BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c35972_g1_i1 len=373 path=[351:0-372]

Length=373
                                                                      Score     E

gb|AFQ00710.1|  pyrophosphate-energized vacuolar membrane proteon...    104   5e-23   
gb|KHG19866.1|  Pyrophosphate-energized vacuolar membrane proton ...  97.1    1e-20   
ref|XP_011084078.1|  PREDICTED: pyrophosphate-energized vacuolar ...  97.1    2e-20   
emb|CDP10479.1|  unnamed protein product                              93.6    2e-19   
ref|XP_010250265.1|  PREDICTED: pyrophosphate-energized vacuolar ...  92.4    6e-19   
emb|CDO98179.1|  unnamed protein product                              92.4    6e-19   
ref|XP_010244912.1|  PREDICTED: pyrophosphate-energized vacuolar ...  90.9    2e-18   
ref|XP_004251737.1|  PREDICTED: pyrophosphate-energized vacuolar ...  90.9    2e-18   
ref|XP_010323159.1|  PREDICTED: vacuolar-type H+-pyrophosphatase ...  90.1    4e-18   
ref|NP_001265905.1|  vacuolar-type H+-pyrophosphatase                 90.1    4e-18   
gb|AAC49175.1|  pyrophosphatase                                       90.1    4e-18   Vigna radiata var. radiata [golden gram]
dbj|BAA23649.1|  proton pyrophosphatase                               90.1    5e-18   Vigna radiata [mung bean]
sp|P21616.4|AVP_VIGRR  RecName: Full=Pyrophosphate-energized vacu...  90.1    5e-18   Vigna radiata var. radiata [golden gram]
ref|XP_003609464.1|  Vacuolar proton-inorganic pyrophosphatase        89.7    5e-18   
ref|XP_009598387.1|  PREDICTED: pyrophosphate-energized vacuolar ...  89.7    5e-18   
ref|XP_003609463.1|  Vacuolar proton-inorganic pyrophosphatase        89.4    7e-18   
ref|XP_009595111.1|  PREDICTED: pyrophosphate-energized vacuolar ...  89.4    8e-18   
gb|KHN15033.1|  Pyrophosphate-energized vacuolar membrane proton ...  89.0    1e-17   
ref|XP_004508424.1|  PREDICTED: pyrophosphate-energized vacuolar ...  89.0    1e-17   
ref|XP_006350116.1|  PREDICTED: pyrophosphate-energized vacuolar ...  88.6    1e-17   
ref|XP_009796113.1|  PREDICTED: pyrophosphate-energized vacuolar ...  88.6    1e-17   
emb|CAA58701.1|  inorganic pyrophosphatase                            88.6    1e-17   Nicotiana tabacum [American tobacco]
ref|XP_003542656.1|  PREDICTED: pyrophosphate-energized vacuolar ...  88.6    2e-17   
ref|XP_007013601.1|  Inorganic H pyrophosphatase family protein i...  88.2    2e-17   
gb|AAM97920.1|  vacuolar proton-pumping PPase                         88.2    2e-17   Oxybasis rubra [pigweed]
emb|CAA58700.1|  inorganic pyrophosphatase                            88.2    2e-17   Nicotiana tabacum [American tobacco]
ref|XP_009779977.1|  PREDICTED: pyrophosphate-energized vacuolar ...  88.2    2e-17   
ref|XP_007155080.1|  hypothetical protein PHAVU_003G171500g           88.2    2e-17   
ref|XP_007013600.1|  Inorganic H pyrophosphatase family protein i...  88.2    2e-17   
emb|CAN65456.1|  hypothetical protein VITISV_035221                   88.2    2e-17   Vitis vinifera
ref|NP_001268155.1|  vacuolar pyrophosphatase                         88.2    2e-17   
emb|CBI25554.3|  unnamed protein product                              88.2    2e-17   
ref|XP_006381091.1|  Pyrophosphate-energized vacuolar membrane pr...  87.8    2e-17   
gb|ABF85694.1|  inorganic pyrophosphatase                             87.8    2e-17   Nicotiana rustica [wild tobacco]
gb|KDO47421.1|  hypothetical protein CISIN_1g0042301mg                81.6    3e-17   
ref|XP_007204643.1|  hypothetical protein PRUPE_ppa001782mg           87.8    3e-17   
ref|XP_008242846.1|  PREDICTED: pyrophosphate-energized vacuolar ...  87.8    3e-17   
gb|EYU40132.1|  hypothetical protein MIMGU_mgv1a001763mg              87.8    3e-17   
ref|XP_009628297.1|  PREDICTED: pyrophosphate-energized vacuolar ...  87.4    3e-17   
gb|KHF98453.1|  Pyrophosphate-energized vacuolar membrane proton ...  87.4    4e-17   
ref|XP_002535533.1|  hypothetical protein RCOM_1930180                81.6    4e-17   Ricinus communis
ref|XP_009791988.1|  PREDICTED: pyrophosphate-energized vacuolar ...  87.0    4e-17   
gb|KDP30223.1|  hypothetical protein JCGZ_17005                       87.0    4e-17   
ref|XP_009363953.1|  PREDICTED: pyrophosphate-energized vacuolar ...  87.0    5e-17   
gb|ABD98735.1|  vacuolar H+-pyrophosphatase                           87.0    5e-17   Oxybasis glauca [oakleaf goosefoot]
ref|XP_009392139.1|  PREDICTED: pyrophosphate-energized vacuolar ...  86.7    6e-17   
ref|XP_011020230.1|  PREDICTED: pyrophosphate-energized vacuolar ...  86.7    6e-17   
ref|XP_011073387.1|  PREDICTED: pyrophosphate-energized vacuolar ...  86.7    7e-17   
gb|AHA38114.1|  vacuolar H+-pyrophosphatase                           86.7    7e-17   
dbj|BAA33149.1|  proton-translocating inorganic pyrophosphatase       86.3    1e-16   Cucurbita moschata [Canada pumpkin]
ref|XP_006389422.1|  Pyrophosphate-energized vacuolar membrane pr...  86.3    1e-16   
ref|XP_006474386.1|  PREDICTED: pyrophosphate-energized vacuolar ...  85.9    1e-16   
gb|KDO73437.1|  hypothetical protein CISIN_1g004159mg                 85.9    1e-16   
ref|XP_009358552.1|  PREDICTED: pyrophosphate-energized vacuolar ...  85.9    1e-16   
gb|EYU34952.1|  hypothetical protein MIMGU_mgv1a001747mg              85.9    1e-16   
ref|XP_004287260.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...  85.9    1e-16   
ref|XP_010097004.1|  Pyrophosphate-energized vacuolar membrane pr...  85.9    1e-16   
ref|XP_006359496.1|  PREDICTED: pyrophosphate-energized vacuolar ...  85.9    1e-16   
ref|XP_006453118.1|  hypothetical protein CICLE_v10007524mg           85.9    1e-16   
gb|KDO73436.1|  hypothetical protein CISIN_1g004159mg                 85.9    1e-16   
ref|XP_011017877.1|  PREDICTED: pyrophosphate-energized vacuolar ...  85.5    2e-16   
gb|KHG11819.1|  Pyrophosphate-energized vacuolar membrane proton ...  85.1    2e-16   
ref|XP_011081989.1|  PREDICTED: pyrophosphate-energized vacuolar ...  85.1    2e-16   
ref|XP_010687850.1|  PREDICTED: pyrophosphate-energized vacuolar ...  85.1    2e-16   
ref|XP_011078537.1|  PREDICTED: pyrophosphate-energized vacuolar ...  84.7    3e-16   
gb|ADQ00196.1|  vacuolar H+-PPase protein                             84.3    5e-16   
gb|ABO45933.1|  vacuolar H+-pyrophosphatase                           84.0    5e-16   Halostachys caspica
ref|XP_009593516.1|  PREDICTED: pyrophosphate-energized vacuolar ...  84.0    5e-16   
ref|XP_006427442.1|  hypothetical protein CICLE_v10024946mg           83.6    6e-16   
gb|AAA61610.1|  pyrophosphatase                                       83.6    8e-16   Beta vulgaris [beet]
ref|XP_006427443.1|  hypothetical protein CICLE_v10024946mg           83.6    8e-16   
ref|XP_010097186.1|  Pyrophosphate-energized vacuolar membrane pr...  83.6    9e-16   
ref|XP_006427441.1|  hypothetical protein CICLE_v10024946mg           83.2    9e-16   
ref|XP_006341399.1|  PREDICTED: pyrophosphate-energized vacuolar ...  83.2    1e-15   
ref|XP_004173355.1|  PREDICTED: pyrophosphate-energized vacuolar ...  82.0    2e-15   
gb|AEI17665.1|  vacuolar H+-pyrophosphatase                           82.0    2e-15   
gb|AGJ81362.1|  vacuolar H+ pyrophosphatase 1                         82.0    2e-15   
ref|XP_006492091.1|  PREDICTED: pyrophosphate-energized vacuolar ...  82.0    3e-15   
ref|XP_008676297.1|  PREDICTED: pyrophosphate-energized vacuolar ...  77.4    3e-15   
ref|XP_008352108.1|  PREDICTED: pyrophosphate-energized vacuolar ...  81.6    3e-15   
ref|XP_004150506.1|  PREDICTED: pyrophosphate-energized vacuolar ...  81.6    4e-15   
ref|XP_010541940.1|  PREDICTED: pyrophosphate-energized vacuolar ...  81.6    4e-15   
ref|XP_002453419.1|  hypothetical protein SORBIDRAFT_04g005710        81.6    4e-15   Sorghum bicolor [broomcorn]
gb|ABK91685.1|  vacuolar H+-pyrophosphatase                           81.6    4e-15   Kalidium foliatum
ref|XP_010913343.1|  PREDICTED: pyrophosphate-energized vacuolar ...  81.6    4e-15   
ref|XP_010928300.1|  PREDICTED: pyrophosphate-energized vacuolar ...  81.3    4e-15   
ref|XP_008443926.1|  PREDICTED: pyrophosphate-energized vacuolar ...  81.3    5e-15   
ref|XP_008343930.1|  PREDICTED: pyrophosphate-energized vacuolar ...  80.9    6e-15   
gb|ABS01290.1|  tonoplast proton pump                                 80.9    7e-15   Lotus corniculatus
gb|ADN96173.1|  pyrophosphate-energized vacuolar membrane proton ...  80.9    7e-15   
gb|EPS68114.1|  inorganic pyrophosphatase                             80.9    7e-15   
gb|KHG04918.1|  Pyrophosphate-energized vacuolar membrane proton ...  80.5    8e-15   
ref|XP_009117814.1|  PREDICTED: pyrophosphate-energized vacuolar ...  80.5    9e-15   
emb|CDY53310.1|  BnaA09g56670D                                        80.5    9e-15   
ref|XP_010557616.1|  PREDICTED: pyrophosphate-energized vacuolar ...  80.5    1e-14   
ref|XP_007023298.1|  Inorganic H pyrophosphatase family protein i...  80.1    1e-14   
ref|XP_007023297.1|  Inorganic H pyrophosphatase family protein i...  80.1    1e-14   
ref|XP_004235902.1|  PREDICTED: pyrophosphate-energized vacuolar ...  80.1    1e-14   
gb|KHG25943.1|  Pyrophosphate-energized vacuolar membrane proton ...  80.1    1e-14   
gb|AAS66771.1|  PPase                                                 80.1    1e-14   Hevea brasiliensis [Para rubber tree]
gb|ADD51840.1|  pyrophosphatase                                       80.1    1e-14   
ref|XP_010908157.1|  PREDICTED: pyrophosphate-energized vacuolar ...  75.5    2e-14   
ref|XP_009418179.1|  PREDICTED: pyrophosphate-energized vacuolar ...  79.3    2e-14   
emb|CDX81728.1|  BnaC08g38730D                                        79.3    3e-14   
gb|KDP37047.1|  hypothetical protein JCGZ_06103                       79.0    3e-14   
ref|XP_010459106.1|  PREDICTED: pyrophosphate-energized vacuolar ...  78.6    4e-14   
ref|XP_010476656.1|  PREDICTED: pyrophosphate-energized vacuolar ...  78.6    4e-14   
ref|XP_010497310.1|  PREDICTED: pyrophosphate-energized vacuolar ...  78.6    4e-14   
emb|CDY33390.1|  BnaC05g11930D                                        78.6    4e-14   
gb|AFW70478.1|  vacuolar H+-translocating inorganic pyrophosphatase   78.6    4e-14   
ref|XP_008795832.1|  PREDICTED: pyrophosphate-energized vacuolar ...  78.6    5e-14   
ref|XP_009765177.1|  PREDICTED: pyrophosphate-energized vacuolar ...  78.2    5e-14   
ref|XP_009403196.1|  PREDICTED: pyrophosphate-energized vacuolar ...  78.2    5e-14   
emb|CAA54869.1|  inorganic pyrophosphatase                            78.2    5e-14   Nicotiana tabacum [American tobacco]
ref|XP_002273207.1|  PREDICTED: pyrophosphate-energized vacuolar ...  78.2    5e-14   Vitis vinifera
ref|XP_006306837.1|  hypothetical protein CARUB_v10008378mg           78.2    5e-14   
ref|XP_010050115.1|  PREDICTED: pyrophosphate-energized vacuolar ...  78.2    5e-14   
gb|AGQ50316.1|  vaculoar H+ pyrophosphatase                           78.2    6e-14   
ref|XP_003531725.1|  PREDICTED: pyrophosphate-energized vacuolar ...  78.2    6e-14   
ref|XP_009407207.1|  PREDICTED: pyrophosphate-energized vacuolar ...  77.8    7e-14   
ref|XP_004241690.1|  PREDICTED: pyrophosphate-energized vacuolar ...  77.8    7e-14   
ref|XP_010537929.1|  PREDICTED: pyrophosphate-energized vacuolar ...  77.4    1e-13   
ref|XP_008679906.1|  PREDICTED: pyrophosphate-energized vacuolar ...  77.4    1e-13   
gb|AFW66266.1|  hypothetical protein ZEAMMB73_353171                  77.4    1e-13   
ref|XP_010905999.1|  PREDICTED: pyrophosphate-energized vacuolar ...  77.4    1e-13   
ref|XP_008788803.1|  PREDICTED: pyrophosphate-energized vacuolar ...  77.0    2e-13   
gb|ACT98610.2|  vacuolar proton-inorganic pyrophosphatase             76.6    2e-13   
ref|NP_001077542.1|  Pyrophosphate-energized vacuolar membrane pr...  76.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43817.1|  hypothetical protein AALP_AA1G177100                  76.6    2e-13   
gb|ADJ67258.1|  vaculor H+-pyrophosphatase                            76.6    2e-13   
ref|XP_010691127.1|  PREDICTED: pyrophosphate-energized vacuolar ...  76.3    3e-13   
ref|XP_008793954.1|  PREDICTED: pyrophosphate-energized vacuolar ...  76.3    3e-13   
gb|AAL84953.1|  At1g15690/F7H2_3                                      76.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003528302.1|  PREDICTED: pyrophosphate-energized vacuolar ...  76.3    3e-13   
ref|XP_002890120.1|  vacuolar-type H+-pumping pyrophosphatase 1       76.3    3e-13   
gb|AAP55210.1|  vacuolar proton-inorganic pyrophosphatase             76.3    3e-13   Triticum aestivum [Canadian hard winter wheat]
ref|NP_173021.1|  Pyrophosphate-energized vacuolar membrane proto...  76.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57660.1|  At1g15690/F7H2_3                                      76.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87313.1|  BnaA07g35600D                                        75.9    3e-13   
emb|CDY36581.1|  BnaA06g10340D                                        75.9    4e-13   
gb|AHZ97880.1|  vacuolar H+-pyrophosphatase                           75.9    4e-13   
gb|EMT29715.1|  Pyrophosphate-energized vacuolar membrane proton ...  75.5    4e-13   
gb|EYU24628.1|  hypothetical protein MIMGU_mgv1a001756mg              75.5    4e-13   
gb|ACA63883.1|  vacuolar proton-inorganic pyrophosphatase             75.5    5e-13   Hordeum vulgare [barley]
dbj|BAJ88084.1|  predicted protein                                    75.5    5e-13   
sp|Q06572.2|AVP_HORVU  RecName: Full=Pyrophosphate-energized vacu...  75.5    5e-13   Hordeum vulgare [barley]
ref|NP_001288904.1|  uncharacterized protein LOC103836019             75.5    5e-13   
emb|CDX96835.1|  BnaA08g23780D                                        75.1    6e-13   
dbj|BAK04633.1|  predicted protein                                    75.1    6e-13   
dbj|BAE98517.1|  hypothetical protein                                 75.1    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008801902.1|  PREDICTED: pyrophosphate-energized vacuolar ...  75.1    7e-13   
ref|NP_001266772.1|  uncharacterized protein LOC101027208             74.7    8e-13   
emb|CDY39975.1|  BnaC06g40530D                                        74.7    9e-13   
ref|XP_010927355.1|  PREDICTED: pyrophosphate-energized vacuolar ...  74.7    9e-13   
ref|NP_001288927.1|  uncharacterized protein LOC103832483             74.7    9e-13   
ref|XP_010539519.1|  PREDICTED: pyrophosphate-energized vacuolar ...  74.3    1e-12   
ref|XP_009401376.1|  PREDICTED: pyrophosphate-energized vacuolar ...  74.3    1e-12   
gb|AFW77130.1|  hypothetical protein ZEAMMB73_840165                  74.3    1e-12   
gb|AIS71988.1|  vacuolar pyrophosphatase 1                            73.9    1e-12   
ref|XP_002438225.1|  hypothetical protein SORBIDRAFT_10g009880        73.9    2e-12   Sorghum bicolor [broomcorn]
gb|AET95912.1|  PHP1                                                  73.9    2e-12   
ref|XP_010417704.1|  PREDICTED: pyrophosphate-energized vacuolar ...  73.9    2e-12   
gb|AEI17666.1|  vacuolar H+-pyrophosphatase                           73.6    2e-12   
ref|XP_006852851.1|  hypothetical protein AMTR_s00033p00195690        73.6    2e-12   
ref|NP_001105380.1|  vacuolar proton pump homolog1                    73.2    2e-12   Zea mays [maize]
ref|XP_010429951.1|  PREDICTED: pyrophosphate-energized vacuolar ...  73.2    3e-12   
ref|XP_004951661.1|  PREDICTED: pyrophosphate-energized vacuolar ...  73.2    3e-12   
ref|XP_004951662.1|  PREDICTED: pyrophosphate-energized vacuolar ...  72.8    4e-12   
gb|ABR18024.1|  unknown                                               72.8    4e-12   Picea sitchensis
ref|XP_006300952.1|  hypothetical protein CARUB_v10021340mg           72.8    4e-12   
gb|KHN38003.1|  Pyrophosphate-energized vacuolar membrane proton ...  72.8    4e-12   
ref|XP_009148959.1|  PREDICTED: pyrophosphate-energized vacuolar ...  72.8    4e-12   
dbj|BAB18681.1|  vacuolar proton-inorganic pyrophosphatase            72.8    4e-12   Hordeum vulgare [barley]
ref|XP_002530755.1|  Pyrophosphate-energized vacuolar membrane pr...  72.4    5e-12   Ricinus communis
ref|XP_010472923.1|  PREDICTED: pyrophosphate-energized vacuolar ...  72.4    5e-12   
dbj|BAJ91598.1|  predicted protein                                    72.4    6e-12   
ref|XP_003564217.1|  PREDICTED: pyrophosphate-energized vacuolar ...  72.0    6e-12   
dbj|BAA32210.1|  Vacuolar proton pyrophosphatase                      72.0    7e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646987.1|  PREDICTED: pyrophosphate-energized vacuolar ...  72.0    7e-12   
ref|XP_004303283.1|  PREDICTED: pyrophosphate-energized vacuolar ...  71.6    1e-11   
ref|XP_009385121.1|  PREDICTED: pyrophosphate-energized vacuolar ...  71.2    1e-11   
emb|CAG29370.1|  vacuolar H+-translocating inorganic pyrophosphatase  71.2    1e-11   Zea mays [maize]
ref|XP_006389797.1|  hypothetical protein EUTSA_v10018163mg           71.2    1e-11   
ref|XP_004965753.1|  PREDICTED: pyrophosphate-energized vacuolar ...  70.9    2e-11   
gb|EYU21676.1|  hypothetical protein MIMGU_mgv1a001720mg              70.9    2e-11   
ref|XP_009410369.1|  PREDICTED: pyrophosphate-energized vacuolar ...  70.9    2e-11   
ref|XP_006656294.1|  PREDICTED: pyrophosphate-energized vacuolar ...  70.5    3e-11   
ref|XP_007217159.1|  hypothetical protein PRUPE_ppa001776mg           70.1    4e-11   
ref|XP_009334631.1|  PREDICTED: pyrophosphate-energized vacuolar ...  69.7    5e-11   
gb|KFK42469.1|  hypothetical protein AALP_AA2G261100                  68.9    7e-11   
ref|XP_008372806.1|  PREDICTED: pyrophosphate-energized vacuolar ...  68.9    9e-11   
emb|CBI35335.3|  unnamed protein product                              68.6    1e-10   
dbj|BAD37432.1|  inorganic diphosphatase, H+-translocating, vacuo...  64.7    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648065.1|  PREDICTED: pyrophosphate-energized vacuolar ...  67.4    3e-10   
ref|XP_008228676.1|  PREDICTED: pyrophosphate-energized vacuolar ...  67.4    3e-10   
ref|XP_004954254.1|  PREDICTED: pyrophosphate-energized vacuolar ...  67.0    3e-10   
ref|XP_009336318.1|  PREDICTED: pyrophosphate-energized vacuolar ...  66.2    6e-10   
ref|XP_009338516.1|  PREDICTED: pyrophosphate-energized vacuolar ...  66.2    6e-10   
gb|AAL11506.1|AF367446_1  vacuolar H+-pyrophosphatase                 65.9    8e-10   Prunus persica
emb|CAD90116.1|  vacuolar pyrophosphatase                             60.1    1e-09   Vitis vinifera
ref|XP_006841407.1|  hypothetical protein AMTR_s00003p00014700        65.5    1e-09   
gb|EMS65629.1|  Pyrophosphate-energized vacuolar membrane proton ...  64.7    2e-09   
ref|NP_001058184.1|  Os06g0644200                                     64.7    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454723.1|  hypothetical protein SORBIDRAFT_04g036230        64.7    2e-09   Sorghum bicolor [broomcorn]
gb|EEE66103.1|  hypothetical protein OsJ_22136                        64.7    2e-09   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA08232.1|  vacuolar H+-pyrophosphatase                          64.7    2e-09   Oryza sativa [red rice]
dbj|BAA31523.1|  ovp1                                                 64.7    2e-09   Oryza sativa [red rice]
gb|EAZ01854.1|  hypothetical protein OsI_23875                        64.3    3e-09   Oryza sativa Indica Group [Indian rice]
gb|AAA61609.1|  pyrophosphatase                                       63.9    4e-09   Beta vulgaris [beet]
gb|EAY84762.1|  hypothetical protein OsI_06130                        61.6    6e-09   Oryza sativa Indica Group [Indian rice]
gb|AAR08913.2|  pyrophosphate-energized vacuolar membrane proton ...  62.0    2e-08   Eutrema salsugineum
ref|XP_006416887.1|  hypothetical protein EUTSA_v10006869mg           62.0    2e-08   
ref|XP_010259323.1|  PREDICTED: pyrophosphate-energized vacuolar ...  62.0    2e-08   
dbj|BAD25066.1|  putative inorganic diphosphatase                     61.6    2e-08   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD02277.1|  vacuolar proton pyrophosphatase                      61.6    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011023767.1|  PREDICTED: pyrophosphate-energized vacuolar ...  60.8    4e-08   
emb|CBI39586.3|  unnamed protein product                              60.8    4e-08   
ref|NP_001268072.1|  H+-pyrophosphatase                               60.5    5e-08   
gb|AAP06752.1|  vacuolar proton-inorganic pyrophosphatase             60.5    6e-08   Hordeum brevisubulatum
ref|XP_002318956.1|  inorganic pyrophosphatase family protein         60.1    7e-08   Populus trichocarpa [western balsam poplar]
gb|KHN16066.1|  Pyrophosphate-energized vacuolar membrane proton ...  59.7    1e-07   
gb|ABX10014.1|  vacuolar H+-pyrophosphatase                           59.3    1e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010042849.1|  PREDICTED: pyrophosphate-energized vacuolar ...  58.2    1e-07   
ref|XP_010039554.1|  PREDICTED: pyrophosphate-energized vacuolar ...  58.9    2e-07   
gb|KCW45902.1|  hypothetical protein EUGRSUZ_L00271                   58.9    2e-07   
ref|XP_003555808.1|  PREDICTED: pyrophosphate-energized vacuolar ...  58.9    2e-07   
ref|XP_006605822.1|  PREDICTED: pyrophosphate-energized vacuolar ...  58.5    2e-07   
ref|XP_006382405.1|  inorganic pyrophosphatase family protein         57.8    4e-07   
emb|CDX83972.1|  BnaC08g16730D                                        57.8    4e-07   
gb|KHG22725.1|  Pyrophosphate-energized vacuolar membrane proton ...  57.4    6e-07   
gb|ACN40474.1|  unknown                                               57.0    8e-07   Picea sitchensis
gb|ABR16052.1|  unknown                                               57.0    8e-07   Picea sitchensis
ref|XP_006656699.1|  PREDICTED: pyrophosphate-energized vacuolar ...  56.6    1e-06   
dbj|BAF63470.1|  vacuolar proton-pyrophosphatase                      56.6    1e-06   Potamogeton distinctus
ref|XP_003563306.1|  PREDICTED: pyrophosphate-energized vacuolar ...  56.6    1e-06   
ref|XP_010033979.1|  PREDICTED: pyrophosphate-energized vacuolar ...  56.2    1e-06   
ref|XP_007031139.1|  Inorganic H pyrophosphatase family protein i...  55.8    1e-06   
ref|NP_001146732.1|  uncharacterized protein LOC100280334             56.2    2e-06   Zea mays [maize]
ref|XP_007031138.1|  Inorganic H pyrophosphatase family protein i...  55.8    2e-06   
ref|XP_002960455.1|  hypothetical protein SELMODRAFT_270204           55.8    2e-06   
ref|XP_002967265.1|  hypothetical protein SELMODRAFT_270614           55.8    2e-06   
ref|XP_004964695.1|  PREDICTED: pyrophosphate-energized vacuolar ...  54.7    4e-06   
ref|XP_008797457.1|  PREDICTED: pyrophosphate-energized vacuolar ...  54.3    6e-06   
ref|XP_009630144.1|  PREDICTED: pyrophosphate-energized vacuolar ...  53.9    7e-06   
ref|XP_009630145.1|  PREDICTED: pyrophosphate-energized vacuolar ...  53.9    7e-06   
gb|AGT15917.1|  vacuolar H+-pyrophosphatase                           53.9    8e-06   
ref|XP_008370385.1|  PREDICTED: pyrophosphate-energized vacuolar ...  53.9    8e-06   
gb|AGT16227.1|  vacuolar proton pyrophosphatase                       53.9    8e-06   
gb|AGT16998.1|  diphosphatase                                         53.9    8e-06   
ref|XP_008359855.1|  PREDICTED: pyrophosphate-energized vacuolar ...  53.9    9e-06   
gb|KDP23377.1|  hypothetical protein JCGZ_23210                       53.1    1e-05   
ref|XP_009763192.1|  PREDICTED: pyrophosphate-energized vacuolar ...  53.1    2e-05   
ref|XP_004230300.1|  PREDICTED: pyrophosphate-energized vacuolar ...  52.8    2e-05   
ref|XP_008245918.1|  PREDICTED: pyrophosphate-energized vacuolar ...  52.8    2e-05   
gb|EAZ24976.1|  hypothetical protein OsJ_08754                        52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048422.1|  Os02g0802500                                     52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAF18416.1|  proton translocating pyrophosphatase                 52.8    2e-05   Oryza sativa [red rice]
gb|EAZ42870.1|  hypothetical protein OsJ_27463                        50.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ABK62847.1|  vacuolar H+-PPase                                     51.6    4e-05   Malus domestica [apple tree]
ref|XP_006344755.1|  PREDICTED: pyrophosphate-energized vacuolar ...  51.6    4e-05   
ref|XP_009373278.1|  PREDICTED: pyrophosphate-energized vacuolar ...  51.6    5e-05   
gb|AAL11507.1|AF367447_1  vacuolar H+-pyrophosphatase                 51.2    6e-05   Prunus persica
ref|XP_007208066.1|  hypothetical protein PRUPE_ppa001833mg           51.2    6e-05   
emb|CDP18241.1|  unnamed protein product                              50.1    2e-04   
ref|XP_002437341.1|  hypothetical protein SORBIDRAFT_10g025280        50.1    2e-04   Sorghum bicolor [broomcorn]
gb|KCW60551.1|  hypothetical protein EUGRSUZ_H03285                   49.7    2e-04   
ref|XP_010024124.1|  PREDICTED: pyrophosphate-energized vacuolar ...  49.7    2e-04   
gb|KCW60550.1|  hypothetical protein EUGRSUZ_H03285                   49.7    2e-04   
ref|XP_009412123.1|  PREDICTED: pyrophosphate-energized vacuolar ...  49.3    3e-04   
ref|XP_004302243.1|  PREDICTED: pyrophosphate-energized vacuolar ...  49.3    3e-04   
ref|XP_002512502.1|  Pyrophosphate-energized vacuolar membrane pr...  48.9    3e-04   Ricinus communis
ref|XP_003567657.1|  PREDICTED: pyrophosphate-energized vacuolar ...  47.8    7e-04   
gb|EMS67278.1|  hypothetical protein TRIUR3_04121                     44.7    7e-04   



>gb|AFQ00710.1| pyrophosphate-energized vacuolar membrane proteon pump 1 [Ipomoea 
batatas]
Length=767

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 1/64 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  361
            M A+TILPDLGT++LIP CAIVGIAFALVQW+LVSKVKLSPEKS    +D KNGFAESLI
Sbjct  1    MVAATILPDLGTQVLIPACAIVGIAFALVQWVLVSKVKLSPEKSGPGPADGKNGFAESLI  60

Query  362  EEEE  373
            EEEE
Sbjct  61   EEEE  64



>gb|KHG19866.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=771

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 5/68 (7%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  349
            MGAS+ILPDLGTEILIPVCA++GIAF+LVQWILVS+VKLSP + +     S +  KNG+A
Sbjct  1    MGASSILPDLGTEILIPVCAVIGIAFSLVQWILVSRVKLSPGRDSGASGNSGAAGKNGYA  60

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  61   DYLIEEEE  68



>ref|XP_011084078.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
 ref|XP_011084079.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=823

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M  +T+LPDLGT+ILIP+CA+VGIAFALVQW+LVSKVKLS +KS+S +D KNGF E+LIE
Sbjct  59   MAETTLLPDLGTQILIPICALVGIAFALVQWLLVSKVKLSTDKSSS-ADGKNGFTEALIE  117

Query  365  EEE  373
            EE+
Sbjct  118  EED  120



>emb|CDP10479.1| unnamed protein product [Coffea canephora]
Length=765

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ ILPDL TEILIPVCA++GI FALVQW+LVSKVKLS +K  + +D KNGF E+LIE
Sbjct  1    MGAA-ILPDLATEILIPVCAVIGIIFALVQWLLVSKVKLSHDKFDAGADGKNGFTEALIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>ref|XP_010250265.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nelumbo nucifera]
Length=765

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ IL DL TEILIPVCA+VGIAFALVQW LVS+VKLSPE+  S +++KNG+ + LIE
Sbjct  1    MGAA-ILSDLATEILIPVCAVVGIAFALVQWSLVSRVKLSPERQTSSNNSKNGYNDYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>emb|CDO98179.1| unnamed protein product [Coffea canephora]
Length=762

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            +LPDLGTEI+IPVCA++GI F+L+QW+LVS+VKLSPE+  +++++KNGF + LIEEEE
Sbjct  3    LLPDLGTEIVIPVCAVIGIIFSLIQWVLVSRVKLSPERKEANNNSKNGFNDCLIEEEE  60



>ref|XP_010244912.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nelumbo nucifera]
Length=765

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ IL DL TEILIPVCA++GI F+LVQW+LVS+VKLSPE+  S +++KNG+ + LIE
Sbjct  1    MGAA-ILSDLATEILIPVCAVIGIVFSLVQWLLVSRVKLSPERQTSSNNSKNGYNDYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>ref|XP_004251737.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=769

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 4/65 (6%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD----SDAKNGFAESL  358
             +TILPDLGTEILIPVCA++GI FALVQW++VSKV +S +  +S     +D KNG+AESL
Sbjct  2    GTTILPDLGTEILIPVCAVIGIGFALVQWVIVSKVTVSTDGKSSSPGAGADGKNGYAESL  61

Query  359  IEEEE  373
            IEEEE
Sbjct  62   IEEEE  66



>ref|XP_010323159.1| PREDICTED: vacuolar-type H+-pyrophosphatase isoform X1 [Solanum 
lycopersicum]
Length=765

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +2

Query  197  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            TIL DLG EILIPVCA+VGIAF+L QW LVSKV +  +KS S  D KNG+AESLIEEEE
Sbjct  4    TILTDLGMEILIPVCAVVGIAFSLFQWYLVSKVTVGTDKSHSSGDDKNGYAESLIEEEE  62



>ref|NP_001265905.1| vacuolar-type H+-pyrophosphatase [Solanum lycopersicum]
 dbj|BAM65603.1| vacuolar H+-pyrophosphatase [Solanum lycopersicum]
Length=765

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +2

Query  197  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            TIL DLG EILIPVCA+VGIAF+L QW LVSKV +  +KS S  D KNG+AESLIEEEE
Sbjct  4    TILTDLGMEILIPVCAVVGIAFSLFQWYLVSKVTVGTDKSHSSGDDKNGYAESLIEEEE  62



>gb|AAC49175.1| pyrophosphatase [Vigna radiata]
Length=765

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  361
            MGA+ ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS ++ AKNG+ + LI
Sbjct  1    MGAA-ILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAAKNGYNDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>dbj|BAA23649.1| proton pyrophosphatase [Vigna radiata]
Length=766

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  361
            MGA+ ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS ++ AKNG+ + LI
Sbjct  1    MGAA-ILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAAKNGYNDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>sp|P21616.4|AVP_VIGRR RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase; 
Short=H(+)-PPase; AltName: Full=Vacuolar H(+)-pyrophosphatase 
[Vigna radiata var. radiata]
 pdb|4A01|A Chain A, Crystal Structure Of The H-Translocating Pyrophosphatase
 pdb|4A01|B Chain B, Crystal Structure Of The H-Translocating Pyrophosphatase
Length=766

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  361
            MGA+ ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS ++ AKNG+ + LI
Sbjct  1    MGAA-ILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAAKNGYNDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_003609464.1| Vacuolar proton-inorganic pyrophosphatase [Medicago truncatula]
Length=715

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLI  361
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKL+  + SA+++  KNG+ +SLI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLTAGRDSATEAPGKNGYNDSLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_009598387.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=766

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGF-AESLI  361
            MGA  IL DLGTEILIPVCA+VGIAF+L QW LVSKV LS EKS+  +D KNG+ AESLI
Sbjct  1    MGAP-ILSDLGTEILIPVCAVVGIAFSLFQWFLVSKVTLSTEKSSGGADDKNGYAAESLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_003609463.1| Vacuolar proton-inorganic pyrophosphatase [Medicago truncatula]
 gb|ACI22377.1| vacuolar-type H-pyrophosphatase [Medicago truncatula]
 gb|AES91660.1| vacuolar H+-translocating inorganic pyrophosphatase [Medicago 
truncatula]
Length=765

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLI  361
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKL+  + SA+++  KNG+ +SLI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLTAGRDSATEAPGKNGYNDSLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_009595111.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nicotiana tomentosiformis]
Length=767

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 3/65 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNG-FAESL  358
            MGA TILPDLGTEILIPVCA++GI FALVQW++VSKV +S +K S+S  D KNG +AE+L
Sbjct  1    MGA-TILPDLGTEILIPVCALIGIGFALVQWVIVSKVIVSTDKLSSSSGDGKNGSYAEAL  59

Query  359  IEEEE  373
            IEEEE
Sbjct  60   IEEEE  64



>gb|KHN15033.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=732

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  358
            MGA  ILPDLGTEILIPVCAI+GIAFAL QW+LVSKVKLS  + AS +    KNG+ + L
Sbjct  1    MGA-VILPDLGTEILIPVCAIIGIAFALFQWVLVSKVKLSAARDASSNAGGGKNGYNDYL  59

Query  359  IEEEE  373
            IEEEE
Sbjct  60   IEEEE  64



>ref|XP_004508424.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Cicer arietinum]
Length=765

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  361
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKL+  +  + D+  KNG+ +SLI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLTAGREVTADASGKNGYNDSLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_006350116.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum tuberosum]
Length=769

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 4/65 (6%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAESL  358
             +TIL DLGTEILIPVCA++GI FALVQW++VSKV +S +  +S S    D KNG+AESL
Sbjct  2    GTTILSDLGTEILIPVCALIGIGFALVQWVIVSKVTVSTDGKSSSSGAGTDGKNGYAESL  61

Query  359  IEEEE  373
            IEEEE
Sbjct  62   IEEEE  66



>ref|XP_009796113.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=765

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ +LPDLG EI+IPVCA++GI F+LVQW LVS VKL+PE S+  ++ KNG+ + LIE
Sbjct  1    MGAA-LLPDLGAEIVIPVCAVIGIVFSLVQWYLVSNVKLTPESSSPSNNGKNGYGDYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=765

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ +LPDLG EI+IPVCA++GI F+LVQW LVS VKL+PE S+  ++ KNG+ + LIE
Sbjct  1    MGAA-LLPDLGAEIVIPVCAVIGIVFSLVQWYLVSNVKLTPESSSPSNNGKNGYGDYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>ref|XP_003542656.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Glycine max]
 gb|KHN47114.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=765

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  361
            MGA  ILPDLGTEILIPVCAI+GI FAL QW+LVSKVKLS  + AS ++  KNG+ + LI
Sbjct  1    MGA-VILPDLGTEILIPVCAIIGIGFALFQWVLVSKVKLSAARDASPNAAGKNGYNDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_007013601.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY31220.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
Length=734

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 6/68 (9%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  349
            MGAS IL DLG EILIPVCA+VGIAF+LVQW+LVSKVKLSP + +     + + AKNG+A
Sbjct  1    MGAS-ILTDLGAEILIPVCAVVGIAFSLVQWVLVSKVKLSPGRDSGSPGNNGAGAKNGYA  59

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  60   DYLIEEEE  67



>gb|AAM97920.1| vacuolar proton-pumping PPase [Oxybasis rubra]
 gb|AAM97921.1| vacuolar proton-pumping PPase [Oxybasis rubra]
Length=764

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            +LPDLGTEILIPVCA++GI F+L+QW +VS+VKLSP+   S+++ KNGF+E+LIEEEE
Sbjct  5    LLPDLGTEILIPVCAVIGIVFSLIQWYVVSQVKLSPDSGRSNNN-KNGFSENLIEEEE  61



>emb|CAA58700.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=766

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGF-AESLI  361
            MGA  IL DLGTEILIPVCA+VGIAF+L QW LVSKV LS +KS+  +D KNG+ AESLI
Sbjct  1    MGAP-ILSDLGTEILIPVCAVVGIAFSLFQWFLVSKVTLSADKSSGAADDKNGYAAESLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_009779977.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=766

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGF-AESLI  361
            MGA  IL DLGTEILIPVCA+VGIAF+L QW LVSKV LS +KS+  +D KNG+ AESLI
Sbjct  1    MGAP-ILSDLGTEILIPVCAVVGIAFSLFQWFLVSKVTLSADKSSGAADDKNGYAAESLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_007155080.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris]
 gb|ESW27074.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris]
Length=766

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  361
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS ++  KNG+ + LI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAGKNGYNDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_007013600.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY31219.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=770

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 6/68 (9%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  349
            MGAS IL DLG EILIPVCA+VGIAF+LVQW+LVSKVKLSP + +     + + AKNG+A
Sbjct  1    MGAS-ILTDLGAEILIPVCAVVGIAFSLVQWVLVSKVKLSPGRDSGSPGNNGAGAKNGYA  59

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  60   DYLIEEEE  67



>emb|CAN65456.1| hypothetical protein VITISV_035221 [Vitis vinifera]
Length=764

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL DLGTEIL+P CAIVGI F++VQWILVS+VKLSPE+ +  + +KNG AE LIEEEE
Sbjct  3    ILSDLGTEILVPACAIVGIVFSVVQWILVSRVKLSPERHSLSNSSKNGTAEYLIEEEE  60



>ref|NP_001268155.1| vacuolar pyrophosphatase [Vitis vinifera]
 emb|CAD89675.2| vacuolar pyrophosphatase [Vitis vinifera]
Length=764

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL DLGTEIL+P CAIVGI F++VQWILVS+VKLSPE+ +  + +KNG AE LIEEEE
Sbjct  3    ILSDLGTEILVPACAIVGIVFSVVQWILVSRVKLSPERHSLSNSSKNGTAEYLIEEEE  60



>emb|CBI25554.3| unnamed protein product [Vitis vinifera]
Length=764

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL DLGTEIL+P CAIVGI F++VQWILVS+VKLSPE+ +  + +KNG AE LIEEEE
Sbjct  3    ILSDLGTEILVPACAIVGIVFSVVQWILVSRVKLSPERHSLSNSSKNGTAEYLIEEEE  60



>ref|XP_006381091.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
 gb|ERP58888.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
Length=768

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 3/63 (5%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD---AKNGFAESLIE  364
            S ILPDLGTEILIPVCAI+GI F+L+QW+LVSKVKL P  +AS++     KNG+ + LIE
Sbjct  3    SVILPDLGTEILIPVCAIIGIGFSLLQWLLVSKVKLVPSPAASNNSGAAGKNGYGDYLIE  62

Query  365  EEE  373
            EEE
Sbjct  63   EEE  65



>gb|ABF85694.1| inorganic pyrophosphatase [Nicotiana rustica]
Length=765

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
             S +LPDLG EI+IPVCA++GI F+LVQW LVS VKL+PE S+  ++ KNG+ + LIEEE
Sbjct  2    GSALLPDLGAEIVIPVCAVIGIVFSLVQWYLVSTVKLTPESSSPSNNGKNGYGDYLIEEE  61

Query  371  E  373
            E
Sbjct  62   E  62



>gb|KDO47421.1| hypothetical protein CISIN_1g0042301mg, partial [Citrus sinensis]
 gb|KDO47422.1| hypothetical protein CISIN_1g0042301mg, partial [Citrus sinensis]
 gb|KDO47423.1| hypothetical protein CISIN_1g0042301mg, partial [Citrus sinensis]
 gb|KDO47424.1| hypothetical protein CISIN_1g0042301mg, partial [Citrus sinensis]
 gb|KDO47425.1| hypothetical protein CISIN_1g0042301mg, partial [Citrus sinensis]
Length=83

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLI  361
            MG ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+  +S+SD KNGF + LI
Sbjct  1    MG-STLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPPSSNSDKKNGFNDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_007204643.1| hypothetical protein PRUPE_ppa001782mg [Prunus persica]
 gb|EMJ05842.1| hypothetical protein PRUPE_ppa001782mg [Prunus persica]
Length=765

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  361
            MGA T+LPDLGTEILIP+CA++GIAF++VQW+ VS+VKLSP + A S++  KNG+ + LI
Sbjct  1    MGA-TLLPDLGTEILIPLCAVIGIAFSVVQWMFVSQVKLSPGRDANSNAPGKNGYNDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_008242846.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Prunus mume]
Length=765

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  361
            MGA T+LPDLGTEILIP+CA++GIAF++VQW+ VS+VKLSP + A S++  KNG+ + LI
Sbjct  1    MGA-TLLPDLGTEILIPLCAVIGIAFSVVQWMFVSQVKLSPGRDANSNAPGKNGYNDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>gb|EYU40132.1| hypothetical protein MIMGU_mgv1a001763mg [Erythranthe guttata]
Length=762

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 4/63 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M  ST+L DLGT+I+IPVCA+VGIAFAL+QW  V+KVK+S EK    SDAKNGF+E LIE
Sbjct  1    MAESTLLTDLGTQIIIPVCALVGIAFALLQWYFVAKVKVSSEK----SDAKNGFSEPLIE  56

Query  365  EEE  373
            EE+
Sbjct  57   EED  59



>ref|XP_009628297.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=765

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ +LPDLG EI+IPVCA++GI F+LVQW +VS VKL+PE S+  ++ KNG+ + LIE
Sbjct  1    MGAA-LLPDLGAEIVIPVCAVIGIVFSLVQWYIVSNVKLTPESSSPSNNGKNGYGDYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>gb|KHF98453.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=767

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 3/65 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP--EKSASDSDAKNGFAESL  358
            MGAS IL D G EILIPVCA++GIAF+LVQW+LVSKVKLSP  E   + S AKNG+++ L
Sbjct  1    MGAS-ILSDFGAEILIPVCAVIGIAFSLVQWVLVSKVKLSPGRESVNNGSGAKNGYSDYL  59

Query  359  IEEEE  373
            IEEEE
Sbjct  60   IEEEE  64



>ref|XP_002535533.1| hypothetical protein RCOM_1930180 [Ricinus communis]
 gb|EEF26850.1| hypothetical protein RCOM_1930180 [Ricinus communis]
Length=104

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 7/70 (10%)
 Frame = +2

Query  182  AMGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA------SDSDAKNG  343
            +MG ST+L DLGTE+L+PVCAIVGI F+LVQW LVS+VKL+ E+ A      S    KNG
Sbjct  5    SMG-STLLSDLGTEVLVPVCAIVGIIFSLVQWYLVSRVKLTSERHAPGLSPSSGGGNKNG  63

Query  344  FAESLIEEEE  373
            + + LIEEEE
Sbjct  64   YNDYLIEEEE  73



>ref|XP_009791988.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nicotiana sylvestris]
Length=767

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 56/65 (86%), Gaps = 3/65 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNG-FAESL  358
            MGA TILPDLGTEILIPVCA++GI FALVQW++VSKV +S +K S++  D K+G +AE+L
Sbjct  1    MGA-TILPDLGTEILIPVCALIGIGFALVQWVIVSKVTVSTDKLSSASGDGKHGSYAEAL  59

Query  359  IEEEE  373
            IEEEE
Sbjct  60   IEEEE  64



>gb|KDP30223.1| hypothetical protein JCGZ_17005 [Jatropha curcas]
Length=770

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-----KNGFAES  355
              TILPDLGTEILIP+CAI+GI F+L+QW+LVSKVKL P   +   DA     KNG+++ 
Sbjct  2    GGTILPDLGTEILIPICAIIGIGFSLIQWLLVSKVKLVPGGGSGGRDAAAGNKKNGYSDY  61

Query  356  LIEEEE  373
            LIEEEE
Sbjct  62   LIEEEE  67



>ref|XP_009363953.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=764

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA TILPDLG EILIP+CA+VGIAF+LVQW+ VS+VKLSP      +  KNG  E LIE
Sbjct  1    MGA-TILPDLGAEILIPLCAVVGIAFSLVQWMYVSQVKLSPGGGRDSNSGKNGHNEYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>gb|ABD98735.1| vacuolar H+-pyrophosphatase [Oxybasis glauca]
Length=763

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
            +LPDLGTEILIPVCA++GI F+LVQW +V++VKLSP+   S+S+ KNG++ESLIEEE
Sbjct  5    LLPDLGTEILIPVCAVIGIVFSLVQWYIVAQVKLSPDSGRSNSN-KNGYSESLIEEE  60



>ref|XP_009392139.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=766

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-DAKNGFAESLI  361
            MGA TILPDL T+ILIP  A+VGIAFALVQW+LVSKVKLSPE+ +S + + KNG+++ LI
Sbjct  1    MGA-TILPDLLTQILIPATAVVGIAFALVQWLLVSKVKLSPERESSGAGNNKNGYSDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_011020230.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Populus euphratica]
Length=768

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 3/63 (5%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD---AKNGFAESLIE  364
            S ILPDLGTEILIP CAI+GI F+L+QW+LVSKVKL P  +AS++     KNG+ + LIE
Sbjct  3    SVILPDLGTEILIPACAIIGIGFSLLQWLLVSKVKLVPSSAASNNSGAAGKNGYGDYLIE  62

Query  365  EEE  373
            EEE
Sbjct  63   EEE  65



>ref|XP_011073387.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Sesamum indicum]
Length=765

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD--SDAKNGFAESLIEEEE  373
            +LPDLGTEI+IP+CA++GI F+LVQW LVSKVKLSPE+  +   ++ KNG++E LIEEE+
Sbjct  3    LLPDLGTEIVIPLCAVIGIVFSLVQWFLVSKVKLSPERGGASAANNGKNGYSEYLIEEED  62



>gb|AHA38114.1| vacuolar H+-pyrophosphatase [Sesuvium portulacastrum]
Length=765

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+T+LPDL TEILIP CA+VGIAF+L+QW LVS+VKLS + S+ +++   G A+SLIE
Sbjct  1    MGAATLLPDLATEILIPACAVVGIAFSLIQWFLVSQVKLSHD-SSRNNNKNGGMADSLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>dbj|BAA33149.1| proton-translocating inorganic pyrophosphatase [Cucurbita moschata]
Length=768

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 3/62 (5%)
 Frame = +2

Query  197  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD---AKNGFAESLIEE  367
            TILPDLGTEI IPVCA++GI F+LVQW  VS+VKLSP + A+ ++   +KNG+++ LIEE
Sbjct  4    TILPDLGTEIFIPVCAVIGIVFSLVQWYYVSQVKLSPGRDAAHNNSAGSKNGYSDYLIEE  63

Query  368  EE  373
            EE
Sbjct  64   EE  65



>ref|XP_006389422.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
 gb|ABK95131.1| unknown [Populus trichocarpa]
 gb|ERP48336.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
Length=768

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD---AKNGFAESLI  361
             S ILPDLGTEILIPVCAI+GI F+L QW+LVSKVKL+P  +AS++     KNG  + LI
Sbjct  2    GSPILPDLGTEILIPVCAIIGIGFSLFQWLLVSKVKLTPGSAASNNSGGAGKNGHGDYLI  61

Query  362  EEEE  373
            EEEE
Sbjct  62   EEEE  65



>ref|XP_006474386.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X2 [Citrus sinensis]
Length=705

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 6/68 (9%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  349
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  60   DYLIEEEE  67



>gb|KDO73437.1| hypothetical protein CISIN_1g004159mg [Citrus sinensis]
Length=705

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 6/68 (9%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  349
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  60   DYLIEEEE  67



>ref|XP_009358552.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Pyrus x bretschneideri]
Length=767

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 52/66 (79%), Gaps = 4/66 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---EKSASDSDAKNGFAES  355
            MGA TILPDLG EILIP+CA++GIAF+LVQW+ VS+VKLSP     S S   AKNG+ + 
Sbjct  1    MGA-TILPDLGAEILIPLCAVIGIAFSLVQWMYVSQVKLSPGGGRDSNSGGAAKNGYNDY  59

Query  356  LIEEEE  373
            LIEEEE
Sbjct  60   LIEEEE  65



>gb|EYU34952.1| hypothetical protein MIMGU_mgv1a001747mg [Erythranthe guttata]
Length=765

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M  +T+L DLGT+I+IP+CA+VGI FALVQW+LV+KVK+S  KS S +D  NGF E+LIE
Sbjct  1    MAEATLLSDLGTQIIIPICALVGIVFALVQWMLVAKVKISTGKSNS-ADGNNGFTEALIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>ref|XP_004287260.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate-energized vacuolar 
membrane proton pump-like [Fragaria vesca subsp. vesca]
Length=765

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLI  361
            MGAS ILPDLG EILIP CA+VGI F+L+QW+ VS+V+LSP + S S+S  KNG+ + LI
Sbjct  1    MGAS-ILPDLGAEILIPFCAVVGIVFSLLQWVYVSRVQLSPARDSNSNSTGKNGYNDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_010097004.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
 gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
Length=764

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
             S ILPDLGTEILIP CA+VGI F+LVQW LVS+VKLSP   A + + KNG+ + LIEEE
Sbjct  2    GSAILPDLGTEILIPACAVVGIVFSLVQWFLVSQVKLSPAGEAQN-NGKNGYTDYLIEEE  60

Query  371  E  373
            E
Sbjct  61   E  61



>ref|XP_006359496.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum tuberosum]
Length=765

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  197  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            TIL DLG EILIP+CA++GIAF+L QW LVSKV +  +K  S  D KNG+AESLIEEEE
Sbjct  4    TILTDLGMEILIPICAVIGIAFSLFQWHLVSKVTVGTDKPHSSGDDKNGYAESLIEEEE  62



>ref|XP_006453118.1| hypothetical protein CICLE_v10007524mg [Citrus clementina]
 ref|XP_006474385.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X1 [Citrus sinensis]
 gb|ESR66358.1| hypothetical protein CICLE_v10007524mg [Citrus clementina]
Length=771

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 6/68 (9%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  349
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  60   DYLIEEEE  67



>gb|KDO73436.1| hypothetical protein CISIN_1g004159mg [Citrus sinensis]
Length=771

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 6/68 (9%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  349
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  60   DYLIEEEE  67



>ref|XP_011017877.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Populus euphratica]
Length=768

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLI  361
             S +LPDLGTEILIPVCAI+GI F+L QW+LVSKVKL+P  +AS++     KNG  + LI
Sbjct  2    GSPVLPDLGTEILIPVCAIIGIGFSLFQWLLVSKVKLTPGSAASNNSRGSGKNGHGDYLI  61

Query  362  EEEE  373
            EEEE
Sbjct  62   EEEE  65



>gb|KHG11819.1| Pyrophosphate-energized vacuolar membrane proton pump 1 -like 
protein [Gossypium arboreum]
Length=666

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA  +L +  TEI++PVCA++GIAF+LVQW+LVS+VKL+PE+ AS +  KNG+++ LIE
Sbjct  2    MGA-VLLSEFATEIVVPVCAVIGIAFSLVQWLLVSRVKLNPERHASGNSNKNGYSDYLIE  60

Query  365  EEE  373
            EEE
Sbjct  61   EEE  63



>ref|XP_011081989.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=764

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESLIEEEE  373
            +LPDLGTEI+IPVCA++GI F+LVQW LVS+VKLSPE+    +  + KNG+++ LIEEE+
Sbjct  3    LLPDLGTEIVIPVCAVIGIVFSLVQWFLVSRVKLSPERGGESAAKNGKNGYSDYLIEEED  62



>ref|XP_010687850.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 55/63 (87%), Gaps = 2/63 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ +LPDL TEI+IPVCA++GIAF+L QW +VS+VKLSP+ S  +++ KNGF++SLIE
Sbjct  1    MGAA-LLPDLITEIIIPVCAVIGIAFSLFQWYIVSQVKLSPD-STRNNNNKNGFSDSLIE  58

Query  365  EEE  373
            EEE
Sbjct  59   EEE  61



>ref|XP_011078537.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=764

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MG +T+LPD GTEILIPVCA++GIAFALVQW+LV+KV+LS  K    +  ++G+ E+LIE
Sbjct  1    MGDATLLPDRGTEILIPVCAVIGIAFALVQWLLVAKVRLSNGKDY--AGGRSGYTEALIE  58

Query  365  EEE  373
            EEE
Sbjct  59   EEE  61



>gb|ADQ00196.1| vacuolar H+-PPase protein [Suaeda corniculata]
Length=764

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+   S+++ KNG AESLIEEEE
Sbjct  5    LLPDLGTEIIVPACAVIGIVFSLIQWYIVSQVKLSPDSGISNNN-KNGIAESLIEEEE  61



>gb|ABO45933.1| vacuolar H+-pyrophosphatase [Halostachys caspica]
Length=764

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+   S+++ KNG AESLIEEEE
Sbjct  5    LLPDLGTEIIVPACAVIGIVFSLIQWYIVSQVKLSPDSGISNNN-KNGIAESLIEEEE  61



>ref|XP_009593516.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=769

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESL  358
             S +LPDLGT+I+IPVCA++GI F+LVQW LVS+VK+S E+ A    S+ + KNG+ + L
Sbjct  2    GSALLPDLGTQIVIPVCAVIGIVFSLVQWYLVSRVKVSSERGATSPSSNKNNKNGYGDCL  61

Query  359  IEEEE  373
            IEEEE
Sbjct  62   IEEEE  66



>ref|XP_006427442.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40682.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=683

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLIEE  367
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+ ++S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPTSSNSDKKNGFNDYLIEE  61

Query  368  EE  373
            EE
Sbjct  62   EE  63



>gb|AAA61610.1| pyrophosphatase [Beta vulgaris]
Length=765

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 55/63 (87%), Gaps = 2/63 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ +LPDL TEI+IPVCA++GIAF+L+QW +V +VKLSP+ S  +++ KNGF++SLIE
Sbjct  1    MGAA-LLPDLITEIIIPVCAVIGIAFSLLQWYIVLRVKLSPD-STRNNNNKNGFSDSLIE  58

Query  365  EEE  373
            EEE
Sbjct  59   EEE  61



>ref|XP_006427443.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40683.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=746

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLIEE  367
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+ ++S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPTSSNSDKKNGFNDYLIEE  61

Query  368  EE  373
            EE
Sbjct  62   EE  63



>ref|XP_010097186.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
 gb|EXB67253.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
Length=765

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
             S +L DL TEI+IPVCA+VGI F+LVQW LVS+VKL+PE++   +  KNG+++ LIEEE
Sbjct  2    GSPLLSDLATEIVIPVCAVVGIVFSLVQWFLVSRVKLTPERNPPSTGNKNGYSDYLIEEE  61

Query  371  E  373
            E
Sbjct  62   E  62



>ref|XP_006427441.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40681.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=766

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLIEE  367
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+ ++S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPTSSNSDKKNGFNDYLIEE  61

Query  368  EE  373
            EE
Sbjct  62   EE  63



>ref|XP_006341399.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Solanum tuberosum]
Length=767

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS--DSDAKNGFAESLIE  364
             S +LPDLGTEI+IPVCA+VGI F+L QW LVS+VK+S E+ A+   ++ KNG+ + LIE
Sbjct  2    GSALLPDLGTEIVIPVCAVVGIVFSLFQWYLVSRVKVSSERGATSPSNNNKNGYGDYLIE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>ref|XP_004173355.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like, 
partial [Cucumis sativus]
Length=543

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 4/66 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  355
            MGA TILPDLG +I IP+CAIVGI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGA-TILPDLGAQIFIPLCAIVGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  356  LIEEEE  373
            LIEEEE
Sbjct  60   LIEEEE  65



>gb|AEI17665.1| vacuolar H+-pyrophosphatase [Salicornia europaea]
Length=764

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+   ++ ++KNG AESLIEEEE
Sbjct  5    LLPDLGTEIIVPACAVIGILFSLIQWYIVSQVKLSPDSGLAN-NSKNGIAESLIEEEE  61



>gb|AGJ81362.1| vacuolar H+ pyrophosphatase 1 [Brassica napus]
Length=768

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  358
            M AS  LP+L TEILIPVCA+VGIAF+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIAFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYGDYL  60

Query  359  IEEEE  373
            IEEEE
Sbjct  61   IEEEE  65



>ref|XP_006492091.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Citrus sinensis]
Length=766

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLIEE  367
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+  +S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPPSSNSDKKNGFNDYLIEE  61

Query  368  EE  373
            EE
Sbjct  62   EE  63



>ref|XP_008676297.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Zea mays]
 ref|XP_008676298.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Zea mays]
 ref|XP_008676299.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Zea mays]
Length=136

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  361
            M A+ ILP+LGT +LIPV A VGI+F++VQW+LVSKV+L+PE+ A    A K+G ++ LI
Sbjct  1    MAAAAILPELGTHVLIPVAAAVGISFSVVQWVLVSKVRLAPERRADGGGAVKSGPSDYLI  60

Query  362  EEEE  373
            EEEE
Sbjct  61   EEEE  64



>ref|XP_008352108.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Malus domestica]
Length=767

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 4/66 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---EKSASDSDAKNGFAES  355
            MGA TILPDLG EILIP+CA++GIAF+L QW+ VS+VKLSP     S S    KNG+ + 
Sbjct  1    MGA-TILPDLGAEILIPLCAVIGIAFSLXQWMYVSQVKLSPGGGRDSNSGGADKNGYNDY  59

Query  356  LIEEEE  373
            LIEEEE
Sbjct  60   LIEEEE  65



>ref|XP_004150506.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Cucumis sativus]
 gb|KGN65098.1| hypothetical protein Csa_1G212840 [Cucumis sativus]
Length=768

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 4/66 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  355
            MGA TILPDLG +I IP+CAIVGI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGA-TILPDLGAQIFIPLCAIVGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  356  LIEEEE  373
            LIEEEE
Sbjct  60   LIEEEE  65



>ref|XP_010541940.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Tarenaya hassleriana]
Length=765

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            ILPDLGTEILIPVCA++GI FA  QW LVS+VKL    +AS    KNG+ + LIEEEE
Sbjct  5    ILPDLGTEILIPVCAVIGIGFAAFQWFLVSQVKLVSGATASSGSRKNGYDDYLIEEEE  62



>ref|XP_002453419.1| hypothetical protein SORBIDRAFT_04g005710 [Sorghum bicolor]
 gb|EES06395.1| hypothetical protein SORBIDRAFT_04g005710 [Sorghum bicolor]
Length=766

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M A+ ILP+L T++LIPV A VGIAFA+VQW+LVSKV+L+PE+ A    AK+G ++ LIE
Sbjct  1    MAAAAILPELATQVLIPVAAAVGIAFAVVQWVLVSKVRLTPERRADGGAAKSGPSDYLIE  60

Query  365  EEE  373
            EEE
Sbjct  61   EEE  63



>gb|ABK91685.1| vacuolar H+-pyrophosphatase [Kalidium foliatum]
Length=764

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+ S   +++KNG AESLIEE+E
Sbjct  5    LLPDLGTEIIVPACAVIGIVFSLIQWYIVSQVKLSPD-SGLGNNSKNGIAESLIEEKE  61



>ref|XP_010913343.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Elaeis guineensis]
Length=765

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
             + IL DL TEILIPV A+VGI FAL+QW+LVSKVKLSPE+    S  KNG+ + LIEEE
Sbjct  2    GTAILSDLLTEILIPVAAVVGIVFALIQWMLVSKVKLSPEQHPPASGNKNGYTDYLIEEE  61

Query  371  E  373
            E
Sbjct  62   E  62



>ref|XP_010928300.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Elaeis guineensis]
Length=765

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ IL DL TEILIPV A+VGI F+LVQW+LVSKVK+SPE+    S  KNG+ + LIE
Sbjct  1    MGAA-ILSDLLTEILIPVAAVVGIVFSLVQWMLVSKVKVSPERQPPASGNKNGYTDYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>ref|XP_008443926.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Cucumis melo]
Length=768

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 4/66 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  355
            MGA TILPDLG +I IP+CAI+GI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGA-TILPDLGAQIFIPLCAIIGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  356  LIEEEE  373
            LIEEEE
Sbjct  60   LIEEEE  65



>ref|XP_008343930.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Malus domestica]
Length=764

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA TILPDL  EILIP+CA++GIAF+L QW+ VS+VKLSP      +  KNG  E LIE
Sbjct  1    MGA-TILPDLWAEILIPLCAVIGIAFSLXQWMYVSQVKLSPGGGRDSNSGKNGHNEYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>gb|ABS01290.1| tonoplast proton pump [Lotus corniculatus]
Length=767

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 4/66 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---EKSASDSDAKNGFAES  355
            MGA  +LPDLGTEILIPVCA++GI FAL QW LVSKVK++    + ++ D+  KNG+ + 
Sbjct  1    MGA-VLLPDLGTEILIPVCAVIGIVFALFQWFLVSKVKITAATRDAASPDAAGKNGYNDY  59

Query  356  LIEEEE  373
            LIEEEE
Sbjct  60   LIEEEE  65



>gb|ADN96173.1| pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
hirsutum]
Length=766

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-AKNGFAESLI  361
            MGA+ +L +L TEI++PVCA++GIAF+LVQW++VS+VKL+ E+ AS ++ +KNG+ + LI
Sbjct  1    MGAA-MLSELATEIVVPVCAVIGIAFSLVQWVMVSRVKLTSERHASSANSSKNGYGDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>gb|EPS68114.1| inorganic pyrophosphatase, partial [Genlisea aurea]
Length=765

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD--SDAKNGFAESLIEEEE  373
            +LPDLG EILIP+CA++GI F+L QW LVSKVKL+P +  S   ++ +NG+ + LIEEEE
Sbjct  5    LLPDLGAEILIPLCAVIGIVFSLAQWFLVSKVKLTPGRGGSSAANNGRNGYRDHLIEEEE  64



>gb|KHG04918.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=770

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 6/68 (9%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-----SASDSDAKNGFA  349
            MGAS IL DLGTEILIPVCA++GIAF+L+QW+LVSKVKLSP +       + +  KN  A
Sbjct  1    MGAS-ILSDLGTEILIPVCAVIGIAFSLLQWVLVSKVKLSPGRDPGSPRNNGAGGKNDCA  59

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  60   DYLIEEEE  67



>ref|XP_009117814.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Brassica rapa]
Length=768

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  358
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYGDYL  60

Query  359  IEEEE  373
            IEEEE
Sbjct  61   IEEEE  65



>emb|CDY53310.1| BnaA09g56670D [Brassica napus]
Length=802

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  358
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYGDYL  60

Query  359  IEEEE  373
            IEEEE
Sbjct  61   IEEEE  65



>ref|XP_010557616.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Tarenaya hassleriana]
Length=768

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 4/66 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAES  355
            MG + ILPDLGTEILIPVCA++GI FA  QW LVS+VKL P  +A+ +++   KNG+ + 
Sbjct  1    MGGA-ILPDLGTEILIPVCAVIGIGFAAFQWFLVSQVKLVPGAAAASTNSGGRKNGYDDY  59

Query  356  LIEEEE  373
            LIEEEE
Sbjct  60   LIEEEE  65



>ref|XP_007023298.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY25920.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
Length=769

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 52/61 (85%), Gaps = 3/61 (5%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIEEE  370
            +L ++ TEI++PVCA++GIAF+LVQW+LVS+VKL+ E+ A   S S++KNG+++ LIEEE
Sbjct  5    VLSEMATEIVVPVCAVIGIAFSLVQWVLVSRVKLTSERHASGGSGSNSKNGYSDYLIEEE  64

Query  371  E  373
            E
Sbjct  65   E  65



>ref|XP_007023297.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25919.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=768

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 52/61 (85%), Gaps = 3/61 (5%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIEEE  370
            +L ++ TEI++PVCA++GIAF+LVQW+LVS+VKL+ E+ A   S S++KNG+++ LIEEE
Sbjct  5    VLSEMATEIVVPVCAVIGIAFSLVQWVLVSRVKLTSERHASGGSGSNSKNGYSDYLIEEE  64

Query  371  E  373
            E
Sbjct  65   E  65



>ref|XP_004235902.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=767

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK--SASDSDAKNGFAESLIE  364
             S +LPDLGTEI+IPVCA+VGI F+L QW +VS+VK+S E+  ++  ++ KNG+ + LIE
Sbjct  2    GSALLPDLGTEIVIPVCAVVGIVFSLYQWYVVSRVKVSSERGDTSPSNNNKNGYGDYLIE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>gb|KHG25943.1| Pyrophosphate-energized vacuolar membrane proton pump 1 -like 
protein [Gossypium arboreum]
Length=766

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-AKNGFAESLI  361
            MGA+ +L ++ TEI++PVCA++GIAF+LVQW++VS+VKL+ E+ AS ++ +KNG+ + LI
Sbjct  1    MGAA-MLSEMATEIVVPVCAVIGIAFSLVQWVMVSRVKLTSERHASSANSSKNGYGDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>gb|AAS66771.1| PPase [Hevea brasiliensis]
Length=769

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 4/65 (6%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD----AKNGFAESL  358
             + +L +LGTEIL+PVCA+VGI F+L+QW LVS+VKL+PE+ A  S      KNG+ + L
Sbjct  2    GTAVLSELGTEILVPVCAVVGIVFSLIQWYLVSRVKLTPERQAPGSSPAGANKNGYNDCL  61

Query  359  IEEEE  373
            IEEEE
Sbjct  62   IEEEE  66



>gb|ADD51840.1| pyrophosphatase [Cucumis sativus]
Length=768

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 4/66 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  355
            MGA+ ILPDLG +I IP+CAIVGI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGAA-ILPDLGAQIFIPLCAIVGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  356  LIEEEE  373
            LIEEEE
Sbjct  60   LIEEEE  65



>ref|XP_010908157.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Elaeis guineensis]
Length=138

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 3/65 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  358
            MGA+ IL DL TEILIPV A+VGI FALVQW LVS+VKLSPEK    + S+ KN +++ L
Sbjct  1    MGAA-ILTDLLTEILIPVAAVVGIGFALVQWGLVSRVKLSPEKQGPPAGSNNKNDYSDYL  59

Query  359  IEEEE  373
            IEEEE
Sbjct  60   IEEEE  64



>ref|XP_009418179.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Musa acuminata subsp. malaccensis]
Length=766

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE-KSASDSDAKNGFAESLIEE  367
            A   L DL TE+LIPV A+VGI FALVQW+LVSKVKLSPE +S+   + KNG+++ LIEE
Sbjct  2    AVAFLSDLLTEVLIPVAAVVGIVFALVQWLLVSKVKLSPEGESSGTGNGKNGYSDYLIEE  61

Query  368  EE  373
            EE
Sbjct  62   EE  63



>emb|CDX81728.1| BnaC08g38730D [Brassica napus]
Length=1174

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  358
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYDDYL  60

Query  359  IEEEE  373
            IEEEE
Sbjct  61   IEEEE  65



>gb|KDP37047.1| hypothetical protein JCGZ_06103 [Jatropha curcas]
Length=765

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
             S +L +LGTEIL+PVCA+VGI F+L+QW LVS+V L+ E+ A     KNG+ + LIEEE
Sbjct  2    GSALLSELGTEILVPVCAVVGIVFSLIQWYLVSRVTLTSERHAPGGANKNGYNDYLIEEE  61

Query  371  E  373
            E
Sbjct  62   E  62



>ref|XP_010459106.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=766

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M AS +LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVASALLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTTDLGASSSAGKNGHEDYLIE  60

Query  365  EEE  373
            EEE
Sbjct  61   EEE  63



>ref|XP_010476656.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Camelina sativa]
Length=766

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M AS +LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVASALLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTSDLGASSSAGKNGHEDYLIE  60

Query  365  EEE  373
            EEE
Sbjct  61   EEE  63



>ref|XP_010497310.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=766

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M AS +LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVASALLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTSDLGASSSAGKNGHEDYLIE  60

Query  365  EEE  373
            EEE
Sbjct  61   EEE  63



>emb|CDY33390.1| BnaC05g11930D [Brassica napus]
Length=771

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-----DAKNGFA  349
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+V++S ++ AS S     + KNG+ 
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVRVSADQGASSSSGGANNGKNGYG  60

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  61   DYLIEEEE  68



>gb|AFW70478.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M A+ ILP+L T++LIPV A VGIAFA+VQW+LVSKV+++PE+ A     K+G ++ LIE
Sbjct  1    MAAAAILPELATQVLIPVAAAVGIAFAVVQWVLVSKVRVTPERRADGGAVKSGPSDYLIE  60

Query  365  EEE  373
            EEE
Sbjct  61   EEE  63



>ref|XP_008795832.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=765

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ IL DL T ILIPV A+VGI FALVQW  VSKVKLSPE+    S  KNG+++ LIE
Sbjct  1    MGAA-ILSDLLTVILIPVAAVVGIVFALVQWTFVSKVKLSPEQQPPASGNKNGYSDYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>ref|XP_009765177.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=769

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESL  358
             S +LPDLGT+I+IPVCA++GI F+  QW LVS+VK+S E  A    S+ + KNG+ + L
Sbjct  2    GSALLPDLGTQIVIPVCAVIGIVFSSFQWYLVSRVKVSSEHGATSPSSNKNNKNGYGDCL  61

Query  359  IEEEE  373
            IEEEE
Sbjct  62   IEEEE  66



>ref|XP_009403196.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=763

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 3/63 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M A+ IL  L TEILIP  A+VGIAFALVQW+LVSKVKLSPE SAS   +K+G ++ LIE
Sbjct  1    MAAAAILSGLLTEILIPAAAVVGIAFALVQWLLVSKVKLSPEDSAS---SKDGVSDYLIE  57

Query  365  EEE  373
            EEE
Sbjct  58   EEE  60



>emb|CAA54869.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=764

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESL  358
             S +LPDLGT+I+IPVCA++GI F+  QW LVS+VK+S E  A    S+ + KNG+ + L
Sbjct  2    GSALLPDLGTQIVIPVCAVIGIVFSSFQWYLVSRVKVSSEHGATSPSSNKNNKNGYGDCL  61

Query  359  IEEEE  373
            IEEEE
Sbjct  62   IEEEE  66



>ref|XP_002273207.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Vitis vinifera]
 emb|CBI36393.3| unnamed protein product [Vitis vinifera]
Length=767

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKN--GFAESLIE  364
             STIL DL TEI++PVCA++GI F+L+QW LVS++K+SP++ +S S+     G+ + LIE
Sbjct  2    GSTILSDLATEIVVPVCAVIGIVFSLIQWFLVSRIKVSPDRHSSSSNNGKGAGYGDYLIE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>ref|XP_006306837.1| hypothetical protein CARUB_v10008378mg [Capsella rubella]
 gb|EOA39735.1| hypothetical protein CARUB_v10008378mg [Capsella rubella]
Length=766

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M A+ +LP+L TEIL+P+CA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVAAALLPELWTEILVPICAVVGILFSLFQWYVVSRVKLTTDLGASSSGGKNGHGDYLIE  60

Query  365  EEE  373
            EEE
Sbjct  61   EEE  63



>ref|XP_010050115.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Eucalyptus grandis]
 gb|KCW82997.1| hypothetical protein EUGRSUZ_C04383 [Eucalyptus grandis]
Length=768

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLS---PEKSASDSDAKNGFAESLI  361
            A+TIL DLG EILIPVCA+VGI F+LVQW+LVSKVKL+      + + ++ KNG+ + LI
Sbjct  2    ATTILSDLGAEILIPVCAVVGIVFSLVQWLLVSKVKLTPADAAAAPAANNGKNGYTDYLI  61

Query  362  EEEE  373
            +EEE
Sbjct  62   DEEE  65



>gb|AGQ50316.1| vaculoar H+ pyrophosphatase [Prosopis juliflora]
Length=764

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
             S +LPDLGTEILIPVCA++GI FAL QWILVS+VKLS   S S  ++KNG+ + LIEEE
Sbjct  2    GSALLPDLGTEILIPVCAVIGIGFALFQWILVSRVKLS-ASSDSSPNSKNGYNDYLIEEE  60

Query  371  E  373
            E
Sbjct  61   E  61



>ref|XP_003531725.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Glycine max]
Length=768

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 4/66 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAES  355
            MGA+ +L +L TEI++PVCA++GI F+LVQW LVS+VKL+P+++ + S   + KNG+ + 
Sbjct  1    MGAA-LLSELATEIVVPVCAVIGIVFSLVQWFLVSRVKLTPDRNGTTSSPRNNKNGYGDF  59

Query  356  LIEEEE  373
            LIEEEE
Sbjct  60   LIEEEE  65



>ref|XP_009407207.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=766

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS-ASDSDAKNGFAESLI  361
            MGA+ +L D  TE+LIPV A+VGIAFALVQW+LVS VKLSPE+     S+ KNG+++ LI
Sbjct  1    MGAA-MLTDQVTEVLIPVAAVVGIAFALVQWLLVSTVKLSPERQPGGGSNDKNGYSDYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_004241690.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=767

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD--SDAKNGFAESLIE  364
             S +L + GTEI+IP+CA++GI F+LVQW LVS VKLSPE+      ++  NGF ESL+E
Sbjct  2    GSALLSEFGTEIVIPICAVIGIVFSLVQWYLVSLVKLSPEQGGCSPRNNKNNGFNESLVE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>ref|XP_010537929.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Tarenaya hassleriana]
Length=769

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  355
            M A  +L ++GTEI++P+CA+VGI F+LVQW LVS+VKL+ ++ AS    ++ KNG+ + 
Sbjct  1    MVAVALLSEMGTEIVVPLCAVVGIVFSLVQWFLVSRVKLTDDRGASSGGANNGKNGYGDY  60

Query  356  LIEEEE  373
            LIEEEE
Sbjct  61   LIEEEE  66



>ref|XP_008679906.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Zea mays]
Length=859

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  361
            M A+ ILP+LGT++LIPV A VGIAF+++QW+LVSKV+L+PE+ A    A K+G ++ LI
Sbjct  93   MAAAAILPELGTQVLIPVAAAVGIAFSVLQWVLVSKVRLAPERRADGGGAVKSGPSDYLI  152

Query  362  EEEE  373
            EEEE
Sbjct  153  EEEE  156



>gb|AFW66266.1| hypothetical protein ZEAMMB73_353171 [Zea mays]
Length=767

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  361
            M A+ ILP+LGT++LIPV A VGIAF+++QW+LVSKV+L+PE+ A    A K+G ++ LI
Sbjct  1    MAAAAILPELGTQVLIPVAAAVGIAFSVLQWVLVSKVRLAPERRADGGGAVKSGPSDYLI  60

Query  362  EEEE  373
            EEEE
Sbjct  61   EEEE  64



>ref|XP_010905999.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Elaeis guineensis]
Length=767

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 3/65 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  358
            MGA+ IL DL TEILIPV A+VGI FAL+QW LVS+VKLSPEK    + S+ KN +++ L
Sbjct  1    MGAA-ILTDLLTEILIPVAAVVGIGFALIQWGLVSRVKLSPEKQGPPAGSNNKNDYSDYL  59

Query  359  IEEEE  373
            IEEEE
Sbjct  60   IEEEE  64



>ref|XP_008788803.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Phoenix dactylifera]
Length=765

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ IL DL TEILIPV A+VGI F+L QW+LVSKVKLSPE+       KN + + LIE
Sbjct  1    MGAA-ILSDLLTEILIPVAAVVGIVFSLFQWMLVSKVKLSPERQTPARGNKNDYTDYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>gb|ACT98610.2| vacuolar proton-inorganic pyrophosphatase [Diplachne fusca]
Length=763

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL +L TE+ IPV  I+GIAFA+VQW+LVSKVKLSP  +AS  +   G+ + LIEEEE
Sbjct  3    ILSELATEVFIPVAGIIGIAFAIVQWVLVSKVKLSPAAAASGGNKNGGYGDYLIEEEE  60



>ref|NP_001077542.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
 gb|AEE29350.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
Length=642

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  352
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>gb|KFK43817.1| hypothetical protein AALP_AA1G177100 [Arabis alpina]
Length=771

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  352
            M  +T+LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVVATLLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTTDLGASSSGGANNGKNGYGD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>gb|ADJ67258.1| vaculor H+-pyrophosphatase [Sorghum bicolor]
Length=763

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL  L TE+ IPV A++GI FA+VQW+LVS+VKLSP  +A+    KNG+ + LIEEEE
Sbjct  3    ILSPLATEVFIPVAAVIGIVFAVVQWVLVSRVKLSPTAAAASGGGKNGYGDYLIEEEE  60



>ref|XP_010691127.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Beta vulgaris subsp. vulgaris]
Length=762

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD-SDAKNGFAESLIEEEE  373
            ++ DL TEI IPVCA++GI F+LVQW LVSKVK+S ++  ++   AKNGF + LIEEEE
Sbjct  1    MISDLATEIFIPVCAVIGIIFSLVQWFLVSKVKVSTDRHVNNGGSAKNGFNDYLIEEEE  59



>ref|XP_008793954.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=767

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 3/65 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  358
            MGA+ IL DL TEI+IPV A+VGI FAL+QW+LVS+VKLSPE+    + S  KNG ++ L
Sbjct  1    MGAA-ILTDLLTEIVIPVAAVVGIGFALMQWLLVSRVKLSPERQGPLAGSKNKNGCSDYL  59

Query  359  IEEEE  373
            IEEEE
Sbjct  60   IEEEE  64



>gb|AAL84953.1| At1g15690/F7H2_3 [Arabidopsis thaliana]
Length=770

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  352
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>ref|XP_003528302.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Glycine max]
Length=768

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 52/66 (79%), Gaps = 4/66 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAES  355
            MGA+ +L +L TEI++P CA++GI F+LVQW LVS+VKL+P+++ + S   + KNG+ + 
Sbjct  1    MGAA-LLSELATEIVVPACAVIGIVFSLVQWFLVSRVKLTPDRNGTTSSPRNNKNGYGDF  59

Query  356  LIEEEE  373
            LIEEEE
Sbjct  60   LIEEEE  65



>ref|XP_002890120.1| vacuolar-type H+-pumping pyrophosphatase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66379.1| vacuolar-type H+-pumping pyrophosphatase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=770

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  352
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTTDLGASSSGGANNGKNGYGD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>gb|AAP55210.1| vacuolar proton-inorganic pyrophosphatase [Triticum aestivum]
Length=762

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL +LGTEILIPVC +VGI FA+ QW +VSKVK++P  +++    KNG+ + LIEEEE
Sbjct  3    ILGELGTEILIPVCGVVGIVFAVAQWFIVSKVKVTPGAASAAGGGKNGYGDYLIEEEE  60



>ref|NP_173021.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
 sp|P31414.1|AVP1_ARATH RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump 1; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase 
1; Short=H(+)-PPase 1; AltName: Full=Vacuolar 
proton pyrophosphatase 1; AltName: Full=Vacuolar proton pyrophosphatase 
3 [Arabidopsis thaliana]
 gb|AAF82139.1|AC034256_3 Identical to Vacuolar proton pyrophosphatase (AVP3) from Arabidopsis 
thaliana gb|AB015138 and gb|M81892. ESTs gb|AA006922, 
gb|AA586042, gb|AA651053, gb|AA712863, gb|AA394384, gb|AA605347, 
gb|AA006474, gb|AA006772, gb|AA650817, gb|AA042538, gb|AA006217, 
gb|AW004149, gb|H36252, gb|H36659, gb|R30444, gb|W43600, 
gb|W43886, gb|W43517, gb|W43127, gb|N96656, gb|T14167, 
gb|T76140, gb|T21188, gb|Z17694, gb|Z17695 come from this 
gene [Arabidopsis thaliana]
 gb|AAA32754.1| vacuolar H+-phosphatase [Arabidopsis thaliana]
 gb|AAO00841.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE29349.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
Length=770

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  352
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>gb|AAL57660.1| At1g15690/F7H2_3 [Arabidopsis thaliana]
Length=770

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  352
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>emb|CDX87313.1| BnaA07g35600D [Brassica napus]
Length=769

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS--DSDAKNGFAESL  358
            M    +LP+L TEIL+PVCA+VGIAF+L QW +VS VKL+ ++ AS    DAKNG  + L
Sbjct  1    MTGKALLPELWTEILVPVCAVVGIAFSLFQWYIVSGVKLTADRGASSESEDAKNGNEDYL  60

Query  359  IEEEE  373
            IEEEE
Sbjct  61   IEEEE  65



>emb|CDY36581.1| BnaA06g10340D [Brassica napus]
Length=771

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 5/68 (7%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-----DAKNGFA  349
            M A   LP+L TEILIPVCA+VGI F+L QW +VS+V++S ++ AS S     + KNG+ 
Sbjct  1    MVALAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVRVSADQGASSSSGGANNGKNGYG  60

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  61   DYLIEEEE  68



>gb|AHZ97880.1| vacuolar H+-pyrophosphatase [Olimarabidopsis pumila]
Length=770

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  352
            M A+ +LP+L TEIL+P+CA+VGI F+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVATALLPELWTEILVPICAVVGILFSLFQWYVVSRVKLTTDLGASSSGGANNGKNGYGD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>gb|EMT29715.1| Pyrophosphate-energized vacuolar membrane proton pump [Aegilops 
tauschii]
Length=761

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL +LGTEILIPVC +VGI FA+ QW +VSKVK++P  +A+   +KNG+ + LIEEEE
Sbjct  3    ILGELGTEILIPVCGVVGIVFAIAQWFIVSKVKVTPGAAAA-GGSKNGYGDYLIEEEE  59



>gb|EYU24628.1| hypothetical protein MIMGU_mgv1a001756mg [Erythranthe guttata]
Length=764

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESLIEEEE  373
            +L DLGTEI+IPVCA++GIAF+L QW LVS+VK+ P+     +  + KNG+ + LI+EEE
Sbjct  3    LLSDLGTEIVIPVCAVIGIAFSLFQWYLVSRVKVKPDHGGEPAAKNGKNGYGDYLIDEEE  62



>gb|ACA63883.1| vacuolar proton-inorganic pyrophosphatase [Hordeum vulgare]
Length=762

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEE
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEE  60



>dbj|BAJ88084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=762

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEE
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEE  60



>sp|Q06572.2|AVP_HORVU RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase; 
Short=H(+)-PPase [Hordeum vulgare]
 dbj|BAA02717.2| inorganic pyrophosphatase [Hordeum vulgare subsp. vulgare]
Length=762

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEE
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEE  60



>ref|NP_001288904.1| uncharacterized protein LOC103836019 [Brassica rapa]
 gb|AET95910.1| AVP1-1 [Brassica rapa]
Length=769

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAES  355
            M AS  LP+L TEILIPVCA+VGIAF+L QW +VS+V++S ++ A   S   +KNG+ + 
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIAFSLFQWFIVSRVRVSADQGASSSSSGGSKNGYGDY  60

Query  356  LIEEEE  373
            LIEEEE
Sbjct  61   LIEEEE  66



>emb|CDX96835.1| BnaA08g23780D [Brassica napus]
Length=769

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAES  355
            M AS  LP+L TEILIPVCA+VGIAF+L QW +VS+V++S ++ A   S   +KNG+ + 
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIAFSLFQWFIVSRVRVSADQGASSSSSGGSKNGYGDY  60

Query  356  LIEEEE  373
            LIEEEE
Sbjct  61   LIEEEE  66



>dbj|BAK04633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=718

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEE
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEE  60



>dbj|BAE98517.1| hypothetical protein [Arabidopsis thaliana]
Length=767

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 4/62 (6%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAESLIEE  367
            +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ + LIEE
Sbjct  3    LLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGDYLIEE  62

Query  368  EE  373
            EE
Sbjct  63   EE  64



>ref|XP_008801902.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=767

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 3/65 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  358
            MGA+ IL DL TEILIPV A+VGI F+L+QW LVS+VKLSPE+    + S+ KN +++ L
Sbjct  1    MGAA-ILTDLLTEILIPVAAVVGIGFSLIQWGLVSRVKLSPERQGLPAGSNDKNDYSDYL  59

Query  359  IEEEE  373
            IEEEE
Sbjct  60   IEEEE  64



>ref|NP_001266772.1| uncharacterized protein LOC101027208 [Zea mays]
 gb|ACN33286.1| unknown [Zea mays]
 gb|ACR36585.1| unknown [Zea mays]
Length=762

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL  L TE+ IPV A++GIAFA+VQW+LVS+VKLSP  +AS   +KNG+ + LIEEEE
Sbjct  3    ILSALATEVFIPVAAVIGIAFAVVQWVLVSRVKLSPAAAAS-GGSKNGYGDYLIEEEE  59



>emb|CDY39975.1| BnaC06g40530D [Brassica napus]
Length=769

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS--DSDAKNGFAESL  358
            M    +LP+L TEIL+PVCA+VGIAF+L QW +VS VKL+ ++ AS    D KNG  + L
Sbjct  1    MTGKALLPELWTEILVPVCAVVGIAFSLFQWYIVSGVKLTADRGASSESEDGKNGNEDYL  60

Query  359  IEEEE  373
            IEEEE
Sbjct  61   IEEEE  65



>ref|XP_010927355.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Elaeis guineensis]
Length=767

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESLIEEEE  373
            IL DL TEILIPV A+VGI FAL+QW++VS+VKLSPE+    + S  KN +++ LIEEEE
Sbjct  5    ILADLLTEILIPVAAVVGIGFALMQWLMVSRVKLSPERQGPLAGSKNKNDYSDYLIEEEE  64



>ref|NP_001288927.1| uncharacterized protein LOC103832483 [Brassica rapa]
 gb|AET95911.1| AVP1-2 [Brassica rapa]
Length=769

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS--DSDAKNGFAESL  358
            M    +LP+L TEIL+PVCA+VGIAF+L QW +VS VKL+ ++ AS    D KNG  + L
Sbjct  1    MTGKALLPELWTEILVPVCAVVGIAFSLFQWYIVSGVKLTADRGASSESEDGKNGNEDYL  60

Query  359  IEEEE  373
            IEEEE
Sbjct  61   IEEEE  65



>ref|XP_010539519.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Tarenaya hassleriana]
Length=769

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 48/61 (79%), Gaps = 3/61 (5%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLIEEE  370
            +LP++GTE+++P+CA++GI F+LVQW LVS+VKL+ +  +S   A   KNG+ + LIEEE
Sbjct  6    LLPEIGTEVVVPLCAVIGIVFSLVQWFLVSRVKLTTDGGSSSGGANKGKNGYDDYLIEEE  65

Query  371  E  373
            E
Sbjct  66   E  66



>ref|XP_009401376.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 4/63 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ IL  L TEILIPV A+VGIAFALVQW+LVSKV LSPEK A   D   G ++ LIE
Sbjct  1    MGAA-ILSGLLTEILIPVAAVVGIAFALVQWLLVSKVSLSPEKPAGSRD---GVSDYLIE  56

Query  365  EEE  373
            EEE
Sbjct  57   EEE  59



>gb|AFW77130.1| hypothetical protein ZEAMMB73_840165 [Zea mays]
Length=819

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL  L TE+ IPV A++GIAFA+VQW+LVS+VKLSP  +AS   +KNG+ + LIEEEE
Sbjct  3    ILSALATEVFIPVAAVIGIAFAVVQWVLVSRVKLSPAAAAS-GGSKNGYGDYLIEEEE  59



>gb|AIS71988.1| vacuolar pyrophosphatase 1 [Haloxylon ammodendron]
Length=767

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE--KSASDSDAKNGFAESLIEEEE  373
            +LPDLGTEILIP+CA+VGI F+L QW +VS+VKLSP+  ++ ++++   G  E+LIEEEE
Sbjct  5    LLPDLGTEILIPLCAVVGILFSLFQWYIVSQVKLSPDSGRTNNNNNKNGGVVENLIEEEE  64



>ref|XP_002438225.1| hypothetical protein SORBIDRAFT_10g009880 [Sorghum bicolor]
 gb|EER89592.1| hypothetical protein SORBIDRAFT_10g009880 [Sorghum bicolor]
 gb|ACV74424.1| vacuolar H+-pyrophosphatase [Sorghum bicolor]
Length=763

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  197  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            TIL  L T++ IPV A++GI FA+VQW+LVS+VKLSP  +A+    KNG+ + LIEEEE
Sbjct  2    TILSPLATKVFIPVAAVIGIVFAVVQWVLVSRVKLSPAAAAASGGGKNGYGDYLIEEEE  60



>gb|AET95912.1| PHP1 [Lagenaria siceraria]
Length=768

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 3/62 (5%)
 Frame = +2

Query  197  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK---SASDSDAKNGFAESLIEE  367
            TILPDLG EI IPVCAIVGI F+LVQW  VS+VKLSP +   + + + AKNG+++ LIEE
Sbjct  4    TILPDLGAEIFIPVCAIVGILFSLVQWYYVSQVKLSPGRDSANNNSAAAKNGYSDYLIEE  63

Query  368  EE  373
            EE
Sbjct  64   EE  65



>ref|XP_010417704.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=769

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESL  358
            M A  +LP+L TEIL+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D  NG  + L
Sbjct  1    MSAKALLPELWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRSDPSSTEDGTNGHGDYL  60

Query  359  IEEEE  373
            IEEEE
Sbjct  61   IEEEE  65



>gb|AEI17666.1| vacuolar H+-pyrophosphatase [Salicornia europaea]
Length=763

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD-SDAKNGFAESLIEEEE  373
            ++ DL TEILIP CA+VGI F+LVQW +V+KVK+S EK  ++   AKNG+ + LIEEE+
Sbjct  1    MISDLATEILIPACAVVGILFSLVQWFIVAKVKVSSEKHVNNGGSAKNGYNDYLIEEED  59



>ref|XP_006852851.1| hypothetical protein AMTR_s00033p00195690 [Amborella trichopoda]
 gb|ERN14318.1| hypothetical protein AMTR_s00033p00195690 [Amborella trichopoda]
Length=765

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ IL +   EILIPV A++GI F+LVQW++V++VKLSP+  A  S +KNG+ + LIE
Sbjct  1    MGAA-ILSETLAEILIPVAAVIGIVFSLVQWLIVARVKLSPQAPAPSSKSKNGYTDYLIE  59

Query  365  EEE  373
            EEE
Sbjct  60   EEE  62



>ref|NP_001105380.1| vacuolar proton pump homolog1 [Zea mays]
 emb|CAG29369.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M A+ ILP+L T++LIPV A VGIAFA+VQ +LVSKV+++PE+ A     K+G ++ LIE
Sbjct  1    MAAAAILPELATQVLIPVAAAVGIAFAVVQLVLVSKVRVTPERRADGGAVKSGPSDYLIE  60

Query  365  EEE  373
            EEE
Sbjct  61   EEE  63



>ref|XP_010429951.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X1 [Camelina sativa]
 ref|XP_010429952.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X2 [Camelina sativa]
Length=769

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESLIEEEE  373
            +LP+L TEIL+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D KNG  + LIEEEE
Sbjct  6    LLPELWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRSDPSSTEDGKNGHGDYLIEEEE  65



>ref|XP_004951661.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X2 [Setaria italica]
Length=795

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-AKNGFAESLIEEE  370
            + ILP+L T+++IPV A VGIAFA++QW+LVSKV+L+PE+  +D   AK G ++ LIEEE
Sbjct  2    AAILPELATQVVIPVAAAVGIAFAVLQWVLVSKVRLTPERGRADGGAAKTGPSDYLIEEE  61

Query  371  E  373
            E
Sbjct  62   E  62



>ref|XP_004951662.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X3 [Setaria italica]
Length=765

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-AKNGFAESLIEEE  370
            + ILP+L T+++IPV A VGIAFA++QW+LVSKV+L+PE+  +D   AK G ++ LIEEE
Sbjct  2    AAILPELATQVVIPVAAAVGIAFAVLQWVLVSKVRLTPERGRADGGAAKTGPSDYLIEEE  61

Query  371  E  373
            E
Sbjct  62   E  62



>gb|ABR18024.1| unknown [Picea sitchensis]
Length=765

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-DAKNGFAESLI  361
            MG + +L +  TE+LIPV A+VGIAFAL+QW LVS+VK++P+ S + S + KNG+ E LI
Sbjct  1    MGGA-LLSETLTEVLIPVAAVVGIAFALIQWFLVSRVKVAPDHSHTPSNNNKNGYTEYLI  59

Query  362  EEEE  373
            EEEE
Sbjct  60   EEEE  63



>ref|XP_006300952.1| hypothetical protein CARUB_v10021340mg [Capsella rubella]
 gb|EOA33850.1| hypothetical protein CARUB_v10021340mg [Capsella rubella]
Length=780

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +2

Query  182  AMGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAES  355
            AM A  +LP++ TE L+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D KNG  + 
Sbjct  11   AMLAKALLPEVWTETLVPVCAVVGIVFSLFQWYVVSCVKLTADRSDLSSTEDGKNGHGDY  70

Query  356  LIEEEE  373
            LIEEEE
Sbjct  71   LIEEEE  76



>gb|KHN38003.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=764

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MGA+ +L +L TEI++PVCA++GI F+LVQW LVS+VKL+P+++ + S  +N     LIE
Sbjct  1    MGAA-LLSELATEIVVPVCAVIGIVFSLVQWFLVSRVKLTPDRNGTTSSPRNN-KNGLIE  58

Query  365  EEE  373
            EEE
Sbjct  59   EEE  61



>ref|XP_009148959.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Brassica rapa]
Length=771

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 5/68 (7%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-----DAKNGFA  349
            M A   LP+L TEILIPVCA+VGI F+L QW +VS+ ++S ++ AS       + KNG+ 
Sbjct  1    MVALAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRFRVSADQGASSHCGGAINGKNGYG  60

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  61   DYLIEEEE  68



>dbj|BAB18681.1| vacuolar proton-inorganic pyrophosphatase [Hordeum vulgare subsp. 
vulgare]
Length=771

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 5/68 (7%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE-----KSASDSDAKNGFA  349
            M A+ ILP+L T++++PV A VGIAFA++QW+LVSKVK++PE      SAS   AK+G  
Sbjct  1    MVAAAILPELATQLVVPVAAAVGIAFAVLQWVLVSKVKVAPEPRAEGGSASAVGAKDGAT  60

Query  350  ESLIEEEE  373
            E LIEEEE
Sbjct  61   EYLIEEEE  68



>ref|XP_002530755.1| Pyrophosphate-energized vacuolar membrane proton pump, putative 
[Ricinus communis]
 gb|EEF31615.1| Pyrophosphate-energized vacuolar membrane proton pump, putative 
[Ricinus communis]
Length=767

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE--KSASDSDAKNGFAESLIEEEE  373
            ILPDLGTEILIP+CAI+GI F+L+QW+LVSKVKL P      ++++ KNG+++ LIEEEE
Sbjct  5    ILPDLGTEILIPICAIIGIGFSLIQWLLVSKVKLVPSGGAGNNNNNNKNGYSDYLIEEEE  64



>ref|XP_010472923.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=769

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESL  358
            M A  +LP+L TEIL+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D  NG  + L
Sbjct  1    MLAKALLPELWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRSDPSSTEDGTNGHGDYL  60

Query  359  IEEEE  373
            IEEEE
Sbjct  61   IEEEE  65



>dbj|BAJ91598.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 5/68 (7%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE-----KSASDSDAKNGFA  349
            M A+ ILP+L T++++PV A VGIAFA++QW+LVSKVK++PE      SAS +  K+G  
Sbjct  1    MVAAAILPELATQLVVPVAAAVGIAFAVLQWVLVSKVKVAPEPRAEGGSASAAGGKDGAT  60

Query  350  ESLIEEEE  373
            E LIEEEE
Sbjct  61   EYLIEEEE  68



>ref|XP_003564217.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Brachypodium distachyon]
Length=762

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL  LGTE+ IPV A++GI FA+VQW+LV++VK++P  +A  + AKNG+ + LIEEEE
Sbjct  3    ILSALGTEVFIPVAAVIGIVFAVVQWVLVARVKVTP-GAAGATGAKNGYGDYLIEEEE  59



>dbj|BAA32210.1| Vacuolar proton pyrophosphatase [Arabidopsis thaliana]
Length=770

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  352
            M A  +L +L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLLELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>ref|XP_006646987.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=764

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            + ILP+L  ++LIPV A VGIAFA++QW+LVSKV+L+PE+       K+G ++ LIEEEE
Sbjct  2    AAILPELAAQVLIPVAAAVGIAFAVLQWVLVSKVRLTPERRGEGGAGKSGPSDYLIEEEE  61



>ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Fragaria vesca subsp. vesca]
Length=767

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIE  364
            + +L  L TEI+IPVCA+VGI F+L+QW LVS+V+++P+++A     +  KNGF + LIE
Sbjct  2    AVLLSYLATEIVIPVCAVVGILFSLLQWYLVSRVRVTPDRNAPAPGTNAKKNGFNDYLIE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>ref|XP_009385121.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=771

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK--SASDSDAKNGFAESLIEEEE  373
            ++ DL TE+LIPV ++VGI F+L+QW  VSKVKLSPE+    +    KNG+++ LIEEEE
Sbjct  5    MMSDLLTEVLIPVASVVGIFFSLLQWYFVSKVKLSPERQTRGAHDHGKNGYSDRLIEEEE  64



>emb|CAG29370.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M A+ I   L T++LIPV A VGIAFA+VQW+LVSKV+++PE+ A     K+G ++ LIE
Sbjct  1    MAAAAIPSKLATQVLIPVAAAVGIAFAVVQWVLVSKVRVTPERRADGGAVKSGPSDYLIE  60

Query  365  EEE  373
            EEE
Sbjct  61   EEE  63



>ref|XP_006389797.1| hypothetical protein EUTSA_v10018163mg [Eutrema salsugineum]
 gb|ESQ27083.1| hypothetical protein EUTSA_v10018163mg [Eutrema salsugineum]
Length=768

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  361
            M A  +LP+  TEIL+PVCA+VGI F+L QW +VS VKL+ ++    + D KNG  + LI
Sbjct  1    MMAKALLPEFWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRGGEHEGDGKNGHDDYLI  60

Query  362  EEEE  373
            EEEE
Sbjct  61   EEEE  64



>ref|XP_004965753.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=769

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKN---GFAES  355
            M +   LP+L T++++PV A+VGIAFA++QW+LVSKVKLSPE    D  +     G +E 
Sbjct  1    MASPAFLPELATQVIVPVAAVVGIAFAVLQWVLVSKVKLSPEPRRGDGSSGKSGAGASEY  60

Query  356  LIEEEE  373
            LIEEEE
Sbjct  61   LIEEEE  66



>gb|EYU21676.1| hypothetical protein MIMGU_mgv1a001720mg [Erythranthe guttata]
Length=769

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 48/64 (75%), Gaps = 6/64 (9%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS------ASDSDAKNGFAESLI  361
            +L + GTEI+IPVCA++GI F+LVQW +VSKVK+SPE+S      A+++    G+ + LI
Sbjct  3    LLSEQGTEIVIPVCAVIGIIFSLVQWYIVSKVKVSPERSGAAASPAANNGKNGGYNDYLI  62

Query  362  EEEE  373
            EEE+
Sbjct  63   EEED  66



>ref|XP_009410369.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=767

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGF-AESL  358
            MGA+ +L  + TEILIPV A++GIAFAL+QW+LVS VKLSPE+ + +  + KNGF A+ L
Sbjct  1    MGAA-MLTGVITEILIPVAAVIGIAFALLQWMLVSAVKLSPERQTPAGGNKKNGFAADFL  59

Query  359  IEEEE  373
            IEEEE
Sbjct  60   IEEEE  64



>ref|XP_006656294.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=772

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-----EKSASDSDAKNGFAES  355
            ++ ILPDL T++L+P  A+VGIAFA+ QW+LVSKVK+ P     E SAS      G +E 
Sbjct  4    SAAILPDLATQVLVPAAAVVGIAFAVAQWVLVSKVKMMPVERRGEGSASGPGKNGGASEY  63

Query  356  LIEEEE  373
            LIEEEE
Sbjct  64   LIEEEE  69



>ref|XP_007217159.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica]
 gb|EMJ18358.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica]
Length=767

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 3/63 (5%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIE  364
            + +L  L TEI+IPV A++GI F+LVQW +VS+VK++PE+ A     +  KNGF + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVIGIVFSLVQWFIVSRVKVTPERHAPPPGPNSNKNGFNDYLIE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>ref|XP_009334631.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=767

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 3/61 (5%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIEEE  370
            +L  L TEI+IPV A+VGI F+LVQW LVS+VK++PE+ A  S     KNG+ + LIEEE
Sbjct  4    LLSTLATEIVIPVAAVVGIVFSLVQWYLVSRVKVTPERQAPPSGPNSNKNGYNDILIEEE  63

Query  371  E  373
            E
Sbjct  64   E  64



>gb|KFK42469.1| hypothetical protein AALP_AA2G261100 [Arabis alpina]
Length=769

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  358
            M    +LP+L TEILIPVCA++GI F+L QW +VS VKL+ +   S S  D KNG  + L
Sbjct  1    MMTKAMLPELLTEILIPVCAVIGIIFSLFQWYIVSCVKLNSDGDVSSSLDDDKNGHEDYL  60

Query  359  IEEEE  373
            IEEEE
Sbjct  61   IEEEE  65



>ref|XP_008372806.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Malus domestica]
Length=1179

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 3/63 (5%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIE  364
            + +L  L TEI+IPV A+VGI F+LVQW LVS VK++PE++A  S     KNG+ + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVVGIVFSLVQWFLVSLVKVTPERNAPPSGPNSNKNGYNDYLIE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>emb|CBI35335.3| unnamed protein product [Vitis vinifera]
Length=792

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  179  TAMGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESL  358
            T   +  I+ D GTEIL+P CAI+GI F +VQWILVS+VKLSP++ ++  +A+ G  ++ 
Sbjct  634  TVRPSMAIMSDSGTEILVPACAIIGIIFFVVQWILVSRVKLSPKRHSTTLEARKGVRKAF  693

Query  359  I  361
            I
Sbjct  694  I  694



>dbj|BAD37432.1| inorganic diphosphatase, H+-translocating, vacuolar membrane 
-like [Oryza sativa Japonica Group]
Length=123

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 7/75 (9%)
 Frame = +2

Query  170  AEATAMGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD------  331
            A  + +  + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +        
Sbjct  5    ARISQVAMAAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAG  64

Query  332  -AKNGFAESLIEEEE  373
                  +E LIEEEE
Sbjct  65   KDGGAASEYLIEEEE  79



>ref|XP_006648065.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=762

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL D+ TE+LIP+ A+VGIAF++ QW+LV++VKL+P    + S  K+ + +SLIEEEE
Sbjct  3    ILSDVATEVLIPIAAVVGIAFSIAQWVLVARVKLAPTPPGA-SRGKDSYGDSLIEEEE  59



>ref|XP_008228676.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Prunus mume]
Length=767

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS---ASDSDAKNGFAESLIE  364
            + +L  L TEI+IPV A++GI F+LVQW +VS+VK++P +    A  +  KNGF + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVIGIVFSLVQWFIVSRVKVTPGRHAPPAGPNSNKNGFNDYLIE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>ref|XP_004954254.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=762

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL D  TE+L+P+ A+VGIAFA+ QW+LVS+VKLSP       D K+   +SLIEEEE
Sbjct  3    ILSDAATEVLVPLAAVVGIAFAVAQWVLVSRVKLSPSARGGARD-KDVLGDSLIEEEE  59



>ref|XP_009336318.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
 dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus communis]
Length=767

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIE  364
            + +L  L TEI+IPV A+VGI F+LVQW LVS VK++PE++A  S     KNG  + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVVGIVFSLVQWFLVSLVKVTPERNAPPSGPNSNKNGCNDYLIE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>ref|XP_009338516.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=767

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIE  364
            + +L  L TEI+IPV A+VGI F+LVQW LVS VK++PE++A  S     KNG  + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVVGIVFSLVQWFLVSLVKVTPERNAPPSGPNSNKNGCNDYLIE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>gb|AAL11506.1|AF367446_1 vacuolar H+-pyrophosphatase [Prunus persica]
Length=767

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS---ASDSDAKNGFAESLIE  364
            + +L  L TEI+IPV A++GI F+LVQW +VS+VK++ E+    A  +  KNGF + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVIGIVFSLVQWFIVSRVKVTLERHAPPAGPNSNKNGFNDYLIE  61

Query  365  EEE  373
            EEE
Sbjct  62   EEE  64



>emb|CAD90116.1| vacuolar pyrophosphatase [Vitis vinifera]
Length=37

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLS  304
            IL DLGTEIL+P CAIVGI F++VQWILVS+VKLS
Sbjct  3    ILSDLGTEILVPACAIVGIVFSVVQWILVSRVKLS  37



>ref|XP_006841407.1| hypothetical protein AMTR_s00003p00014700 [Amborella trichopoda]
 gb|ERN03082.1| hypothetical protein AMTR_s00003p00014700 [Amborella trichopoda]
Length=764

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            M +S +L +   ++LIPV AI+GI FAL+QW LVS+V++SPE     S A NG+ + LIE
Sbjct  1    MASSALLGETLAQVLIPVAAIIGIVFALLQWYLVSQVRVSPEHR---SGANNGYDDRLIE  57

Query  365  EEE  373
            +EE
Sbjct  58   DEE  60



>gb|EMS65629.1| Pyrophosphate-energized vacuolar membrane proton pump [Triticum 
urartu]
Length=762

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL +LGTEILIPVC +VGI FA+ QW +VSKVK++P  +++    KNG+ + LIEEEE
Sbjct  3    ILGELGTEILIPVCGVVGIVFAVAQWFIVSKVKVTPGAASAGGGGKNGYGDYLIEEEE  60



>ref|NP_001058184.1| Os06g0644200 [Oryza sativa Japonica Group]
 dbj|BAD37431.1| inorganic diphosphatase, H+-translocating, vacuolar membrane 
[Oryza sativa Japonica Group]
 dbj|BAF20098.1| Os06g0644200 [Oryza sativa Japonica Group]
 dbj|BAG94303.1| unnamed protein product [Oryza sativa Japonica Group]
Length=782

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 7/75 (9%)
 Frame = +2

Query  170  AEATAMGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD------  331
            A  + +  + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +        
Sbjct  5    ARISQVAMAAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAG  64

Query  332  -AKNGFAESLIEEEE  373
                  +E LIEEEE
Sbjct  65   KDGGAASEYLIEEEE  79



>ref|XP_002454723.1| hypothetical protein SORBIDRAFT_04g036230 [Sorghum bicolor]
 gb|EES07699.1| hypothetical protein SORBIDRAFT_04g036230 [Sorghum bicolor]
Length=759

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL ++ TE+LIP+ A VGIAFA+ QW+LVS+VKL+P  S  D D     AESLIEEEE
Sbjct  3    ILSEVATEVLIPLAAAVGIAFAVAQWVLVSRVKLAPS-SGRDKDV---LAESLIEEEE  56



>gb|EEE66103.1| hypothetical protein OsJ_22136 [Oryza sativa Japonica Group]
Length=771

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 7/67 (10%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  352
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  62   YLIEEEE  68



>dbj|BAA08232.1| vacuolar H+-pyrophosphatase [Oryza sativa (japonica cultivar-group)]
Length=771

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 7/67 (10%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  352
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  62   YLIEEEE  68



>dbj|BAA31523.1| ovp1 [Oryza sativa]
Length=771

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 7/67 (10%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  352
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  62   YLIEEEE  68



>gb|EAZ01854.1| hypothetical protein OsI_23875 [Oryza sativa Indica Group]
Length=784

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 7/67 (10%)
 Frame = +2

Query  194  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  352
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  62   YLIEEEE  68



>gb|AAA61609.1| pyrophosphatase [Beta vulgaris]
Length=761

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD-SDAKNGFAESLIEEEE  373
            ++ DL TEI IPVCA++G   +  QW LVSKVK+S ++  ++   AKNGF + LIEEEE
Sbjct  1    MISDLATEIFIPVCAVIGY-ISCYQWFLVSKVKVSTDRHVNNGGSAKNGFNDYLIEEEE  58



>gb|EAY84762.1| hypothetical protein OsI_06130 [Oryza sativa Indica Group]
Length=285

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE----KSASDSDAKNGFAE  352
            M A+ ILP+L  +++IPV A VGIAFA++QW LVSKVKL+ E    ++   +  K+G ++
Sbjct  1    MAAAAILPELAAQVVIPVAAAVGIAFAVLQWALVSKVKLTAEPRRGEAGGAAGGKSGPSD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>gb|AAR08913.2| pyrophosphate-energized vacuolar membrane proton pump [Eutrema 
salsugineum]
Length=771

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-----SASDSDAKNGFA  349
            M AS  LP+L TEIL+PVCA++GIAF+L QW +VS+V+++ ++     S   ++ KNG+ 
Sbjct  1    MVASAFLPELWTEILVPVCAVIGIAFSLFQWFIVSRVRVTADQGASSSSGGSNNGKNGYG  60

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  61   DYLIEEEE  68



>ref|XP_006416887.1| hypothetical protein EUTSA_v10006869mg [Eutrema salsugineum]
 gb|ESQ35240.1| hypothetical protein EUTSA_v10006869mg [Eutrema salsugineum]
Length=771

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-----SASDSDAKNGFA  349
            M AS  LP+L TEIL+PVCA++GIAF+L QW +VS+V+++ ++     S   ++ KNG+ 
Sbjct  1    MVASAFLPELWTEILVPVCAVIGIAFSLFQWFIVSRVRVTADQGASSSSGGSNNGKNGYG  60

Query  350  ESLIEEEE  373
            + LIEEEE
Sbjct  61   DYLIEEEE  68



>ref|XP_010259323.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nelumbo nucifera]
Length=761

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 3/52 (6%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T+ILIPV AIVGI FAL+QW+LVS+V++S +    DS   NG ++ LIEEEE
Sbjct  9    TQILIPVAAIVGIGFALLQWLLVSRVRVSADP---DSGLDNGCSDRLIEEEE  57



>dbj|BAD25066.1| putative inorganic diphosphatase [Oryza sativa Japonica Group]
 gb|EEE56454.1| hypothetical protein OsJ_05651 [Oryza sativa Japonica Group]
Length=770

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE----KSASDSDAKNGFAE  352
            M A+ ILP+L  +++IPV A VGIAFA++QW LVSKVKL+ E    ++   +  K+G ++
Sbjct  1    MAAAAILPELAAQVVIPVAAAVGIAFAVLQWALVSKVKLTAEPRRGEAGGAAGGKSGPSD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>dbj|BAD02277.1| vacuolar proton pyrophosphatase [Oryza sativa Japonica Group]
Length=770

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE----KSASDSDAKNGFAE  352
            M A+ ILP+L  +++IPV A VGIAFA++QW LVSKVKL+ E    ++   +  K+G ++
Sbjct  1    MAAAAILPELAAQVVIPVAAAVGIAFAVLQWALVSKVKLTAEPRRGEAGGAAGGKSGPSD  60

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  61   YLIEEEE  67



>ref|XP_011023767.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Populus euphratica]
Length=757

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 7/52 (13%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T++LIP  A+VGIAFAL+QW LVSKVK+S        D+ NG++  LIEEEE
Sbjct  9    TQVLIPAAALVGIAFALLQWYLVSKVKVS-------GDSSNGYSSKLIEEEE  53



>emb|CBI39586.3| unnamed protein product [Vitis vinifera]
Length=759

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 5/54 (9%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLI  361
            ++ D  T++LIPV A+VGI FAL+QW+LVSKVK+S     +DSD  NG+++ LI
Sbjct  3    VMGDTFTQLLIPVAALVGIGFALLQWLLVSKVKVS-----ADSDLNNGYSDRLI  51



>ref|NP_001268072.1| H+-pyrophosphatase [Vitis vinifera]
 gb|AAF69010.1|AF257777_1 H+-pyrophosphatase [Vitis vinifera]
Length=759

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 5/54 (9%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLI  361
            ++ D  T++LIPV A+VGI FAL+QW+LVSKVK+S     +DSD  NG+++ LI
Sbjct  3    VMGDAFTQLLIPVAALVGIGFALLQWLLVSKVKVS-----ADSDLNNGYSDRLI  51



>gb|AAP06752.1| vacuolar proton-inorganic pyrophosphatase [Hordeum brevisubulatum]
Length=773

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 6/67 (9%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS------ASDSDAKNGFAE  352
            A+ ILP+L T++++PV A VGIAFA++QW LVSKVK++PE+       A     K+G +E
Sbjct  4    AAAILPELATQLVVPVAAAVGIAFAVLQWFLVSKVKVAPERRGEGSGSAGAGGGKDGASE  63

Query  353  SLIEEEE  373
             LIEEEE
Sbjct  64   YLIEEEE  70



>ref|XP_002318956.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
 gb|EEE94879.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
Length=757

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 7/52 (13%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T++LIP  A+VGIAFAL+QW LVSKVK+S        D+ NG++  LIEEEE
Sbjct  9    TQVLIPAAALVGIAFALLQWYLVSKVKVS-------GDSSNGYSGKLIEEEE  53



>gb|KHN16066.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Glycine 
soja]
Length=734

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 41/52 (79%), Gaps = 3/52 (6%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T+ILIPV A++GI FAL+QW+L+S+V++S   SA  ++A NG+ +SLI + E
Sbjct  9    TQILIPVTALIGIGFALLQWLLLSRVRVS---SADHTNADNGYRKSLIGDSE  57



>gb|ABX10014.1| vacuolar H+-pyrophosphatase [Triticum aestivum]
Length=775

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 51/72 (71%), Gaps = 9/72 (13%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE---------KSASDSDAK  337
            M A+ ILP+L T++++PV A VGIAFA++QW+LVSKVK++PE            + + AK
Sbjct  1    MVAAAILPELATQLVVPVAAAVGIAFAVLQWVLVSKVKVAPEPRGEGGSAAGGGAGAGAK  60

Query  338  NGFAESLIEEEE  373
            +G +E LIEEEE
Sbjct  61   DGASEYLIEEEE  72



>ref|XP_010042849.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Eucalyptus grandis]
Length=320

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 5/58 (9%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            +L +  T+ILIP  A++GI FAL+QW+LVSKVK+S      D   K+G+ + LIE+EE
Sbjct  3    VLSEALTQILIPTSALIGIGFALLQWLLVSKVKVSV-----DYGKKDGYKDKLIEDEE  55



>ref|XP_010039554.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Eucalyptus grandis]
 gb|KCW45903.1| hypothetical protein EUGRSUZ_L00271 [Eucalyptus grandis]
 gb|KCW45904.1| hypothetical protein EUGRSUZ_L00271 [Eucalyptus grandis]
Length=759

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 5/58 (9%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            +L +  T+ILIP  A++GI FAL+QW+LVSKVK+S     +D   K+G+ + LIE+EE
Sbjct  3    VLSEALTQILIPASALIGIGFALLQWLLVSKVKVS-----ADYGKKDGYKDKLIEDEE  55



>gb|KCW45902.1| hypothetical protein EUGRSUZ_L00271 [Eucalyptus grandis]
Length=776

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 5/58 (9%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            +L +  T+ILIP  A++GI FAL+QW+LVSKVK+S     +D   K+G+ + LIE+EE
Sbjct  3    VLSEALTQILIPASALIGIGFALLQWLLVSKVKVS-----ADYGKKDGYKDKLIEDEE  55



>ref|XP_003555808.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X1 [Glycine max]
Length=763

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 40/52 (77%), Gaps = 3/52 (6%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T+ILIPV A +GI FAL+QW+LVS+V++S   SA  ++A NG+ +SL+ + E
Sbjct  9    TQILIPVTAFIGIGFALLQWLLVSRVRVS---SADHTEADNGYRKSLMGDSE  57



>ref|XP_006605822.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X2 [Glycine max]
Length=762

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 40/52 (77%), Gaps = 3/52 (6%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T+ILIPV A +GI FAL+QW+LVS+V++S   SA  ++A NG+ +SL+ + E
Sbjct  9    TQILIPVTAFIGIGFALLQWLLVSRVRVS---SADHTEADNGYRKSLMGDSE  57



>ref|XP_006382405.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
 gb|ERP60202.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
Length=757

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 7/52 (13%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T++LIPV A++GI FAL+QW LVSKVK+S        D+ NG ++ LIE+EE
Sbjct  9    TQVLIPVAALIGIIFALLQWYLVSKVKVS-------GDSSNGLSDKLIEDEE  53



>emb|CDX83972.1| BnaC08g16730D [Brassica napus]
Length=769

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKL---SPEKSASDSDAKNGFAES  355
            M AS  LP+L TEIL+PVCA+VGIAF+L QW +VS+V++       S+S   +KNG+ + 
Sbjct  1    MVASAFLPELWTEILVPVCAVVGIAFSLFQWFIVSRVRVSSDQGASSSSSGGSKNGYGDY  60

Query  356  LIEEEE  373
            LIEEEE
Sbjct  61   LIEEEE  66



>gb|KHG22725.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=760

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 6/52 (12%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T+ILIP+ ++VGI FA++QW LVS+VKLS +      D+ NG+ + LIE +E
Sbjct  9    TQILIPLASLVGIGFAVLQWFLVSRVKLSSQ------DSSNGYKQKLIESDE  54



>gb|ACN40474.1| unknown [Picea sitchensis]
Length=764

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MG + +L +  +EILIPV A++GI F+L+QW+LVS+VK+ PEK++S ++    + E L++
Sbjct  1    MGGA-LLSETLSEILIPVAAVIGIGFSLLQWLLVSRVKVGPEKASSRNNGV--YNEFLLD  57

Query  365  EEE  373
            E +
Sbjct  58   EAD  60



>gb|ABR16052.1| unknown [Picea sitchensis]
Length=764

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  364
            MG + +L +  +EILIPV A++GI F+L+QW+LVS+VK+ PEK++S ++    + E L++
Sbjct  1    MGGA-LLSETLSEILIPVAAVIGIGFSLLQWLLVSRVKVGPEKASSRNNGV--YNEFLLD  57

Query  365  EEE  373
            E +
Sbjct  58   EAD  60



>ref|XP_006656699.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=801

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE-KSASDSDAKNGFAESLIEEEE  373
            IL +LGTE+ +PV A VGIAFA+VQW+LV++VKLS +   AS      G+ + LIEEEE
Sbjct  3    ILSELGTEVFVPVAAAVGIAFAVVQWVLVARVKLSEDAAGASGGGKNGGYGDYLIEEEE  61



>dbj|BAF63470.1| vacuolar proton-pyrophosphatase [Potamogeton distinctus]
Length=767

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 4/55 (7%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKL---SPEKSASDSDAKNGFAESLIEEEE  373
            +E+LIP+ A++GIAF+L QW LVS+VK+    P + A  S+ KNG  + L+EEEE
Sbjct  11   SEVLIPLAAVIGIAFSLAQWYLVSRVKVIGADPVQRAR-SERKNGLGDYLVEEEE  64



>ref|XP_003563306.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Brachypodium distachyon]
Length=773

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK  313
            +L +L T++++PV A+VGIAFA++QW+LVSKVK++PE+
Sbjct  2    VLSELATQLVVPVAAVVGIAFAVLQWVLVSKVKVTPER  39



>ref|XP_010033979.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Eucalyptus grandis]
 gb|KCW53849.1| hypothetical protein EUGRSUZ_J03081 [Eucalyptus grandis]
Length=769

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 6/64 (9%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLS------PEKSASDSDAKNGFAESLI  361
            +L  L TEI IP CA+VGI F+LVQW+LVS+VKL+         S   ++ KNG+ E LI
Sbjct  3    LLSPLATEIAIPACALVGIVFSLVQWLLVSRVKLTPEPRAPSSSSPGSNNNKNGYGEYLI  62

Query  362  EEEE  373
            EEE+
Sbjct  63   EEED  66



>ref|XP_007031139.1| Inorganic H pyrophosphatase family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY11641.1| Inorganic H pyrophosphatase family protein isoform 2, partial 
[Theobroma cacao]
Length=543

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 6/52 (12%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T+ILIPV A+VGI FAL QW LVS+VK+S       +D+ N + E LIE +E
Sbjct  9    TQILIPVAALVGIGFALFQWFLVSRVKVSS------NDSSNEYKEKLIEADE  54



>ref|NP_001146732.1| uncharacterized protein LOC100280334 [Zea mays]
 gb|ACL54639.1| unknown [Zea mays]
 gb|AFW87296.1| hypothetical protein ZEAMMB73_037805 [Zea mays]
Length=771

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +2

Query  185  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD-----SDAKNGFA  349
            M +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKLSPE    D     S A  G +
Sbjct  1    MASSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLSPEPRRGDGSAGKSGAGAGAS  60

Query  350  ESLIEEEE  373
            E LIEEEE
Sbjct  61   EYLIEEEE  68



>ref|XP_007031138.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY11640.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=781

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 6/52 (12%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T+ILIPV A+VGI FAL QW LVS+VK+      S +D+ N + E LIE +E
Sbjct  30   TQILIPVAALVGIGFALFQWFLVSRVKV------SSNDSSNEYKEKLIEADE  75



>ref|XP_002960455.1| hypothetical protein SELMODRAFT_270204 [Selaginella moellendorffii]
 gb|EFJ37994.1| hypothetical protein SELMODRAFT_270204 [Selaginella moellendorffii]
Length=764

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
            A+TIL     EILIPV A++GI FAL QW +VS+V +    +A+   + NG+ +SL+  E
Sbjct  2    AATILSAFQVEILIPVAALIGILFALFQWYIVSRVSVG---AATRVSSNNGYNDSLLSHE  58

Query  371  E  373
            E
Sbjct  59   E  59



>ref|XP_002967265.1| hypothetical protein SELMODRAFT_270614 [Selaginella moellendorffii]
 gb|EFJ31864.1| hypothetical protein SELMODRAFT_270614 [Selaginella moellendorffii]
Length=764

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
            A+TIL     EILIPV A++GI FAL QW +VS+V +    +A+   + NG+ +SL+  E
Sbjct  2    AATILSAFQVEILIPVAALIGILFALFQWYIVSRVSVG---AATRVSSNNGYNDSLLSHE  58

Query  371  E  373
            E
Sbjct  59   E  59



>ref|XP_004964695.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=762

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +2

Query  200  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            IL  L TE+ IP+  I+GIAFA+VQW++VS+VKLSP  +AS   +KNG+ + LIEEEE
Sbjct  3    ILSPLATEVFIPIAGIIGIAFAVVQWVIVSRVKLSPAAAAS-GGSKNGYGDYLIEEEE  59



>ref|XP_008797457.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Phoenix dactylifera]
Length=760

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = +2

Query  209  DLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
            D+  + +IP  A++GI FAL QW LVS++++S      DSD  NGF + LIE+E
Sbjct  6    DIVAQAVIPAAAVIGIVFALFQWFLVSRIRVS-----GDSDENNGFDDKLIEDE  54



>ref|XP_009630144.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X1 [Nicotiana tomentosiformis]
Length=761

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 39/51 (76%), Gaps = 5/51 (10%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
            T+ILIP+ ++VGI FAL+QW LVSKV++S     S S+ ++G+ + LIEE+
Sbjct  9    TQILIPLASLVGIGFALLQWFLVSKVRIS-----SGSELEDGYNDMLIEED  54



>ref|XP_009630145.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X2 [Nicotiana tomentosiformis]
Length=698

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 39/51 (76%), Gaps = 5/51 (10%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  370
            T+ILIP+ ++VGI FAL+QW LVSKV++S     S S+ ++G+ + LIEE+
Sbjct  9    TQILIPLASLVGIGFALLQWFLVSKVRIS-----SGSELEDGYNDMLIEED  54



>gb|AGT15917.1| vacuolar H+-pyrophosphatase [Saccharum hybrid cultivar R570]
 gb|AGT16391.1| vacuolar H+-pyrophosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD----SDAKNGFAESL  358
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE   +D         G +E L
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPRRADGSAGKSGGAGASEYL  63

Query  359  IEEEE  373
            IEEEE
Sbjct  64   IEEEE  68



>ref|XP_008370385.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Malus domestica]
Length=759

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 5/52 (10%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T+++IP+ A+VG+ FAL+QW LVSKVK+S          +NGF + LI +EE
Sbjct  9    TQVVIPLAAVVGLGFALLQWFLVSKVKVS-----GGHGERNGFKDKLIGDEE  55



>gb|AGT16227.1| vacuolar proton pyrophosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD----SDAKNGFAESL  358
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE   +D         G +E L
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPRRADGSAGKSGGAGASEYL  63

Query  359  IEEEE  373
            IEEEE
Sbjct  64   IEEEE  68



>gb|AGT16998.1| diphosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +2

Query  191  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD----SDAKNGFAESL  358
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE   +D         G +E L
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPRRADGSAGKSGAGGASEYL  63

Query  359  IEEEE  373
            IEEEE
Sbjct  64   IEEEE  68



>ref|XP_008359855.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Malus domestica]
Length=759

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 5/52 (10%)
 Frame = +2

Query  218  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  373
            T+I+IP+ A+VG+ FAL+QW LVS+VK+S          +NG+ + LI EEE
Sbjct  9    TQIVIPLAAVVGLGFALLQWFLVSRVKVS-----GGHGERNGYKDKLIGEEE  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510693543822