56%), Gaps = 39/319 (12%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD ++E++ +L    I  ES+K+I   +KIF+QI L+ +LPL+IIF  Q +VS+   + +
Sbjct  1     MDSDEEKLGYLWFLGICEESFKIIVSWKKIFTQITLAFILPLSIIFFVQFQVSENPKARI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +  + +L +        +R+ ++L+S      L K AY   LLV SLLSTSAV YTVAC 
Sbjct  61    QFEKYRLHHRGDN----ERMDEYLSSQRIEFWLIKIAYLVFLLVLSLLSTSAVTYTVACN  116

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + ++FK ++S+VPK+WK L                   +   IW FL          
Sbjct  117   YTGKSITFKNIMSMVPKLWKPL-------------------TITFIWSFL----------  147

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVL-EDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
                +  ++  +G  ++SI+WQLA+ VSVL E++YG KAM KS  L+ GK  +    FL L
Sbjct  148   -FHLAYSLCMLGTFFLSIVWQLASVVSVLEEENYGIKAMVKSVSLIEGKRQVTSFIFLPL  206

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
                 + + ++++ FVV  W+        VG+  LCL++   L +  LV QTVIYFVCKSY
Sbjct  207   VLFYYGIMIVYQLFVVYLWNLG----IVVGISTLCLVLQMLLFLSSLVIQTVIYFVCKSY  262

Query  340   QHENIDKSALSDHLEVYLG  284
               ENID  AL++HLE  L 
Sbjct  263   HCENIDMLALANHLEALLS  281



>emb|CAA16603.1| putative protein [Arabidopsis thaliana]
 emb|CAB78995.1| putative protein [Arabidopsis thaliana]
Length=306

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 180/341 (53%), Gaps = 41/341 (12%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL    I  ES  +     K F  I L+L+ PL+   LA    +Q I + +
Sbjct  1     MDLAPEELQFLNKRGILRESTSIPQYSLKTFYLITLTLIFPLSFAILAHSLFTQPILAQI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               T  Q + SQ            L  ++  LL+F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    D-TYPQADQSQ------------LQHEWTVLLVFQFCYIIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR--V  710
             YT + +SF   +S +P V KRL +TFL   L+   YN  FL    F++ + +A+  +  V
Sbjct  108   YTGKPVSFSSTMSAIPLVLKRLFITFLWVSLLMLAYNTVFLI---FLVTLIVAVDLQNVV  164

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--MVLGVV  536
              A   L V   ++ V  +YM+ +W LA+ VSVLE  YG  AM KS +LL+GK  M   +V
Sbjct  165   LAVFSLVVIFVLFLVVHVYMTALWHLASVVSVLEPIYGLAAMKKSYELLKGKTLMACSMV  224

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
             F   +H     +  +F   VV G D +      V  G L                +V Y+
Sbjct  225   FIYLVHCG--FIAGVFGAVVVRGGDDYGIFARIVAGGFL----------------SVFYY  266

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VCKS+ H+ IDKSAL DHL  YLGEYVPLKS ++Q+E ++V
Sbjct  267   VCKSFHHQEIDKSALHDHLGGYLGEYVPLKS-NIQMENFEV  306



>emb|CDY12438.1| BnaC08g09270D [Brassica napus]
Length=321

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 188/336 (56%), Gaps = 18/336 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+Q L +  +  ES  +  R  + F  I LS + PL+   LA    +Q I +  
Sbjct  1     MDLQPEELQLLTIPQLLQESISIKKRTPRTFYLITLSPIFPLSFAILAHSLFTQPILA--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  +L++S P +      SD    D+  LL F+F+Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----ELDSSDPPN------SDRSRHDWTVLLTFQFSYLIFLFSFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFRVFA  704
             YT + +SF   I+ +PKV+KRLM+TFL   L+ F YN  FL   A +I + L L+    A
Sbjct  108   YTGKPVSFSSTITDIPKVFKRLMITFLWVALLMFAYNSVFLVFLAILI-VALYLNSVGLA  166

Query  703   DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
              I   +   +Y V  +Y + +W L + VSVLE  YG  AM K+ +LL+G+  + +V    
Sbjct  167   IIAGVIISVLYFVVHVYFTALWHLGSVVSVLEPVYGLAAMRKAYELLKGETRMAMVLVFV  226

Query  523   LHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
                   ++   F   V++G     G + R  VG L + +L  + + GL+ Q+V Y+VCKS
Sbjct  227   YLLLCAVIGGAFGGIVIHGGG-KFGTLTRTLVGGLLVGLLVMVNLVGLLVQSVFYYVCKS  285

Query  343   YQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             Y H+ IDK+ L +HL  YLGEYVPLKS ++QLE  +
Sbjct  286   YHHQTIDKTVLYNHLGGYLGEYVPLKS-NIQLENLE  320



>ref|XP_003524809.1| PREDICTED: uncharacterized protein LOC100797824 [Glycine max]
Length=320

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 120/339 (35%), Positives = 177/339 (52%), Gaps = 23/339 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  R  K F  I LSL+ PL+   LA    +  + S L
Sbjct  1     MDLAPEELQFLTIPDILRESISIPKRSPKTFYLITLSLIFPLSFAILAHSLFTHPLISQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                +S   +    S  +  L          L  F     T   VF++          A +
Sbjct  61    ---QSPFNDPSQTSHEWTLLLLIQFLYLLFLFAFSLLS-TAAAVFTV----------ASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLAL----SFRV  710
             YT++ +SF   +S +P+V+KRL +TFL   L+  +YN L   + V+ I LA+    S  +
Sbjct  107   YTSKAVSFSSTLSAIPRVFKRLFLTFLWVTLLMILYNSLILLSLVLMI-LAIDTDNSLLL  165

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
             F  I   + + ++ V  +Y++ +W LA+ VSVLE  YG  AM KS  LL+G++    V  
Sbjct  166   FLAI--LIVLTLFLVAHVYITALWHLASVVSVLEPVYGLAAMKKSYHLLKGRLRFAAVLV  223

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
                  A  +++ +F   VV+G +   G+  R+ VG   + +L  + + GL+ Q+V Y+VC
Sbjct  224   SAYLVACGVISGVFSVVVVHGGE-DYGVFTRIVVGGFLVGLLVIVNLVGLLVQSVFYYVC  282

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             KSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E   V
Sbjct  283   KSYHHQGIDKSALHDHLGGYLGEYVPLKS-SIQMENLDV  320



>ref|XP_010041178.1| PREDICTED: uncharacterized protein LOC104430113 [Eucalyptus grandis]
Length=293

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 122/319 (38%), Positives = 180/319 (56%), Gaps = 39/319 (12%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD ++E++ +L    I  ES+K+I   +KIF+QI L+ +LPL+IIF  Q +VS+   + +
Sbjct  1     MDSDEEKLGYLWFLGICEESFKIIVSWKKIFTQITLAFILPLSIIFFVQFQVSENPKARI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +  + +L +        +R+ ++L+S      L K AY   LLV SLLSTSAV YTVAC 
Sbjct  61    QFEKYRLHHRGDN----ERMDEYLSSQRIEFWLIKIAYLVFLLVLSLLSTSAVTYTVACN  116

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + ++FK ++S+VPK+WK L                   +   IW FL          
Sbjct  117   YTGKSITFKNIMSMVPKLWKLL-------------------TITFIWSFL----------  147

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVL-EDSYGFKAMSKSKQLLRGKMVLGVVFFLKL  521
                +  ++  +G  ++SI+WQLA+ VSVL E++YG KAM KS  L+ GK  +    FL L
Sbjct  148   -FHLAYSLCMLGTFFLSIVWQLASVVSVLEEENYGIKAMVKSVSLIEGKRQVTSFIFLPL  206

Query  520   HFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSY  341
                 + + ++++ FVV  W+        VG+G LCL++   L +  LV QTVIYFVCKSY
Sbjct  207   VLFYYGIMIVYQLFVVYLWNLG----IVVGIGTLCLVLQMLLFLSSLVIQTVIYFVCKSY  262

Query  340   QHENIDKSALSDHLEVYLG  284
               ENID  AL++HLE  L 
Sbjct  263   HCENIDMLALANHLEALLS  281



>ref|XP_008440618.1| PREDICTED: uncharacterized protein LOC103484985 [Cucumis melo]
Length=320

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 131/337 (39%), Positives = 190/337 (56%), Gaps = 25/337 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  R  K F  I L+L+ PL+   LA       +F++ 
Sbjct  1     MDLAPEELQFLTIPDILRESILIPKRSPKTFYLITLTLIFPLSFAILAHS-----LFTHP  55

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                + Q   + P   R+ R +  LT  F         Y   L  FSLLST+AVV+TVA +
Sbjct  56    LLVQLQNPFADPIQTRH-RWTKLLTFQFC--------YLIFLFAFSLLSTAAVVFTVASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +S+   +S +PKV+KRL VTFL   L+  +YNF+  +  V+ +    +   F   
Sbjct  107   YTSKPVSYSSTLSAIPKVFKRLFVTFLWVSLLMIIYNFIFLAFLVLLVLAIDTQNYFL--  164

Query  697   PLWVGVAVYTVGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKM-VLGVVF  533
               +  V V  + FL    Y++ +W LA+ VSVLE  YGF AM KS +LL+GK    GV+ 
Sbjct  165   -FFFSVVVIFILFLVVHVYITALWHLASVVSVLEPIYGFSAMKKSYELLKGKTRFAGVLV  223

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
             F  L      +++IF   VV+G + + G++ R+ VG   + VL  + + GL+ Q+V Y+V
Sbjct  224   FAYLAICA-TISVIFGAVVVHGGNGY-GVIVRIVVGGFLVGVLVIVNLVGLLVQSVFYYV  281

Query  352   CKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             CKS+ H+ IDK AL DHL  YLGEYVPLKS  +Q++ 
Sbjct  282   CKSFHHQGIDKLALHDHLGGYLGEYVPLKS-SIQMDS  317



>gb|KDO77337.1| hypothetical protein CISIN_1g020766mg [Citrus sinensis]
Length=321

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 131/353 (37%), Positives = 185/353 (52%), Gaps = 50/353 (14%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD    E+QFL + DI  ES  +  R  + F  I L L+ PL+   LA    +  I   L
Sbjct  1     MDLSPGELQFLSIPDILRESISIPRRAARTFYFITLILIFPLSFAILAHSLFTHPI---L  57

Query  1057  RHTESQLENSQPGSPRYQ--RLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytva  884
             R  E       P   R+Q  RL           L+F+F Y   L  FSLLST+AVV+TVA
Sbjct  58    RQLEDH-PTYDPTETRHQWTRL-----------LVFQFCYLIFLFAFSLLSTAAVVFTVA  105

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR--V  710
              +YT++ +SF   +S +PKV KRL +TFL   L+  +YN +  S F+I + +A+  +  +
Sbjct  106   SLYTSKPVSFSSTMSAIPKVLKRLFITFLWVSLLMIIYNAVFLS-FLILLIIAIDTQSAL  164

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKM-VLGVVF  533
                  + V   ++ V  +Y++ +W LA+ VSVLE  YGF AM KS +LL+GK  + GV+ 
Sbjct  165   LVLFCMLVIFLLFLVVHVYITALWHLASVVSVLEPLYGFAAMKKSYELLKGKTRMAGVLV  224

Query  532   FLKLHFALFLVNL-------------IFKRFVVNGWDFHlgmvgrvgvgllcllvlfklv  392
             F  L     + ++             +F R VV G+                + VL  + 
Sbjct  225   FGYLAICAAIGSVFGVVVVHGGDRYGVFTRIVVGGF---------------LVGVLVIVN  269

Query  391   vfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             + GL+ Q+V Y+VCKSY H+ IDK AL DHL  YLGEYVPLKS  +Q+E   V
Sbjct  270   LVGLLVQSVFYYVCKSYHHQEIDKIALHDHLGGYLGEYVPLKS-SIQMENMDV  321



>ref|XP_010441817.1| PREDICTED: uncharacterized protein LOC104724944 isoform X1 [Camelina 
sativa]
 ref|XP_010441818.1| PREDICTED: uncharacterized protein LOC104724944 isoform X2 [Camelina 
sativa]
 ref|XP_010441819.1| PREDICTED: uncharacterized protein LOC104724944 isoform X3 [Camelina 
sativa]
Length=321

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 133/348 (38%), Positives = 198/348 (57%), Gaps = 40/348 (11%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     K F  I L+L+ PL+   LA    +Q I + L
Sbjct  1     MDLAAEELQFLNIQGILRESTTIPKFSPKTFYLITLTLIFPLSFAILAHSLFTQPILAQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                     +S P  P+ Q  ++H   ++  LL+++F Y   L  FSLLST+AVV+T+A +
Sbjct  61    --------DSIP--PQDQSQTNH---EWTLLLIYQFVYVIFLFAFSLLSTAAVVFTLASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR---  713
             YT + +SF   +  +P V KRL +TFL   L+  VYN  FL    F++ + +A+  +   
Sbjct  108   YTGKPVSFSSTLHAIPLVLKRLFITFLWVSLLMLVYNSVFLL---FLVVLIVAIDLQSVI  164

Query  712   --VFADIPLWV---GVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--  554
               VF+ + ++V   GV VY      M+ +W LA+ VSVLE  YG  AM KS +LL+G+  
Sbjct  165   LAVFSMVVIFVLFLGVHVY------MTALWHLASVVSVLEPIYGIAAMKKSYELLKGRTS  218

Query  553   MVLGVVFFLKLHFALFLVNL-IFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglV  377
             M   +VF   ++ AL  V   +F   VV+G D   G+  ++ VG   + +L  + + GL+
Sbjct  219   MACTMVF---VYLALCGVTAGVFGAVVVHGGD-DFGLFTKIVVGGFLVGILVIVNLVGLL  274

Query  376   TQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              Q+V Y+VCKS+ H+ IDKSAL DHL  YLG+YVPLKS  +Q+E + +
Sbjct  275   VQSVFYYVCKSFHHQEIDKSALHDHLGGYLGDYVPLKS-SIQMENFDI  321



>ref|XP_004504676.1| PREDICTED: uncharacterized protein LOC101515353 [Cicer arietinum]
Length=320

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 127/338 (38%), Positives = 183/338 (54%), Gaps = 21/338 (6%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + +I  ES  +     K F  I L+L+ PL+   LA    +  +   +
Sbjct  1     MDLAPEELQFLNISNILGESISIPKTSPKTFYLITLTLIFPLSFAILAHSLFTHPL---I  57

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
              H +S   +    S            D+  LL+ +F Y   L  FSLLST+AVV+TVA +
Sbjct  58    VHLQSPFTDPSQTS-----------HDWTLLLIIQFFYLIFLFAFSLLSTAAVVFTVASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFV---IWIFLALSFRVF  707
             YT++ +SF   IS +PKV+KRL VTF+   L+  +YNF+   + V   I +    SF +F
Sbjct  107   YTSKPVSFSSTISAIPKVFKRLFVTFIWVTLLMIMYNFVFVLSLVLLVIAVDTDNSFLLF  166

Query  706   ADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFL  527
                 + V + ++ V  +Y++ +W LA+ VSVLE  YGF AM KS +LL+G++    V   
Sbjct  167   FS--IVVILLLFLVVHVYITALWHLASVVSVLEPVYGFAAMKKSYELLKGRVRYAAVLVC  224

Query  526   KLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCK  347
                    ++  +F   VV G D +      V  G L  +++   +V  L  Q+V Y+VCK
Sbjct  225   GYLLICGVIGGMFSVVVVYGGDSYGVFSRIVIGGFLVGVLVIVNLVGLL-VQSVFYYVCK  283

Query  346   SYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             SY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E   V
Sbjct  284   SYHHQGIDKSALHDHLGGYLGEYVPLKS-SIQMENLDV  320



>ref|XP_006356886.1| PREDICTED: uncharacterized protein LOC102605114 isoform X1 [Solanum 
tuberosum]
 ref|XP_006356887.1| PREDICTED: uncharacterized protein LOC102605114 isoform X2 [Solanum 
tuberosum]
 ref|XP_006356888.1| PREDICTED: uncharacterized protein LOC102605114 isoform X3 [Solanum 
tuberosum]
 ref|XP_006356889.1| PREDICTED: uncharacterized protein LOC102605114 isoform X4 [Solanum 
tuberosum]
Length=323

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 112/341 (33%), Positives = 169/341 (50%), Gaps = 31/341 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI+ ES  +  R  K F  I L+LV PL+   LA    +  I + L
Sbjct  1     MDLPAEELQFLTIPDIFQESISIPKRSPKTFYLITLTLVFPLSFAILAHSLFTHPIITQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +   +    SQ       +    L     +LL      FT   +++              
Sbjct  61    QQNPNSSHASQWTKLIVFQFFYLLFLFAFSLLSTAAVVFTVASIYT--------------  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
               A+ +SF   ++ +P V+KRL +TF+   L    YN    + F+I++ L +      ++
Sbjct  107   --AKPVSFSSTLAAIPSVFKRLFITFIWVSLSMLAYN----TVFLIFLVLLIVAADTQNV  160

Query  697   PLW-----VGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
              L+     V   ++ V  +Y S +W LA+ VSVLE  YG  AM KS  LL+GK   G+ F
Sbjct  161   VLFLFSFLVVFILFLVVHVYFSALWHLASVVSVLEPIYGIGAMKKSYHLLKGKT--GMAF  218

Query  532   FLKLHF--ALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIY  359
             F    +     ++N  F   VV+G + +  +   +  G L  +++   +V  L+ Q+V Y
Sbjct  219   FFVFGYLSICGVINGFFGSVVVHGGESYGVISRILIGGFLVGVLVIVNLVGLLM-QSVFY  277

Query  358   FVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             +VCKSY H+ IDK+AL DHL  YLGEYVPLKS  VQ+E  +
Sbjct  278   YVCKSYHHQGIDKTALYDHLGGYLGEYVPLKS-SVQMENLE  317



>ref|XP_004145125.1| PREDICTED: uncharacterized protein LOC101217213 [Cucumis sativus]
 ref|XP_004153945.1| PREDICTED: uncharacterized protein LOC101206734 [Cucumis sativus]
Length=320

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 128/340 (38%), Positives = 184/340 (54%), Gaps = 31/340 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +  R  K F  I L+L+ PL+   LA       +F++ 
Sbjct  1     MDLAPEELQFLTIPHILRESILIPKRSPKTFYLITLTLIFPLSFAILAHS-----LFTHP  55

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                + Q   + P   R+ R +  L+  F         Y   L  FSLLST+AVV+TVA +
Sbjct  56    LLVQLQNPFADPIQTRH-RWTKLLSFQFC--------YLIFLFAFSLLSTAAVVFTVASL  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWI-------FLALS  719
             YT++ +S+   +S +PKV+KRL VTFL   L+  +YNF+  +  V+ +       +    
Sbjct  107   YTSKPVSYSSTLSAIPKVFKRLFVTFLWVSLLMIIYNFIFLAFLVLLVLAIDTQNYFLFF  166

Query  718   FRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKM-VLG  542
             F V     L++ V VY      ++ +W LA+ VSVLE  YGF AM KS +LL+GK    G
Sbjct  167   FSVIVIFILFLVVHVY------ITALWHLASVVSVLEPIYGFSAMRKSYELLKGKTRFAG  220

Query  541   VVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVI  362
             V+ F  L      +++IF   VV+G D +   V  V  G L  +++   +V  L  Q+V 
Sbjct  221   VLVFAYLAICA-TISVIFGAVVVHGGDGYGVFVRIVVGGFLVGVLVIVNLVGLL-VQSVF  278

Query  361   YFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             Y+VCKS+ H+ IDK AL DHL  YLGEYVPLKS  +Q++ 
Sbjct  279   YYVCKSFHHQGIDKLALHDHLGGYLGEYVPLKS-SIQMDS  317



>gb|KGN64471.1| hypothetical protein Csa_1G058060 [Cucumis sativus]
Length=359

 Score =   120 bits (302),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 129/342 (38%), Positives = 187/342 (55%), Gaps = 31/342 (9%)
 Frame = -3

Query  1243  DAMDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFS  1064
             + MD   EE+QFL +  I  ES  +  R  K F  I L+L+ PL+   LA       +F+
Sbjct  38    NPMDLAPEELQFLTIPHILRESILIPKRSPKTFYLITLTLIFPLSFAILAHS-----LFT  92

Query  1063  NLRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytva  884
             +    + Q   + P   R+ R +  L+        F+F Y   L  FSLLST+AVV+TVA
Sbjct  93    HPLLVQLQNPFADPIQTRH-RWTKLLS--------FQFCYLIFLFAFSLLSTAAVVFTVA  143

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWI-------FLA  725
              +YT++ +S+   +S +PKV+KRL VTFL   L+  +YNF+  +  V+ +       +  
Sbjct  144   SLYTSKPVSYSSTLSAIPKVFKRLFVTFLWVSLLMIIYNFIFLAFLVLLVLAIDTQNYFL  203

Query  724   LSFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKM-V  548
               F V     L++ V VY      ++ +W LA+ VSVLE  YGF AM KS +LL+GK   
Sbjct  204   FFFSVIVIFILFLVVHVY------ITALWHLASVVSVLEPIYGFSAMRKSYELLKGKTRF  257

Query  547   LGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
              GV+ F  L      +++IF   VV+G D +   V  V  G L  +++   +V  L  Q+
Sbjct  258   AGVLVFAYLAICA-TISVIFGAVVVHGGDGYGVFVRIVVGGFLVGVLVIVNLVGLL-VQS  315

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             V Y+VCKS+ H+ IDK AL DHL  YLGEYVPLKS  +Q++ 
Sbjct  316   VFYYVCKSFHHQGIDKLALHDHLGGYLGEYVPLKS-SIQMDS  356



>ref|XP_006398126.1| hypothetical protein EUTSA_v10001106mg [Eutrema salsugineum]
 gb|ESQ39579.1| hypothetical protein EUTSA_v10001106mg [Eutrema salsugineum]
Length=321

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 127/354 (36%), Positives = 184/354 (52%), Gaps = 52/354 (15%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     K F  I L+L+ PL+   LA    +  I + L
Sbjct  1     MDLAAEELQFLSIGGILRESTTIPKFSPKTFHLITLTLIFPLSFAILAHSLFTHPILAQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                     +S P  P  Q  ++H   ++  L +++F Y   L  FSLLST+AVV+TVA +
Sbjct  61    --------DSTP--PSDQSQTNH---EWTLLFVYQFIYIIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIW-IFLALSFRVFAD  701
             YT + +SF   +S +P V KRL +TFL   L   VYN    S F+++ + L ++  + + 
Sbjct  108   YTGKPVSFSSTMSAIPLVLKRLFITFLWVSLCMLVYN----SVFLLFLVILIIAIDIQSV  163

Query  700   IPLWVGVAVYTVGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV-V  536
             I   V + V  V FL    YM+  W LA+ VSVLE  YG  AM KS +LL+G+  +   +
Sbjct  164   ILTVVSMVVIFVLFLGVHVYMTAWWHLASVVSVLEPIYGIAAMRKSYELLKGRTHMACSM  223

Query  535   FFLKLHFALFLVNL-------------IFKRFVVNGWDFHlgmvgrvgvgllcllvlfkl  395
              F+ L    F   +             +F R VV G+                + VL  +
Sbjct  224   VFIYLALCSFTAGVFGGVVVRGGDAFGLFTRIVVGGF---------------LVGVLVIV  268

Query  394   vvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              + GL+ Q+V Y+VCKS+ H+ IDKSAL DHL  YLG+YVPLKS  +Q+E + +
Sbjct  269   NLVGLLVQSVFYYVCKSFHHQAIDKSALHDHLGGYLGDYVPLKS-SIQMENFDI  321



>ref|XP_010481699.1| PREDICTED: uncharacterized protein LOC104760477 [Camelina sativa]
 ref|XP_010481700.1| PREDICTED: uncharacterized protein LOC104760477 [Camelina sativa]
Length=321

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 134/348 (39%), Positives = 197/348 (57%), Gaps = 40/348 (11%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     K F  I L+L+ PL+   LA    +Q I + L
Sbjct  1     MDLVAEELQFLNIQGILRESTTIPKFSPKTFYLITLTLIFPLSFAILAHSLFTQPILAQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                     +S P  P+ Q  ++H   ++  LL+++F Y   L  FSLLST+AVV+TVA +
Sbjct  61    --------DSIP--PQDQSQTNH---EWTLLLIYQFIYVIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR---  713
             YT + +SF   +  +P V KRL +TFL   L+  VYN  FL    F++ + +A+  +   
Sbjct  108   YTGKPVSFSSTLHAIPLVLKRLFITFLWVSLLMLVYNSVFLL---FLVVLIVAIDLQSVI  164

Query  712   --VFADIPLWV---GVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--  554
               VF+ + ++V   GV VY      M+  W LA+ VSVLE  YG  AM KS +LL+G+  
Sbjct  165   LAVFSMVVIFVLFLGVHVY------MTAWWHLASVVSVLEPIYGIAAMRKSYELLKGRTS  218

Query  553   MVLGVVFFLKLHFALFLVNL-IFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglV  377
             M   +VF   ++ AL  V   +F   VV+G D   G+  ++ VG   + +L  + + GL+
Sbjct  219   MACTMVF---VYLALCGVTAGVFGAVVVHGGD-DFGLFTKIVVGGFLVGILVIVNLVGLL  274

Query  376   TQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              Q+V Y+VCKS+ H+ IDKSAL DHL  YLG+YVPLKS  +Q+E + +
Sbjct  275   VQSVFYYVCKSFHHQEIDKSALHDHLGGYLGDYVPLKS-SIQMENFDI  321



>emb|CDY50777.1| BnaC07g18260D [Brassica napus]
Length=322

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 129/359 (36%), Positives = 190/359 (53%), Gaps = 61/359 (17%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     + F  I L+L+ PL+   LA    +Q I +  
Sbjct  1     MDLAAEELQFLSIGGILRESTTIPKFSPRTFYLITLTLIFPLSFAILAHSLFTQPILN--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  QL+ S P + + Q  ++H    +  L +++F Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----QLDASPPSADQSQ--TNH---QWTLLFVYQFIYIIFLFAFSLLSTAAVVFTVASL  108

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR---  713
             YT++ +SF   +S +P V KRL +TFL   L   VYN  FL    F++ + +A+  +   
Sbjct  109   YTSKPVSFSSTMSAIPLVLKRLFITFLWVSLCMLVYNSVFLM---FLVILIVAIDLQSVI  165

Query  712   --VFADIPLWV---GVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMV  548
               VF+ + ++V   GV VY      M+  W LA+ VSVLE  YG  AM KS +LL+G+  
Sbjct  166   LAVFSMVVIFVLFLGVHVY------MTAWWHLASVVSVLEPVYGIAAMRKSYELLKGRTH  219

Query  547   LGV-VFFLKLHFALFLVNL-------------IFKRFVVNGWDFHlgmvgrvgvgllcll  410
             +   + F+ L    F+  +             +F R VV G+                + 
Sbjct  220   MACSMVFMYLALCGFIAGVFGGVVVRGGDDFGLFARIVVGGF---------------LVG  264

Query  409   vlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VL  + + GL+ Q+V Y+VCKS+ H+ IDKSAL DHL  YLG+YVPLKS  VQ+E + +
Sbjct  265   VLVIVNLVGLLVQSVFYYVCKSFHHQAIDKSALHDHLGGYLGDYVPLKSS-VQMENFDI  322



>ref|XP_009764357.1| PREDICTED: uncharacterized protein LOC104216094 [Nicotiana sylvestris]
 ref|XP_009764358.1| PREDICTED: uncharacterized protein LOC104216094 [Nicotiana sylvestris]
Length=323

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 128/344 (37%), Positives = 186/344 (54%), Gaps = 37/344 (11%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI+ ES  +  R  K F  I L+LV PL+   LA    +  I + L
Sbjct  1     MDLPPEELQFLTIPDIFKESISIPKRSPKTFYLITLTLVFPLSFAILAHSLFTHPIITQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +   +    SQ     + +L           ++F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    QENPNSSHASQ-----WTKL-----------IVFQFCYLLFLFGFSLLSTAAVVFTVASI  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF   ++ +P V+KRL +TF+   L    YN    + F+I++ L +   V AD 
Sbjct  105   YTSKPVSFSSTLAAIPSVFKRLFITFIWVSLSMLAYN----TVFLIFLVLLI---VAADT  157

Query  697   --------PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLG  542
                        V   ++ V  +Y+S +W LA+ VSVLE  YG  AM KS +LL+G+   G
Sbjct  158   QNVVLFLFSFLVVFVLFLVVHVYISALWHLASVVSVLEPVYGIGAMKKSYELLKGRT--G  215

Query  541   VVFFLKLHF--ALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
             + FFL   +     ++N  F   VV+G + +      V  G L  +++   +V  L  Q+
Sbjct  216   MAFFLVFGYLSICGVINGFFGTIVVHGGESYGVFSRIVVGGFLVGVLVIVNLVGLL-VQS  274

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             V Y+VCKSY H+ IDK+AL DHL  YLGEYVPLKS  VQ+E  +
Sbjct  275   VFYYVCKSYHHQGIDKTALYDHLGGYLGEYVPLKS-SVQMENME  317



>ref|XP_007158902.1| hypothetical protein PHAVU_002G191400g [Phaseolus vulgaris]
 ref|XP_007158903.1| hypothetical protein PHAVU_002G191400g [Phaseolus vulgaris]
 gb|AGV54843.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW30896.1| hypothetical protein PHAVU_002G191400g [Phaseolus vulgaris]
 gb|ESW30897.1| hypothetical protein PHAVU_002G191400g [Phaseolus vulgaris]
Length=320

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 115/339 (34%), Positives = 174/339 (51%), Gaps = 23/339 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI  ES  +  RC K F  I L+L+ PL+   LA    +  + S  
Sbjct  1     MDLAPEELQFLNITDILRESTSIPKRCPKTFYLITLTLIFPLSFAILAHSLFTHPLIS--  58

Query  1057  RHTESQLEN--SQPGSPRYQ-RLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytv  887
                  QL+N  + P    +Q  L   +   +   L       T  +VF++          
Sbjct  59    -----QLQNPFNDPSQTSHQWTLLLIIQFSYLLFLFAFSLLSTAAVVFTV----------  103

Query  886   acvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIW-IFLALSFRV  710
             A +YTA+ +SF   ++ +P+V+KRL +TFL   L   +YN L   + ++  + +     +
Sbjct  104   ASLYTAKAVSFSSTLAAIPRVFKRLFLTFLWVTLFMILYNSLILLSLLLIIVAIDTDNSL  163

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFF  530
                + L V ++++ V  +Y++ +W LA+ VSVLE  YG  AM KS QLL+G+     V  
Sbjct  164   LLLLSLLVILSLFLVAHVYITALWHLASVVSVLEPVYGLAAMKKSYQLLKGRTKYAAVLV  223

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
                     +++ +F   VV+G D +      V  G L  L++   +V  L  Q+V Y+VC
Sbjct  224   AGYLVVCSIISGVFSVVVVHGGDAYGVFTRIVVGGFLVGLLVIVNLVGLL-VQSVFYYVC  282

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             KS+ H+ IDKSAL DHL  YLGEYVPLKS  +Q+E   V
Sbjct  283   KSFHHQGIDKSALHDHLGGYLGEYVPLKS-SIQMENLDV  320



>gb|EMS48934.1| hypothetical protein TRIUR3_32538 [Triticum urartu]
Length=316

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -3

Query  649  SIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVVN  470
            +++W LA+ VSVLED  GF+AM KSK L++GK+   V+ F+ L+    +V   F+ ++V 
Sbjct  121  NVVWHLASVVSVLEDYKGFQAMRKSKALIQGKLWTVVIIFVTLNIVFVVVEFAFRAWIVQ  180

Query  469  GWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVY  290
            G    LG  GR+ +GL+ L  L  +V+  LV QTV+Y VCKSY HE+IDKS +SDHLEVY
Sbjct  181  GARHGLGAGGRLLLGLVILAALCSVVMVALVVQTVVYLVCKSYHHESIDKSNISDHLEVY  240

Query  289  LGEYVPLKSKDVQLEQY  239
            LG+YVPLK+ DVQ++ +
Sbjct  241  LGDYVPLKASDVQMQHF  257


 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+ E EE+QFLG   IY ES  ++   R ++++IA + VLPL+ +FLA   +S  +FS +
Sbjct  1     MECEPEELQFLGPVGIYRESVAILRAHRPLYARIAAAFVLPLSALFLAHIAISHALFSTI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSD  977
                +S LE+S PG+   QR+   L +D
Sbjct  61    DSDDSALESSAPGTASQQRILQRLGAD  87



>ref|XP_009101630.1| PREDICTED: uncharacterized protein LOC103827822 [Brassica rapa]
 emb|CDY39405.1| BnaAnng05360D [Brassica napus]
Length=322

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 190/359 (53%), Gaps = 61/359 (17%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     + F  I L+L+ PL+   LA    +Q I +  
Sbjct  1     MDLAAEELQFLSIGGILRESTTIPKFSPRTFYLITLTLIFPLSFAILAHSLFTQPILN--  58

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                  QL+ + P + + Q  ++H    +  L +++F Y   L  FSLLST+AVV+TVA +
Sbjct  59    -----QLDAAPPSADQSQ--TNH---QWTLLFVYQFIYIIFLFAFSLLSTAAVVFTVASL  108

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR---  713
             YT++ +SF   +S +P V KRL +TFL   L   +YN  FL    F++ + +A+  +   
Sbjct  109   YTSKPVSFSSTMSAIPLVLKRLFITFLWVSLCMLLYNSVFLM---FLVILIVAIDLQSVI  165

Query  712   --VFADIPLWV---GVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMV  548
               VF+ + ++V   GV VY      M+  W LA+ VSVLE  YG  AM KS +LL+G+  
Sbjct  166   LAVFSMVVIFVLFLGVHVY------MTAWWHLASVVSVLEPVYGIAAMRKSYELLKGRTH  219

Query  547   LGV-VFFLKLHFALFLVNL-------------IFKRFVVNGWDFHlgmvgrvgvgllcll  410
             +   + F+ L    F+  +             +F R VV G+                + 
Sbjct  220   MACSMVFMYLALCGFIAGVFGGVVVRGGDEFGLFARIVVGGF---------------LVG  264

Query  409   vlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VL  + + GL+ Q+V Y+VCKS+ H+ IDKSAL DHL  YLG+YVPLKS  VQ+E + +
Sbjct  265   VLVIVNLVGLLVQSVFYYVCKSFHHQAIDKSALHDHLGGYLGDYVPLKS-SVQMENFDI  322



>ref|XP_009630354.1| PREDICTED: uncharacterized protein LOC104120320 [Nicotiana tomentosiformis]
 ref|XP_009630355.1| PREDICTED: uncharacterized protein LOC104120320 [Nicotiana tomentosiformis]
 ref|XP_009630356.1| PREDICTED: uncharacterized protein LOC104120320 [Nicotiana tomentosiformis]
 ref|XP_009630357.1| PREDICTED: uncharacterized protein LOC104120320 [Nicotiana tomentosiformis]
Length=323

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 127/345 (37%), Positives = 187/345 (54%), Gaps = 37/345 (11%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + DI+ ES  +  R  K F  I L++V PL+   LA    +  I + L
Sbjct  1     MDLPPEELQFLTIPDIFKESISIPKRSPKTFYLITLTIVFPLSFAILAHSLFTHPIITQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             +   +    SQ     + +L           ++F+F Y   L  FSLLST+AVV+TVA +
Sbjct  61    QENPNSSHASQ-----WTKL-----------IVFQFCYLLFLFGFSLLSTAAVVFTVASI  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF   ++ +P V+KRL +TF+   L    YN    + F+I++ L +   V AD 
Sbjct  105   YTSKPVSFSSTLAAIPSVFKRLFITFIWVSLSMLAYN----TVFLIFLVLLI---VAADT  157

Query  697   --------PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLG  542
                        V   ++ V  +Y+S +W LA+ VSVLE  YG  AM KS +LL+G+   G
Sbjct  158   QNVVLFLFSFLVVFVLFLVVHVYISALWHLASVVSVLEPVYGIGAMKKSYELLKGRT--G  215

Query  541   VVFFLKLHF--ALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
             + FFL   +     ++N  F   VV+G + +      V  G L  +++   +V  L  Q+
Sbjct  216   MAFFLVFGYLSICGVINGFFGSIVVHGGESYGVFSRIVVGGFLVGVLVIVNLVGLL-VQS  274

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             V Y+VCKSY H+ IDK+AL DHL  YLGEYVPLKS  VQ+E  ++
Sbjct  275   VFYYVCKSYHHQGIDKTALYDHLGGYLGEYVPLKS-SVQMENLEM  318



>gb|KFK31603.1| hypothetical protein AALP_AA6G134500 [Arabis alpina]
Length=321

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 127/343 (37%), Positives = 181/343 (53%), Gaps = 30/343 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     K F  I L+L+ PL+   LA    +  I   L
Sbjct  1     MDLAAEELQFLTIGGILRESTTIPKFSPKTFYLITLTLIFPLSFAILAHSLFTHPILDQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                           P  Q  ++H   ++  L +++F Y   L  FSLLST+AVV+TVA +
Sbjct  61    DQIP----------PSDQSQTNH---EWTLLFVYQFIYIIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN-----FLAASAFVIWI--FLALS  719
             YT + +SF   +S +P V KRL +TFL   L+  VYN     FL      I I  F+   
Sbjct  108   YTGKPVSFSSTMSAIPLVLKRLFITFLWVSLMMLVYNSVFLLFLVVLIIAIDIQSFILAV  167

Query  718   FRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
             F +     L++GV VY      M+  W LA+ VSVLE  YG  A+ KS +LL G+  +  
Sbjct  168   FSMVVIFVLFLGVHVY------MTAWWHLASVVSVLEPIYGIAALKKSYELLNGRTNMAC  221

Query  538   -VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVI  362
              + F+ L    F+   +F   VV G D   G+  ++ +G   + VL  + + GL+ Q+V 
Sbjct  222   SMVFMYLATCGFIAG-VFGSVVVRGGD-DFGLFTKITIGGFLVGVLVIVNLVGLLVQSVF  279

Query  361   YFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             Y+VCKS+ H+ IDKSAL DHL  YLG+YVPLKS  +Q+E + +
Sbjct  280   YYVCKSFHHQAIDKSALHDHLGGYLGDYVPLKSS-IQMENFDI  321



>ref|XP_002863539.1| hypothetical protein ARALYDRAFT_917078 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002863540.1| hypothetical protein ARALYDRAFT_917082 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39798.1| hypothetical protein ARALYDRAFT_917078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39799.1| hypothetical protein ARALYDRAFT_917082 [Arabidopsis lyrata subsp. 
lyrata]
Length=321

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 130/362 (36%), Positives = 191/362 (53%), Gaps = 68/362 (19%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     K F  I L+L+ PL+   LA    +Q I + L
Sbjct  1     MDLAAEELQFLNIQGILRESTTIPKFSPKTFYLITLTLIFPLSFAILAHSLFTQPILAQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                     +S P  P  Q  ++H   ++  LL+++F Y   L  FSLLST+AVV+TVA +
Sbjct  61    --------DSTP--PSDQSKTNH---EWTLLLVYQFIYVIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR---  713
             YT + +SF   +S +P V KRL +TFL   L+  VYN  FL    F++ + +A+  +   
Sbjct  108   YTGKPVSFSSTMSAIPLVLKRLFITFLWVSLMMLVYNSVFLL---FLVVLIVAIDLQSVI  164

Query  712   --VFADIPLWV---GVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--  554
               VF+ + ++V   GV VY      M+  W LA+ VSVLE  YG  AM KS +LL+G+  
Sbjct  165   LAVFSMVVIFVLFLGVHVY------MTAWWHLASVVSVLEPIYGIAAMKKSYELLKGRTN  218

Query  553   MVLGVVFFLKLHFALFLVNL---------------IFKRFVVNGWDFHlgmvgrvgvgll  419
             M   +VF   ++ AL  +                 +F + VV G+               
Sbjct  219   MACSMVF---MYLALCGITAGVFGGVVVHGGDDFGLFTKIVVGGF---------------  260

Query  418   cllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQY  239
              + +L  + + GL+ Q+V Y+VCKS+ H+ IDKSAL DHL  YLG+YVPLKS  +Q+E +
Sbjct  261   LVGILVIVNLVGLLVQSVFYYVCKSFHHQPIDKSALHDHLGGYLGDYVPLKS-SIQMENF  319

Query  238   QV  233
              +
Sbjct  320   DI  321



>ref|XP_010494539.1| PREDICTED: uncharacterized protein LOC104771669 [Camelina sativa]
 ref|XP_010494540.1| PREDICTED: uncharacterized protein LOC104771669 [Camelina sativa]
Length=321

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 128/348 (37%), Positives = 191/348 (55%), Gaps = 40/348 (11%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     K F  I L+L+ PL+   LA    +Q I + L
Sbjct  1     MDLAAEELQFLNIQGILRESTTIPKFSPKTFYLITLTLIFPLSFAILAHSLFTQPILAQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                     +S P  P+ Q  ++H   ++  LL+++F Y   L  FSL+ST+AVV+TVA +
Sbjct  61    --------DSIP--PQDQSQTNH---EWTLLLIYQFIYVIFLFAFSLVSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIW------------I  734
             YT + +SF   +  +P V KRL +TFL   L+  VYN    S F+++            +
Sbjct  108   YTGKPVSFSSTLHAIPLVLKRLFITFLWVSLLMLVYN----SVFLLFLVVLIVAIDLQSV  163

Query  733   FLALSFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK  554
              LA+ F +     L++GV VY      M+  W LA+ VSVLE  YG  AM KS +LL+G+
Sbjct  164   ILAM-FSMVVIFVLFLGVHVY------MTAWWHLASVVSVLEPIYGIAAMKKSYELLKGR  216

Query  553   MVLGVVFFLKLHFALFLVNL-IFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglV  377
                       ++ AL  V   +F   VV+G D   G++ ++ VG   + +L  + + GL+
Sbjct  217   TSTACTMVF-VYLALCGVTAGVFGAVVVHGGD-DFGLLTKIVVGGFLVGILVIVNLVGLL  274

Query  376   TQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              Q+V Y+VCKS+ H+ IDKSAL DH+  YLG+YVPLKS  +Q+E + +
Sbjct  275   VQSVFYYVCKSFHHQEIDKSALHDHIGGYLGDYVPLKS-SIQMENFDI  321



>ref|NP_199299.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC79135.1| unknown protein [Arabidopsis thaliana]
 dbj|BAB10867.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM64612.1| unknown [Arabidopsis thaliana]
 gb|AAO41902.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64120.1| unknown protein [Arabidopsis thaliana]
 gb|AED95169.1| uncharacterized protein AT5G44860 [Arabidopsis thaliana]
Length=321

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 129/362 (36%), Positives = 188/362 (52%), Gaps = 68/362 (19%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     K F  I L+L+ PL+   LA    +Q I + L
Sbjct  1     MDLAAEELQFLNIQGILRESTTIPKFSPKTFYLITLTLIFPLSFAILAHSLFTQPILAQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               T           P  Q  ++H   ++  LL+++F Y   L  FSLLST+AVV+TVA +
Sbjct  61    DATP----------PSDQSKTNH---EWTLLLIYQFIYVIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR---  713
             YT + +SF   +S +P V KRL +TFL   L+  VYN  FL    F++ + +A+  +   
Sbjct  108   YTGKPVSFSSTMSAIPLVLKRLFITFLWVSLMMLVYNSVFLL---FLVVLIVAIDLQSVI  164

Query  712   --VFADIPLWV---GVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--  554
               VF+ + ++V   GV VY      M+  W LA+ VSVLE  YG  AM KS +LL G+  
Sbjct  165   LAVFSMVVIFVLFLGVHVY------MTAWWHLASVVSVLEPIYGIAAMKKSYELLNGRTN  218

Query  553   MVLGVVFFLKLHFALFLVNL---------------IFKRFVVNGWDFHlgmvgrvgvgll  419
             M   +VF   ++ AL  +                 +F + VV G+               
Sbjct  219   MACSMVF---MYLALCGITAGVFGGVVVHGGDDFGLFTKIVVGGF---------------  260

Query  418   cllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQY  239
              + +L  + + GL+ Q+V Y+VCKS+ H+ IDKSAL DHL  YLG+YVPLKS  +Q+E +
Sbjct  261   LVGILVIVNLVGLLVQSVFYYVCKSFHHQPIDKSALHDHLGGYLGDYVPLKS-SIQMENF  319

Query  238   QV  233
              +
Sbjct  320   DI  321



>ref|XP_002318888.1| hypothetical protein POPTR_0012s14750g [Populus trichocarpa]
 gb|EEE97108.1| hypothetical protein POPTR_0012s14750g [Populus trichocarpa]
Length=318

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 128/358 (36%), Positives = 187/358 (52%), Gaps = 69/358 (19%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + +I  ES  +  +  K F  I ++L+ PL+             F++L
Sbjct  1     MDLATEELQFLTIPEILKESTSIPKQSPKTFQLITVALIFPLS-------------FASL  47

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfa----alllfkfAYFTCLLVFSLLstsavvyt  890
              H       S    P   ++ DH +S        LL+F+F Y   L  FSLLST+AVV+T
Sbjct  48    AH-------SLFTHPLLDQIQDHPSSQNTHQWTLLLVFQFFYLIFLFAFSLLSTAAVVFT  100

Query  889   vacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRV  710
             VA +YT++ +SF    S +P+V+KRL +TFL   L+  VYN    S F++++ + +   V
Sbjct  101   VASLYTSKPVSFSSTTSAIPQVFKRLFITFLWVCLLMLVYN----SVFLLFLVILI---V  153

Query  709   FADI--PLWVGVAVYTVGFL------YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK  554
               DI   L V  ++  +G L      Y++ +W LA+ VSVLE  YG  AM KS +LL+GK
Sbjct  154   GIDIQNTLLVLFSLMVIGVLFLVVHVYITALWHLASVVSVLEPVYGLVAMKKSYELLKGK  213

Query  553   M-VLGVVFFLKLHFALFLVNL-------------IFKRFVVNGWDFHlgmvgrvgvgllc  416
             + V GV+ F  L     +  +             +F R VV G+                
Sbjct  214   IRVAGVLVFGYLSICGSVSVVFATVVVHGGDKYGVFTRIVVGGF---------------L  258

Query  415   llvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             +  L  + + GL+ Q+V Y+VCKSY H+ IDK+AL +HL  YLGEYVPLKS  +Q+E 
Sbjct  259   VGALVIVNLVGLLVQSVFYYVCKSYHHQGIDKTALHEHLGGYLGEYVPLKS-SIQMEN  315



>ref|XP_010529293.1| PREDICTED: uncharacterized protein LOC104806216 [Tarenaya hassleriana]
Length=321

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 130/338 (38%), Positives = 183/338 (54%), Gaps = 22/338 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL +  I  ES  +     K F  + L+L+ PL+   LA    +  I + L
Sbjct  1     MDLAPEELQFLSIRGILRESTSIPKFSPKTFYLVTLTLIFPLSFAILAHSLFTDPILAQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                     +  P S   Q    HL   F ALL   F Y   L  FSLLST+AVV+TVA +
Sbjct  61    --------DFYPSSDSGQI---HL--GFIALLFLLFCYLIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN-FLAASAFVIWIFLALSFRVFAD  701
             YT++ +SF   +  +P+V KRL +TFL   L+   YN        V  I + L     A 
Sbjct  108   YTSKPVSFSSTMFSIPRVLKRLFITFLWVSLLMLAYNTVFFIFVVVFLIAIDLQNVPLAM  167

Query  700   IPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--MVLGVVF-F  530
               + V   ++ V  +Y++ +W LA+ VSVLE  YGF AM KS +LL+G+  M   +VF +
Sbjct  168   FSILVIFVLFLVVHVYITALWHLASVVSVLEPVYGFGAMKKSYELLKGRTRMAFSMVFDY  227

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
             L L     ++  +F+  VV+G +   G+  R+  G   + VL  L + GL+ Q+V Y+VC
Sbjct  228   LAL---CGVIGGVFRSVVVHGGE-DYGLFTRIATGGFLVGVLVILNLVGLLVQSVFYYVC  283

Query  349   KSYQHENIDKSALSDHLEVYLGEYVPLK-SKDVQLEQY  239
             KSY H+ IDK AL+DHL  YLGEYVPLK S  +Q+E +
Sbjct  284   KSYHHQAIDKIALNDHLGGYLGEYVPLKNSSGIQMENF  321



>ref|XP_006280824.1| hypothetical protein CARUB_v10026792mg [Capsella rubella]
 gb|EOA13722.1| hypothetical protein CARUB_v10026792mg [Capsella rubella]
Length=321

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 126/356 (35%), Positives = 189/356 (53%), Gaps = 56/356 (16%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+Q+L +  I  ES  +     K F  I L+L+ PL+   LA    +Q I + L
Sbjct  1     MDLAAEELQYLNIQGILRESTTIPKFSPKTFYLITLTLIFPLSFAILAHSLFTQPILAQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                     +S P  P+ Q  ++H   ++  LL+++F Y   L  FSLLST+AVV+TVA +
Sbjct  61    --------DSSP--PQDQSQTNH---EWTLLLIYQFIYVIFLFAFSLLSTAAVVFTVASL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN--FLAASAFVIWIFLALSFR--V  710
             YT + +SF   +  +P V KRL +TFL   L+  VYN  FL    F++ + +A+  +  +
Sbjct  108   YTGKPVSFSSTMHAIPLVLKRLFITFLWVSLLMLVYNSVFLL---FLVVLIVAIDLQSVI  164

Query  709   FADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--MVLGVV  536
              A   + V   ++ V  +YM+  W LA+ VSVLE  YG  AM KS +LL+G+  M   +V
Sbjct  165   LAVFSMVVIFVLFLVVHVYMTAWWHLASVVSVLEPIYGIAAMKKSYELLKGRTNMACTMV  224

Query  535   FFLKLHFALFLVNL---------------IFKRFVVNGWDFHlgmvgrvgvgllcllvlf  401
             F   ++ AL  +                 +F + VV G+                + +L 
Sbjct  225   F---VYLALCGITAGVFGGVVVHGGDDFGLFTKIVVGGF---------------LVGILV  266

Query  400   klvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
              + + GL+ Q+V Y+VCKS+ HE IDKSAL DHL  YLG+YVPLKS  +Q+E + +
Sbjct  267   IVNLVGLLVQSVFYYVCKSFHHEEIDKSALHDHLGGYLGDYVPLKSS-IQMENFDI  321



>ref|XP_010030349.1| PREDICTED: uncharacterized protein LOC104420153 [Eucalyptus grandis]
Length=259

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 122/200 (61%), Gaps = 6/200 (3%)
 Frame = -3

Query  823  WKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADIPLWVGVAV---YTVGFLY  653
            WKRLMV FL +F +F V+  +A    +  + +   F V   + + + V +   Y VGF+Y
Sbjct  63   WKRLMVPFLRSFALFVVFIVMAIGLLIAGLIVVRQFSVGPALGIALAVILLILYVVGFVY  122

Query  652  MSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVV  473
            +++I QLA+ +SVLED+YG KAM+KSK L  GKM L V  FL +     LV  +F   VV
Sbjct  123  ITVICQLASVISVLEDAYGRKAMAKSKGLTNGKMGLRVWCFLGVFVCSVLVQALFGSLVV  182

Query  472  NGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEV  293
               D  + +  ++GV L+C+++L   V+F LV QTVIYFVCKSY HENID S LSDHLE 
Sbjct  183  --LDV-VPIGVKIGVRLICMMLLSMQVLFDLVMQTVIYFVCKSYHHENIDSSCLSDHLEF  239

Query  292  YLGEYVPLKSKDVQLEQYQV  233
              G+      K  Q+EQ+ V
Sbjct  240  CRGDCPSEGQKAAQVEQFHV  259


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPL  1112
             MDR+Q E+QFLG   +Y ES K+I + RKIF+QI L+L+L L
Sbjct  1     MDRDQHELQFLGFLGVYRESSKIILKGRKIFAQITLTLILHL  42



>ref|XP_009759733.1| PREDICTED: uncharacterized protein LOC104212215 [Nicotiana sylvestris]
Length=335

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 127/337 (38%), Positives = 182/337 (54%), Gaps = 30/337 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+Q L L  I  ES  +  R  + F +I LSL+LPL+   LA    S  I   L
Sbjct  1     MDLPPEELQHLSLPSILKESIAIPKRSPQTFYRITLSLILPLSFAILAHSLFSHPILDQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                    EN +         S H  S +  LL F+F Y   LL FSLLST+AVV+TVA +
Sbjct  61    H------ENPK---------SSH-ASQWTKLLFFQFCYLVFLLAFSLLSTAAVVFTVASL  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF  +I+ +P + +RL +TF+   L   VYN  A  +F I + + + F     +
Sbjct  105   YTSKQVSFSSIITAIPSILRRLFITFIWVLLSMLVYN--AVLSFFI-VLMLIVFESKNSV  161

Query  697   PLW-VGVAVYTVGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
              L+ + V V +V FL    Y+S +W LA+ V+VLE   G  A+ KS +LL+GKM +  V 
Sbjct  162   TLFLISVFVLSVLFLIVHVYLSALWHLASVVTVLEPIQGVTALKKSYELLKGKMRIAAVM  221

Query  532   FLKLHFALFLVNLIFKRFVVNGW-----DFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
              L       L++  F   VV+G      +    +  R+ +G + + VL  +++ GL+ Q+
Sbjct  222   VLGYLVIFGLISSGFSAIVVDGGAHEEHEAGYSLFARILIGGILIGVLVVVILVGLLVQS  281

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYV-PLKSK  260
             + Y+VCKSY +E IDKSAL  HL  YLGEY  PLK  
Sbjct  282   LFYYVCKSYHNERIDKSALYSHLGGYLGEYYEPLKGN  318



>ref|XP_011029940.1| PREDICTED: uncharacterized protein LOC105129531 [Populus euphratica]
Length=318

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 125/365 (34%), Positives = 184/365 (50%), Gaps = 83/365 (23%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+QFL + +I  ES  +  +  K F  I ++L+ PL+   LA       +F++ 
Sbjct  1     MDLATEELQFLTIPEILKESISIPKQSPKTFQLITVALIFPLSFAILAHS-----LFTH-  54

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVF-----------SLLs  911
                           P   ++ DH +S            +T LLVF           SLLS
Sbjct  55    --------------PLLDQIQDHPSSQNTHQ-------WTLLLVFQFFYFIFLFAFSLLS  93

Query  910   tsavvytvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIF  731
             T+AVV+TVA +YT++ +SF    S +P+V+KRL +TFL   L+  VYN    S F++++ 
Sbjct  94    TAAVVFTVASLYTSKPVSFSSTTSALPQVFKRLFITFLWVCLLMLVYN----SVFLLFLV  149

Query  730   LALSFRVFADI--PLWVGVAVYTVGFL------YMSIIWQLANTVSVLEDSYGFKAMSKS  575
             + +   V  DI   L V  ++  +G L      Y++ +W LA+ VSVLE  YG  AM KS
Sbjct  150   ILI---VGIDIQNTLLVLFSLMVIGVLFLVVHVYITALWHLASVVSVLEPVYGLVAMKKS  206

Query  574   KQLLRGKM-VLGVVFFLKLHFALFLVNL-------------IFKRFVVNGWDFHlgmvgr  437
              +LL+GK+ V GV+ F  L     +  +             +F R VV G+         
Sbjct  207   YELLKGKIRVAGVLVFGYLSICGLVSVVFATVVVHGGDKYGVFTRIVVGGF---------  257

Query  436   vgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKD  257
                    +  L  + + GL+ Q+V Y+VCKSY H+ IDK+AL +HL  YLGEYVPLKS  
Sbjct  258   ------LVGALVIVNLVGLLVQSVFYYVCKSYHHQGIDKTALHEHLGGYLGEYVPLKS-S  310

Query  256   VQLEQ  242
             +Q+E 
Sbjct  311   IQMEN  315



>ref|XP_008381731.1| PREDICTED: uncharacterized protein LOC103444560, partial [Malus 
domestica]
Length=127

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = -3

Query  622  VSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmv  443
            VSVLE++ G KAM+KSK+LL+G M +  + + +L+    L+   F++ VV+G  F   + 
Sbjct  1    VSVLEEARGIKAMAKSKELLKGNMWVATIIYFRLNVLAALLQFGFQQLVVSGRSF--SVA  58

Query  442  grvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYL-GEYVPLK  266
             RV  G++CLL+L KL++F LV QTV+YFVCKS+ HENIDKS LSDHLEVYL G Y+PL 
Sbjct  59   ERVAYGVICLLLLLKLILFXLVIQTVLYFVCKSHHHENIDKSELSDHLEVYLMGGYMPLS  118

Query  265  SKDVQLEQ  242
            SKDVQ EQ
Sbjct  119  SKDVQFEQ  126



>ref|XP_009589786.1| PREDICTED: uncharacterized protein LOC104087091 [Nicotiana tomentosiformis]
Length=335

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 128/337 (38%), Positives = 184/337 (55%), Gaps = 30/337 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   EE+Q L L  I  ES  +  R  + F +I LSL+LPL+   L     +  I   L
Sbjct  1     MDLLPEELQHLSLPSILKESIAIPKRSPQTFYRITLSLILPLSFAILGHSFFTHPILDQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                    EN     PR    S H  S +  LL F+F Y   LL FSLLST+AVV+TVA +
Sbjct  61    H------EN-----PR----SSH-ASQWTKLLFFQFCYLVFLLAFSLLSTAAVVFTVASL  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF  +I+ +P + +RL +TF+  FL   VYN  A  +F I + + + F     +
Sbjct  105   YTSKQVSFSSIITAIPSILRRLFITFIWVFLSMLVYN--AVLSFFI-VLMLIVFESKNSV  161

Query  697   PLW-VGVAVYTVGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
              L+ + V V +V FL    Y+S +W LA+ V+VLE + G  A+ KS +LL+GKM +  V 
Sbjct  162   TLFLISVFVLSVFFLIVHVYLSALWHLASVVTVLEPNQGLGALKKSYELLKGKMRIAAVM  221

Query  532   FLKLHFALFLVNLIFKRFVVNGW-----DFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
              L       L++  F   VV+G      +    +  R+ +G + + VL  +++ GL+ Q+
Sbjct  222   VLGYLVIFGLISSGFSAIVVDGGAHEEHEASYSIFARILIGGILIGVLVVVILVGLLVQS  281

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYV-PLKSK  260
             + Y+VCKSY +E IDKSAL  HL  YLGEY  PLK  
Sbjct  282   LFYYVCKSYHNERIDKSALYSHLGGYLGEYYEPLKGN  318



>emb|CDY51890.1| BnaC01g41310D [Brassica napus]
Length=255

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 141/241 (59%), Gaps = 19/241 (8%)
 Frame = -3

Query  946  YFTCLLVFSLLstsavvytvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYN  767
            Y   L  FSLLST+AVV+TVA +YT++ +SF   IS +P V   L VTF+   L+   Y 
Sbjct  31   YLAFLFAFSLLSTAAVVFTVASLYTSKPVSFTSTISAIPLVLNPLFVTFIWVCLLMLTYY  90

Query  766  FLAASAFVIWIFLALSFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKA  587
                + F+I++ LA  F       L++GV VY      M+ +W LA+ VSVLE  YGF A
Sbjct  91   ----TVFLIFLGLAF-FSSLVISVLFLGVHVY------MTALWHLASVVSVLEPVYGFAA  139

Query  586  MSKSKQLLRGK--MVLGVVFFLKLHFALF-LVNLIFKRFVVNGWDFHlgmvgrvgvgllc  416
            M KS  LL+GK  M   VVF   ++ AL   V+ +F + VV G + H      V  G L 
Sbjct  140  MKKSYDLLKGKTFMACAVVF---IYLALCGFVSEVFGKVVVRGGEDHGVFARIVAGGFLV  196

Query  415  llvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQ  236
             +++   +V  L  Q+V Y+VCKS+ H+ IDKSAL DHL  YLGEYVPLKS  +Q+E + 
Sbjct  197  GVLVVVNLVGLL-VQSVFYYVCKSFHHQEIDKSALHDHLGGYLGEYVPLKS-SIQMEHFD  254

Query  235  V  233
            +
Sbjct  255  I  255



>ref|XP_004229510.1| PREDICTED: uncharacterized protein LOC101252815 [Solanum lycopersicum]
Length=330

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 123/332 (37%), Positives = 181/332 (55%), Gaps = 25/332 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   E+ Q L L  ++ ES  +  R  + F +I LSL+LPL+   LA    +  I S L
Sbjct  1     MDVAPEQQQNLSLPSLFKESLSIPKRSPQTFYRITLSLILPLSFAILAHSFFTHPILSQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                 S    SQ     + +L           L ++F Y   LL FSLLSTSAVV+TVA +
Sbjct  61    HENPSASHASQ-----WTKL-----------LFYQFCYLIFLLAFSLLSTSAVVFTVASL  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF  +I+ +P + +RL +TFL  FL   VYN    S F++ + +A   +     
Sbjct  105   YTSKQVSFSSIITALPSILRRLFITFLWVFLSMLVYN-AVLSFFIVLMLIAFESKSKNST  163

Query  697   PLW-VGVAVYTVGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
              L+ V V + +V FL    Y+S +W LA+ ++VLE   G  A  KS +LL+GK+ +  V 
Sbjct  164   ALFLVSVFLLSVFFLVVHVYLSALWHLASVITVLEPIQGLAAFKKSYELLKGKIRMASVL  223

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFV  353
              L       +V+  F   VV+G  +   +  R+ VG + + VL  +++ GL+ Q++ Y+V
Sbjct  224   ILGYLVIFGVVSSGFGSIVVDGEGY--SVFVRIAVGGILIGVLVVVILVGLLVQSLFYYV  281

Query  352   CKSYQHENIDKSALSDHLEVYLGEYV-PLKSK  260
             CKSY +E IDKSAL +HL  YLGEY  PLK  
Sbjct  282   CKSYHNERIDKSALYNHLGGYLGEYYEPLKGN  313



>ref|XP_006354606.1| PREDICTED: uncharacterized protein LOC102603419 [Solanum tuberosum]
Length=336

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 176/336 (52%), Gaps = 27/336 (8%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD   E+ Q L L  ++ ES  +  R  + F +I LSL+LPL+   LA    +  I S L
Sbjct  1     MDLAPEQQQNLSLLSLFKESLSIPKRSPQTFYRITLSLILPLSFAILAHSFFTHPILSQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                 S    SQ     + +                  Y   LL FSLLSTSAVV+TVA +
Sbjct  61    HENPSASHASQWTKLLFYQFC----------------YLIFLLAFSLLSTSAVVFTVASL  104

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT++ +SF  +I+ +P + +RL +TF+  FL   VYN    S F++ + +A   +    I
Sbjct  105   YTSKQVSFSSIITALPSILRRLFITFIWVFLSMLVYN-AVLSFFIVLMLIAFESKSKNSI  163

Query  697   PLW-VGVAVYTVGFL----YMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
              L+ V V + +V FL    Y+S +W LA+ ++VLE   G  A  KS +LL+GK+ +  V 
Sbjct  164   ALFLVSVFLLSVFFLVVHVYLSALWHLASVITVLEPIQGLAAFKKSYELLKGKIRMASVL  223

Query  532   FLKLHFALFLVNLIFKRFVVNGWDFH----lgmvgrvgvgllcllvlfklvvfglVTQTV  365
              L       +++  F   VV+G          +  R+ VG + + VL  +++ GL+ Q++
Sbjct  224   VLGYLVIFGVISSAFGSIVVDGGANKDHEGYSVFVRIVVGGILIGVLVVVILVGLLVQSL  283

Query  364   IYFVCKSYQHENIDKSALSDHLEVYLGEYV-PLKSK  260
              Y+VCKSY +E IDKSAL +HL  YLGEY  PLK  
Sbjct  284   FYYVCKSYHNERIDKSALYNHLGGYLGEYYEPLKGN  319



>gb|KDO51680.1| hypothetical protein CISIN_1g035634mg [Citrus sinensis]
Length=323

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 183/325 (56%), Gaps = 12/325 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M++  E    LG F +  E++++I+  +KIFSQI L+L++PL++I  A   V+QL+ S +
Sbjct  1     MEKHNELKAALGFFGVLKETFELIFSNKKIFSQITLALIVPLSLILQANILVTQLLSSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTS-----DfaalllfkfAYFTCLLVFSLLstsavvy  893
                    +N  P    +Q  + +L+        A   L KF+YF   L+FS L TS V +
Sbjct  61    FGNN---DNMHPTFDIFQYSNLNLSELNSFKGVAFWALIKFSYFFFTLIFSFLCTSTVAF  117

Query  892   tvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR  713
              V+C+YT  D++ KK  S++PKVWK+++ T L +  + F Y+ +  S  V+   L   F 
Sbjct  118   IVSCIYTGNDINVKKAFSIIPKVWKQVLFTLLISLFIVFFYDVVFGSLLVLT--LGFLFN  175

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDS-YGFKAMSKSKQLLRGKMVLGVV  536
               A I   V + ++  G LY++I W LA  VSVLE++ YG KA++KS+ LL+GK+ + + 
Sbjct  176   GPAIIAAVVALILFFAGSLYITITWHLAIVVSVLEENVYGIKAITKSRFLLKGKIGIAMG  235

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
               +       +++ IF++F +        +  RVG+G+ C L+   L++F LV QTV+Y+
Sbjct  236   MLVISGVCSAVIDAIFQKFALRELLIQ-NVGIRVGIGVFCFLLESLLILFDLVVQTVVYY  294

Query  355   VCKSYQHENIDKSALSDHLEVYLGE  281
             VCKSY  ++    A      +Y+ E
Sbjct  295   VCKSYHADSFAGEASHQQKVIYIEE  319



>ref|XP_010680472.1| PREDICTED: uncharacterized protein LOC104895611 [Beta vulgaris 
subsp. vulgaris]
Length=134

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 6/140 (4%)
 Frame = -3

Query  652  MSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVV  473
            M++IWQLAN VSVLE   GFKA+ KSK+L++GKM       L ++     + ++ ++F  
Sbjct  1    MTMIWQLANIVSVLEKICGFKALIKSKELIKGKMGTAFALLLVMNICALPITVLQQKF--  58

Query  472  NGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEV  293
             G+      V R+  G+  L++   +++FGLV QTV Y VCKSY HE+IDKS+L DHL+ 
Sbjct  59   GGFGI----VERICFGISSLVLWTLIILFGLVVQTVFYLVCKSYHHESIDKSSLGDHLDE  114

Query  292  YLGEYVPLKSKDVQLEQYQV  233
            YLGEYV LK + +QLE   V
Sbjct  115  YLGEYVALKDESIQLEHLNV  134



>ref|XP_009397210.1| PREDICTED: uncharacterized protein LOC103982118 [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 178/345 (52%), Gaps = 35/345 (10%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE+Q L + D+  ES  +     + F+ I L+LV PL+   LA    +  I   L
Sbjct  1     MDLQLEELQALSMADVVRESVAIPRGAPRTFALITLALVFPLSFAILAHTLFTHPILLQL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                              QR SD   SD+  LLL++FAY   L  FSLLST+AVV+TVA +
Sbjct  61    -----------------QR-SDAPPSDWLLLLLYQFAYLLFLFTFSLLSTAAVVFTVASL  102

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALS-------  719
             Y A+ +SF   +  V  ++ RL  TFL   L+  +YN + A A ++ +  +         
Sbjct  103   YAAKPVSFSSSLVAVRPIFPRLFRTFLWVALLMLLYNLVFALAVLLLLLFSPLQGSPSPL  162

Query  718   FRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGV  539
             F +F  + L   +AV+    +Y+S +W LA+ +SVLE   G  AM+KS+ LLRG+  +  
Sbjct  163   FVIFFVLVLLAFLAVH----VYISALWHLASVISVLEPLCGLAAMAKSRDLLRGRARMAA  218

Query  538   VFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfgl-----VT  374
             V  +       LV  +F+  VV G +    +        + +      V+  +     + 
Sbjct  219   VLVVAYLGTCGLVGALFRAIVVKGPNEEGSLGVTSVSVKVLVGGALVAVLVMVNLVGLLV  278

Query  373   QTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQY  239
             Q+V Y+VCKSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E +
Sbjct  279   QSVFYYVCKSYHHQQIDKSALYDHLGGYLGEYVPLKS-SIQMENF  322



>ref|XP_008798698.1| PREDICTED: uncharacterized protein LOC103713518 [Phoenix dactylifera]
Length=320

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 127/341 (37%), Positives = 182/341 (53%), Gaps = 31/341 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + EE++ L L D+  ES  +     + F+ I L+LV PL+   LA    +  I   L
Sbjct  1     MDLQLEELESLTLTDVLRESVAIPRSSPRTFALITLTLVFPLSFAVLAHTLFTHPI---L  57

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
             RH +S   +S  G              +A LLL++F Y   L  FSLL+T+AVV+TVA +
Sbjct  58    RHLQSSSSSSSGG--------------WALLLLYQFVYLLFLFTFSLLATAAVVFTVASL  103

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YTA+ +SF+  I+ +P +  RL+ TFL   L+  +YN   A A ++ +    S     D 
Sbjct  104   YTAKPVSFRSTIAAIPPILPRLLRTFLWVALLMLLYNLAFALAVLLLLLATPSV----DS  159

Query  697   PLWVGVAVYTVGF-----LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
             P ++      +       +Y+S IW LA+ VSVLE   G  AM+KS+ LLRG+  +   F
Sbjct  160   PSFLLGLALVLLAFLAAHVYISAIWHLASVVSVLEPLCGLAAMAKSRDLLRGRARMAAAF  219

Query  532   FLKLHFALFLVNLIFKRFVVNGWD----FHlgmvgrvgvgllcllvlfklvvfglVTQTV  365
              +       L+   F+  VV G D       G   +V +G   + VL  L + GL+ Q+V
Sbjct  220   VVTYLGLCGLIGWAFRAVVVKGPDEEGSAQAGTGTKVLIGGALVAVLVVLNLVGLLVQSV  279

Query  364   IYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
              Y+VCKS+ H+ IDKSAL DHL  YLGEYVPLKS  +Q+E 
Sbjct  280   FYYVCKSHHHQQIDKSALYDHLGGYLGEYVPLKS-SIQMEN  319



>ref|XP_010932271.1| PREDICTED: uncharacterized protein LOC105052977 [Elaeis guineensis]
 ref|XP_010932279.1| PREDICTED: uncharacterized protein LOC105052977 [Elaeis guineensis]
 ref|XP_010932287.1| PREDICTED: uncharacterized protein LOC105052977 [Elaeis guineensis]
 ref|XP_010932295.1| PREDICTED: uncharacterized protein LOC105052977 [Elaeis guineensis]
 ref|XP_010932302.1| PREDICTED: uncharacterized protein LOC105052977 [Elaeis guineensis]
Length=320

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 120/342 (35%), Positives = 172/342 (50%), Gaps = 31/342 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + E+++ + L D+  ES  +     + F+ I L+LV PL+   LA    +  IF +L
Sbjct  1     MDLQLEQLESVTLADVLRESVSIPRSSPRTFALITLTLVFPLSFAVLAHTLFTHPIFRHL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               + S           YQ +                 Y   L  FSLLST+AVV+ VA +
Sbjct  61    HASSSSSSGEWALLLLYQFI-----------------YLLFLFTFSLLSTAAVVFAVASL  103

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y A+ +SF+  +S +  +  RL+ TFL   L+  +YN   A AF I + L  +  V  D 
Sbjct  104   YAAKPVSFRSTLSAIRPILPRLLRTFLWVALIMLLYNL--AFAFSILLLLVATHSV--DS  159

Query  697   PLWVGVAVYTVGF-----LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVF  533
             P ++      +       +Y+S IW LA+ VSVLE   G  AM+KS+ LLRG+  +   F
Sbjct  160   PSFLLGLALVLLAFLAAHVYISAIWHLASVVSVLEPICGLAAMTKSRDLLRGRARMAAAF  219

Query  532   FLKLHFALFLVNLIFKRFVVNGWD----FHlgmvgrvgvgllcllvlfklvvfglVTQTV  365
                      L+   F+  VV G D       G   +V +G   + VL  L + GL+ Q+V
Sbjct  220   VATYLGFCGLIGWAFRAIVVKGPDEDGSAGAGTGTKVLIGGALVAVLVVLNLVGLLVQSV  279

Query  364   IYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQY  239
              Y+VCKSY H+ IDKS L DHL  YLGEYVPLKS  +Q+E +
Sbjct  280   FYYVCKSYHHQQIDKSVLYDHLGGYLGEYVPLKS-SIQMENF  320



>gb|KGN47986.1| hypothetical protein Csa_6G421800 [Cucumis sativus]
Length=307

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 109/321 (34%), Positives = 160/321 (50%), Gaps = 35/321 (11%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + +EMQFLG F I+ E+YK+I + +KIF+  AL  + PL  +          I  NL
Sbjct  1     MDTKHKEMQFLGAFRIFKETYKIISKNKKIFAMAALCFIHPLNFVLSGLMLTLNNILRNL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVF--SLLstsavvytva  884
                 +               + HL S     + + +   +   +F  S+LST+ V  TVA
Sbjct  61    HDYGN---------------TSHLFSSHYMFIAWPYDIISIFFLFGWSILSTAGVSQTVA  105

Query  883   cvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFA  704
              +YT ++ S    +SVV  VWKRL+VTFL   LVF +Y+ +   A  I I   L      
Sbjct  106   TLYTGQEPSINDTMSVVVTVWKRLLVTFLCVILVFLIYHMIVGLALFIII---LPLGEVD  162

Query  703   DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
                L V    Y +G  Y+ ++ QLA  VSVLE+S GFKAM  S+ LL+  MV   V  L 
Sbjct  163   RTTLGVAFLFYFIGLFYLVVVLQLAGVVSVLEESRGFKAMENSRLLLKENMVSATVIVLT  222

Query  523   LH--FALFL------VNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
             ++  F + L        ++F    V  W +       +   L    ++   +++ LV++T
Sbjct  223   IYSGFGILLWLKALTKKMLFSPSTVPIWMY-------LLGSLSLDFLILVFLLWRLVSET  275

Query  367   VIYFVCKSYQHENIDKSALSD  305
             +IY VCKSY HE+IDK+ LSD
Sbjct  276   MIYLVCKSYNHESIDKTTLSD  296



>ref|XP_008464353.1| PREDICTED: uncharacterized protein LOC103502262 [Cucumis melo]
Length=308

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 118/321 (37%), Positives = 174/321 (54%), Gaps = 18/321 (6%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MD + +EMQFLG F I+ E+YK+I + +KIF+  AL  + PL  I          I  NL
Sbjct  1     MDTKHKEMQFLGAFQIFEETYKIISKNKKIFAMSALCFIHPLNFILSGFMFTLNYILRNL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                         G+  +   S+++T     +  +   Y   L V+S+LST+ V  TVA +
Sbjct  61    H---------DYGNTSHLFSSNYMT----VVFPYDIIYIFFLFVWSILSTAGVSQTVAAL  107

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             Y  ++ S K ++SVV KVWKRL+VTFL   LVFF+Y+ +   A  I I   L        
Sbjct  108   YNGQEPSIKDIMSVVVKVWKRLLVTFLCVILVFFIYHMIVGLALFIII---LPLGKVDRT  164

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              L V    Y VG LY+ ++ QL+  VSVLE+S GFKAM+KS+ LL+  MV   V  L ++
Sbjct  165   TLGVAFVFYFVGLLYLVVVLQLSGVVSVLEESSGFKAMAKSRLLLKENMVSATVIVLAIY  224

Query  517   --FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKS  344
               F + L      R ++      + +   +   L   L++   +++ LV++T+IYFVCKS
Sbjct  225   SGFGILLWLEALTRKMLFSTSSTVAIWMHLLGSLSLDLLILVFLLWRLVSETMIYFVCKS  284

Query  343   YQHENIDKSALSDHLEVYLGE  281
             Y+HE ID S++SDH  + LG 
Sbjct  285   YKHERIDMSSVSDHDPILLGS  305



>ref|XP_006658971.1| PREDICTED: uncharacterized protein LOC102710140 [Oryza brachyantha]
Length=349

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 88/150 (59%), Gaps = 6/150 (4%)
 Frame = -3

Query  676  VYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVN  497
            VY  G +Y+ ++W LA+ VSVLED+ G  AM KS+ LL GK+      F KL    F V 
Sbjct  199  VYLAGLVYIGVVWHLASVVSVLEDARGAAAMRKSRALLAGKLWTVAAIFAKLSGLSFAVE  258

Query  496  LIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKS  317
            + F+  VV      LG+  R  +G+     L  +++  LV Q V+YFVCKSY  E +DK+
Sbjct  259  MAFRVVVVED-KMRLGLGDRALLGMAMAATLCAVIMVALVAQAVVYFVCKSYHREVVDKA  317

Query  316  ALSDHLEVYLGEYVPLKS-----KDVQLEQ  242
             LSDHL VYLGEY PL S     + VQ+EQ
Sbjct  318  HLSDHLGVYLGEYEPLDSSNGGGRGVQMEQ  347



>ref|XP_006432197.1| hypothetical protein CICLE_v10003650mg [Citrus clementina]
 gb|ESR45437.1| hypothetical protein CICLE_v10003650mg [Citrus clementina]
Length=303

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 107/309 (35%), Positives = 178/309 (58%), Gaps = 12/309 (4%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M++  E    LG F +  E++++I+  +KIFSQI L+L++PL++I  A   V+QL+ S +
Sbjct  1     MEKHNELKAALGFFGVLKETFELIFSNKKIFSQITLALIVPLSLILQANILVTQLLSSKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTS-----DfaalllfkfAYFTCLLVFSLLstsavvy  893
                    +N  P    +Q  + +L+        A   L KF+YF   L+FS L TS V +
Sbjct  61    FGNN---DNMHPTFDIFQYSNLNLSELNSFKGVAFWALIKFSYFFFTLIFSFLCTSTVAF  117

Query  892   tvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR  713
              V+C+YT +D++ KK  S++PKVWK+++ T L +  + F Y+ +  S  V+   L   F 
Sbjct  118   IVSCIYTGKDINVKKAFSIIPKVWKQVLFTLLISLFIVFFYDVVFGSLLVLT--LGFLFN  175

Query  712   VFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDS-YGFKAMSKSKQLLRGKMVLGVV  536
               A I   V + ++  G LY++I W LA  VSVLE++ YG KA++KS+ LL+GK+ + + 
Sbjct  176   GPAIIAAVVALILFFAGSLYITITWHLAIVVSVLEENVYGIKAITKSRFLLKGKIGIAMG  235

Query  535   FFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
               +       +++ IF++F +        +  RVG+G+ C L+   L++F LV QTV+Y+
Sbjct  236   MLVISGVCSAVIDAIFQKFALRELLIQ-NVGIRVGIGVFCFLLESLLILFDLVVQTVVYY  294

Query  355   VCKSYQHEN  329
             VCKS +  +
Sbjct  295   VCKSCRSSS  303



>dbj|BAF01423.1| hypothetical protein [Arabidopsis thaliana]
Length=203

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 91/144 (63%), Gaps = 6/144 (4%)
 Frame = -3

Query  658  LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGK--MVLGVVFFLKLHFALFLVNLIFK  485
            +YM+ +W LA+ VSVLE  YG  AM KS +LL+GK  M   +VF   +H     +  +F 
Sbjct  64   VYMTALWHLASVVSVLEPIYGLAAMKKSYELLKGKTLMACSMVFIYLVHCGF--IAGVFG  121

Query  484  RFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSD  305
              VV G D   G+  R+  G   + VL  + + GL+ Q+V Y+VCKS+ H+ IDKSAL D
Sbjct  122  AVVVRGGD-DYGIFARIVAGGFLVGVLVIVNLIGLLVQSVFYYVCKSFHHQEIDKSALHD  180

Query  304  HLEVYLGEYVPLKSKDVQLEQYQV  233
            HL  YLGEYVPLKS ++Q+E ++V
Sbjct  181  HLGGYLGEYVPLKS-NIQMENFEV  203



>ref|XP_010030345.1| PREDICTED: uncharacterized protein LOC104420150 [Eucalyptus grandis]
Length=220

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 109/169 (64%), Gaps = 9/169 (5%)
 Frame = -3

Query  772  YNFLAASAFVIWIFLALSFRVFADIPLWVGVAV-----YTVGFLYMSIIWQLANTVSVLE  608
            ++ L+ SA V+++ L +  +      L + +AV     Y VGF+Y+++I QLA+ +SVLE
Sbjct  54   FSLLSTSA-VVYMGLVIVRQFSVGPALGIALAVILLILYVVGFVYITMICQLASVISVLE  112

Query  607  DSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgv  428
            D+YG KAM KSK L++GKM L V  F  +     LV  +F   V    D  + +  ++GV
Sbjct  113  DAYGRKAMMKSKGLIKGKMDLRVWCFFGVLVCSVLVQALFGSLV--ALD-AVPLGVKIGV  169

Query  427  gllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGE  281
             L+C++++  LV+F L+ QTVIYFVCKSY HENID S LS+H +VYLG+
Sbjct  170  ELICMMLMSMLVLFDLIVQTVIYFVCKSYHHENIDSSCLSNHPKVYLGD  218



>ref|XP_008795789.1| PREDICTED: uncharacterized protein LOC103711430 [Phoenix dactylifera]
Length=320

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 178/339 (53%), Gaps = 25/339 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCR-KIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             MD + E+++ + L D+  ES   I RC  + F+ I L+LV PL+   LA    +  I  +
Sbjct  1     MDLQLEQLESVSLADVLRESVS-IPRCSPRTFALITLTLVFPLSFAVLAHTLFTHPILRH  59

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             LR + S           YQ +                 Y   L  FSLLST+A+V+TVA 
Sbjct  60    LRFSSSSSSGEWALLLLYQFI-----------------YLLFLFTFSLLSTAAIVFTVAS  102

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALS-FRVFA  704
             +Y A+ +SF+  ++ +P +  RL+ TFL   L+  +YN   A A ++ +    S + V  
Sbjct  103   LYAAKPVSFRSTLAAIPPILPRLLRTFLWVALIMLLYNLAFALAILLLLVTTHSIYSVSF  162

Query  703   DIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLK  524
              + L + +  +    +Y+S IW LA+ VSVLE   G  AM+KS+ L+RG+  +   F   
Sbjct  163   LLGLVLVLLAFLAAHVYISAIWHLASVVSVLEPLCGLAAMTKSRDLIRGRARMAATFVAS  222

Query  523   LHFALFLVNLIFKRFVVNGWD----FHlgmvgrvgvgllcllvlfklvvfglVTQTVIYF  356
                   L+   F+  VV G +       G+  +V +G   + VL  L + GL+ Q+V Y+
Sbjct  223   YLGFCGLIGWAFRAVVVKGPNEEGSARAGIGAKVLIGGALVAVLVVLNLVGLLVQSVFYY  282

Query  355   VCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQY  239
             VCKSY H+ IDKSAL DHL  YLGEYVPLKS  +Q+E +
Sbjct  283   VCKSYHHQQIDKSALYDHLGGYLGEYVPLKS-SIQMEDF  320



>gb|KGN63125.1| hypothetical protein Csa_2G404770 [Cucumis sativus]
Length=304

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 99/331 (30%), Positives = 170/331 (51%), Gaps = 46/331 (14%)
 Frame = -3

Query  1225  QEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNLRHTE  1046
             Q+++QFLG++ I+IE++++I+  R IFSQI L+ +LPL          S LIF+      
Sbjct  5     QKKLQFLGIYGIFIETFRLIFTARVIFSQITLAFILPL----------SLLIFTL-----  49

Query  1045  SQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacvytAR  866
                  SQ  S  +   S              F   T   VFS           AC +T  
Sbjct  50    -----SQSSSNPWTFHSFSFNFTLFFFSAVFFFLSTSAAVFS----------AACTFTDC  94

Query  865   DLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASA---FVIWIFLALSFRVFADIP  695
              ++F  +I V PK+  +L+VTFL   + F  +NF+A SA     I I L L++     + 
Sbjct  95    RITFHHLILVAPKISIQLLVTFLCLIIDFLAFNFIALSATTPIAIMIPLLLNYEPMEFLT  154

Query  694   LWVGVAVYTVGFLYMSIIWQLANTVSVLE-DSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              ++ + +      Y  +IWQ+++ VSV E DSYGF+A+++SK++++GKM++G++  + + 
Sbjct  155   QFLILLLCIEMMFYFGLIWQISSVVSVFEADSYGFEAIARSKEVIKGKMMMGLILLILIC  214

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
             F + +V  +    +V        +   +    +   V     +  L++ TV+Y VC+ ++
Sbjct  215   FPVGVVVFVVHYGIV--------VESALVRVGIMGSVWIYSFMMFLLSGTVLYLVCRLFK  266

Query  337   HENIDKSALSDHLEVYLGEYVPLKSKDVQLE  245
              E I++S LSDHL+     Y P+KS+ V++E
Sbjct  267   GERIEESTLSDHLQ----GYFPIKSEYVKVE  293



>ref|XP_001779038.1| predicted protein [Physcomitrella patens]
 gb|EDQ56184.1| predicted protein [Physcomitrella patens]
Length=320

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 111/338 (33%), Positives = 180/338 (53%), Gaps = 25/338 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M  + E++ F G+  I  E+ K++    + F  +A +LVLPL ++ L+Q  VS  +   L
Sbjct  1     MAGDPEDIGFAGVVGICSEAVKILRSYTRHFLSMAGTLVLPLGVVLLSQSFVSDPLLRKL  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                      +Q G     R +  L ++F  L L    Y   +L  SL +T+A+VY+VAC+
Sbjct  61    ---------TQMG-----RNNQRLDAEFVGLYLIAVLYLVFVLALSLFATAAIVYSVACI  106

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFADI  698
             YT + LS+ KVI VVP VW RL+ TFL   ++   Y     +  +    +  S +V   +
Sbjct  107   YTGKGLSYMKVIRVVPNVWSRLIHTFLWAHILLSFYYAAFVALLLALFLIQESTQVSMTM  166

Query  697   PLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLH  518
              +   + V+ V  ++ +++W LA+ VSVLED+ G  AM +S  L+ GK + G  F+L   
Sbjct  167   IMIPSIIVFNVFLVHFNLVWHLASVVSVLEDTKGVCAMKRSNALIAGKRLAG--FYL---  221

Query  517   FALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQ  338
             F ++   ++F   + +G        GRV + +  L+V   + +  +V Q++ YFVCKSY 
Sbjct  222   FVIYASCILFMLGLFSGGLAKQNTSGRVFLTITLLVVWTTVTLLAIVIQSIFYFVCKSYH  281

Query  337   HENIDKSALSDHLEVYLGEYVPLK------SKDVQLEQ  242
              E ID+SAL+  L+ YLG+Y PL       + + +LEQ
Sbjct  282   QERIDRSALAQKLDGYLGDYTPLSDPVSAGAPNGELEQ  319



>ref|XP_006432196.1| hypothetical protein CICLE_v10003463mg [Citrus clementina]
 gb|ESR45436.1| hypothetical protein CICLE_v10003463mg [Citrus clementina]
Length=332

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 117/327 (36%), Positives = 184/327 (56%), Gaps = 23/327 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFS-N  1061
             M+   +E++ LG F I  ES+K+I+  +K+F+QI+ SL++P++II L  K ++ ++FS N
Sbjct  1     MEERHQELKRLGFFGILKESFKLIFSHKKLFTQISQSLLIPISII-LEVKILTAILFSFN  59

Query  1060  LRHTESQLEN-SQPGSPRYQRLSDHLTSD---faalllfkfAYFTCLLVFSLLstsavvy  893
             +    +  E+ +    P++  L+    +     A  LL +  Y   LLV S+LST  + Y
Sbjct  60    MFKNRADPEDITVFIIPQFSTLNISYIASFKWVALWLLSEVTYLILLLVLSILSTVTIAY  119

Query  892   tvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR  713
             + A +Y  +D +FKK  +VVP++WK +++TFL  F V FVY+++      + + L    R
Sbjct  120   STASIYKTKDTTFKKAAAVVPELWKPVLITFLLVFAVTFVYDYILGPVLGLILRLLFLKR  179

Query  712   VFADIPLWVGV---AVYTVGFLYMSIIWQLANTVSVLE-DSYGFKAMSKSKQLLRGKMVL  545
              FA + + +GV    +Y V F+Y+++IW +   VS LE D YG KA+ K +  L+GKM  
Sbjct  180   -FAFLKIVIGVILTVLYIVVFVYITLIWHVGTMVSALENDIYGAKAIIKGRNFLKGKMKD  238

Query  544   GVVFFLKLHFALFLVNLIFKRFVVNG----WDFHlgmvgrvgvgllcllvlfklvvfglV  377
              V  F+ L      V+  F   VV G    W         +G+G+L +L+   +V+ GLV
Sbjct  239   SVAVFVVLLTLAAGVDAAFALVVVYGTIRIWAIR------IGIGILLVLLKLMMVLIGLV  292

Query  376   TQTVIYFVCKSYQHENIDK--SALSDH  302
              QTVIYFVCKSY  EN +    A  DH
Sbjct  293   AQTVIYFVCKSYHDENFEDLYDAADDH  319



>ref|XP_003564405.2| PREDICTED: uncharacterized protein LOC100837055 [Brachypodium 
distachyon]
Length=419

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 115/350 (33%), Positives = 176/350 (50%), Gaps = 41/350 (12%)
 Frame = -3

Query  1240  AMDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSN  1061
             AM+    ++  LG  D+   S  +     + F+ +   LV PL+   LA    +  I   
Sbjct  93    AMELANHDLAALGAADLIRVSASIPRAAPRTFALLTACLVFPLSFAVLAHSLFTHPILVR  152

Query  1060  LRHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             +  +   L++ Q                + AL  ++F Y   L +FSLLST+A V+TVA 
Sbjct  153   IHTSGHTLDSHQ----------------WLALFAYQFVYAILLFIFSLLSTAAAVFTVAS  196

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFAD  701
             +Y A+  S    ++ +P +  RL+ TFL   LV   YNF    AFV+ +FL + F   A 
Sbjct  197   LYAAKPASISSSLAALPPILPRLLRTFLWVSLVMVAYNF----AFVLTVFLLILF--LAP  250

Query  700   IPLWVGVAVYTVGF------------LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG  557
              P     ++  V              +Y+S +W LA+ ++VLE   G  AMSKSKQLL+G
Sbjct  251   SPATSPPSLSFVLLLLLIVFVFLAIHVYISALWHLASVITVLEPLCGLAAMSKSKQLLQG  310

Query  556   KMVLGVVFFLKLHFALFLVNL-IFKRFVVNG----WDFHlgmvgrvgvgllcllvlfklv  392
             +  L  V     +FA+  V   +F+  VV G        L M GRV  G + + V   + 
Sbjct  311   RTRLAAVLVFS-YFAVCGVTAGLFRAAVVKGRGEEGSLGLSMPGRVLAGAVLVSVFVCVN  369

Query  391   vfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
             + GL+ Q+V Y+ CK++ ++ ID++AL +HL  YLGEYVPLKS ++Q+E 
Sbjct  370   LLGLLVQSVFYYACKAFHNQQIDRTALYEHLGGYLGEYVPLKS-NIQMEN  418



>gb|KDO51679.1| hypothetical protein CISIN_1g037643mg [Citrus sinensis]
Length=332

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 114/318 (36%), Positives = 181/318 (57%), Gaps = 21/318 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFS-N  1061
             M+   +E++ LG F I  ES+K+I+  +K+F+QI+ SL++P++II L  K ++ ++FS N
Sbjct  1     MEERHQELKRLGFFGILKESFKLIFSHKKLFTQISQSLLIPISII-LEVKILTAILFSFN  59

Query  1060  LRHTESQLEN-SQPGSPRYQRLSDHLTSD---faalllfkfAYFTCLLVFSLLstsavvy  893
             +    +  E+ +    P++  L+    +     A  LL +  Y   LLV S+LST  + Y
Sbjct  60    MFKNRADPEDITVFIIPQFSTLNISYIASFKWVALWLLSEVTYLILLLVLSILSTVTIAY  119

Query  892   tvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFR  713
             + A +Y  +D +FKK  +VVP++WK +++TFL  F V FVY+++      + + L    R
Sbjct  120   STASIYKTKDTTFKKAAAVVPELWKPVLITFLLVFAVTFVYDYILGPVLGLILRLLFLKR  179

Query  712   VFADIPLWVGV---AVYTVGFLYMSIIWQLANTVSVLE-DSYGFKAMSKSKQLLRGKMVL  545
              FA + + +GV    +Y V F+Y+++IW +   VS LE D YG KA+ K +  L+GKM  
Sbjct  180   -FAFLKIVIGVILTVLYIVVFVYITLIWHVGTMVSALENDIYGAKAIIKGRNFLKGKMKD  238

Query  544   GVVFFLKLHFALFLVNLIFKRFVVNG----WDFHlgmvgrvgvgllcllvlfklvvfglV  377
              V  F+ L      V+  F   VV G    W         +G+G+L +L+   +V+ GLV
Sbjct  239   SVAVFVVLLTLAAGVDAAFALVVVYGTIRIWAIR------IGIGILLVLLKLMMVLIGLV  292

Query  376   TQTVIYFVCKSYQHENID  323
              QTVIYFVCKSY  EN +
Sbjct  293   AQTVIYFVCKSYHDENFE  310



>ref|XP_010480794.1| PREDICTED: uncharacterized protein LOC104759583 [Camelina sativa]
Length=225

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 91/144 (63%), Gaps = 6/144 (4%)
 Frame = -3

Query  658  LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRG--KMVLGVVFFLKLHFALFLVNLIFK  485
            ++ + +W L + +SVLE  YG  AM K+ +LL+G  KM +G+VF   L     L+ ++F 
Sbjct  86   VFFTALWHLGSVISVLEPVYGLAAMRKAYELLKGKTKMAMGLVFVYLLLCG--LIGVVFG  143

Query  484  RFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSD  305
              VV+G   + G   R  VG L + VL  + + GL+ Q+V Y+VCKSY H+ IDK+AL D
Sbjct  144  AVVVHGGGKY-GTFTRTLVGGLLVGVLVMVNLVGLLVQSVFYYVCKSYHHQTIDKTALYD  202

Query  304  HLEVYLGEYVPLKSKDVQLEQYQV  233
            HL  YLG+YVPLKS ++QLE   +
Sbjct  203  HLGGYLGDYVPLKS-NIQLENLDI  225



>ref|XP_008466772.1| PREDICTED: uncharacterized protein LOC103504102 [Cucumis melo]
Length=158

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 96/146 (66%), Gaps = 4/146 (3%)
 Frame = -3

Query  664  GFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFK  485
            G  Y+ + WQL+ T++VLE+  GFKAM++SK L++GKM + +  F+ L F + +V L+F 
Sbjct  14   GEFYLILTWQLSKTIAVLEEFCGFKAMARSKALVKGKMRMVIKLFIVLSFPMEVVQLVFS  73

Query  484  RFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSD  305
            R ++        +VG++ + ++ +L++   ++  LV QTV+YFVCKSY  +  +K ++SD
Sbjct  74   RLLIQSTIIG--IVGKLVLIIIWMLLISLFLLVSLVAQTVLYFVCKSYHQKLAEKLSISD  131

Query  304  HLEVY-LGEYVPLKSKD-VQLEQYQV  233
            HL+ Y L +Y PLK +D V+ E  Q+
Sbjct  132  HLQRYLLADYDPLKVEDAVRTENLQI  157



>gb|KDO51678.1| hypothetical protein CISIN_1g020089mg [Citrus sinensis]
Length=331

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 113/345 (33%), Positives = 187/345 (54%), Gaps = 24/345 (7%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFS-N  1061
             M+R QE ++ LG F I  ES+K+I+  +K+F+QI+L+L++P++II L  K ++ ++FS N
Sbjct  1     MERHQE-LKRLGFFGILKESFKLIFSLKKLFTQISLALLIPISII-LEVKILTAILFSFN  58

Query  1060  LRHTESQLEN-SQPGSPRYQRLSDHLTSDfaalllfkfAYFT----CLLVFSLLstsavv  896
             +     + E+ +    P+Y  L+    + F  +  +  +  T     L++  L + +   
Sbjct  59    MFKNRDEPEDFTVFIIPQYSTLNISYIASFKWVAFWLLSEITYLILLLVLSILSTVTIAF  118

Query  895   ytvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSF  716
              T +   +    +FKK  + VPK+WK +++TFL  F V F Y+++      + I   L F
Sbjct  119   TTASIYKSKETTTFKKAAAAVPKLWKPVLITFLLVFAVTFAYDYILGPVLGL-ILRLLFF  177

Query  715   RVFADIPLWVGV---AVYTVGFLYMSIIWQLANTVSVLE-DSYGFKAMSKSKQLLRGKMV  548
             + FA + + +GV    +Y   F+Y+++IW +   VS LE D YG KA+ K + LL+GKM 
Sbjct  178   KKFAVLKIVIGVILTVLYIAVFVYITLIWHMGTVVSALENDIYGAKAIIKGRNLLKGKMK  237

Query  547   LGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
               V  F+ L      ++  F   VV  ++       R+GVG+L +L+   +V+ GLV QT
Sbjct  238   ASVAVFVVLLTLSAGIDTAFVLVVV--YETIRIWAVRIGVGILLVLLKLLMVLLGLVAQT  295

Query  367   VIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQYQV  233
             VIYFVCKSY  E  +    +D       + VP+   DVQ E+  V
Sbjct  296   VIYFVCKSYHDETFENLDDADD------QKVPI---DVQYEKLPV  331



>ref|XP_002986807.1| hypothetical protein SELMODRAFT_7569, partial [Selaginella moellendorffii]
 gb|EFJ12137.1| hypothetical protein SELMODRAFT_7569, partial [Selaginella moellendorffii]
Length=136

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  652  MSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVV  473
            +++IW LA+ ++VLE+ YG  A+ KS ++++GK ++G         A  ++  +F   VV
Sbjct  1    LNVIWHLASVITVLEEHYGIAALKKSARVVKGKRMVGSCLVFTHMVASGIIAALFHARVV  60

Query  472  NGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEV  293
            +          R+ +  L + +L  + + G++ Q++ YF  KS+ HE+ID+  LSDHL+ 
Sbjct  61   SANSRLPSAGPRLSLAALLVALLTLVNLLGMLLQSLFYFSVKSFHHESIDRMVLSDHLDA  120

Query  292  YLGEYVPLKSKDVQLE  245
            YLGEYVPLK  D+Q+E
Sbjct  121  YLGEYVPLKDPDIQME  136



>gb|EYU18031.1| hypothetical protein MIMGU_mgv1a013845mg [Erythranthe guttata]
Length=209

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 90/138 (65%), Gaps = 10/138 (7%)
 Frame = -3

Query  727  ALSFRVFADIPLWVGVAVYTVGFLYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMV  548
             ++F +   IP       Y +G LY+++IW LA+ VSVLE+SYG  AM KS+ L++GKM 
Sbjct  64   GMAFVLVLSIP-------YFMGLLYITMIWHLASVVSVLEESYGLNAMRKSRGLIKGKMG  116

Query  547  LGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
            +    F+ L  + F +  +FK  VV G   H G+V R+  G++CL++L   ++F L+ +T
Sbjct  117  ISAAVFVVLGLSFFGIQHMFKIHVVFG---HEGIVKRIVYGIICLVLLSISMLFQLIMET  173

Query  367  VIYFVCKSYQHENIDKSA  314
            ++YFVCKSY HENIDKS+
Sbjct  174  IVYFVCKSYHHENIDKSS  191



>ref|XP_006432195.1| hypothetical protein CICLE_v10001800mg [Citrus clementina]
 gb|ESR45435.1| hypothetical protein CICLE_v10001800mg [Citrus clementina]
Length=331

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 107/325 (33%), Positives = 179/325 (55%), Gaps = 15/325 (5%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFS-N  1061
             M+R QE ++ LG F I  ES+K+I+  +K+F+QI+L+L++P++II L  K ++ ++FS N
Sbjct  1     MERHQE-LKRLGFFGILKESFKLIFSLKKLFTQISLALLIPISII-LEVKILTAILFSFN  58

Query  1060  LRHTESQLEN-SQPGSPRYQRLSDHLTSDfaalllfkfAYFT----CLLVFSLLstsavv  896
             +     + E+ +    P+Y  L+    + F  +  +  +  T     L++  L + +   
Sbjct  59    MFKNRDEPEDFTVFIIPQYSTLNISYIASFKWVAFWLLSEITYLILLLVLSILSTVTIAF  118

Query  895   ytvacvytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSF  716
              T +   +    +FKK  + VPK+WK +++TFL  F V F Y+++      + I   L F
Sbjct  119   TTASIYKSKETTTFKKAAAAVPKLWKPILITFLLVFAVTFAYDYILGPVLGL-ILRLLFF  177

Query  715   RVFADIPLWVGV---AVYTVGFLYMSIIWQLANTVSVLE-DSYGFKAMSKSKQLLRGKMV  548
             + FA + + +GV    +Y   F+Y+++IW +   VS LE D YG KA+ K + LL+GKM 
Sbjct  178   KKFAVLKIVIGVILTVLYIAVFVYITLIWHMGTVVSALENDIYGAKAIIKGRNLLKGKMK  237

Query  547   LGVVFFLKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQT  368
               V  F+ L      ++  F   VV  ++       R+GVG+L +L+   +V+ GLV QT
Sbjct  238   ASVAVFVVLLTLSAGIDTAFVLVVV--YETIRIWAVRIGVGILLVLLKLLMVLLGLVAQT  295

Query  367   VIYFVCKSYQHENIDKSALSDHLEV  293
             VIYFVCKSY  E  +    +D  +V
Sbjct  296   VIYFVCKSYHDETFENLDDADDQKV  320



>ref|XP_002969307.1| hypothetical protein SELMODRAFT_7568, partial [Selaginella moellendorffii]
 gb|EFJ29395.1| hypothetical protein SELMODRAFT_7568, partial [Selaginella moellendorffii]
Length=136

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  652  MSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRFVV  473
            +++IW LA+ ++VLE+ YG  A+ KS ++++GK ++G         A  ++  +F   VV
Sbjct  1    LNVIWHLASVITVLEEHYGIAALKKSARVVKGKRMVGSCLVFTHMVASGIIAALFHARVV  60

Query  472  NGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHLEV  293
            +          R+ +  L + +L  + + G++ Q++ YF  KS+ HE+ID+  LSDHL+ 
Sbjct  61   SANSRLPSAGPRLSLAALLVALLTLVNLLGMLLQSLFYFSVKSFHHESIDRMVLSDHLDA  120

Query  292  YLGEYVPLKSKDVQLE  245
            Y+GEYVPLK  D+Q+E
Sbjct  121  YMGEYVPLKDPDIQME  136



>emb|CDY27163.1| BnaA08g08010D [Brassica napus]
Length=192

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = -3

Query  658  LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRF  479
            +Y + +W L + VSVLE  YG  AM K+ +LL+GK  + +V          ++   F   
Sbjct  53   VYFTALWHLGSVVSVLEPVYGLAAMRKAYELLKGKTRMAMVLVFVYLLLCAVIGGAFGGI  112

Query  478  VVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSALSDHL  299
            VV+G     G + R  VG L + +L  + + GL+ Q+V Y+VCKSY H+ IDK+ L DHL
Sbjct  113  VVHGGG-KFGTLTRTLVGGLLVGLLVMVNLVGLLVQSVFYYVCKSYHHQTIDKTVLYDHL  171

Query  298  EVYLGEYVPLKSKDVQLEQYQ  236
              YLGEYVPLKS ++QLE  +
Sbjct  172  GGYLGEYVPLKS-NIQLENLE  191



>emb|CDM84566.1| unnamed protein product [Triticum aestivum]
Length=327

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 108/351 (31%), Positives = 165/351 (47%), Gaps = 44/351 (13%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M+    ++  LG  D+   S  +     + F+ +   LV PL+   LA    +  I   +
Sbjct  1     MELATRDLAALGAADLVRVSAAIPRAAPRTFALLTACLVFPLSFAVLAHSLFTHPILRRI  60

Query  1057  RHTESQLENSQ-PGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvac  881
             R ++    ++Q      YQ L                 Y   L  FSLLST+A V+TVA 
Sbjct  61    RTSDYTATSAQWVALFAYQFL-----------------YLIFLFTFSLLSTAAAVFTVAS  103

Query  880   vytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFAD  701
             +Y A+  S    +S +P +  RL+ TFL   L+   Y+      FVI + L +   +  D
Sbjct  104   LYAAKPASIASSLSALPPILPRLLRTFLWVSLLMLAYHV----GFVITVVLLI---LLFD  156

Query  700   IPLWVGVAVYTVGF--------------LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLL  563
              P+                         +Y+S +W LA+ +SVLE   G  AMSKSKQLL
Sbjct  157   PPMTASTPPPLSFLLALLAVAFLFLAIHVYISALWHLASVISVLEPLCGLAAMSKSKQLL  216

Query  562   RGKMVLGVVFFLKLHFALFLVNLIFKRFVVNG----WDFHlgmvgrvgvgllcllvlfkl  395
             +G+     V          L+  +F+  VV          + + GR+GVG L + VL  +
Sbjct  217   QGRTRTAAVLVFSYFAICGLITGMFRSAVVKARGEEGSLDMSLAGRIGVGALLVSVLVCV  276

Query  394   vvfglVTQTVIYFVCKSYQHENIDKSALSDHLEVYLGEYVPLKSKDVQLEQ  242
              + GL+ Q+V Y+ CK+Y ++ ID++AL +HL  YLGEYVPLKS ++Q+E 
Sbjct  277   NLLGLLAQSVFYYACKAYHNQEIDRTALYEHLGGYLGEYVPLKS-NIQMEN  326



>ref|XP_010027372.1| PREDICTED: uncharacterized protein LOC104417866 [Eucalyptus grandis]
Length=174

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 83/143 (58%), Gaps = 13/143 (9%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             MDREQEE QFLG F I  ES K+I+  +KIFSQIAL  VLPL ++ LA   +S  +F+ +
Sbjct  1     MDREQEERQFLGFFGIVKESIKIIFTWQKIFSQIALDFVLPLTLVGLAHIHISAFLFAKI  60

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
                          +P Y  LSD +T +   L LF    F  + ++S+L TS    T AC 
Sbjct  61    -------------TPGYTELSDLVTLNTYELFLFTVVSFVLVEIYSILCTSTAACTTACA  107

Query  877   ytARDLSFKKVISVVPKVWKRLM  809
             YT++ ++F  V  V+PKV KRLM
Sbjct  108   YTSKSITFGGVTRVLPKVSKRLM  130



>gb|ADN33683.1| hypothetical protein [Cucumis melo subsp. melo]
Length=301

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 102/332 (31%), Positives = 169/332 (51%), Gaps = 46/332 (14%)
 Frame = -3

Query  1237  MDREQEEMQFLGLFDIYIESYKVIYRCRKIFSQIALSLVLPLAIIFLAQKEVSQLIFSNL  1058
             M   Q+ +QFLG++ I+IE++K+I+  R IFSQI L+ +LPL          S LIF   
Sbjct  1     MFLNQKRLQFLGIYGIFIETFKLIFTARVIFSQITLAFILPL----------SLLIF---  47

Query  1057  RHTESQLENSQPGSPRYQRLSDHLTSDfaalllfkfAYFTCLLVFSLLstsavvytvacv  878
               T SQ  +S P S     LS + T  F + + F  +  T   VFS           AC 
Sbjct  48    --TLSQ--SSNPWSSH--SLSFYFTLFFFSTVFFFIS--TSAAVFS----------AACT  89

Query  877   ytARDLSFKKVISVVPKVWKRLMvtflstflvffVYNFLAASAFVIWIFLALSFRVFAD-  701
             +T   ++F  +I V PK+  +L+VTFL   + F  +NF+A  A +  I + +S  +  + 
Sbjct  90    FTDCQITFHHLILVAPKISMQLLVTFLCLIIDFLAFNFIALPA-ITLIAIVISLLLIYEP  148

Query  700   --IPLWVGVAVYTVGFLYMSIIWQLANTVSVLE-DSYGFKAMSKSKQLLRGKMVLGVVFF  530
               +   + V    +   Y  +IWQ+++ VSV E DSYGF+A++ SK++++GKM++  +  
Sbjct  149   LELLTQLLVLFLCIEVFYFGLIWQISSVVSVFEADSYGFEAIATSKEVMKGKMMMASILL  208

Query  529   LKLHFALFLVNLIFKRFVVNGWDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVC  350
             + + F   ++  +    V             +    +   V     +  L++ TV+Y VC
Sbjct  209   ILICFPFGVIVFVLSYGVAES---------ALVRVGILGNVWIYSFMMFLLSGTVLYLVC  259

Query  349   KSYQHENIDKSALSDHLEVYLG-EYVPLKSKD  257
             K +  ++ID+SALS+HL+ Y    +  LK +D
Sbjct  260   KLFNGQSIDESALSNHLQGYFQINFESLKVED  291



>dbj|BAK06822.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=327

 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 87/143 (61%), Gaps = 5/143 (3%)
 Frame = -3

Query  658  LYMSIIWQLANTVSVLEDSYGFKAMSKSKQLLRGKMVLGVVFFLKLHFALFLVNLIFKRF  479
            +Y+S +W LA+ +SVLE   G  AMSKS+QLL+G+     V          L+  +F+  
Sbjct  185  VYISALWHLASVISVLEPVCGLAAMSKSRQLLQGRTRTASVLVFSYFAVCGLITALFRSA  244

Query  478  VVNG----WDFHlgmvgrvgvgllcllvlfklvvfglVTQTVIYFVCKSYQHENIDKSAL  311
            VV G        + + GR+ +G L + VL  + + GL+ Q+V Y+ CK+Y ++ ID++AL
Sbjct  245  VVKGQGEEGSLDMSLAGRILIGALLVSVLVCVNLLGLLVQSVFYYACKAYHNQQIDRTAL  304

Query  310  SDHLEVYLGEYVPLKSKDVQLEQ  242
             +HL  YLGEYVPLKS ++Q+E 
Sbjct  305  YEHLGGYLGEYVPLKS-NIQMEN  326



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3512314477896