BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c35915_g1_i1 len=618 path=[596:0-617]

Length=618
                                                                      Score     E

ref|XP_009601194.1|  PREDICTED: putative lipid-transfer protein DIR1  70.1    3e-12   
ref|XP_006365510.1|  PREDICTED: putative lipid-transfer protein D...  67.4    3e-11   
ref|XP_009797273.1|  PREDICTED: putative lipid-transfer protein DIR1  65.9    1e-10   
gb|AEB33950.1|  defective in induced resistance 2 protein             65.9    1e-10   
ref|XP_004230985.1|  PREDICTED: putative lipid-transfer protein DIR1  65.5    1e-10   
ref|XP_006606947.1|  PREDICTED: putative lipid-transfer protein D...  61.2    4e-09   
gb|KHN27145.1|  Putative lipid-transfer protein DIR1                  60.8    5e-09   
ref|XP_011092905.1|  PREDICTED: putative lipid-transfer protein DIR1  60.8    7e-09   
gb|EYU42633.1|  hypothetical protein MIMGU_mgv1a024655mg              59.7    2e-08   
ref|XP_008387060.1|  PREDICTED: putative lipid-transfer protein DIR1  56.6    2e-07   
ref|XP_007142607.1|  hypothetical protein PHAVU_007G001800g           55.8    3e-07   
ref|XP_009339897.1|  PREDICTED: putative lipid-transfer protein DIR1  55.8    4e-07   
ref|XP_007223557.1|  hypothetical protein PRUPE_ppa013722mg           55.8    4e-07   
ref|XP_008222678.1|  PREDICTED: putative lipid-transfer protein DIR1  55.5    5e-07   
ref|XP_008386579.1|  PREDICTED: putative lipid-transfer protein DIR1  54.3    1e-06   
ref|XP_010028567.1|  PREDICTED: putative lipid-transfer protein DIR1  53.9    2e-06   
ref|XP_002283832.1|  PREDICTED: putative lipid-transfer protein DIR1  53.5    2e-06   Vitis vinifera
ref|XP_010442271.1|  PREDICTED: putative lipid-transfer protein DIR1  53.5    3e-06   
ref|XP_010241749.1|  PREDICTED: putative lipid-transfer protein DIR1  53.5    3e-06   
ref|XP_009339893.1|  PREDICTED: putative lipid-transfer protein DIR1  53.5    3e-06   
ref|XP_010482097.1|  PREDICTED: putative lipid-transfer protein DIR1  53.1    3e-06   
ref|XP_009364632.1|  PREDICTED: putative lipid-transfer protein DIR1  53.5    3e-06   
ref|XP_008386755.1|  PREDICTED: putative lipid-transfer protein DIR1  53.1    4e-06   
ref|XP_009339389.1|  PREDICTED: putative lipid-transfer protein DIR1  53.1    4e-06   
gb|KDP42884.1|  hypothetical protein JCGZ_23826                       52.8    5e-06   
ref|XP_009335428.1|  PREDICTED: putative lipid-transfer protein DIR1  52.8    5e-06   
ref|XP_009342728.1|  PREDICTED: putative lipid-transfer protein DIR1  52.4    6e-06   
ref|XP_004296699.1|  PREDICTED: putative lipid-transfer protein D...  52.4    7e-06   
ref|XP_009396800.1|  PREDICTED: putative lipid-transfer protein DIR1  52.4    7e-06   
ref|XP_009129731.1|  PREDICTED: putative lipid-transfer protein DIR1  52.0    9e-06   
ref|XP_008385814.1|  PREDICTED: putative lipid-transfer protein DIR1  52.0    1e-05   
ref|XP_010493672.1|  PREDICTED: putative lipid-transfer protein DIR1  51.6    1e-05   
ref|XP_008792988.1|  PREDICTED: putative lipid-transfer protein DIR1  51.6    1e-05   
emb|CDO97873.1|  unnamed protein product                              51.2    2e-05   
ref|XP_004294054.1|  PREDICTED: putative lipid-transfer protein D...  50.8    2e-05   
ref|XP_009375630.1|  PREDICTED: putative lipid-transfer protein DIR1  50.8    2e-05   
gb|EPS67451.1|  hypothetical protein M569_07329                       50.1    4e-05   
ref|XP_008358527.1|  PREDICTED: putative lipid-transfer protein DIR1  50.1    4e-05   
ref|XP_010318493.1|  PREDICTED: putative lipid-transfer protein DIR1  50.1    6e-05   
ref|XP_006423199.1|  hypothetical protein CICLE_v10029642mg           49.7    6e-05   
ref|XP_008227058.1|  PREDICTED: putative lipid-transfer protein DIR1  49.7    7e-05   
ref|XP_010258605.1|  PREDICTED: putative lipid-transfer protein DIR1  49.7    7e-05   
gb|KDO51453.1|  hypothetical protein CISIN_1g042956mg                 49.3    8e-05   
ref|XP_002529688.1|  lipid binding protein, putative                  49.3    1e-04   Ricinus communis
ref|XP_002313813.2|  hypothetical protein POPTR_0009s11560g           49.3    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010241751.1|  PREDICTED: putative lipid-transfer protein DIR1  49.3    1e-04   
gb|ABK93190.1|  unknown                                               48.9    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002519093.1|  lipid binding protein, putative                  48.9    1e-04   Ricinus communis
ref|XP_002529687.1|  lipid binding protein, putative                  48.9    1e-04   Ricinus communis
pdb|2RKN|A  Chain A, X-Ray Structure Of The Self-Defense And Sign...  48.5    1e-04   
ref|XP_008236806.1|  PREDICTED: putative lipid-transfer protein DIR1  48.9    1e-04   
ref|XP_002527254.1|  lipid binding protein, putative                  48.9    1e-04   Ricinus communis
ref|XP_007200072.1|  hypothetical protein PRUPE_ppa021237mg           48.9    1e-04   
ref|XP_006657616.1|  PREDICTED: putative lipid-transfer protein D...  48.5    2e-04   
ref|XP_008236785.1|  PREDICTED: putative lipid-transfer protein DIR1  48.9    2e-04   
gb|AAM62457.1|  unknown                                               48.5    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343129.1|  PREDICTED: putative lipid-transfer protein D...  48.9    2e-04   
ref|NP_568699.1|  putative lipid-transfer protein DIR1                48.5    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151008.1|  PVR3-like protein precursor                      48.5    2e-04   Zea mays [maize]
emb|CDY05673.1|  BnaC02g38640D                                        48.5    2e-04   
ref|XP_009399057.1|  PREDICTED: putative lipid-transfer protein DIR1  48.5    2e-04   
ref|XP_007212412.1|  hypothetical protein PRUPE_ppa016471mg           48.1    2e-04   
ref|XP_002320450.2|  hypothetical protein POPTR_0014s14740g           48.1    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008775676.1|  PREDICTED: putative lipid-transfer protein DIR1  48.1    2e-04   
ref|XP_006395174.1|  hypothetical protein EUTSA_v10005129mg           48.5    2e-04   
tpg|DAA60275.1|  TPA: putative bifunctional inhibitor/lipid-trans...  48.1    2e-04   
ref|XP_002459722.1|  hypothetical protein SORBIDRAFT_02g009340        47.8    2e-04   Sorghum bicolor [broomcorn]
ref|XP_002301823.1|  hypothetical protein POPTR_0002s25240g           48.1    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_004296700.1|  PREDICTED: putative lipid-transfer protein D...  48.1    3e-04   
ref|XP_008779441.1|  PREDICTED: putative lipid-transfer protein DIR1  47.4    4e-04   
ref|XP_010908200.1|  PREDICTED: putative lipid-transfer protein DIR1  47.4    4e-04   
gb|ACM90158.1|  trypsin-alpha amylase inhibitor                       47.4    5e-04   Jatropha curcas
gb|KDP45250.1|  hypothetical protein JCGZ_15115                       47.4    5e-04   
gb|KDP46220.1|  hypothetical protein JCGZ_10060                       47.4    5e-04   
ref|XP_002275805.1|  PREDICTED: putative lipid-transfer protein DIR1  47.0    7e-04   Vitis vinifera
emb|CAN61352.1|  hypothetical protein VITISV_027758                   47.0    7e-04   Vitis vinifera
ref|XP_004292000.1|  PREDICTED: putative lipid-transfer protein D...  47.0    7e-04   
gb|AFK43127.1|  unknown                                               47.0    7e-04   
gb|ABK23184.1|  unknown                                               46.6    8e-04   Picea sitchensis



>ref|XP_009601194.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana tomentosiformis]
Length=104

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
            +S CGLS+ +LM+CK AV+ G    PPS  CCTAL KA LPCLC FKN+ + I TFKIN 
Sbjct  28   DSSCGLSIADLMSCKPAVS-GPKPMPPSEKCCTALGKADLPCLCTFKNSPI-ISTFKINA  85

Query  343  ALAV  354
             LA+
Sbjct  86   TLAM  89



>ref|XP_006365510.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=104

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
            +S CGL++ +LMTCK AV+ G    PPS  CC AL+KA LPCLC FKN+ +L  +FKIN 
Sbjct  28   DSFCGLTINDLMTCKSAVS-GPKPLPPSDKCCAALTKADLPCLCTFKNSPML-SSFKINS  85

Query  343  ALAV  354
             LA+
Sbjct  86   TLAM  89



>ref|XP_009797273.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana sylvestris]
Length=106

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
            +S CGLS+ +LM+CK AV+ G    PPS  CC AL KA LPCLC FKN+  +I  FKIN 
Sbjct  30   DSPCGLSIGDLMSCKPAVS-GPKPLPPSEKCCAALGKADLPCLCTFKNSP-MISAFKINA  87

Query  343  ALAV  354
             LA+
Sbjct  88   TLAM  91



>gb|AEB33950.1| defective in induced resistance 2 protein [Nicotiana tabacum]
Length=106

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
            +S CGLS+ +LM+CK AV+ G    PPS  CC AL KA LPCLC FKN+  +I  FKIN 
Sbjct  30   DSPCGLSIGDLMSCKPAVS-GPKPLPPSEKCCAALGKADLPCLCTFKNSP-MISAFKINA  87

Query  343  ALAV  354
             LA+
Sbjct  88   TLAM  91



>ref|XP_004230985.1| PREDICTED: putative lipid-transfer protein DIR1 [Solanum lycopersicum]
Length=104

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
            +S+CGL++ +LMTCK AV+ G    PPS  CC AL+KA  PCLC FKN+ +L   FKIN 
Sbjct  28   DSLCGLTIYDLMTCKSAVS-GPKPLPPSDKCCAALTKADFPCLCTFKNSPML-SDFKINS  85

Query  343  ALAV  354
             LA+
Sbjct  86   TLAM  89



>ref|XP_006606947.1| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
Length=101

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = +1

Query  157  EDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKI  336
            +  SIC +S+ +LMTCK AVT   +  PPS  CC+ LS A LPCLC++KN+  L+ +  I
Sbjct  24   KGQSICNVSLPDLMTCKPAVTPP-NPTPPSQQCCSVLSHADLPCLCSYKNSP-LLPSLGI  81

Query  337  NPALAV  354
            +P LA+
Sbjct  82   DPKLAL  87



>gb|KHN27145.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=94

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = +1

Query  157  EDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKI  336
            +  SIC +S+ +LMTCK AVT   +  PPS  CC+ LS A LPCLC++KN+  L+ +  I
Sbjct  17   KGQSICNVSLPDLMTCKPAVTPP-NPTPPSQQCCSVLSHADLPCLCSYKNSP-LLPSLGI  74

Query  337  NPALAV  354
            +P LA+
Sbjct  75   DPKLAL  80



>ref|XP_011092905.1| PREDICTED: putative lipid-transfer protein DIR1 [Sesamum indicum]
Length=111

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +1

Query  151  NDEDNSICGLSVEELMTCKEAVTAGGHN-NPPSTLCCTALSKAKLPCLCNFKNNDVLIKT  327
            NDE  S+CG+S +EL+ CK AV  G     PPS  CC AL  A L C C+FKNN  L   
Sbjct  30   NDEGGSLCGMSQDELLECKPAVATGSAAPPPPSGACCAALGHANLTCFCSFKNNKYL-PM  88

Query  328  FKIN  339
            F IN
Sbjct  89   FGIN  92



>gb|EYU42633.1| hypothetical protein MIMGU_mgv1a024655mg [Erythranthe guttata]
Length=112

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +1

Query  151  NDEDNSICGLSVEELMTCKEAVTAGGH-NNPPSTLCCTALSKAKLPCLCNFKNNDVLIKT  327
            + +DN +CG+S +EL  CK AV AG     PPS  CCTAL+ A   C C FKNN  L   
Sbjct  31   SSDDNGLCGMSQDELFECKPAVAAGSAIPPPPSAACCTALTHANATCFCTFKNNKYL-PL  89

Query  328  FKIN  339
            F IN
Sbjct  90   FGIN  93



>ref|XP_008387060.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFK  333
            D   +IC +SV +LMTC+ AVT+  +  PP+  CC ALS A L CLC++KN+ VL  +  
Sbjct  30   DNAQNICNVSVTDLMTCRAAVTSP-NLAPPTKACCAALSHANLSCLCSYKNSSVL-PSLG  87

Query  334  INPALAV  354
            I+P LA+
Sbjct  88   IDPNLAL  94



>ref|XP_007142607.1| hypothetical protein PHAVU_007G001800g [Phaseolus vulgaris]
 gb|ESW14601.1| hypothetical protein PHAVU_007G001800g [Phaseolus vulgaris]
Length=101

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            +CG+SV +LMTCK AVT    + P S  CC+ +SK  + CLCN+KN+  L+ +  I+P L
Sbjct  28   VCGVSVTDLMTCKAAVTPPSPSEP-SDECCSVVSKVDMDCLCNYKNSP-LLPSLGIDPDL  85

Query  349  AV  354
            A+
Sbjct  86   AL  87



>ref|XP_009339897.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=112

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            IC +SV +LMTC+ AVT+  +  PP+  CC ALS A L CLC++KN+ VL  +  I+P L
Sbjct  39   ICNVSVSDLMTCRPAVTSP-NPAPPTKACCAALSHANLSCLCSYKNSSVL-PSLGIDPNL  96

Query  349  AV  354
            A+
Sbjct  97   AL  98



>ref|XP_007223557.1| hypothetical protein PRUPE_ppa013722mg [Prunus persica]
 gb|EMJ24756.1| hypothetical protein PRUPE_ppa013722mg [Prunus persica]
Length=107

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +1

Query  157  EDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKI  336
            +  +IC +S+  LMTC+ AVTA  +  PP+T CC+ALS A + CLC++KN++ L+ +  I
Sbjct  30   DAQNICNVSLNGLMTCRPAVTAP-NPAPPTTACCSALSHADMGCLCSYKNSN-LLPSLGI  87

Query  337  NPALAV  354
            +P LA+
Sbjct  88   DPNLAL  93



>ref|XP_008222678.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=107

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +1

Query  157  EDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKI  336
            +  +IC +S+  LMTC+ AVTA  +  PP+T CC+ALS A + CLC++KN++ L+ +  I
Sbjct  30   DAQNICNVSMNGLMTCRPAVTAP-NPAPPTTACCSALSHADMGCLCSYKNSN-LLPSLGI  87

Query  337  NPALAV  354
            +P LA+
Sbjct  88   DPNLAL  93



>ref|XP_008386579.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            IC +SV  LMTC+ AVT+  +  PP+  CC ALS A L CLC++KN+ VL  +  I+P L
Sbjct  35   ICNISVTGLMTCRPAVTSP-NPAPPTKACCAALSHANLSCLCSYKNSSVL-PSLGIDPNL  92

Query  349  AV  354
            A+
Sbjct  93   AL  94



>ref|XP_010028567.1| PREDICTED: putative lipid-transfer protein DIR1 [Eucalyptus grandis]
 gb|KCW55323.1| hypothetical protein EUGRSUZ_I01246 [Eucalyptus grandis]
Length=104

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +1

Query  160  DNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKIN  339
            ++S+CG+S E    CK +V+ G +   P+  CC+AL+ A L CLC FK    L++T++IN
Sbjct  27   NSSMCGMSKEGFEACKPSVS-GSNPTEPTRGCCSALTNADLNCLCFFKYARTLLQTYQIN  85

Query  340  PALAV  354
            P LA 
Sbjct  86   PDLAA  90



>ref|XP_002283832.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=99

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +1

Query  160  DNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKIN  339
              SIC ++ + L  CK +V+ G    PPS  CC A+SKA LPCLC+FKN+  L+    I+
Sbjct  23   QGSICRMTQDGLTACKPSVS-GQSPLPPSPACCAAISKADLPCLCSFKNS-ALLPYLGID  80

Query  340  PALAV  354
            P +A 
Sbjct  81   PNMAT  85



>ref|XP_010442271.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=94

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            +CG++ +EL  CK AVT G   +P S LCCTAL  A   CLC +KN+  L  +F ++P L
Sbjct  21   LCGMTQDELNECKPAVTKGNPTSP-SQLCCTALQHADFACLCGYKNSPWL-GSFGVDPEL  78

Query  349  A  351
            A
Sbjct  79   A  79



>ref|XP_010241749.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=103

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +1

Query  160  DNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKIN  339
              +IC +    LM C  +VT G   +PPS  CC+ALS A L CLC++KN+  L+ +  IN
Sbjct  27   SQTICNMPAASLMACMPSVT-GTKPSPPSGDCCSALSHADLKCLCSYKNSK-LLPSLGIN  84

Query  340  PALAV  354
            P LA+
Sbjct  85   PKLAI  89



>ref|XP_009339893.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=108

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            IC +SV  LMTC+ AVT+  +  PP+  CC+ALS A + CLC++KN+ VL  +  I+P L
Sbjct  35   ICNVSVTGLMTCRPAVTSP-NPAPPTKACCSALSHANVSCLCSYKNSSVL-PSLGIDPNL  92

Query  349  AV  354
            A+
Sbjct  93   AL  94



>ref|XP_010482097.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=103

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            +CG++ +EL  CK AVT G   +P S LCCTAL  A   CLC +KN+  L  +F ++P L
Sbjct  30   LCGMTQDELNECKPAVTKGNPTSP-SQLCCTALQHADFACLCGYKNSPWL-GSFGVDPEL  87

Query  349  A  351
            A
Sbjct  88   A  88



>ref|XP_009364632.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Pyrus 
x bretschneideri]
 ref|XP_009364650.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Pyrus 
x bretschneideri]
Length=108

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            SIC +  ++L  C+ AVT G    PP+  CC+ + +A LPCLCNFK+   ++ +  I+PA
Sbjct  33   SICNIESDQLKECRPAVT-GKSPKPPTKRCCSVVRQANLPCLCNFKS---VLPSIGIDPA  88

Query  346  LAV  354
            LA+
Sbjct  89   LAM  91



>ref|XP_008386755.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008387154.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008343359.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            IC +SV +LM C+ AVT+  +  PP+  CC ALS A L CLC++KN+ VL  +  I+P L
Sbjct  35   ICNVSVTDLMKCRPAVTSP-NPAPPTKACCAALSHANLSCLCSYKNSSVL-PSLGIDPNL  92

Query  349  AV  354
            A+
Sbjct  93   AL  94



>ref|XP_009339389.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=102

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            SIC +  ++L  C+ AVT G    PP+  CC+ + +A LPCLCNFK+   ++ +  I+PA
Sbjct  27   SICNIESDQLKECRPAVT-GKSPKPPTKRCCSVVRQANLPCLCNFKS---VLPSIGIDPA  82

Query  346  LAV  354
            LA+
Sbjct  83   LAM  85



>gb|KDP42884.1| hypothetical protein JCGZ_23826 [Jatropha curcas]
Length=101

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
             SIC +S+  L +C+ AVT   +  PP++ CC+ALS A L CLC++KN+  L+ +  I+P
Sbjct  26   QSICNVSISGLTSCRPAVTPP-NPAPPTSACCSALSHADLRCLCSYKNS-TLLPSLGIDP  83

Query  343  ALAV  354
             LA+
Sbjct  84   KLAL  87



>ref|XP_009335428.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=118

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            SIC +  ++L  C+ AVT G    PP+  CC+ + +A LPCLCNFK+   ++ +  I+PA
Sbjct  43   SICNIESDQLKECRPAVT-GKSPKPPTKRCCSVVRQANLPCLCNFKS---VLPSIGIDPA  98

Query  346  LAV  354
            LA+
Sbjct  99   LAM  101



>ref|XP_009342728.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=106

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFK  333
            + D S C ++ E L  C  +V  G +  PPS LCCTALS A   CLC FK     +  + 
Sbjct  27   NSDQSFCRMTKEGLNACAPSVN-GANPQPPSALCCTALSYADFGCLCLFKKYSNFLSAYG  85

Query  334  INPALAV  354
            I+P LA+
Sbjct  86   IDPNLAM  92



>ref|XP_004296699.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=104

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNP--PSTLCCTALSKAKLPCLCNFKNNDVLIKT  327
             E  +IC +SV  LM+CK AVT     NP  P+  CC+ALS A L CLC+++N++ L+ +
Sbjct  26   SEAQTICNVSVNNLMSCKPAVT---KPNPARPTQACCSALSHADLGCLCSYRNSN-LLPS  81

Query  328  FKINPALAV  354
              I+P LA+
Sbjct  82   LGIDPKLAM  90



>ref|XP_009396800.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=105

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  160  DNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVL  318
            D S+C ++ E L  CK  +        PS  CC AL +A LPCLC++KN+D+L
Sbjct  28   DQSLCKMTQEGLAACKPCIAMVKPEEKPSEACCAALKQADLPCLCSYKNSDLL  80



>ref|XP_009129731.1| PREDICTED: putative lipid-transfer protein DIR1 [Brassica rapa]
 emb|CDY48760.1| BnaA02g30210D [Brassica napus]
Length=104

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            +CG++  EL  CK AV+     NP STLCC  L  A + CLC +KN+  L+ +F I+PAL
Sbjct  31   LCGMTQSELNECKPAVSKENPTNP-STLCCDYLKHADISCLCGYKNSP-LLGSFGIDPAL  88

Query  349  AV  354
            A 
Sbjct  89   AA  90



>ref|XP_008385814.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=114

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 4/63 (6%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            SIC +  ++L  C+ AVT G    PP+  CC  + +A LPCLCNFK+   ++ +  I+PA
Sbjct  39   SICNIESDQLKECRPAVT-GKSPKPPTKRCCXVVRQANLPCLCNFKS---VLPSIGIDPA  94

Query  346  LAV  354
            LA+
Sbjct  95   LAM  97



>ref|XP_010493672.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
 ref|XP_010493673.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=100

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            +CG++ +EL  CK AVT G   NP +  CCTAL  A   CLC +KN+  L  +F ++P L
Sbjct  27   LCGMTQDELNECKPAVTKGNPTNP-TQPCCTALQHADFACLCGYKNSPWL-GSFGVDPEL  84

Query  349  A  351
            A
Sbjct  85   A  85



>ref|XP_008792988.1| PREDICTED: putative lipid-transfer protein DIR1 [Phoenix dactylifera]
Length=107

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
               C ++ +ELM CK +++       P+  CCTALS A LPCLC +KN+ +L     I+P
Sbjct  31   QGFCNMTRDELMACKPSISTAKPVEKPADACCTALSHADLPCLCAYKNSGML-PYLGIDP  89

Query  343  ALAV  354
             LA+
Sbjct  90   NLAM  93



>emb|CDO97873.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
             +IC +S +ELM+CK AVT    ++P S+ CC AL  A + CLC+FK++  L  +  I+P
Sbjct  29   QTICKMSAQELMSCKPAVTPPEPSDP-SSACCAALKHADVACLCSFKSSSWL-PSLGIDP  86

Query  343  ALA  351
             LA
Sbjct  87   NLA  89



>ref|XP_004294054.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=102

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 4/63 (6%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            SIC +   +L  C+ AV+ G    PPS  CC  + +A LPCLCN+K    ++ +F I+PA
Sbjct  28   SICNIDSAQLNYCRRAVS-GKSPTPPSKKCCGVVHRANLPCLCNYKT---VLPSFGIDPA  83

Query  346  LAV  354
            LA+
Sbjct  84   LAM  86



>ref|XP_009375630.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=106

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFK  333
            + D S C ++ E L  C  +V+ G +  PPS LCC+ALS A   CLC FK     +  + 
Sbjct  27   NSDESFCRMTKEGLNACAPSVS-GANPPPPSALCCSALSYADFGCLCLFKKYSNFLSAYG  85

Query  334  INPALAV  354
            I+P LA+
Sbjct  86   IDPNLAM  92



>gb|EPS67451.1| hypothetical protein M569_07329 [Genlisea aurea]
Length=98

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +1

Query  157  EDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKI  336
            +   +C L+V ELM C+ A T     NP S  CC AL  A   CLCN+ +N VL  +  I
Sbjct  22   KGQEVCSLTVGELMECRPAATPPKPENP-SAACCKALKHADFKCLCNYLDNPVL-PSLNI  79

Query  337  NPALAV  354
            +P LA+
Sbjct  80   DPKLAL  85



>ref|XP_008358527.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008365974.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=106

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 36/67 (54%), Gaps = 1/67 (1%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFK  333
            + D   C ++ E L  C  +V  G +  PPS LCCTALS A   CLC FK     +  + 
Sbjct  27   NSDQRFCRMTKEGLNACALSVN-GANPQPPSALCCTALSYADFGCLCLFKKYSNFLSAYG  85

Query  334  INPALAV  354
            I+P LA+
Sbjct  86   IDPNLAM  92



>ref|XP_010318493.1| PREDICTED: putative lipid-transfer protein DIR1 [Solanum lycopersicum]
Length=106

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
              IC +S E LM+C+ ++T   +   P+  CC ALS+A + CLC++KN+  L+ +  I+P
Sbjct  31   QGICNVSGEGLMSCRPSITPP-YPTAPTAQCCNALSRADMACLCSYKNSQ-LLPSLGIDP  88

Query  343  ALAV  354
             LA+
Sbjct  89   NLAI  92



>ref|XP_006423199.1| hypothetical protein CICLE_v10029642mg [Citrus clementina]
 gb|ESR36439.1| hypothetical protein CICLE_v10029642mg [Citrus clementina]
Length=103

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVL  318
            + +C ++ + L  C+ AV A  + +PPST CC+ALSKA L C C FKN+ VL
Sbjct  28   DGLCRMTKDGLTACQPAVAAS-NPSPPSTACCSALSKADLQCFCAFKNSRVL  78



>ref|XP_008227058.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=104

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            SIC +   +L  C+ AVT G    PP+  CC  + +A LPCLCN+K+       F INPA
Sbjct  29   SICNIDSAKLNECRPAVT-GNSPKPPTKKCCDVVHQANLPCLCNYKS---AFPAFGINPA  84

Query  346  LAV  354
            LA+
Sbjct  85   LAM  87



>ref|XP_010258605.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=103

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 6/68 (9%)
 Frame = +1

Query  157  EDNSICGLSVEELMTCKEAVTAGGHNNP--PSTLCCTALSKAKLPCLCNFKNNDVLIKTF  330
            ++ S+C +S  +L+ CK AV+     NP  PS  CC ALS A L CLC++KN+ +L+ + 
Sbjct  26   KEVSLCNMSENDLLACKPAVS---KQNPADPSPACCKALSSADLSCLCSYKNS-ILLPSL  81

Query  331  KINPALAV  354
             INP  A+
Sbjct  82   GINPDFAM  89



>gb|KDO51453.1| hypothetical protein CISIN_1g042956mg [Citrus sinensis]
Length=103

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVL  318
            + +C ++ + L  C+ AV A  + +PPST CC+ALSKA L C C FKN+ VL
Sbjct  28   DGLCRMTKDGLTACQPAVAAS-NPSPPSTACCSALSKADLQCFCVFKNSRVL  78



>ref|XP_002529688.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF32699.1| lipid binding protein, putative [Ricinus communis]
Length=106

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
             S+C + +  LM CK AVT    + P ++ CC+AL+ A + CLC++KN++VL  +  I+P
Sbjct  32   QSVCNVPISGLMACKPAVTPPNPSAP-TSACCSALTHADMRCLCSYKNSNVL-PSLGIDP  89

Query  343  ALAV  354
             LA+
Sbjct  90   NLAL  93



>ref|XP_002313813.2| hypothetical protein POPTR_0009s11560g [Populus trichocarpa]
 gb|EEE87768.2| hypothetical protein POPTR_0009s11560g [Populus trichocarpa]
Length=109

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNN-DVLIKTFKINP  342
            ++CG++ E   +CK +V  G +  PPS  CC+AL KA L CLC FK N   ++    I+P
Sbjct  31   TLCGMTKEGFASCKPSVQTGVNPLPPSYSCCSALEKADLSCLCFFKKNYPKMLTDNNIDP  90

Query  343  ALAV  354
             LA+
Sbjct  91   NLAM  94



>ref|XP_010241751.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=106

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            +C +S ++LM CK AV      +P +  CC ALS A L CLC++K++ +L+ TF I+P L
Sbjct  32   LCNMSEDDLMACKPAVIKPNPADP-TPACCKALSGADLSCLCSYKHS-LLLPTFGIDPDL  89

Query  349  AV  354
            A+
Sbjct  90   AM  91



>gb|ABK93190.1| unknown [Populus trichocarpa]
Length=103

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNP--PSTLCCTALSKAKLPCLCNFKNNDVLIKT  327
            +  ++IC + V  LM+CK +VT     NP  PS  CC+ALS A L CLC++KN++ L+ +
Sbjct  25   NAQSTICKMPVAGLMSCKPSVTPP---NPTAPSADCCSALSHADLNCLCSYKNSN-LLPS  80

Query  328  FKINPALAV  354
              I+P LA+
Sbjct  81   LGIDPKLAM  89



>ref|XP_002519093.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF43304.1| lipid binding protein, putative [Ricinus communis]
Length=99

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  172  CGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNN-DVLIKTFKINPAL  348
            C L+ E +  C+ +VT G +   PS  CC ALSKA L CLC +KNN   L+ ++KI+P L
Sbjct  24   CRLTNEGIEACRPSVT-GQNPAAPSDACCAALSKADLQCLCFYKNNYPWLLSSYKIDPNL  82

Query  349  AV  354
            A+
Sbjct  83   AM  84



>ref|XP_002529687.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF32698.1| lipid binding protein, putative [Ricinus communis]
Length=93

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            SIC + +  LM CK AVT    + P ++ CC+AL+ A + CLC++KN++ L+ +  I+P 
Sbjct  20   SICNVPISGLMACKPAVTPPNPSAP-TSACCSALTHADMRCLCSYKNSN-LLPSLGIDPN  77

Query  346  LAV  354
            LA+
Sbjct  78   LAL  80



>pdb|2RKN|A Chain A, X-Ray Structure Of The Self-Defense And Signaling Protein 
Dir1 From Arabidopsis Taliana
Length=77

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 6/63 (10%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNP--PSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
            +CG+S +EL  CK AV+     NP  PS  CCTAL  A   CLC +KN+  L  +F ++P
Sbjct  4    LCGMSQDELNECKPAVS---KENPTSPSQPCCTALQHADFACLCGYKNSPWL-GSFGVDP  59

Query  343  ALA  351
             LA
Sbjct  60   ELA  62



>ref|XP_008236806.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=105

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            + C L+ E L  C  +V+ G +  PPS LCC+ALS A   CLC FKN   L+ ++ I+P 
Sbjct  30   TFCRLTKEGLNACAPSVS-GLNPLPPSALCCSALSIADFQCLCFFKNYSNLLTSYGIDPN  88

Query  346  LAV  354
            LA+
Sbjct  89   LAM  91



>ref|XP_002527254.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF35098.1| lipid binding protein, putative [Ricinus communis]
Length=102

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            ++C ++ + L+ CK +VT      PPS  CC AL+ A L CLC+++N+ +++ +  I+P 
Sbjct  27   TLCDMNDDGLLACKPSVTKPDPVEPPSPACCQALTGANLTCLCSYRNS-LMLPSLGIDPD  85

Query  346  LAV  354
            LA+
Sbjct  86   LAL  88



>ref|XP_007200072.1| hypothetical protein PRUPE_ppa021237mg [Prunus persica]
 gb|EMJ01271.1| hypothetical protein PRUPE_ppa021237mg [Prunus persica]
Length=107

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFK  333
            + + S C ++ E L  C  AV+ G +  PPS LCC+AL  A   CLC FK    L+  + 
Sbjct  28   NNEQSFCRMTKEGLNACAPAVS-GQNPLPPSALCCSALKTADFQCLCLFKKYSNLLSAYG  86

Query  334  INPALAV  354
            I+P LA+
Sbjct  87   IDPNLAM  93



>ref|XP_006657616.1| PREDICTED: putative lipid-transfer protein DIR1-like [Oryza brachyantha]
Length=100

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +1

Query  172  CGLSVEELMTCKEAVTAGGHNNP-PSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            C +S ++ M C+ A  A  +  P PS  CCTALSKA L CLC++KN+  L   + I+P+ 
Sbjct  26   CNMSNDQFMACQPAAAATSNPTPSPSADCCTALSKADLSCLCSYKNSPWL-SLYNIDPSR  84

Query  349  AV  354
            A+
Sbjct  85   AM  86



>ref|XP_008236785.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=107

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFK  333
            + + S C ++ E L  C  AV+ G +  PPS LCC+AL  A   CLC FK    L+  + 
Sbjct  28   NNEQSFCRMTKEGLNACAPAVS-GQNPLPPSALCCSALKTADFQCLCLFKKYSNLLSAYG  86

Query  334  INPALAV  354
            I+P LA+
Sbjct  87   IDPNLAM  93



>gb|AAM62457.1| unknown [Arabidopsis thaliana]
Length=102

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 6/63 (10%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNP--PSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
            +CG+S +EL  CK AV+     NP  PS  CCTAL  A   CLC +KN+  L  +F ++P
Sbjct  29   LCGMSQDELNECKPAVS---KENPTSPSQPCCTALQHADFACLCGYKNSPWL-GSFGVDP  84

Query  343  ALA  351
             LA
Sbjct  85   ELA  87



>ref|XP_006343129.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=129

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFK  333
             +   IC +S E LM+C+ ++T   +   P+  CC ALS A + CLC++KN+  L+ +  
Sbjct  51   SQAQGICNVSGEGLMSCRPSITPP-YPTAPTAQCCNALSHADMACLCSYKNSQ-LLPSLG  108

Query  334  INPALAV  354
            I+P LA+
Sbjct  109  IDPNLAI  115



>ref|NP_568699.1| putative lipid-transfer protein DIR1 [Arabidopsis thaliana]
 sp|Q8W453.1|DIRL1_ARATH RecName: Full=Putative lipid-transfer protein DIR1; AltName: 
Full=Protein DEFECTIVE IN INDUCED RESISTANCE 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32935.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL76110.1| DIR1 protein [Arabidopsis thaliana]
 gb|AAP21318.1| At5g48485 [Arabidopsis thaliana]
 gb|AED95676.1| putative lipid-transfer protein DIR1 [Arabidopsis thaliana]
Length=102

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 6/63 (10%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNP--PSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
            +CG+S +EL  CK AV+     NP  PS  CCTAL  A   CLC +KN+  L  +F ++P
Sbjct  29   LCGMSQDELNECKPAVS---KENPTSPSQPCCTALQHADFACLCGYKNSPWL-GSFGVDP  84

Query  343  ALA  351
             LA
Sbjct  85   ELA  87



>ref|NP_001151008.1| PVR3-like protein precursor [Zea mays]
 gb|ACG41271.1| PVR3-like protein [Zea mays]
Length=105

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKN-NDVLIKTF  330
            +  ++ICG++ E+   C+ A  A    + PS  CC AL KA L C+C +K    + ++ +
Sbjct  23   ESAHAICGMANEDFKLCQPAAAANDPTDSPSAECCAALGKADLGCICRYKGVAGIWMRIY  82

Query  331  KINPALAV  354
             I+P+ A+
Sbjct  83   HIDPSXAM  90



>emb|CDY05673.1| BnaC02g38640D [Brassica napus]
Length=103

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 6/64 (9%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNP--PSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
            +CG++  EL  CK AV+     NP  PSTLCC  L  A   CLC ++N+  L  +F I+P
Sbjct  30   LCGMTQSELNECKPAVS---KENPTKPSTLCCDYLKHADFSCLCGYRNSPWL-GSFGIDP  85

Query  343  ALAV  354
            ALA+
Sbjct  86   ALAL  89



>ref|XP_009399057.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=103

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (58%), Gaps = 1/64 (2%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
             S+C +S E L  C+  ++       PS  CC AL +A LPCLC++KN+ VL+    I+P
Sbjct  27   QSLCKMSQEGLDACRPCISTVKPAEQPSDACCAALKQADLPCLCSYKNS-VLLPYIGIDP  85

Query  343  ALAV  354
              A+
Sbjct  86   KRAM  89



>ref|XP_007212412.1| hypothetical protein PRUPE_ppa016471mg, partial [Prunus persica]
 gb|EMJ13611.1| hypothetical protein PRUPE_ppa016471mg, partial [Prunus persica]
Length=89

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            IC +   +L  C+ AVT G    PP+  CC  + +A LPCLCN+K+       F INPAL
Sbjct  17   ICNIDSAKLNECRPAVT-GNSPKPPTKKCCDVVHQANLPCLCNYKS---AFPAFGINPAL  72

Query  349  AV  354
            A+
Sbjct  73   AM  74



>ref|XP_002320450.2| hypothetical protein POPTR_0014s14740g [Populus trichocarpa]
 gb|ABK94334.1| unknown [Populus trichocarpa]
 gb|EEE98765.2| hypothetical protein POPTR_0014s14740g [Populus trichocarpa]
Length=103

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNP--PSTLCCTALSKAKLPCLCNFKNNDVLIKT  327
            +  ++IC + V  LM+CK +VT     NP  PS  CC+ALS A + CLC++KN++ L+ +
Sbjct  25   NAQSTICKMPVAGLMSCKPSVTPP---NPTAPSADCCSALSHADINCLCSYKNSN-LLPS  80

Query  328  FKINPALAV  354
              I+P LA+
Sbjct  81   LGIDPKLAM  89



>ref|XP_008775676.1| PREDICTED: putative lipid-transfer protein DIR1 [Phoenix dactylifera]
Length=105

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINP  342
            +  C +++E    CK AVT G     PS  CC ALS A LPCLC+++++ +L+ +  I+P
Sbjct  30   DGFCNMTMEGFNACKPAVT-GPEPTEPSEECCEALSNADLPCLCSYRHS-MLLPSLGIDP  87

Query  343  ALAV  354
             LA+
Sbjct  88   DLAM  91



>ref|XP_006395174.1| hypothetical protein EUTSA_v10005129mg [Eutrema salsugineum]
 gb|ESQ32460.1| hypothetical protein EUTSA_v10005129mg [Eutrema salsugineum]
Length=126

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            +CG++  EL  CK AVT     +P S LCC AL  A L CLC +K++  L  +F I+P L
Sbjct  53   LCGMTETELNECKPAVTKESPTSP-SQLCCDALKHADLNCLCGYKHSPWL-GSFGIDPEL  110

Query  349  AV  354
            AV
Sbjct  111  AV  112



>tpg|DAA60275.1| TPA: putative bifunctional inhibitor/lipid-transfer protein/seed 
storage 2S albumin superfamily protein [Zea mays]
Length=105

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +1

Query  154  DEDNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKN-NDVLIKTF  330
            +  ++ICG++ E+   C+ A  A    + PS  CC AL KA L C+C +K    + ++ +
Sbjct  23   ESAHAICGMANEDFKLCQPAAAANDPTDSPSAECCAALGKADLGCICRYKGVAGIWMRIY  82

Query  331  KINPALAV  354
             I+P+ A+
Sbjct  83   HIDPSRAM  90



>ref|XP_002459722.1| hypothetical protein SORBIDRAFT_02g009340 [Sorghum bicolor]
 gb|EER96243.1| hypothetical protein SORBIDRAFT_02g009340 [Sorghum bicolor]
Length=84

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKN-NDVLIKTFKIN  339
            ++ICG++ E+   C+ A +     + PS  CC AL KA L C+C +K    + ++ + I+
Sbjct  5    DAICGMANEDFKLCQPAASVSDPTDSPSAECCAALGKADLGCICRYKGVAGIWMRIYHID  64

Query  340  PALAV  354
            P+ A+
Sbjct  65   PSRAM  69



>ref|XP_002301823.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
 ref|XP_006386890.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
 gb|ABK93979.1| unknown [Populus trichocarpa]
 gb|EEE81096.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
 gb|ERP64687.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
Length=102

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            S+C +S + L  CK +VT      PPS  CC A+S A   CLC++KN+  L+    I+P 
Sbjct  26   SVCDISEDGLAACKPSVTKPDPVEPPSVDCCKAVSGANFTCLCSYKNS-YLLPYLGIDPD  84

Query  346  LAV  354
            LA+
Sbjct  85   LAM  87



>ref|XP_004296700.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=104

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 6/68 (9%)
 Frame = +1

Query  157  EDNSICGLSVEELMTCKEAVTAGGHNNP--PSTLCCTALSKAKLPCLCNFKNNDVLIKTF  330
            +  +IC + +  LM+C+ A+T     NP  PS  CC+ALS A L CLC++KN++ L+ + 
Sbjct  27   DAQTICNVPLNNLMSCRAAIT---RPNPAKPSKACCSALSLADLGCLCSYKNSN-LLPSL  82

Query  331  KINPALAV  354
             I+P LA+
Sbjct  83   GIDPELAM  90



>ref|XP_008779441.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Phoenix 
dactylifera]
Length=103

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +1

Query  160  DNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKIN  339
             +S C ++ E L+ C  ++T G     PS  CCTALSKA L CLC++KN+ +L +   I 
Sbjct  28   SDSHCRITEEGLLACLPSIT-GSQPVKPSVWCCTALSKADLLCLCHYKNSPMLSQ-LGIK  85

Query  340  PALAV  354
            P LA+
Sbjct  86   PKLAM  90



>ref|XP_010908200.1| PREDICTED: putative lipid-transfer protein DIR1 [Elaeis guineensis]
Length=105

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +1

Query  160  DNSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKIN  339
             +S C ++ E L+ C  ++T     NP S  CCTALSKA L CLC++KN+ +L +   I 
Sbjct  28   SDSHCRMTEEGLLACLPSITGSRPVNP-SVKCCTALSKADLRCLCHYKNSPMLSQ-LGIK  85

Query  340  PALAV  354
            P LA+
Sbjct  86   PQLAM  90



>gb|ACM90158.1| trypsin-alpha amylase inhibitor [Jatropha curcas]
Length=101

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVL  318
             SIC +S+  L +C  AVT   +  PP++ CC+ALS A L CLC++KN+ +L
Sbjct  26   QSICNVSISGLTSCSPAVTPP-NPAPPTSACCSALSHADLRCLCSYKNSTLL  76



>gb|KDP45250.1| hypothetical protein JCGZ_15115 [Jatropha curcas]
Length=102

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPAL  348
            +C +  + L+ CK +VT      PPS  CC ALS A L CLC+++N+ +++ +  I+P L
Sbjct  28   LCDMDDDGLLACKPSVTKPNPVVPPSPKCCKALSGANLTCLCSYRNS-LMLPSLGIDPDL  86

Query  349  AV  354
            A+
Sbjct  87   AL  88



>gb|KDP46220.1| hypothetical protein JCGZ_10060 [Jatropha curcas]
Length=109

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query  163  NSICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNN-DVLIKTFKIN  339
             + C ++ E L  C+ +V+ G +   PS  CC+ALSKA L CLC +KNN   L+ T+KI+
Sbjct  31   ETFCHMTDEGLNACRPSVS-GQNPVAPSAACCSALSKADLQCLCFYKNNYPWLLTTYKID  89

Query  340  PALAV  354
            P  A+
Sbjct  90   PNQAL  94



>ref|XP_002275805.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=107

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            +IC +   +L  C  AV+ G    PP+  CCTAL  A L CLCN+K+    +  F INPA
Sbjct  29   TICNIDTSKLAECLPAVS-GRSPPPPTKACCTALLSADLHCLCNYKSA---LPAFGINPA  84

Query  346  LAV  354
            LA+
Sbjct  85   LAM  87



>emb|CAN61352.1| hypothetical protein VITISV_027758 [Vitis vinifera]
Length=107

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            +IC +   +L  C  AV+ G    PP+  CCTAL  A L CLCN+K+    +  F INPA
Sbjct  29   TICNIDTSKLAECLPAVS-GRSPPPPTKACCTALLSADLHCLCNYKSA---LPAFGINPA  84

Query  346  LAV  354
            LA+
Sbjct  85   LAM  87



>ref|XP_004292000.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=108

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 38/72 (53%), Gaps = 4/72 (6%)
 Frame = +1

Query  151  NDEDNSICGLSVEELMTCKEAVTAGGHNN----PPSTLCCTALSKAKLPCLCNFKNNDVL  318
                +SIC ++ +  + C  +VTA          P+  CC+ALS A  PCLC F  N  +
Sbjct  23   GQGQSSICRMTKDGFLACAPSVTASATPGFIPAAPTAECCSALSVADFPCLCFFMRNSKI  82

Query  319  IKTFKINPALAV  354
            +  + ++P+LA+
Sbjct  83   LNAYGVDPSLAM  94



>gb|AFK43127.1| unknown [Lotus japonicus]
Length=102

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = +1

Query  166  SICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNNDVLIKTFKINPA  345
            ++C +   +L +C+ A T G H  PP   CC  + +A LPCLC +K+    + +F INP 
Sbjct  29   ALCNIDTSQLKSCRAAAT-GEHPPPPDKKCCDVVRQANLPCLCKYKS---ALPSFGINPT  84

Query  346  LAV  354
             A+
Sbjct  85   QAL  87



>gb|ABK23184.1| unknown [Picea sitchensis]
Length=103

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 3/62 (5%)
 Frame = +1

Query  169  ICGLSVEELMTCKEAVTAGGHNNPPSTLCCTALSKAKLPCLCNFKNN-DVLIKTFKINPA  345
            IC +S ++LM CK AVT       P   CC+ LS A L C C F NN   L++ F I+P 
Sbjct  29   ICNVSKDDLMPCKPAVTQPPAQ--PVQACCSVLSTANLTCFCEFGNNYPSLLRMFGIDPD  86

Query  346  LA  351
            LA
Sbjct  87   LA  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 801610136576