BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3578_g1_i1 len=1104 path=[1082:0-1103]

Length=1104
                                                                      Score     E

ref|XP_006363118.1|  PREDICTED: cytokinin hydroxylase-like isofor...    524   0.0      
ref|XP_009607763.1|  PREDICTED: cytokinin hydroxylase-like              524   0.0      
ref|XP_006363117.1|  PREDICTED: cytokinin hydroxylase-like isofor...    523   3e-180   
gb|KDP32947.1|  hypothetical protein JCGZ_12978                         519   3e-179   
ref|XP_002516723.1|  cytochrome P450, putative                          520   4e-179   Ricinus communis
ref|XP_009789073.1|  PREDICTED: cytokinin hydroxylase-like isofor...    519   1e-178   
ref|XP_008379543.1|  PREDICTED: cytokinin hydroxylase-like              518   2e-178   
ref|XP_009357060.1|  PREDICTED: cytokinin hydroxylase-like              518   3e-178   
gb|KCW68914.1|  hypothetical protein EUGRSUZ_F02489                     516   4e-178   
ref|XP_006430783.1|  hypothetical protein CICLE_v10011497mg             518   4e-178   
ref|XP_011099558.1|  PREDICTED: cytokinin hydroxylase                   517   4e-178   
ref|XP_010061877.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin hy...    517   5e-178   
gb|EYU44640.1|  hypothetical protein MIMGU_mgv1a004492mg                517   7e-178   
ref|XP_008230401.1|  PREDICTED: cytokinin hydroxylase-like              517   7e-178   
gb|KDO59002.1|  hypothetical protein CISIN_1g010083mg                   516   2e-177   
ref|XP_007216102.1|  hypothetical protein PRUPE_ppa018639mg             516   2e-177   
ref|XP_006482258.1|  PREDICTED: cytokinin hydroxylase-like              515   2e-177   
ref|NP_001266167.1|  cytokinin hydroxylase-like                         515   4e-177   
ref|XP_008341882.1|  PREDICTED: cytokinin hydroxylase-like              514   9e-177   
ref|NP_001266171.1|  cytokinin hydroxylase-like                         513   1e-176   
ref|XP_009789072.1|  PREDICTED: cytokinin hydroxylase-like isofor...    513   2e-176   
ref|XP_006383461.1|  hypothetical protein POPTR_0005s15710g             505   2e-175   
ref|XP_010061875.1|  PREDICTED: cytokinin hydroxylase-like              510   3e-175   
emb|CDP21560.1|  unnamed protein product                                510   4e-175   
ref|XP_007033282.1|  Cytochrome P450, family 735, subfamily A, po...    507   3e-174   
ref|XP_010066873.1|  PREDICTED: cytokinin hydroxylase-like              507   6e-174   
ref|XP_004304133.1|  PREDICTED: cytokinin hydroxylase-like              506   2e-173   
ref|XP_011021238.1|  PREDICTED: cytokinin hydroxylase                   504   5e-173   
ref|XP_006383462.1|  cytochrome P450 family protein                     504   6e-173   
ref|XP_010265149.1|  PREDICTED: cytokinin hydroxylase-like              504   7e-173   
ref|XP_002305160.1|  cytochrome P450 family protein                     500   3e-171   Populus trichocarpa [western balsam poplar]
ref|XP_004489114.1|  PREDICTED: cytokinin hydroxylase-like              499   7e-171   
gb|KEH21516.1|  cytochrome P450 family protein                          497   1e-170   
ref|XP_010064771.1|  PREDICTED: cytokinin hydroxylase-like              497   5e-170   
ref|XP_007139151.1|  hypothetical protein PHAVU_008G005600g             496   1e-169   
ref|XP_011035058.1|  PREDICTED: cytokinin hydroxylase                   494   4e-169   
ref|XP_002280205.1|  PREDICTED: cytokinin hydroxylase                   494   8e-169   Vitis vinifera
ref|XP_010103790.1|  Cytokinin hydroxylase                              491   2e-168   
ref|XP_008459472.1|  PREDICTED: cytokinin hydroxylase-like              488   1e-166   
ref|XP_008461587.1|  PREDICTED: cytokinin hydroxylase-like              488   1e-166   
ref|XP_004156127.1|  PREDICTED: cytokinin hydroxylase-like              486   9e-166   
ref|XP_004145660.1|  PREDICTED: cytokinin hydroxylase-like              486   1e-165   
gb|KHN24938.1|  Cytokinin hydroxylase                                   483   4e-165   
ref|XP_010032635.1|  PREDICTED: cytokinin hydroxylase-like              484   5e-165   
ref|XP_003532338.1|  PREDICTED: cytokinin hydroxylase-like              484   7e-165   
ref|XP_004141504.1|  PREDICTED: cytokinin hydroxylase-like              484   2e-164   
ref|XP_004163729.1|  PREDICTED: cytokinin hydroxylase-like              484   2e-164   
ref|XP_003541283.1|  PREDICTED: cytokinin hydroxylase-like              482   3e-164   
ref|XP_003552729.2|  PREDICTED: cytokinin hydroxylase-like              479   3e-163   
emb|CAN79415.1|  hypothetical protein VITISV_009963                     479   5e-163   Vitis vinifera
ref|XP_010528474.1|  PREDICTED: cytokinin hydroxylase                   469   4e-159   
ref|XP_010693131.1|  PREDICTED: cytokinin hydroxylase                   468   8e-159   
gb|KEH25339.1|  cytochrome P450 family 709 protein                      467   2e-158   
ref|XP_010263673.1|  PREDICTED: cytokinin hydroxylase-like              465   2e-157   
ref|XP_007151648.1|  hypothetical protein PHAVU_004G0646000g            457   9e-156   
ref|XP_004516675.1|  PREDICTED: cytokinin hydroxylase-like              455   1e-153   
ref|XP_009410074.1|  PREDICTED: cytokinin hydroxylase-like              452   1e-152   
ref|XP_008801159.1|  PREDICTED: cytokinin hydroxylase-like              449   3e-151   
ref|XP_009391406.1|  PREDICTED: cytokinin hydroxylase-like              444   3e-149   
ref|XP_006405768.1|  hypothetical protein EUTSA_v10027726mg             441   3e-148   
ref|XP_002888577.1|  CYP735A2                                           437   2e-146   
gb|KFK33247.1|  hypothetical protein AALP_AA6G349900                    435   2e-146   
ref|XP_009139787.1|  PREDICTED: cytokinin hydroxylase                   435   8e-146   
ref|NP_176882.1|  cytokinin hydroxylase                                 434   2e-145   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01664.1|  BnaC04g30880D                                          434   2e-145   
gb|KFK41112.1|  hypothetical protein AALP_AA2G087500                    432   2e-145   
ref|XP_010511627.1|  PREDICTED: cytokinin hydroxylase                   433   4e-145   
ref|XP_010435747.1|  PREDICTED: cytokinin hydroxylase                   433   4e-145   
ref|XP_006300450.1|  hypothetical protein CARUB_v10020158mg             433   5e-145   
emb|CDX74524.1|  BnaA04g08650D                                          431   6e-145   
ref|XP_006285498.1|  hypothetical protein CARUB_v10006940mg             433   6e-145   
emb|CDY42343.1|  BnaC02g17200D                                          433   8e-145   
ref|XP_006391474.1|  hypothetical protein EUTSA_v10018406mg             432   9e-145   
ref|XP_010470607.1|  PREDICTED: cytokinin hydroxylase-like isofor...    432   1e-144   
ref|XP_010470606.1|  PREDICTED: cytokinin hydroxylase-like isofor...    432   1e-144   
ref|XP_002868774.1|  CYP735A1                                           432   1e-144   
ref|XP_010450909.1|  PREDICTED: cytokinin hydroxylase-like              432   2e-144   
emb|CDY12618.1|  BnaA02g12860D                                          431   4e-144   
ref|XP_009127524.1|  PREDICTED: cytokinin hydroxylase                   427   1e-142   
ref|XP_010910276.1|  PREDICTED: cytokinin hydroxylase-like isofor...    427   1e-142   
ref|NP_198661.1|  cytochrome P450, family 735, subfamily A, polyp...    424   1e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415267.1|  PREDICTED: cytokinin hydroxylase-like isofor...    423   1e-141   
ref|XP_010415263.1|  PREDICTED: cytokinin hydroxylase-like isofor...    423   4e-141   
ref|XP_010910275.1|  PREDICTED: cytokinin hydroxylase-like isofor...    421   4e-140   
ref|XP_010553918.1|  PREDICTED: cytokinin hydroxylase                   409   1e-135   
ref|NP_001175823.1|  Os09g0403300                                       392   7e-129   
ref|XP_002445526.1|  hypothetical protein SORBIDRAFT_07g020940          382   4e-125   Sorghum bicolor [broomcorn]
dbj|BAK00632.1|  predicted protein                                      379   6e-124   
ref|XP_004973486.1|  PREDICTED: cytokinin hydroxylase-like              378   2e-123   
ref|NP_001146669.1|  putative cytochrome P450 superfamily protein       370   1e-121   Zea mays [maize]
gb|EAZ09049.1|  hypothetical protein OsI_31310                          373   2e-121   Oryza sativa Indica Group [Indian rice]
dbj|BAC24945.1|  putative cytochrome P450 monooxygenase                 363   1e-117   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ07069.1|  hypothetical protein OsI_29315                          363   2e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_003572218.1|  PREDICTED: cytokinin hydroxylase-like              359   6e-116   
ref|NP_001183425.1|  putative cytochrome P450 superfamily protein       358   8e-116   
ref|XP_002462357.1|  hypothetical protein SORBIDRAFT_02g024330          355   2e-114   Sorghum bicolor [broomcorn]
ref|XP_003578093.1|  PREDICTED: cytokinin hydroxylase-like              353   8e-114   
gb|EEE69674.1|  hypothetical protein OsJ_29302                          350   2e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956775.1|  PREDICTED: cytokinin hydroxylase-like              347   5e-111   
gb|EPS57598.1|  hypothetical protein M569_17219                         335   2e-110   
ref|XP_008671701.1|  PREDICTED: cytokinin hydroxylase-like              338   2e-106   
ref|XP_002992582.1|  hypothetical protein SELMODRAFT_186869             300   6e-93    
gb|ACN39923.1|  unknown                                                 297   1e-92    Picea sitchensis
gb|ABR16167.1|  unknown                                                 296   9e-92    Picea sitchensis
ref|XP_002972525.1|  hypothetical protein SELMODRAFT_97810              294   7e-91    
gb|KHG14489.1|  Secologanin synthase                                    293   2e-90    
ref|XP_002988271.1|  hypothetical protein SELMODRAFT_183651             290   3e-89    
ref|XP_002967823.1|  hypothetical protein SELMODRAFT_88220              289   7e-89    
ref|XP_002981694.1|  hypothetical protein SELMODRAFT_115032             289   8e-89    
emb|CBI39923.3|  unnamed protein product                                284   8e-88    
dbj|BAF98466.1|  cytochrome P450                                        285   2e-87    Coptis japonica var. dissecta
gb|ABR16379.1|  unknown                                                 284   4e-87    Picea sitchensis
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               284   5e-87    Vitis vinifera
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          284   6e-87    
ref|XP_008778644.1|  PREDICTED: cytochrome P450 734A6-like isofor...    283   6e-87    
ref|XP_008778643.1|  PREDICTED: cytochrome P450 734A6-like isofor...    283   6e-87    
ref|XP_010644760.1|  PREDICTED: cytochrome P450 CYP72A219-like          280   6e-87    
gb|AFK44453.1|  unknown                                                 276   7e-87    
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               283   8e-87    Vitis vinifera
emb|CBI39937.3|  unnamed protein product                                281   1e-86    
ref|XP_007211745.1|  hypothetical protein PRUPE_ppa006307mg             280   1e-86    
emb|CBI39917.3|  unnamed protein product                                281   1e-86    
gb|ABC69393.1|  CYP72A55v2                                              283   2e-86    Nicotiana tabacum [American tobacco]
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              282   2e-86    
gb|ABC69392.1|  CYP72A55v1                                              282   2e-86    Nicotiana tabacum [American tobacco]
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               282   2e-86    Vitis vinifera
emb|CBI39929.3|  unnamed protein product                                280   5e-86    
gb|ABK25130.1|  unknown                                                 281   7e-86    Picea sitchensis
emb|CBI39886.3|  unnamed protein product                                281   8e-86    
emb|CAN67740.1|  hypothetical protein VITISV_015554                     281   8e-86    Vitis vinifera
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          281   9e-86    Vitis vinifera
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               280   1e-85    Vitis vinifera
ref|XP_002992583.1|  hypothetical protein SELMODRAFT_135558             280   1e-85    
gb|EAZ42814.1|  hypothetical protein OsJ_27399                          280   1e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006830577.1|  hypothetical protein AMTR_s00117p00134960          280   2e-85    
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          280   2e-85    
ref|XP_008805359.1|  PREDICTED: cytochrome P450 734A6-like              280   2e-85    
gb|KEH38477.1|  cytochrome P450 family 72 protein                       274   3e-85    
ref|XP_002963468.1|  hypothetical protein SELMODRAFT_80290              279   3e-85    
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          279   4e-85    Vitis vinifera
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    279   4e-85    
ref|XP_008775781.1|  PREDICTED: cytochrome P450 734A6-like              276   5e-85    
ref|XP_010090129.1|  Secologanin synthase                               276   6e-85    
ref|XP_008776849.1|  PREDICTED: cytochrome P450 734A6-like              278   7e-85    
ref|XP_008806616.1|  PREDICTED: cytochrome P450 734A6-like              278   7e-85    
ref|XP_002526971.1|  cytochrome P450, putative                          275   1e-84    Ricinus communis
ref|XP_002988180.1|  hypothetical protein SELMODRAFT_127819             278   1e-84    
gb|KDP28356.1|  hypothetical protein JCGZ_14127                         278   1e-84    
ref|XP_010909557.1|  PREDICTED: cytochrome P450 734A6-like              277   1e-84    
emb|CDX97592.1|  BnaA05g24870D                                          277   1e-84    
emb|CBI39912.3|  unnamed protein product                                275   2e-84    
gb|KEH43175.1|  cytochrome P450 family 709 protein                      277   2e-84    
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like          277   2e-84    
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              277   2e-84    
emb|CBI39938.3|  unnamed protein product                                275   2e-84    
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    277   2e-84    
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          277   2e-84    
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    277   3e-84    
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    276   3e-84    
dbj|BAJ95825.1|  predicted protein                                      276   4e-84    
gb|KDP28354.1|  hypothetical protein JCGZ_14125                         276   4e-84    
ref|XP_002968296.1|  hypothetical protein SELMODRAFT_231182             275   4e-84    
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               276   4e-84    
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               276   5e-84    
ref|XP_010644766.1|  PREDICTED: cytochrome P450 CYP72A219-like          274   6e-84    
ref|XP_006377690.1|  cytochrome P450 family protein                     271   6e-84    
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    276   7e-84    
ref|XP_002976081.1|  hypothetical protein SELMODRAFT_416039             276   8e-84    
ref|XP_006477950.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    272   9e-84    
ref|XP_002992584.1|  hypothetical protein SELMODRAFT_448822             275   9e-84    
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   275   1e-83    
ref|XP_004301212.1|  PREDICTED: secologanin synthase-like               275   1e-83    
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          275   1e-83    
ref|XP_004495852.1|  PREDICTED: cytochrome P450 734A1-like              275   1e-83    
ref|XP_006840143.1|  hypothetical protein AMTR_s00089p00051730          272   1e-83    
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          275   1e-83    
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          275   2e-83    
gb|KHN47456.1|  Secologanin synthase                                    275   2e-83    
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      275   2e-83    
gb|KHN36820.1|  Secologanin synthase                                    274   2e-83    
ref|XP_010943694.1|  PREDICTED: cytochrome P450 734A6-like              275   2e-83    
ref|XP_002516294.1|  cytochrome P450, putative                          273   2e-83    Ricinus communis
gb|KEH38476.1|  cytochrome P450 family 72 protein                       273   2e-83    
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               274   3e-83    
gb|EMT31416.1|  Secologanin synthase                                    272   3e-83    
gb|KEH21517.1|  cytochrome P450 family protein                          270   3e-83    
gb|AAL66766.1|  cytochrome P450 monooxygenase CYP72A5                   268   3e-83    Zea mays [maize]
dbj|BAJ97266.1|  predicted protein                                      273   4e-83    
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              273   4e-83    
ref|XP_006830579.1|  hypothetical protein AMTR_s00117p00135700          273   4e-83    
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          273   5e-83    
ref|XP_002961570.1|  hypothetical protein SELMODRAFT_266618             273   5e-83    
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    273   5e-83    
ref|XP_002971244.1|  hypothetical protein SELMODRAFT_94751              273   5e-83    
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          273   5e-83    
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  273   5e-83    Medicago truncatula
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    273   6e-83    
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              273   6e-83    
gb|KEH38472.1|  cytochrome P450 family protein                          268   6e-83    
emb|CDX75785.1|  BnaC03g38680D                                          269   6e-83    
emb|CDY28093.1|  BnaC06g02740D                                          273   6e-83    
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    273   7e-83    
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              274   7e-83    
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          273   8e-83    
ref|XP_002515162.1|  cytochrome P450, putative                          272   8e-83    Ricinus communis
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              273   1e-82    
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          273   1e-82    
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    273   1e-82    
ref|XP_007204041.1|  hypothetical protein PRUPE_ppa021108mg             272   1e-82    
ref|XP_006407057.1|  hypothetical protein EUTSA_v10020855mg             269   1e-82    
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   272   1e-82    
emb|CDP15982.1|  unnamed protein product                                273   1e-82    
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      273   1e-82    
ref|XP_002970897.1|  hypothetical protein SELMODRAFT_94367              272   1e-82    
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    272   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          272   1e-82    Vitis vinifera
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          272   1e-82    
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               272   1e-82    Vitis vinifera
ref|XP_002972526.1|  hypothetical protein SELMODRAFT_441830             272   2e-82    
ref|XP_002969411.1|  hypothetical protein SELMODRAFT_410461             272   2e-82    
ref|XP_009146340.1|  PREDICTED: cytochrome P450 72A13                   273   2e-82    
gb|AAR11387.1|  cytochrome P450                                         272   2e-82    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              272   2e-82    
emb|CDP04590.1|  unnamed protein product                                271   2e-82    
emb|CDX97588.1|  BnaA05g24910D                                          271   2e-82    
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      272   2e-82    
ref|XP_010323670.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X2    269   2e-82    
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    272   2e-82    
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    272   2e-82    
tpg|DAA58485.1|  TPA: putative cytochrome P450 superfamily protein      267   2e-82    
emb|CBI22134.3|  unnamed protein product                                272   3e-82    
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    272   3e-82    
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              271   3e-82    
ref|XP_002969404.1|  hypothetical protein SELMODRAFT_410445             270   3e-82    
emb|CDY51036.1|  BnaA06g02990D                                          271   3e-82    
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              271   3e-82    
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              271   3e-82    
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             271   3e-82    
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              271   3e-82    
gb|EMT23743.1|  Secologanin synthase                                    271   4e-82    
ref|XP_002882888.1|  CYP72A15                                           271   5e-82    
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              271   5e-82    
ref|XP_006377681.1|  cytochrome P450 family protein                     268   5e-82    
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             271   5e-82    
emb|CDP15978.1|  unnamed protein product                                271   5e-82    
ref|XP_002972325.1|  hypothetical protein SELMODRAFT_172829             270   5e-82    
ref|XP_006348402.1|  PREDICTED: secologanin synthase-like               269   6e-82    
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    270   6e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              271   6e-82    
emb|CDX98486.1|  BnaC05g38890D                                          270   6e-82    
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              270   7e-82    
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               271   7e-82    
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              271   8e-82    
ref|XP_009404407.1|  PREDICTED: cytochrome P450 CYP72A219-like          270   9e-82    
ref|XP_004294187.1|  PREDICTED: secologanin synthase-like               270   9e-82    
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein          270   1e-81    
gb|EMT31417.1|  Secologanin synthase                                    270   1e-81    
gb|KEH38478.1|  cytochrome P450 family 72 protein                       270   1e-81    
ref|XP_008778221.1|  PREDICTED: cytochrome P450 72A15-like              270   1e-81    
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          270   1e-81    
ref|XP_006658008.1|  PREDICTED: cytochrome P450 734A6-like              270   1e-81    
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        270   1e-81    
emb|CAN72865.1|  hypothetical protein VITISV_029731                     269   2e-81    Vitis vinifera
ref|XP_007149356.1|  hypothetical protein PHAVU_005G063500g             265   2e-81    
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             269   2e-81    
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        270   2e-81    
ref|XP_010092744.1|  Secologanin synthase                               270   2e-81    
ref|XP_004287619.1|  PREDICTED: secologanin synthase-like               268   2e-81    
emb|CDP11335.1|  unnamed protein product                                270   2e-81    
ref|XP_010926847.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    266   2e-81    
emb|CDP19599.1|  unnamed protein product                                269   2e-81    
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          269   2e-81    
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          270   2e-81    
gb|KHN14193.1|  Secologanin synthase                                    269   2e-81    
gb|EEE67038.1|  hypothetical protein OsJ_23978                          268   2e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    270   2e-81    
dbj|BAO73900.1|  cytochrome P450                                        264   3e-81    
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein          269   3e-81    
gb|KEH38475.1|  cytochrome P450 family 72 protein                       269   3e-81    
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          269   3e-81    
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              269   3e-81    
gb|KFK36905.1|  hypothetical protein AALP_AA4G188200                    268   4e-81    
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          268   4e-81    
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               268   4e-81    
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          269   4e-81    
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          269   4e-81    
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             268   4e-81    
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like          268   4e-81    
ref|NP_001059471.1|  Os07g0418500                                       268   4e-81    
ref|XP_010487265.1|  PREDICTED: cytochrome P450 72A13-like              267   4e-81    
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein          268   4e-81    
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             268   5e-81    
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              268   5e-81    
ref|XP_010487263.1|  PREDICTED: cytochrome P450 72A13-like              265   5e-81    
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              268   5e-81    
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              268   6e-81    
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    268   6e-81    
ref|XP_010248211.1|  PREDICTED: cytochrome P450 CYP72A219-like          265   7e-81    
gb|KGN52582.1|  hypothetical protein Csa_5G644580                       265   7e-81    
emb|CDP14360.1|  unnamed protein product                                265   7e-81    
emb|CDX82471.1|  BnaA03g33500D                                          268   7e-81    
ref|XP_006382610.1|  hypothetical protein POPTR_0005s03740g             267   7e-81    
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               268   8e-81    
emb|CDM83378.1|  unnamed protein product                                268   8e-81    
emb|CDX97593.1|  BnaA05g24860D                                          268   8e-81    
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    267   9e-81    
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              267   9e-81    
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          267   1e-80    
ref|XP_003562608.1|  PREDICTED: cytochrome P450 734A6-like              267   1e-80    
ref|XP_010064521.1|  PREDICTED: cytochrome P450 72A14-like              264   1e-80    
gb|EAZ04830.1|  hypothetical protein OsI_27008                          267   1e-80    
ref|XP_006841892.1|  hypothetical protein AMTR_s00042p00080860          267   1e-80    
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          268   1e-80    
dbj|BAO73901.1|  cytochrome P450                                        262   1e-80    
ref|XP_007133275.1|  hypothetical protein PHAVU_011G166000g             261   1e-80    
ref|XP_002458200.1|  hypothetical protein SORBIDRAFT_03g028610          267   1e-80    
ref|XP_009381346.1|  PREDICTED: cytochrome P450 714C2-like              267   2e-80    
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    266   2e-80    
emb|CDX98485.1|  BnaC05g38900D                                          266   2e-80    
ref|XP_010092742.1|  Secologanin synthase                               266   2e-80    
emb|CDY70619.1|  BnaCnng69060D                                          262   2e-80    
gb|EAZ12776.1|  hypothetical protein OsJ_02693                          267   2e-80    
dbj|BAB02395.1|  cytochrome P450-like protein                           266   2e-80    
ref|XP_009391532.1|  PREDICTED: cytochrome P450 734A6-like isofor...    266   3e-80    
ref|XP_009391533.1|  PREDICTED: cytochrome P450 734A6-like isofor...    266   3e-80    
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    266   3e-80    
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    266   3e-80    
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          266   3e-80    
ref|XP_006348902.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    264   3e-80    
gb|EMT23021.1|  Secologanin synthase                                    266   3e-80    
dbj|BAJ95191.1|  predicted protein                                      266   3e-80    
emb|CDX97591.1|  BnaA05g24880D                                          266   3e-80    
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              266   3e-80    
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          266   4e-80    
ref|XP_010273926.1|  PREDICTED: cytochrome P450 72A15-like              266   4e-80    
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    266   4e-80    
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like               266   4e-80    
ref|XP_011036766.1|  PREDICTED: cytochrome P450 734A1-like              265   4e-80    
ref|NP_001168492.1|  putative cytochrome P450 superfamily protein       265   4e-80    
ref|XP_006407061.1|  hypothetical protein EUTSA_v10020533mg             266   4e-80    
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          266   4e-80    
dbj|BAJ89369.1|  predicted protein                                      266   5e-80    
ref|NP_001140686.1|  putative cytochrome P450 superfamily protein       266   5e-80    
ref|XP_002970892.1|  hypothetical protein SELMODRAFT_94002              265   5e-80    
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    266   5e-80    
ref|NP_188081.1|  cytochrome P450, family 72, subfamily A, polype...    265   5e-80    
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    266   5e-80    
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase             266   5e-80    
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      266   5e-80    
ref|NP_001050201.1|  Os03g0370900                                       265   6e-80    
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              265   6e-80    
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              265   6e-80    
gb|EMT29386.1|  Secologanin synthase                                    265   6e-80    
emb|CDY51038.1|  BnaA06g03010D                                          265   6e-80    
gb|KHG20903.1|  Secologanin synthase                                    259   6e-80    
ref|NP_001060386.1|  Os07g0635500                                       265   6e-80    
emb|CDY66253.1|  BnaC04g52050D                                          265   6e-80    
emb|CDP19600.1|  unnamed protein product                                265   6e-80    
emb|CDP15976.1|  unnamed protein product                                266   6e-80    
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              265   6e-80    
tpg|DAA58480.1|  TPA: putative cytochrome P450 superfamily protein      261   6e-80    
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    265   7e-80    
ref|XP_007149357.1|  hypothetical protein PHAVU_005G063500g             265   7e-80    
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    265   7e-80    
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    265   7e-80    
gb|KDP35176.1|  hypothetical protein JCGZ_10710                         263   7e-80    
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    266   8e-80    
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein          265   8e-80    
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               265   8e-80    
ref|XP_010533036.1|  PREDICTED: cytochrome P450 72A15-like isofor...    265   9e-80    
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             265   9e-80    
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    265   9e-80    
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          265   9e-80    
gb|EMT26606.1|  Secologanin synthase                                    265   1e-79    
emb|CDP19601.1|  unnamed protein product                                265   1e-79    
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               264   1e-79    
gb|AAT68297.1|  cytochrome P450 CYP709C1                                265   1e-79    
ref|XP_002455992.1|  hypothetical protein SORBIDRAFT_03g028630          265   1e-79    
ref|NP_001043638.1|  Os01g0628900                                       265   1e-79    
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          264   1e-79    
ref|XP_007051323.1|  Cytochrome P450, family 709, subfamily B, po...    262   1e-79    
ref|XP_008673122.1|  PREDICTED: putative cytochrome P450 superfam...    265   2e-79    
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    264   2e-79    
emb|CDX82468.1|  BnaA03g33530D                                          265   2e-79    
ref|XP_003562610.1|  PREDICTED: cytochrome P450 734A6-like              264   2e-79    
gb|AAM77716.1|AF465265_1  cytochrome P450 monooxygenase CYP72A16        265   2e-79    
dbj|BAO73902.1|  cytochrome P450                                        261   2e-79    
ref|NP_001132612.1|  putative cytochrome P450 superfamily protein       260   2e-79    
emb|CDX98484.1|  BnaC05g38910D                                          264   2e-79    
gb|EMS67588.1|  Secologanin synthase                                    264   2e-79    
gb|ACG45585.1|  cytochrome P450 CYP734A8                                264   2e-79    
ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          264   2e-79    
gb|EMS66485.1|  Secologanin synthase                                    270   2e-79    
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              264   2e-79    
ref|XP_006377676.1|  hypothetical protein POPTR_0011s10150g             263   2e-79    
emb|CDP15988.1|  unnamed protein product                                264   2e-79    
dbj|BAO73906.1|  cytochrome P450                                        259   2e-79    
ref|XP_006397886.1|  hypothetical protein EUTSA_v10001402mg             264   2e-79    
ref|XP_010533035.1|  PREDICTED: cytochrome P450 72A15-like isofor...    265   2e-79    
gb|EEC71130.1|  hypothetical protein OsI_02943                          264   2e-79    
ref|XP_009596805.1|  PREDICTED: cytochrome P450 72A15-like              264   2e-79    
gb|ACR38392.1|  unknown                                                 260   2e-79    
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    264   2e-79    
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              264   2e-79    
ref|XP_002990520.1|  hypothetical protein SELMODRAFT_131811             264   2e-79    
ref|XP_004297211.1|  PREDICTED: cytochrome P450 734A1-like              264   2e-79    
ref|XP_008656135.1|  PREDICTED: cytochrome P450 734A6-like isofor...    261   3e-79    
ref|XP_010502025.1|  PREDICTED: cytochrome P450 72A13-like isofor...    261   3e-79    
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          264   3e-79    
gb|EAY75044.1|  hypothetical protein OsI_02940                          267   3e-79    
gb|ABC69417.1|  CYP72A54                                                264   3e-79    
ref|XP_006341671.1|  PREDICTED: cytochrome P450 734A1-like              264   3e-79    
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like               263   3e-79    
gb|EEC77611.1|  hypothetical protein OsI_16590                          258   3e-79    
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    264   3e-79    
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          263   3e-79    
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          264   3e-79    
ref|XP_002983738.1|  hypothetical protein SELMODRAFT_119072             263   4e-79    
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    263   4e-79    
ref|XP_007212563.1|  hypothetical protein PRUPE_ppa015526mg             263   4e-79    
ref|XP_004295683.1|  PREDICTED: secologanin synthase-like               263   4e-79    
ref|NP_001233940.1|  castasterone 26-hydroxylase                        263   4e-79    
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          263   4e-79    
ref|XP_002975934.1|  hypothetical protein SELMODRAFT_104195             263   4e-79    
ref|XP_009388193.1|  PREDICTED: cytochrome P450 734A6-like              263   5e-79    
dbj|BAN19913.1|  cytochrome P450                                        263   5e-79    
ref|XP_008660196.1|  PREDICTED: uncharacterized protein LOC100194...    260   5e-79    
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          263   5e-79    
gb|KFK38820.1|  hypothetical protein AALP_AA3G164700                    261   5e-79    
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              263   5e-79    
emb|CDX80062.1|  BnaA05g00940D                                          263   6e-79    
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          263   6e-79    
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          263   6e-79    
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             263   6e-79    
emb|CDP15975.1|  unnamed protein product                                263   7e-79    
ref|XP_006473472.1|  PREDICTED: cytochrome P450 734A1-like              262   7e-79    
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          263   7e-79    
ref|XP_007224470.1|  hypothetical protein PRUPE_ppa022621mg             262   7e-79    
dbj|BAO73903.1|  cytochrome P450                                        259   7e-79    
ref|XP_009383021.1|  PREDICTED: cytochrome P450 734A6-like              262   7e-79    
ref|XP_002461089.1|  hypothetical protein SORBIDRAFT_02g040510          262   7e-79    
ref|XP_006646126.1|  PREDICTED: secologanin synthase-like               263   8e-79    
ref|XP_008226214.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    263   8e-79    
ref|XP_002463247.1|  hypothetical protein SORBIDRAFT_02g040500          262   8e-79    
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like          262   8e-79    
gb|EEE63491.1|  hypothetical protein OsJ_18307                          263   9e-79    
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              262   9e-79    
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    262   1e-78    
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             262   1e-78    
ref|XP_007010212.1|  Cytochrome P450 isoform 2                          257   1e-78    
dbj|BAP90521.1|  secologanin synthase                                   262   1e-78    
ref|XP_009391534.1|  PREDICTED: cytochrome P450 734A6-like isofor...    262   1e-78    
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          262   1e-78    
ref|XP_003592277.1|  Cytochrome P450                                    262   1e-78    
ref|NP_001043634.1|  Os01g0627800                                       262   1e-78    
gb|AAZ07706.1|  cytochrome P450 monooxygenase                           262   1e-78    
ref|NP_001170729.1|  uncharacterized protein LOC100384816 precursor     262   1e-78    
ref|XP_006434955.1|  hypothetical protein CICLE_v10000905mg             262   1e-78    
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    262   1e-78    
dbj|BAN19927.1|  cytochrome P450                                        262   1e-78    
ref|XP_007051322.1|  Cytochrome P450, family 709, subfamily B, po...    262   1e-78    
gb|ACN25366.1|  unknown                                                 256   1e-78    
ref|XP_009594692.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    258   2e-78    
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     261   2e-78    
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   2e-78    
ref|XP_004968390.1|  PREDICTED: cytochrome P450 734A6-like isofor...    258   2e-78    
ref|NP_001055361.1|  Os05g0372300                                       261   2e-78    
ref|XP_004958442.1|  PREDICTED: cytochrome P450 734A6-like              261   2e-78    
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   2e-78    
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg                261   2e-78    
gb|ABC69419.1|  CYP72A56                                                261   2e-78    
ref|XP_003569401.1|  PREDICTED: cytochrome P450 72A13-like              262   2e-78    
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   2e-78    
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    261   2e-78    
ref|XP_010535014.1|  PREDICTED: cytochrome P450 72A13-like              261   2e-78    
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219               261   2e-78    
ref|XP_010046258.1|  PREDICTED: cytochrome P450 CYP749A22-like          257   2e-78    
ref|XP_009615909.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    259   2e-78    
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   2e-78    
ref|XP_002461088.1|  hypothetical protein SORBIDRAFT_02g040490          261   2e-78    
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               261   3e-78    
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              261   3e-78    
emb|CDY32349.1|  BnaC01g36680D                                          261   3e-78    
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   3e-78    
ref|XP_010916789.1|  PREDICTED: cytochrome P450 CYP72A219-like          258   3e-78    
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          261   3e-78    
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   3e-78    
emb|CDP15981.1|  unnamed protein product                                261   3e-78    
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   3e-78    
ref|XP_004135429.1|  PREDICTED: cytochrome P450 734A1-like              261   3e-78    
gb|KDP41345.1|  hypothetical protein JCGZ_15752                         258   3e-78    
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   3e-78    
emb|CBI27824.3|  unnamed protein product                                259   3e-78    
ref|XP_004295684.1|  PREDICTED: secologanin synthase-like               261   3e-78    
gb|KCW67647.1|  hypothetical protein EUGRSUZ_F01394                     258   3e-78    
ref|XP_002455092.1|  hypothetical protein SORBIDRAFT_03g004210          261   4e-78    
ref|XP_003557757.2|  PREDICTED: cytochrome P450 72A14-like              261   4e-78    
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    260   4e-78    
ref|XP_003566917.1|  PREDICTED: cytochrome P450 72A15-like              261   4e-78    
ref|XP_008776865.1|  PREDICTED: cytochrome P450 72A15-like isofor...    258   4e-78    



>ref|XP_006363118.1| PREDICTED: cytokinin hydroxylase-like isoform X2 [Solanum tuberosum]
Length=507

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/311 (77%), Positives = 283/311 (91%), Gaps = 1/311 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             A+IISRTEF SSYEKGK+IF LLT+LQ+ C+Q++RHLC+PG+RF+PSKYN +IKTL +E
Sbjct  196  TAEIISRTEFDSSYEKGKQIFHLLTILQKKCAQASRHLCFPGSRFFPSKYNRDIKTLKME  255

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ+ K +SNGF LNL LIMDECKTF
Sbjct  256  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQK-KRSSNGFSLNLQLIMDECKTF  314

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQ+KVREE+ QVC GD P+++ L KLTLLS +INE+
Sbjct  315  FFAGHETTALLLTWTVMLLASNPSWQDKVREEINQVCKGDSPTVDHLPKLTLLSMIINES  374

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFEDFKLGDL+IPKGL+IWIPVLAIHHSEEIWGKD NEF+P+RF S+
Sbjct  375  LRLYPPATVLPRMAFEDFKLGDLNIPKGLSIWIPVLAIHHSEEIWGKDANEFRPDRFASK  434

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             ++ GR FLPFAAGPRNCVGQS+ALMEAKI+LAMLIS+F F IS+NYRHAPV+V+++KPK
Sbjct  435  PFTAGRNFLPFAAGPRNCVGQSFALMEAKIILAMLISKFRFTISENYRHAPVIVLTIKPK  494

Query  901  YGVQIRLNPLI  933
            YGVQ++L PLI
Sbjct  495  YGVQVKLTPLI  505



>ref|XP_009607763.1| PREDICTED: cytokinin hydroxylase-like [Nicotiana tomentosiformis]
Length=515

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/310 (78%), Positives = 281/310 (91%), Gaps = 1/310 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLT+LQ LC+Q++RHLC+PG+RF PSKYN +IK L +E
Sbjct  205  TADIISRTEFDSSYEKGKQIFHLLTLLQNLCAQASRHLCFPGSRFLPSKYNRDIKALKME  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ+ K +SNGF LNL LIMDECKTF
Sbjct  265  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQK-KRSSNGFSLNLQLIMDECKTF  323

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWT MLLA+N SWQ+KVR+EV QVC GDPP++E L KLTLL+ VINE+
Sbjct  324  FFAGHETTALLLTWTSMLLASNSSWQDKVRDEVNQVCKGDPPTVEHLPKLTLLNMVINES  383

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP ++LPRMAFEDFKLGDLHIPKGL+IWIPVLAIHHSEEIWGKDVNEF+P+RF S+
Sbjct  384  LRLYPPASVLPRMAFEDFKLGDLHIPKGLSIWIPVLAIHHSEEIWGKDVNEFRPDRFASK  443

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++ GR FLPFAAGPRNCVGQS+ALMEAKI+LAMLIS+F F IS+NYRHAPV+V+++KPK
Sbjct  444  SFAAGRNFLPFAAGPRNCVGQSFALMEAKIILAMLISKFRFTISENYRHAPVIVLTIKPK  503

Query  901  YGVQIRLNPL  930
            YGVQI+L PL
Sbjct  504  YGVQIKLTPL  513



>ref|XP_006363117.1| PREDICTED: cytokinin hydroxylase-like isoform X1 [Solanum tuberosum]
Length=517

 Score =   523 bits (1346),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 240/311 (77%), Positives = 283/311 (91%), Gaps = 1/311 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             A+IISRTEF SSYEKGK+IF LLT+LQ+ C+Q++RHLC+PG+RF+PSKYN +IKTL +E
Sbjct  206  TAEIISRTEFDSSYEKGKQIFHLLTILQKKCAQASRHLCFPGSRFFPSKYNRDIKTLKME  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ+ K +SNGF LNL LIMDECKTF
Sbjct  266  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQK-KRSSNGFSLNLQLIMDECKTF  324

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQ+KVREE+ QVC GD P+++ L KLTLLS +INE+
Sbjct  325  FFAGHETTALLLTWTVMLLASNPSWQDKVREEINQVCKGDSPTVDHLPKLTLLSMIINES  384

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFEDFKLGDL+IPKGL+IWIPVLAIHHSEEIWGKD NEF+P+RF S+
Sbjct  385  LRLYPPATVLPRMAFEDFKLGDLNIPKGLSIWIPVLAIHHSEEIWGKDANEFRPDRFASK  444

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             ++ GR FLPFAAGPRNCVGQS+ALMEAKI+LAMLIS+F F IS+NYRHAPV+V+++KPK
Sbjct  445  PFTAGRNFLPFAAGPRNCVGQSFALMEAKIILAMLISKFRFTISENYRHAPVIVLTIKPK  504

Query  901  YGVQIRLNPLI  933
            YGVQ++L PLI
Sbjct  505  YGVQVKLTPLI  515



>gb|KDP32947.1| hypothetical protein JCGZ_12978 [Jatropha curcas]
Length=479

 Score =   519 bits (1337),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 279/310 (90%), Gaps = 1/310 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF  SYEKGK+IF LLTVLQRLC+Q++RHLC+PG+RF+PSKYN EIK+L +E
Sbjct  169  TADIISRTEFDCSYEKGKQIFHLLTVLQRLCAQASRHLCFPGSRFFPSKYNREIKSLKME  228

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+RLLMEIIQSRKDC EIGR S+YG+DLLG+LL EM++ +G SNGF LNL LIMDECKTF
Sbjct  229  VDRLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMEKKRG-SNGFSLNLQLIMDECKTF  287

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEKVR+EV QVCNG  PS + L KLTLL+ VINE+
Sbjct  288  FFAGHETTALLLTWTVMLLASNPSWQEKVRDEVHQVCNGQTPSTDHLPKLTLLNMVINES  347

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD NEF P+RF S+
Sbjct  348  LRLYPPATVLPRMAFEDIKLGDLLIPKGLSIWIPVLAIHHSEELWGKDANEFNPDRFASK  407

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            +++PGR F+PFAAGPRNC+GQ++A+MEAKI+LAMLISRFSF ISD YRHAPVVV+++KPK
Sbjct  408  TFAPGRHFIPFAAGPRNCIGQTFAMMEAKIILAMLISRFSFTISDTYRHAPVVVLTIKPK  467

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  468  YGVQVCLKPL  477



>ref|XP_002516723.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF45621.1| cytochrome P450, putative [Ricinus communis]
Length=515

 Score =   520 bits (1339),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 238/310 (77%), Positives = 279/310 (90%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF  SYEKGK+IF LL VLQRLC+Q++RHLC+PG+RF+PSKYN EIK+L +E
Sbjct  205  TADIISRTEFDCSYEKGKQIFHLLNVLQRLCAQASRHLCFPGSRFFPSKYNREIKSLKME  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR STYG+DLLG+LL EMQ  +   NGF LNL LIMDECKTF
Sbjct  265  VERLLMEIIQSRKDCVEIGRSSTYGNDLLGMLLNEMQSKR--ENGFSLNLQLIMDECKTF  322

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEKVR EV QVCNG+ PS++ L KLTLL+ VINE+
Sbjct  323  FFAGHETTALLLTWTVMLLASNPSWQEKVRAEVNQVCNGETPSVDHLPKLTLLNMVINES  382

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF P+RF S+
Sbjct  383  LRLYPPATVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPDRFASK  442

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            +++PGR F+PFAAGPRNC+GQ++A+MEAKI+LAMLIS+F+F+ISD+YRHAPV+V+++KPK
Sbjct  443  TFAPGRHFIPFAAGPRNCIGQTFAMMEAKIILAMLISKFNFNISDSYRHAPVIVLTIKPK  502

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  503  YGVQVCLRPL  512



>ref|XP_009789073.1| PREDICTED: cytokinin hydroxylase-like isoform X2 [Nicotiana sylvestris]
Length=515

 Score =   519 bits (1336),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 241/310 (78%), Positives = 280/310 (90%), Gaps = 1/310 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLT+LQ LC+Q++RHLC+PG+RF PSKYN +IK L +E
Sbjct  205  TADIISRTEFDSSYEKGKQIFHLLTLLQHLCAQASRHLCFPGSRFLPSKYNRDIKALKME  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ+ K +SNGF LNL LIMDECKTF
Sbjct  265  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQK-KRSSNGFSLNLQLIMDECKTF  323

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWT MLLA+NPSWQ+KVR+EV QVC  DPP++E L KLTLL+ VINE+
Sbjct  324  FFAGHETTALLLTWTSMLLASNPSWQDKVRDEVTQVCKRDPPTVEHLPKLTLLNMVINES  383

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP ++LPRMAFEDFKLGDLHIPKGL+IWIPVLAIHHSEEIWG+DVNEF+P+RF S+
Sbjct  384  LRLYPPASVLPRMAFEDFKLGDLHIPKGLSIWIPVLAIHHSEEIWGEDVNEFRPDRFASK  443

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++ GR FLPFAAGPRNCVGQS+ALMEAKI+LAMLIS+F F IS+NYRHAPV+V+++KPK
Sbjct  444  SFAAGRNFLPFAAGPRNCVGQSFALMEAKIILAMLISKFRFTISENYRHAPVIVLTIKPK  503

Query  901  YGVQIRLNPL  930
            YGVQI+L  L
Sbjct  504  YGVQIKLTTL  513



>ref|XP_008379543.1| PREDICTED: cytokinin hydroxylase-like [Malus domestica]
Length=518

 Score =   518 bits (1334),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 241/310 (78%), Positives = 278/310 (90%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLTVLQ LC+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  208  TADIISRTEFDSSYEKGKQIFRLLTVLQHLCAQASRHLCLPGSRFFPSKYNREIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ+ +GN  GF LNL LIMDECKTF
Sbjct  268  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQKKRGN--GFSLNLQLIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEKVR EV QVCNG  PS++ LSKLTLL+ VINE+
Sbjct  326  FFAGHETTALLLTWTVMLLASNPSWQEKVRAEVKQVCNGGTPSVDHLSKLTLLNRVINES  385

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF S+
Sbjct  386  LRLYPPATVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASK  445

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFA GPRNC+GQS+A+MEAKI+LAMLIS+FSF +S NYRHAPV+V+++KPK
Sbjct  446  SFTPGR-FIPFATGPRNCIGQSFAMMEAKIILAMLISQFSFTVSPNYRHAPVIVLTIKPK  504

Query  901  YGVQIRLNPL  930
            YGVQ+ L P+
Sbjct  505  YGVQVCLTPI  514



>ref|XP_009357060.1| PREDICTED: cytokinin hydroxylase-like [Pyrus x bretschneideri]
Length=518

 Score =   518 bits (1333),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 278/310 (90%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLTVLQ LC+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  208  TADIISRTEFDSSYEKGKQIFRLLTVLQHLCAQASRHLCLPGSRFFPSKYNREIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSR+DC EIGR S+YG+DLLG+LL EMQ+ +GN  GF LNL LIMDECKTF
Sbjct  268  VERLLMEIIQSRRDCVEIGRSSSYGNDLLGMLLNEMQKKRGN--GFSLNLQLIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEKVR EV QVCNG  PS++ LSKLTLL+ VINE+
Sbjct  326  FFAGHETTALLLTWTVMLLASNPSWQEKVRAEVKQVCNGGTPSVDHLSKLTLLNRVINES  385

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF S+
Sbjct  386  LRLYPPATVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASK  445

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFA GPRNC+GQS+A+MEAKI+LAMLIS+FSF +S NYRHAPV+V+++KPK
Sbjct  446  SFTPGR-FIPFATGPRNCIGQSFAMMEAKIILAMLISQFSFTVSPNYRHAPVIVLTIKPK  504

Query  901  YGVQIRLNPL  930
            YGVQ+ L P+
Sbjct  505  YGVQVCLTPI  514



>gb|KCW68914.1| hypothetical protein EUGRSUZ_F02489 [Eucalyptus grandis]
Length=485

 Score =   516 bits (1329),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 280/310 (90%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLT+LQ LC+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  176  TADIISRTEFDSSYEKGKQIFHLLTLLQNLCAQASRHLCLPGSRFFPSKYNREIKSLKME  235

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSR+DC E+GR S+YG+DLLG+LL EMQ+ K + NGF LNL LIMDECKTF
Sbjct  236  VERLLMEIIQSRRDCVEVGRSSSYGNDLLGMLLNEMQK-KRSGNGFSLNLQLIMDECKTF  294

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+TTALLLTWTVMLLA+NPSWQE+VREEV QVCNG  PS+E LSKLTLL+ VINE+
Sbjct  295  FFAGHDTTALLLTWTVMLLASNPSWQERVREEVAQVCNGADPSVEHLSKLTLLNMVINES  354

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP ++LPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF S+
Sbjct  355  LRLYPPASVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASK  414

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            +++PGR F+PFA GPRNC+GQS+ALMEAKI+LAMLISRFSF IS++YRHAPV+V+++KPK
Sbjct  415  AFTPGR-FVPFAMGPRNCIGQSFALMEAKIILAMLISRFSFTISESYRHAPVIVLTIKPK  473

Query  901  YGVQIRLNPL  930
            YGVQI L PL
Sbjct  474  YGVQICLKPL  483



>ref|XP_006430783.1| hypothetical protein CICLE_v10011497mg [Citrus clementina]
 gb|ESR44023.1| hypothetical protein CICLE_v10011497mg [Citrus clementina]
Length=518

 Score =   518 bits (1333),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 239/310 (77%), Positives = 275/310 (89%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLTVLQ LC+QS+RHLC+PG+RF+PSKYN EIK+L +E
Sbjct  209  TADIISRTEFDSSYEKGKQIFHLLTVLQHLCAQSSRHLCFPGSRFFPSKYNREIKSLKME  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ  +GN  GF LN  LIMDECKTF
Sbjct  269  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQNKRGN--GFSLNFQLIMDECKTF  326

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEK+R EV QVCNGD PS++ L KLT L+ VINE+
Sbjct  327  FFAGHETTALLLTWTVMLLASNPSWQEKIRAEVKQVCNGDAPSVDHLPKLTQLNMVINES  386

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDL IPKGL+IWIP+LAIHHSEE+WGKD NEF P+RF SR
Sbjct  387  LRLYPPATVLPRMAFEDIKLGDLLIPKGLSIWIPMLAIHHSEELWGKDANEFNPDRFASR  446

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            +++ GR F PFAAGPRNCVGQS+A+MEAKI+LAMLISRF+F ISD+YRHAPVVV+++KPK
Sbjct  447  TFASGRHFFPFAAGPRNCVGQSFAMMEAKIILAMLISRFNFTISDSYRHAPVVVLTIKPK  506

Query  901  YGVQIRLNPL  930
            YGVQ+ L P+
Sbjct  507  YGVQVYLEPV  516



>ref|XP_011099558.1| PREDICTED: cytokinin hydroxylase [Sesamum indicum]
Length=519

 Score =   517 bits (1332),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 241/310 (78%), Positives = 277/310 (89%), Gaps = 1/310 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF S+YEKGK+IF LLT+LQ LC+++TRHLC+PG+RF PSKYN EIK+L +E
Sbjct  208  TADIISRTEFDSNYEKGKQIFHLLTLLQHLCARATRHLCFPGSRFLPSKYNREIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ+ K + NGF LN  LIMDECKTF
Sbjct  268  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQK-KRSGNGFSLNFQLIMDECKTF  326

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQE+VR +V +VC G  PS+E LSKLTLL+ VINE+
Sbjct  327  FFAGHETTALLLTWTVMLLASNPSWQERVRAQVKEVCGGGAPSVEHLSKLTLLNMVINES  386

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP +LLPRMAFED KLGDLHIPKGL+IWIPVLAIHHSE+IWGKDVNEF P+RF SR
Sbjct  387  LRLYPPASLLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEDIWGKDVNEFNPDRFASR  446

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S   GR F+PFAAGPRNC+GQ++ALMEAKI+LAML+SRFSF IS+NYRHAPVVV+++KPK
Sbjct  447  SSGSGRHFIPFAAGPRNCIGQAFALMEAKIILAMLVSRFSFTISENYRHAPVVVLTMKPK  506

Query  901  YGVQIRLNPL  930
            YGVQIRL PL
Sbjct  507  YGVQIRLKPL  516



>ref|XP_010061877.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin hydroxylase-like [Eucalyptus 
grandis]
Length=511

 Score =   517 bits (1331),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 280/310 (90%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLT+LQ LC+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  202  TADIISRTEFDSSYEKGKQIFHLLTLLQNLCAQASRHLCLPGSRFFPSKYNREIKSLKME  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSR+DC E+GR S+YG+DLLG+LL EMQ+ K + NGF LNL LIMDECKTF
Sbjct  262  VERLLMEIIQSRRDCVEVGRSSSYGNDLLGMLLNEMQK-KRSGNGFSLNLQLIMDECKTF  320

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+TTALLLTWTVMLLA+NPSWQE+VREEV QVCNG  PS+E LSKLTLL+ VINE+
Sbjct  321  FFAGHDTTALLLTWTVMLLASNPSWQERVREEVAQVCNGADPSVEHLSKLTLLNMVINES  380

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP ++LPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF S+
Sbjct  381  LRLYPPASVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASK  440

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            +++PGR F+PFA GPRNC+GQS+ALMEAKI+LAMLISRFSF IS++YRHAPV+V+++KPK
Sbjct  441  AFTPGR-FVPFAMGPRNCIGQSFALMEAKIILAMLISRFSFTISESYRHAPVIVLTIKPK  499

Query  901  YGVQIRLNPL  930
            YGVQI L PL
Sbjct  500  YGVQICLKPL  509



>gb|EYU44640.1| hypothetical protein MIMGU_mgv1a004492mg [Erythranthe guttata]
Length=524

 Score =   517 bits (1332),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 243/310 (78%), Positives = 278/310 (90%), Gaps = 1/310 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF S+YEKGK+IF LLT+LQ LC+++TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  214  TADIISRTEFDSNYEKGKQIFHLLTLLQHLCARATRHLCFPGSRFLPSKYNREIKSLKGE  273

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSR+DC EIGR S+YGDDLLG+LL EMQ+ K + +GF LNL LIMDECKTF
Sbjct  274  VERLLMEIIQSRQDCVEIGRSSSYGDDLLGMLLNEMQKKK-SGDGFSLNLQLIMDECKTF  332

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLATNPSWQ+KVR EV Q+C G PPS + LSKLT L+ VINE+
Sbjct  333  FFAGHETTALLLTWTVMLLATNPSWQDKVRAEVKQLCGGAPPSPDHLSKLTTLNMVINES  392

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP +LLPRMAFEDFKLGDLHIPKGL+IWIPVLAIHH+EEIWGKDVNEF P+RF SR
Sbjct  393  LRLYPPASLLPRMAFEDFKLGDLHIPKGLSIWIPVLAIHHNEEIWGKDVNEFNPDRFGSR  452

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S   GR F+PFAAGPRNCVGQ++ALMEAKI+LAMLIS+FSF+IS+NYRHAPV+V+++KPK
Sbjct  453  SSGSGRHFIPFAAGPRNCVGQAFALMEAKIILAMLISKFSFEISENYRHAPVIVLTMKPK  512

Query  901  YGVQIRLNPL  930
            YGVQIRL PL
Sbjct  513  YGVQIRLKPL  522



>ref|XP_008230401.1| PREDICTED: cytokinin hydroxylase-like [Prunus mume]
Length=517

 Score =   517 bits (1331),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 277/310 (89%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLTVLQ LCSQ+++HLC PG+RF+PSKYN EIK+L +E
Sbjct  207  TADIISRTEFDSSYEKGKQIFRLLTVLQHLCSQASKHLCLPGSRFFPSKYNREIKSLKME  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ+ +GN  GF +NL LIMDECKTF
Sbjct  267  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQKKRGN--GFSINLQLIMDECKTF  324

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEKVR EV QVCNG  PS++ L KLTLL+ VINE+
Sbjct  325  FFAGHETTALLLTWTVMLLASNPSWQEKVRAEVKQVCNGGTPSVDHLPKLTLLNMVINES  384

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF S+
Sbjct  385  LRLYPPATVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASK  444

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFA GPRNC+GQS+A+MEAKI+LAMLISRFSF IS NYRHAPV+V+++KPK
Sbjct  445  SFTPGR-FIPFATGPRNCIGQSFAMMEAKIILAMLISRFSFTISRNYRHAPVIVLTIKPK  503

Query  901  YGVQIRLNPL  930
            YGVQ+ + P+
Sbjct  504  YGVQVCMTPI  513



>gb|KDO59002.1| hypothetical protein CISIN_1g010083mg [Citrus sinensis]
Length=518

 Score =   516 bits (1328),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 238/310 (77%), Positives = 275/310 (89%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKG++IF LLTVLQ LC+QS+RHLC+PG+RF+PSKYN EIK+L +E
Sbjct  209  TADIISRTEFDSSYEKGQQIFHLLTVLQHLCAQSSRHLCFPGSRFFPSKYNREIKSLKME  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ  +GN  GF LN  LIMDECKTF
Sbjct  269  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQNKRGN--GFSLNFQLIMDECKTF  326

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEK+R EV QVCNGD PS++ L KLT L+ VINE+
Sbjct  327  FFAGHETTALLLTWTVMLLASNPSWQEKIRAEVKQVCNGDAPSVDHLPKLTQLNMVINES  386

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDL IPKGL+IWIP+LAIHHSEE+WGKD NEF P+RF SR
Sbjct  387  LRLYPPATVLPRMAFEDIKLGDLLIPKGLSIWIPMLAIHHSEELWGKDANEFNPDRFASR  446

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            +++ GR F PFAAGPRNCVGQS+A+MEAKI+LAMLISRF+F ISD+YRHAPVVV+++KPK
Sbjct  447  TFASGRHFFPFAAGPRNCVGQSFAMMEAKIILAMLISRFNFTISDSYRHAPVVVLTIKPK  506

Query  901  YGVQIRLNPL  930
            YGVQ+ L P+
Sbjct  507  YGVQVYLEPV  516



>ref|XP_007216102.1| hypothetical protein PRUPE_ppa018639mg [Prunus persica]
 gb|EMJ17301.1| hypothetical protein PRUPE_ppa018639mg [Prunus persica]
Length=518

 Score =   516 bits (1328),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 239/310 (77%), Positives = 277/310 (89%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLTVLQ LCSQ+++HLC PG+RF+PSKYN EIK+L +E
Sbjct  208  TADIISRTEFDSSYEKGKQIFRLLTVLQHLCSQASKHLCLPGSRFFPSKYNREIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ+ +GN  GF +NL LIMDECKTF
Sbjct  268  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQKKRGN--GFSINLQLIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEKVR E+ QVCNG  PS++ L KLTLL+ VINE+
Sbjct  326  FFAGHETTALLLTWTVMLLASNPSWQEKVRAELKQVCNGGTPSVDHLPKLTLLNMVINES  385

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF S+
Sbjct  386  LRLYPPATVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASK  445

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFA GPRNC+GQS+A+MEAKI+LAMLISRFSF IS NYRHAPV+V+++KPK
Sbjct  446  SFTPGR-FIPFATGPRNCIGQSFAMMEAKIILAMLISRFSFTISPNYRHAPVIVLTIKPK  504

Query  901  YGVQIRLNPL  930
            YGVQ+ + P+
Sbjct  505  YGVQVCMTPI  514



>ref|XP_006482258.1| PREDICTED: cytokinin hydroxylase-like [Citrus sinensis]
Length=518

 Score =   515 bits (1327),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 238/310 (77%), Positives = 275/310 (89%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKG++IF LLTVLQ LC+QS+RHLC+PG+RF+PSKYN EIK+L +E
Sbjct  209  TADIISRTEFDSSYEKGQQIFHLLTVLQHLCAQSSRHLCFPGSRFFPSKYNREIKSLKME  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ  +GN  GF LN  LIMDECKTF
Sbjct  269  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQNKRGN--GFSLNFQLIMDECKTF  326

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEK+R EV QVCNGD PS++ L KLT L+ VINE+
Sbjct  327  FFAGHETTALLLTWTVMLLASNPSWQEKIRAEVKQVCNGDAPSVDHLPKLTQLNMVINES  386

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDL IPKGL+IWIP+LAIHHSEE+WGKD NEF P+RF SR
Sbjct  387  LRLYPPATVLPRMAFEDIKLGDLLIPKGLSIWIPMLAIHHSEELWGKDANEFNPDRFASR  446

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            +++ GR F PFAAGPRNCVGQS+A+MEAKI+LAMLISRF+F ISD+YRHAPVVV+++KPK
Sbjct  447  TFASGRHFFPFAAGPRNCVGQSFAMMEAKIILAMLISRFNFTISDSYRHAPVVVLTIKPK  506

Query  901  YGVQIRLNPL  930
            YGVQ+ L P+
Sbjct  507  YGVQVYLEPV  516



>ref|NP_001266167.1| cytokinin hydroxylase-like [Solanum lycopersicum]
 ref|XP_010315861.1| PREDICTED: cytokinin hydroxylase-like isoform X1 [Solanum lycopersicum]
 dbj|BAM08999.1| cytokinin hydroxylase-like [Solanum lycopersicum]
Length=516

 Score =   515 bits (1326),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 237/310 (76%), Positives = 280/310 (90%), Gaps = 1/310 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             A+IISRTEF SSYEKGK+IF LLT+LQ+ C+Q++RHLC+PG+RF+PSKYN +IKTL IE
Sbjct  206  TAEIISRTEFDSSYEKGKQIFHLLTILQKKCAQASRHLCFPGSRFFPSKYNRDIKTLKIE  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE LLMEIIQSRKD  EIGR S+YG+DLLG+LL EMQ+ K +SNGF LNL LIMDECKTF
Sbjct  266  VETLLMEIIQSRKDGVEIGRSSSYGNDLLGMLLNEMQK-KRSSNGFSLNLQLIMDECKTF  324

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQ+KVR+E+ QVC GD P+++ L KLTLLS +INE+
Sbjct  325  FFAGHETTALLLTWTVMLLASNPSWQDKVRQEINQVCKGDSPTVDHLPKLTLLSMIINES  384

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFEDFKLGDL+IPKGL+IWIPVLAIHHSEEIWGKD NEF+P+RF S+
Sbjct  385  LRLYPPATVLPRMAFEDFKLGDLNIPKGLSIWIPVLAIHHSEEIWGKDANEFRPDRFASK  444

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             ++ GR FLPFAAGPRNCVGQS+ALMEAKI+LAMLIS+F F IS+NYRHAPV+V+++KPK
Sbjct  445  PFTAGRNFLPFAAGPRNCVGQSFALMEAKIILAMLISKFRFTISENYRHAPVIVLTIKPK  504

Query  901  YGVQIRLNPL  930
            YGVQ++L PL
Sbjct  505  YGVQVKLTPL  514



>ref|XP_008341882.1| PREDICTED: cytokinin hydroxylase-like [Malus domestica]
Length=518

 Score =   514 bits (1323),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 277/310 (89%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLTVLQ+LC++++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  208  TADIISRTEFDSSYEKGKQIFRLLTVLQQLCAEASRHLCLPGSRFFPSKYNREIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE+LLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ  K   NGF LNL  IMDECKTF
Sbjct  268  VEKLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQ--KKRENGFTLNLQQIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLL+WTVMLLA+NPSWQEKVR EV QVCNG  PS++QLSKLTLL+ VINE+
Sbjct  326  FFAGHETTALLLSWTVMLLASNPSWQEKVRAEVKQVCNGGTPSVDQLSKLTLLNMVINES  385

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF S+
Sbjct  386  LRLYPPATVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASK  445

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFA GPRNC+GQS+A+MEAKI+LAMLISRFSF IS NYRHAPV+V+++KPK
Sbjct  446  SFTPGR-FIPFATGPRNCIGQSFAMMEAKIILAMLISRFSFTISPNYRHAPVIVLTIKPK  504

Query  901  YGVQIRLNPL  930
            YGVQ+ L P+
Sbjct  505  YGVQVCLTPI  514



>ref|NP_001266171.1| cytokinin hydroxylase-like [Solanum lycopersicum]
 ref|XP_010315862.1| PREDICTED: cytokinin hydroxylase-like isoform X1 [Solanum lycopersicum]
 dbj|BAM09000.1| cytokinin hydroxylase-like [Solanum lycopersicum]
Length=516

 Score =   513 bits (1322),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 237/310 (76%), Positives = 279/310 (90%), Gaps = 1/310 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             A+IISRTEF SSY KGK+IF LLT+LQ+ C+Q++RHLC+PG+RF+PSKYN +IKTL IE
Sbjct  206  TAEIISRTEFDSSYAKGKQIFHLLTILQQKCAQASRHLCFPGSRFFPSKYNRDIKTLKIE  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE LLMEIIQSRKD  EIGR S+YG+DLLG+LL EMQ+ K +SNGF LNL LIMDECKTF
Sbjct  266  VETLLMEIIQSRKDGVEIGRSSSYGNDLLGMLLNEMQK-KRSSNGFSLNLQLIMDECKTF  324

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQ+KVR+E+ QVC GD P+++ L KLTLLS +INE+
Sbjct  325  FFAGHETTALLLTWTVMLLASNPSWQDKVRQEINQVCKGDSPTVDHLPKLTLLSMIINES  384

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFEDFKLGDL+IPKGL+IWIPVLAIHHSEEIWGKD NEF+P+RF S+
Sbjct  385  LRLYPPATVLPRMAFEDFKLGDLNIPKGLSIWIPVLAIHHSEEIWGKDANEFRPDRFASK  444

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             +S GR FLPFAAGPRNCVGQS+ALMEAKI+LAMLIS+F F IS+NYRHAPV+V+++KPK
Sbjct  445  PFSAGRNFLPFAAGPRNCVGQSFALMEAKIILAMLISKFRFTISENYRHAPVIVLTIKPK  504

Query  901  YGVQIRLNPL  930
            YGVQ++L PL
Sbjct  505  YGVQVKLTPL  514



>ref|XP_009789072.1| PREDICTED: cytokinin hydroxylase-like isoform X1 [Nicotiana sylvestris]
Length=520

 Score =   513 bits (1321),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 241/315 (77%), Positives = 280/315 (89%), Gaps = 6/315 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLT+LQ LC+Q++RHLC+PG+RF PSKYN +IK L +E
Sbjct  205  TADIISRTEFDSSYEKGKQIFHLLTLLQHLCAQASRHLCFPGSRFLPSKYNRDIKALKME  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ+ K +SNGF LNL LIMDECKTF
Sbjct  265  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQK-KRSSNGFSLNLQLIMDECKTF  323

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTL-----LSA  525
            FFAGHETTALLLTWT MLLA+NPSWQ+KVR+EV QVC  DPP++E L KLTL     L+ 
Sbjct  324  FFAGHETTALLLTWTSMLLASNPSWQDKVRDEVTQVCKRDPPTVEHLPKLTLFIFLQLNM  383

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            VINE+LRLYPP ++LPRMAFEDFKLGDLHIPKGL+IWIPVLAIHHSEEIWG+DVNEF+P+
Sbjct  384  VINESLRLYPPASVLPRMAFEDFKLGDLHIPKGLSIWIPVLAIHHSEEIWGEDVNEFRPD  443

Query  706  RFISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
            RF S+S++ GR FLPFAAGPRNCVGQS+ALMEAKI+LAMLIS+F F IS+NYRHAPV+V+
Sbjct  444  RFASKSFAAGRNFLPFAAGPRNCVGQSFALMEAKIILAMLISKFRFTISENYRHAPVIVL  503

Query  886  SVKPKYGVQIRLNPL  930
            ++KPKYGVQI+L  L
Sbjct  504  TIKPKYGVQIKLTTL  518



>ref|XP_006383461.1| hypothetical protein POPTR_0005s15710g [Populus trichocarpa]
 gb|ERP61258.1| hypothetical protein POPTR_0005s15710g [Populus trichocarpa]
Length=371

 Score =   505 bits (1301),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 233/310 (75%), Positives = 272/310 (88%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            +ADIISRTEF SSYEKGK+IF LLT LQ LC Q+TRHLC PG+RF+PS YN +IK+  +E
Sbjct  62   SADIISRTEFDSSYEKGKQIFHLLTELQSLCHQATRHLCLPGSRFFPSNYNRQIKSKKME  121

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+RLL+EIIQSRKDC EIGR S+YG+DLLG+L+ EM+  K  S+GF +NL LIMDECKTF
Sbjct  122  VDRLLLEIIQSRKDCVEIGRSSSYGNDLLGILVNEME--KKRSDGFNINLQLIMDECKTF  179

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEKVR EV +VCNG+ PSI+ LSK  LL+ VINE+
Sbjct  180  FFAGHETTALLLTWTVMLLASNPSWQEKVRAEVNEVCNGETPSIDHLSKFNLLNMVINES  239

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP TLLPRMAFED KLGDLH+PKGL IWIPVLAIHHSEEIWGKD NEF P+RF S+
Sbjct  240  LRLYPPATLLPRMAFEDIKLGDLHVPKGLQIWIPVLAIHHSEEIWGKDANEFNPDRFASK  299

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             ++PGR F+PFA GPRNC+GQS+A+MEAKI+LAMLIS+FSF ISD+YRHAPVVV+++KPK
Sbjct  300  PFAPGRHFIPFATGPRNCIGQSFAMMEAKIILAMLISQFSFHISDSYRHAPVVVLTIKPK  359

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  360  YGVQVYLKPL  369



>ref|XP_010061875.1| PREDICTED: cytokinin hydroxylase-like [Eucalyptus grandis]
 gb|KCW68913.1| hypothetical protein EUGRSUZ_F02488 [Eucalyptus grandis]
Length=516

 Score =   510 bits (1313),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 277/310 (89%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLT LQRLC+Q++ HL +PG+RF+PSKYN EIK+L +E
Sbjct  207  TADIISRTEFDSSYEKGKQIFHLLTNLQRLCAQASCHLWFPGSRFFPSKYNREIKSLKME  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSR+DC E+GR S++G+DLLG+LL EMQE K + NG  LNL LIMDECKTF
Sbjct  267  VERLLMEIIQSRRDCVEVGRSSSHGNDLLGMLLNEMQE-KRSGNGLSLNLQLIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETT+LLLTWTVMLLA+NPSWQE+VREEV QVCNG  PS+E LSKLTLL+ VINE+
Sbjct  326  FFAGHETTSLLLTWTVMLLASNPSWQERVREEVAQVCNGADPSVEHLSKLTLLNMVINES  385

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            +RLYPP T+LPR AFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF S+
Sbjct  386  MRLYPPATVLPRTAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASK  445

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFA GPRNC+GQS+ALMEAKI+LAMLISRFSF IS+NYRHAPV+V++VKPK
Sbjct  446  SFAPGR-FIPFAMGPRNCIGQSFALMEAKIILAMLISRFSFTISENYRHAPVIVLTVKPK  504

Query  901  YGVQIRLNPL  930
            YGVQI L PL
Sbjct  505  YGVQICLKPL  514



>emb|CDP21560.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   510 bits (1313),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 238/310 (77%), Positives = 282/310 (91%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF S+YEKGK+IF LL +LQR CSQ++RHLC+PG+RF+PSKYN +IK+L +E
Sbjct  208  TADIISRTEFDSNYEKGKQIFRLLQLLQRHCSQASRHLCFPGSRFFPSKYNRDIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR ++YG+DLLGLLL EMQ  KG+  GF LNL LIMDECKTF
Sbjct  268  VERLLMEIIQSRKDCVEIGRSNSYGNDLLGLLLNEMQTKKGS--GFSLNLQLIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+TTALLLTWTVMLLA+NPSWQ+KVR +V +VCNG PP+++QLSKLT L+ VINE+
Sbjct  326  FFAGHDTTALLLTWTVMLLASNPSWQDKVRAQVNEVCNGSPPTVDQLSKLTTLNMVINES  385

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP ++LPRMAFED KLGDLHIPKGL++WIPVLAIHHSEE+WG+D NEFKP+RF S+
Sbjct  386  LRLYPPASVLPRMAFEDIKLGDLHIPKGLSVWIPVLAIHHSEELWGEDANEFKPDRFASK  445

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            SY+PGR FLPFAAGPRNCVGQS+A+MEAKI+LAML+S+FSF IS+NYRHAPV+V+++KPK
Sbjct  446  SYAPGRHFLPFAAGPRNCVGQSFAVMEAKIILAMLVSKFSFTISENYRHAPVIVLTIKPK  505

Query  901  YGVQIRLNPL  930
            YGVQIRL PL
Sbjct  506  YGVQIRLKPL  515



>ref|XP_007033282.1| Cytochrome P450, family 735, subfamily A, polypeptide 1 [Theobroma 
cacao]
 gb|EOY04208.1| Cytochrome P450, family 735, subfamily A, polypeptide 1 [Theobroma 
cacao]
Length=518

 Score =   507 bits (1306),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 236/310 (76%), Positives = 277/310 (89%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADII+RTEF SSYEKGK+IF LLT LQ LC+Q++RHLC+PG+RF+P+KYN EIK+L +E
Sbjct  209  TADIIARTEFDSSYEKGKQIFHLLTSLQHLCAQASRHLCFPGSRFFPTKYNREIKSLKME  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+RLL+EIIQSR+DC EIGR S+YG+DLLG+LL EM++ +  S+ F LNL LIMDECKTF
Sbjct  269  VDRLLLEIIQSRRDCVEIGRSSSYGNDLLGMLLNEMEKKR--SDKFSLNLQLIMDECKTF  326

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NP+WQEKVR EV Q CNG  PS++QLSKLTLL  VINE+
Sbjct  327  FFAGHETTALLLTWTVMLLASNPAWQEKVRAEVKQGCNGGVPSVDQLSKLTLLHMVINES  386

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKDVNEFKPERF SR
Sbjct  387  LRLYPPATVLPRMAFEDIKLGDLFIPKGLSIWIPVLAIHHSEELWGKDVNEFKPERFNSR  446

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             ++ GR F+PFAAGPRNCVGQS+A+MEAKI+LAMLISRFSF IS++YRHAPVVV+++KPK
Sbjct  447  PFASGRHFIPFAAGPRNCVGQSFAVMEAKIILAMLISRFSFTISESYRHAPVVVMTIKPK  506

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  507  YGVQVYLKPL  516



>ref|XP_010066873.1| PREDICTED: cytokinin hydroxylase-like [Eucalyptus grandis]
 gb|KCW64919.1| hypothetical protein EUGRSUZ_G02472 [Eucalyptus grandis]
Length=518

 Score =   507 bits (1305),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 276/310 (89%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLT+LQ LC+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  209  TADIISRTEFDSSYEKGKQIFHLLTLLQPLCAQASRHLCLPGSRFFPSKYNREIKSLKME  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSR+DC EIG+ S++G+DLLG+LL EMQ+ K +  GF LNL LIMDECKTF
Sbjct  269  VERLLMEIIQSRRDCVEIGQSSSHGNDLLGMLLDEMQK-KRSGRGFSLNLQLIMDECKTF  327

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+TTALLLTWTVMLLA+NPSWQE+VREEV QVCNG  PS+E LSKLTLL+ VINE+
Sbjct  328  FFAGHDTTALLLTWTVMLLASNPSWQERVREEVAQVCNGADPSVEHLSKLTLLNMVINES  387

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYP  T+LPR AFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF S+
Sbjct  388  LRLYPLATVLPRTAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASK  447

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            ++ PGR FLPFA GPRNCVGQS+ALMEAKI+LAMLISRFSF ISD+YRHAPV+V+++KPK
Sbjct  448  AFVPGR-FLPFAMGPRNCVGQSFALMEAKIILAMLISRFSFTISDSYRHAPVIVLTIKPK  506

Query  901  YGVQIRLNPL  930
            YGVQI L PL
Sbjct  507  YGVQICLKPL  516



>ref|XP_004304133.1| PREDICTED: cytokinin hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=516

 Score =   506 bits (1302),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 233/310 (75%), Positives = 278/310 (90%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+I+ LLT+LQ+ C+++++HLC PG+RF+PSKYN EIK+L +E
Sbjct  207  TADIISRTEFDSSYEKGKQIYRLLTLLQKQCAEASKHLCVPGSRFFPSKYNREIKSLKME  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR ++YG+DLLG+LL EMQ+ +GN  GF LNL LIMDECKTF
Sbjct  267  VERLLMEIIQSRKDCVEIGRNNSYGNDLLGMLLNEMQKKRGN--GFSLNLQLIMDECKTF  324

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQ+KVR EV QVCNG+ PS++ LSKLT L+ VINE+
Sbjct  325  FFAGHETTALLLTWTVMLLASNPSWQDKVRAEVKQVCNGETPSVDHLSKLTSLNMVINES  384

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRMAFED KLGDLHIPKGL+IWIPVLAIHHS+E+WG D NEF PERF S+
Sbjct  385  LRLYPPATVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSKELWGSDANEFNPERFASK  444

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFAAGPRNC+GQS+A+MEAKI+LAMLISRFSF I+ +YRHAPVVV+++KPK
Sbjct  445  SFTPGR-FIPFAAGPRNCIGQSFAIMEAKIILAMLISRFSFTIAPSYRHAPVVVLTIKPK  503

Query  901  YGVQIRLNPL  930
            YGVQ+ L P+
Sbjct  504  YGVQVCLKPI  513



>ref|XP_011021238.1| PREDICTED: cytokinin hydroxylase [Populus euphratica]
Length=518

 Score =   504 bits (1299),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 233/310 (75%), Positives = 272/310 (88%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            +ADIISRTEF SSYEKGK+IF LLT LQ LC Q+TRHLC PG+RF+PS YN +IK+  +E
Sbjct  209  SADIISRTEFDSSYEKGKQIFHLLTELQSLCHQATRHLCLPGSRFFPSNYNRQIKSKKME  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+RLL+EIIQSRKDC EIGR S+YG+DLLG+L+ +M+  K  S+GF +NL LIMDECKTF
Sbjct  269  VDRLLLEIIQSRKDCVEIGRSSSYGNDLLGILVNDME--KKRSDGFNINLQLIMDECKTF  326

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEKVR EV +VCNG+ PSI+ LSK  LL+ VINE+
Sbjct  327  FFAGHETTALLLTWTVMLLASNPSWQEKVRAEVNEVCNGETPSIDHLSKFNLLNMVINES  386

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP TLLPRMAFED KLGDLHIPKGL IWIPVLAIHHS+EIWGKD NEF P+RF S+
Sbjct  387  LRLYPPATLLPRMAFEDIKLGDLHIPKGLQIWIPVLAIHHSQEIWGKDANEFNPDRFASK  446

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             ++PGR F+PFA GPRNC+GQS+A+MEAKI+LAMLISRFSF ISD+YRHAPVVV+++KPK
Sbjct  447  PFAPGRHFIPFATGPRNCIGQSFAMMEAKIILAMLISRFSFHISDSYRHAPVVVLTIKPK  506

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  507  YGVQVYLKPL  516



>ref|XP_006383462.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP61259.1| cytochrome P450 family protein [Populus trichocarpa]
Length=518

 Score =   504 bits (1298),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 233/310 (75%), Positives = 272/310 (88%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            +ADIISRTEF SSYEKGK+IF LLT LQ LC Q+TRHLC PG+RF+PS YN +IK+  +E
Sbjct  209  SADIISRTEFDSSYEKGKQIFHLLTELQSLCHQATRHLCLPGSRFFPSNYNRQIKSKKME  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+RLL+EIIQSRKDC EIGR S+YG+DLLG+L+ EM+  K  S+GF +NL LIMDECKTF
Sbjct  269  VDRLLLEIIQSRKDCVEIGRSSSYGNDLLGILVNEME--KKRSDGFNINLQLIMDECKTF  326

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEKVR EV +VCNG+ PSI+ LSK  LL+ VINE+
Sbjct  327  FFAGHETTALLLTWTVMLLASNPSWQEKVRAEVNEVCNGETPSIDHLSKFNLLNMVINES  386

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP TLLPRMAFED KLGDLH+PKGL IWIPVLAIHHSEEIWGKD NEF P+RF S+
Sbjct  387  LRLYPPATLLPRMAFEDIKLGDLHVPKGLQIWIPVLAIHHSEEIWGKDANEFNPDRFASK  446

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             ++PGR F+PFA GPRNC+GQS+A+MEAKI+LAMLIS+FSF ISD+YRHAPVVV+++KPK
Sbjct  447  PFAPGRHFIPFATGPRNCIGQSFAMMEAKIILAMLISQFSFHISDSYRHAPVVVLTIKPK  506

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  507  YGVQVYLKPL  516



>ref|XP_010265149.1| PREDICTED: cytokinin hydroxylase-like [Nelumbo nucifera]
Length=517

 Score =   504 bits (1298),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 230/310 (74%), Positives = 275/310 (89%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              DIISRTEF SSYEKGKRIF LL  LQRLC+QSTRHLC+PG+RF+PSKYN EIK+L +E
Sbjct  208  TGDIISRTEFDSSYEKGKRIFHLLNSLQRLCAQSTRHLCFPGSRFFPSKYNREIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE+LLMEIIQ RKDC EIGR S+YG+DLLG+LL E Q+ +  + GF   L ++MDECKTF
Sbjct  268  VEKLLMEIIQRRKDCVEIGRSSSYGNDLLGMLLAETQKKR--AGGFSFTLQMLMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+TTALLLTWT+MLLATNP WQ+KVR EV+QVCNG+ P+I+QLSKL+LL+ VINE+
Sbjct  326  FFAGHDTTALLLTWTIMLLATNPEWQDKVRAEVLQVCNGEAPTIDQLSKLSLLNMVINES  385

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP +LLPRMAFED KLGDLHIPKGL++WIPVLAIHHSEE+WGKDV+EF PERF  +
Sbjct  386  LRLYPPASLLPRMAFEDIKLGDLHIPKGLSLWIPVLAIHHSEELWGKDVHEFNPERFSGK  445

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFAAGPRNCVGQS+ALME+KI+LAML+S+FSF IS NYRHAP++V+++KPK
Sbjct  446  SFAPGRHFIPFAAGPRNCVGQSFALMESKIILAMLLSQFSFTISKNYRHAPIMVLTLKPK  505

Query  901  YGVQIRLNPL  930
            +GVQI L PL
Sbjct  506  HGVQICLKPL  515



>ref|XP_002305160.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE85671.1| cytochrome P450 family protein [Populus trichocarpa]
Length=518

 Score =   500 bits (1287),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 230/310 (74%), Positives = 272/310 (88%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRT+FGSSYEKGK+IF LLT LQ LC Q+TRHLC PG+RF+PS YN +IK+  +E
Sbjct  209  TADIISRTQFGSSYEKGKQIFHLLTELQSLCHQATRHLCLPGSRFFPSNYNRQIKSKKME  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+RLL+EIIQSRKDC EIGR S+YGDDLLG+LL EM+  K  S+GF +NL L+MDECKTF
Sbjct  269  VDRLLLEIIQSRKDCVEIGRSSSYGDDLLGMLLNEME--KKRSDGFNINLQLVMDECKTF  326

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETT+LLLTWTVMLLA+NPSWQEKVR EV +VCNG+ PSI+ L K  LL+ V++E+
Sbjct  327  FFAGHETTSLLLTWTVMLLASNPSWQEKVRAEVKEVCNGETPSIDHLPKFNLLNMVVSES  386

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYP  TLLPRMAFED KLGDL IPKGL IWIPVLAIHHSEE+WGKD NEF P+RF S+
Sbjct  387  LRLYPSGTLLPRMAFEDIKLGDLDIPKGLQIWIPVLAIHHSEELWGKDANEFNPDRFASK  446

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFAAGPRNC+GQS+A+MEAKI+LAMLIS+FSF+ISD+YRHAPVVV+++KPK
Sbjct  447  SFAPGRHFIPFAAGPRNCIGQSFAMMEAKIILAMLISQFSFNISDSYRHAPVVVLTIKPK  506

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  507  YGVQVYLKPL  516



>ref|XP_004489114.1| PREDICTED: cytokinin hydroxylase-like [Cicer arietinum]
Length=525

 Score =   499 bits (1285),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 230/310 (74%), Positives = 273/310 (88%), Gaps = 1/310 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFG+SY+KGK+IF LLTVLQ  C+Q++RHLC+PG+RF+PSKYN EIK L +E
Sbjct  210  TADIISRTEFGTSYQKGKKIFHLLTVLQTRCAQASRHLCFPGSRFFPSKYNREIKALKME  269

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE+LLMEIIQSRKDC EIGR ++YG+DLLG+LL EMQ+    +    LNL ++MDECKTF
Sbjct  270  VEKLLMEIIQSRKDCVEIGRTNSYGNDLLGILLNEMQKKGSRNENNSLNLQVVMDECKTF  329

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FF+GHETTALLLTWTVMLLA+NPSWQ+KVR+EV +VCNG  PS++QLSKLT+L  VINE+
Sbjct  330  FFSGHETTALLLTWTVMLLASNPSWQDKVRDEVKRVCNGGIPSLDQLSKLTILHMVINES  389

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP ++LPRMAFED  LGDL+IPKGL+IWIPVLAIHHSE++WGKD NEF P+RF S+
Sbjct  390  LRLYPPASVLPRMAFEDIILGDLYIPKGLSIWIPVLAIHHSEKLWGKDANEFNPDRFTSK  449

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            SY P R FLPFA GPRNCVGQ++ALMEAKI+LAMLISRFSF ISDNYRHAPVVV+++KPK
Sbjct  450  SYIPSR-FLPFAFGPRNCVGQTFALMEAKIILAMLISRFSFTISDNYRHAPVVVLTIKPK  508

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  509  YGVQVCLKPL  518



>gb|KEH21516.1| cytochrome P450 family protein [Medicago truncatula]
Length=474

 Score =   497 bits (1279),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 232/310 (75%), Positives = 277/310 (89%), Gaps = 6/310 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFG+SY+KG++IF LLTVLQ LC+Q++RHLC+PG+RF+PSKYN EIK+L +E
Sbjct  169  TADIISRTEFGASYQKGRKIFHLLTVLQTLCAQASRHLCFPGSRFFPSKYNREIKSLKME  228

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR ++YG+DLLG+LL EMQ+ + +     LNL L+MDECKTF
Sbjct  229  VERLLMEIIQSRKDCVEIGRSNSYGNDLLGILLNEMQKKETS-----LNLQLVMDECKTF  283

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FF+GHETTALLLTWTVMLLA+NPSWQEKVR+EV +VCNG  PS+++LSKL++L  VINE+
Sbjct  284  FFSGHETTALLLTWTVMLLASNPSWQEKVRDEVKRVCNGGIPSLDKLSKLSMLHMVINES  343

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP ++LPRMAFED  LGDL+IPKGL+IWIPVLAIHHSE++WGKD NEF PERF S+
Sbjct  344  LRLYPPASVLPRMAFEDIILGDLYIPKGLSIWIPVLAIHHSEKLWGKDANEFNPERFTSK  403

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S+ PGR FLPFA GPRNCVGQ++ALMEAKI+LAMLISRFSF ISDNYRHAPVVV+++KPK
Sbjct  404  SFIPGR-FLPFAFGPRNCVGQTFALMEAKIILAMLISRFSFTISDNYRHAPVVVLTIKPK  462

Query  901  YGVQIRLNPL  930
            +GVQI L PL
Sbjct  463  HGVQICLKPL  472



>ref|XP_010064771.1| PREDICTED: cytokinin hydroxylase-like [Eucalyptus grandis]
Length=530

 Score =   497 bits (1280),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 236/310 (76%), Positives = 274/310 (88%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LLT+LQ LC+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  209  TADIISRTEFDSSYEKGKQIFHLLTLLQPLCAQASRHLCLPGSRFFPSKYNREIKSLKME  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSR+DC EIG+ S++G+DLLG+LL EMQ+ K +  GF LNL LIMDECKTF
Sbjct  269  VERLLMEIIQSRRDCVEIGQSSSHGNDLLGMLLDEMQK-KTSGRGFSLNLQLIMDECKTF  327

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+TTALLLTWTVMLLA+NPSWQE+VREEV QVCNG  PS+E LSKLTLL+ VINE+
Sbjct  328  FFAGHDTTALLLTWTVMLLASNPSWQERVREEVAQVCNGADPSVEHLSKLTLLNMVINES  387

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYP  T+LPR AFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF S+
Sbjct  388  LRLYPLATVLPRTAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASK  447

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            ++ PGR FL FA GPRNCVGQS+ALMEAKI+LAMLISRFSF IS +YRHAP++V+++KP+
Sbjct  448  AFVPGR-FLLFAMGPRNCVGQSFALMEAKIILAMLISRFSFMISGSYRHAPIIVLTIKPE  506

Query  901  YGVQIRLNPL  930
            YGVQI L PL
Sbjct  507  YGVQICLKPL  516



>ref|XP_007139151.1| hypothetical protein PHAVU_008G005600g [Phaseolus vulgaris]
 gb|ESW11145.1| hypothetical protein PHAVU_008G005600g [Phaseolus vulgaris]
Length=515

 Score =   496 bits (1276),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 231/310 (75%), Positives = 272/310 (88%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFG+SY+KGK+IFELLT LQ  C+Q++RHLC+PG+RF+PSKYN EIK L +E
Sbjct  207  TADIISRTEFGTSYQKGKKIFELLTQLQSRCAQASRHLCFPGSRFFPSKYNREIKCLKME  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE LLMEIIQSRKDC EIGR ++YG+DLLG+LL EMQ+ KGN N   +NL L+MD+CKTF
Sbjct  267  VETLLMEIIQSRKDCVEIGRSNSYGNDLLGMLLNEMQKKKGNGNS--INLQLVMDQCKTF  324

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+N SWQEKVREEV  VCNG  PS++QLSKLT L  VINE+
Sbjct  325  FFAGHETTALLLTWTVMLLASNTSWQEKVREEVKSVCNGSIPSLDQLSKLTHLHMVINES  384

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            +RLYPP ++LPRMAFED  LGDL+IPKGL+IWIPVLAIHHSE++WGKD NEF P+RF S+
Sbjct  385  MRLYPPASVLPRMAFEDIVLGDLYIPKGLSIWIPVLAIHHSEKLWGKDANEFNPQRFTSK  444

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             + PGR FLPFA+GPRNCVGQ++ALMEAKI+LAMLISRFSF IS NYRHAPVVV+++KPK
Sbjct  445  PFVPGR-FLPFASGPRNCVGQAFALMEAKIILAMLISRFSFTISPNYRHAPVVVLTIKPK  503

Query  901  YGVQIRLNPL  930
            YG+Q+ L PL
Sbjct  504  YGLQVCLKPL  513



>ref|XP_011035058.1| PREDICTED: cytokinin hydroxylase [Populus euphratica]
Length=518

 Score =   494 bits (1273),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 228/310 (74%), Positives = 271/310 (87%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRT+FGSSYEKGK+IF LLT LQ LC Q++RHLC PG+RF+PS YN +IK+  +E
Sbjct  209  TADIISRTQFGSSYEKGKQIFHLLTELQSLCHQASRHLCLPGSRFFPSNYNRQIKSKKME  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+RLL+EIIQSRKDC EIGR S+YGDDLLG+LL EM+  K  S+ F +NL LIMDECKTF
Sbjct  269  VDRLLLEIIQSRKDCVEIGRSSSYGDDLLGMLLNEME--KKRSDDFNINLQLIMDECKTF  326

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETT+LLLTWTVMLLA++PSWQEKVR EV +VCNG+ PSI+ L K  LL+ V++E+
Sbjct  327  FFAGHETTSLLLTWTVMLLASSPSWQEKVRAEVREVCNGETPSIDHLPKFNLLNMVVSES  386

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYP  TLLPRMAFED KLGDL IPKGL IWIPVLAIHHSEE+WGKD NEF P+RF S+
Sbjct  387  LRLYPSGTLLPRMAFEDIKLGDLDIPKGLQIWIPVLAIHHSEELWGKDANEFNPDRFASK  446

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFAAGPRNC+GQS+A+MEAKI+LAMLIS+FSF+ISD+YRHAPVVV+++KPK
Sbjct  447  SFAPGRHFIPFAAGPRNCIGQSFAMMEAKIILAMLISQFSFNISDSYRHAPVVVLTIKPK  506

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  507  YGVQVYLKPL  516



>ref|XP_002280205.1| PREDICTED: cytokinin hydroxylase [Vitis vinifera]
 emb|CBI33656.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   494 bits (1271),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 231/310 (75%), Positives = 273/310 (88%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIIS+TEF SSYEKGK+IF LLT LQ LC+Q+++H C PG+R++PSKYN EIK L  E
Sbjct  206  TADIISKTEFDSSYEKGKQIFHLLTELQNLCAQASKHFCLPGSRYFPSKYNREIKALKTE  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S+YG+DLLGLLL EMQ+ +G+  GF LNL LIMDECKTF
Sbjct  266  VERLLMEIIQSRKDCVEIGRSSSYGNDLLGLLLNEMQKKRGS--GFSLNLQLIMDECKTF  323

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWT MLLA+NP+WQ+KVR +V +VCNG+ PS++ LSKLTLL+ VINE+
Sbjct  324  FFAGHETTALLLTWTSMLLASNPTWQDKVRAQVAEVCNGETPSVDHLSKLTLLNMVINES  383

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            +RLYPP T+LPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF P+RF  +
Sbjct  384  MRLYPPATVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPDRFAGK  443

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             ++PGR F+PFAAGPRNCVGQS+A+MEAKI+LAML+SRFSF IS NYRHAPV+++++KPK
Sbjct  444  MFAPGRHFIPFAAGPRNCVGQSFAMMEAKIILAMLVSRFSFTISQNYRHAPVIILTIKPK  503

Query  901  YGVQIRLNPL  930
            YGVQI L PL
Sbjct  504  YGVQICLKPL  513



>ref|XP_010103790.1| Cytokinin hydroxylase [Morus notabilis]
 gb|EXB97152.1| Cytokinin hydroxylase [Morus notabilis]
Length=478

 Score =   491 bits (1265),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 229/310 (74%), Positives = 269/310 (87%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF LL VLQ+LC+Q++RHLC PG+RF+PSKYN EIK+L  E
Sbjct  170  TADIISRTEFDSSYEKGKQIFHLLNVLQKLCAQASRHLCLPGSRFFPSKYNREIKSLKSE  229

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR S++G+DLLG+LL EMQ+ K       LNL LIMDECKTF
Sbjct  230  VERLLMEIIQSRKDCVEIGRSSSHGNDLLGMLLNEMQKQKKGKE-LSLNLQLIMDECKTF  288

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NPSWQEKVR E+ Q CNG+ PS + L KL LL+ +INE+
Sbjct  289  FFAGHETTALLLTWTVMLLASNPSWQEKVRAEIKQKCNGEVPSADHLHKLELLNMIINES  348

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            +RLYPP ++LPRMAFED KLGDLHIPKGL+IWIPVLAIHH++E+WGKD NEF PERF S+
Sbjct  349  MRLYPPASVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHNKELWGKDANEFNPERFSSK  408

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             ++P   F+PFAAGPRNCVGQS+A+MEAKI+LAMLISRFSF IS+NYRHAPVVV+++KPK
Sbjct  409  VFNPN--FIPFAAGPRNCVGQSFAMMEAKIILAMLISRFSFTISENYRHAPVVVLTIKPK  466

Query  901  YGVQIRLNPL  930
            YGVQ+ L P+
Sbjct  467  YGVQVCLKPI  476



>ref|XP_008459472.1| PREDICTED: cytokinin hydroxylase-like [Cucumis melo]
Length=522

 Score =   488 bits (1257),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 233/313 (74%), Positives = 270/313 (86%), Gaps = 5/313 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SS+EKGK+IF LLTVLQ LC+Q++RHLC+PG+RF+PSKYN EIK L  +
Sbjct  211  TADIISRTEFESSFEKGKQIFHLLTVLQHLCAQASRHLCFPGSRFFPSKYNREIKALKGK  270

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENK--GNSNGFRLNLPLIMDECK  354
            VE LLMEIIQSRKDC EIGR S+YG+DLLG+LL EMQ+ K  GN NG  LNL +IMDECK
Sbjct  271  VEELLMEIIQSRKDCVEIGRSSSYGNDLLGMLLNEMQKKKLDGN-NGLSLNLQIIMDECK  329

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
            TFFFAGHETTALLLTWTVMLLATNP+WQ+KVR EVM VC  + PS   LSKL+LLS VIN
Sbjct  330  TFFFAGHETTALLLTWTVMLLATNPTWQDKVRAEVMAVCGSETPSFHHLSKLSLLSMVIN  389

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E+LRLYPP ++LPRMAFED KLGDL IPKGL+IWIP+LAIHHSEE+WGKD NEF PERF 
Sbjct  390  ESLRLYPPASILPRMAFEDIKLGDLEIPKGLSIWIPLLAIHHSEELWGKDANEFNPERFA  449

Query  715  -SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
             S+ ++ G  F+PFA+GPRNC+GQS+ALME KI+LAMLIS+FSF ISDNYRHAPVVV+++
Sbjct  450  NSKPFTSGG-FIPFASGPRNCIGQSFALMETKIILAMLISKFSFTISDNYRHAPVVVLTI  508

Query  892  KPKYGVQIRLNPL  930
            KPKYGVQ+ L PL
Sbjct  509  KPKYGVQVCLKPL  521



>ref|XP_008461587.1| PREDICTED: cytokinin hydroxylase-like [Cucumis melo]
Length=523

 Score =   488 bits (1257),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 231/312 (74%), Positives = 270/312 (87%), Gaps = 3/312 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF ++ +KG +IF LLT+LQ LC+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  208  TADIISRTEFDANSDKGNQIFHLLTLLQHLCAQASRHLCLPGSRFFPSKYNREIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECKT  357
            VERLLMEIIQSRKD  EIGR + YG DLLG+LL EMQ  K +  NGF LNL LIMDECKT
Sbjct  268  VERLLMEIIQSRKDGVEIGRSTCYGSDLLGMLLNEMQRKKDDGDNGFSLNLQLIMDECKT  327

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVC-NGDPPSIEQLSKLTLLSAVIN  534
            FFFAGHETTALLLTWT+MLLATNP+WQ+KVR EV QVC NG  PS+E LSK TLL+ VIN
Sbjct  328  FFFAGHETTALLLTWTIMLLATNPNWQQKVRHEVNQVCHNGATPSVEHLSKFTLLNMVIN  387

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E+LRLYPP T+LPRMAFED K+GDL IPKGL+IWIPVLAIHHSEE+WGKDVNEFKPERF 
Sbjct  388  ESLRLYPPATVLPRMAFEDIKVGDLEIPKGLSIWIPVLAIHHSEELWGKDVNEFKPERFA  447

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            S+ +S GR F+PFAAGPRNCVGQ +ALMEAKI+LAML+S+FSF ISD+YRHAPV V++++
Sbjct  448  SKPFSGGR-FIPFAAGPRNCVGQGFALMEAKIILAMLLSKFSFTISDSYRHAPVSVLTIQ  506

Query  895  PKYGVQIRLNPL  930
            PKYGVQ+ L P+
Sbjct  507  PKYGVQVYLTPI  518



>ref|XP_004156127.1| PREDICTED: cytokinin hydroxylase-like [Cucumis sativus]
Length=523

 Score =   486 bits (1251),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 229/312 (73%), Positives = 270/312 (87%), Gaps = 3/312 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF  + +KG +IF LLT+LQ LC+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  208  TADIISRTEFDCNSDKGNQIFHLLTLLQHLCAQASRHLCLPGSRFFPSKYNREIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECKT  357
            VERLLMEIIQSRKD  EIGR + YG DLLG+LL EMQ+ + +  NGF LNL LIMDECKT
Sbjct  268  VERLLMEIIQSRKDGVEIGRSTCYGSDLLGMLLNEMQKRREDGDNGFSLNLQLIMDECKT  327

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVC-NGDPPSIEQLSKLTLLSAVIN  534
            FFFAGHETTALLLTWT+MLLATNP+WQ+KVR EV QVC NG  PS+E LSK TLL+ VIN
Sbjct  328  FFFAGHETTALLLTWTIMLLATNPNWQQKVRHEVNQVCHNGATPSVEHLSKFTLLNMVIN  387

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E+LRLYPP T+LPRMAFED K+GDL IPKGL+IWIPVLAIHHSEE+WGKDVNEFKPERF 
Sbjct  388  ESLRLYPPATVLPRMAFEDIKVGDLEIPKGLSIWIPVLAIHHSEELWGKDVNEFKPERFA  447

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            S+ +S GR F+PFAAGPRNC+GQ +ALMEAKI+LAML+S+FSF ISD+YRHAPV V++++
Sbjct  448  SKPFSGGR-FIPFAAGPRNCIGQGFALMEAKIILAMLLSKFSFSISDSYRHAPVSVLTIQ  506

Query  895  PKYGVQIRLNPL  930
            PKYGVQ+ L P+
Sbjct  507  PKYGVQVYLTPI  518



>ref|XP_004145660.1| PREDICTED: cytokinin hydroxylase-like [Cucumis sativus]
 gb|KGN57750.1| hypothetical protein Csa_3G271920 [Cucumis sativus]
Length=523

 Score =   486 bits (1250),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 229/312 (73%), Positives = 270/312 (87%), Gaps = 3/312 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF  + +KG +IF LLT+LQ LC+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  208  TADIISRTEFDCNSDKGNQIFHLLTLLQHLCAQASRHLCLPGSRFFPSKYNREIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECKT  357
            VERLLMEIIQSRKD  EIGR + YG DLLG+LL EMQ+ + +  NGF LNL LIMDECKT
Sbjct  268  VERLLMEIIQSRKDGVEIGRSTCYGSDLLGMLLNEMQKRREDGDNGFSLNLQLIMDECKT  327

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVC-NGDPPSIEQLSKLTLLSAVIN  534
            FFFAGHETTALLLTWT+MLLATNP+WQ+KVR EV QVC NG  PS+E LSK TLL+ VIN
Sbjct  328  FFFAGHETTALLLTWTIMLLATNPNWQQKVRHEVNQVCHNGATPSVEHLSKFTLLNMVIN  387

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E+LRLYPP T+LPRMAFED K+GDL IPKGL+IWIPVLAIHHSEE+WGKDVNEFKPERF 
Sbjct  388  ESLRLYPPATVLPRMAFEDIKVGDLEIPKGLSIWIPVLAIHHSEELWGKDVNEFKPERFA  447

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            S+ +S GR F+PFAAGPRNC+GQ +ALMEAKI+LAML+S+FSF ISD+YRHAPV V++++
Sbjct  448  SKPFSGGR-FIPFAAGPRNCIGQGFALMEAKIILAMLLSKFSFSISDSYRHAPVSVLTIQ  506

Query  895  PKYGVQIRLNPL  930
            PKYGVQ+ L P+
Sbjct  507  PKYGVQVYLTPI  518



>gb|KHN24938.1| Cytokinin hydroxylase [Glycine soja]
Length=482

 Score =   483 bits (1243),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 230/312 (74%), Positives = 273/312 (88%), Gaps = 3/312 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFG+SY+KGK+IF LLT+LQ  C+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  170  TADIISRTEFGTSYQKGKKIFHLLTLLQTRCAQASRHLCIPGSRFFPSKYNREIKSLKME  229

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGF--RLNLPLIMDECK  354
            VE LLMEIIQSRKDC EIGR ++YG+DLLG+LL EMQ+ KGN N     +NL L+MD+CK
Sbjct  230  VETLLMEIIQSRKDCVEIGRSNSYGNDLLGMLLNEMQKKKGNGNNNNSSINLQLVMDQCK  289

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
            TFFFAGHETTALLLTWTVMLLA+N SWQ+KVR EV  VC+G  PS++QLSKLTLL  VIN
Sbjct  290  TFFFAGHETTALLLTWTVMLLASNKSWQDKVRAEVTNVCDGGIPSLDQLSKLTLLHMVIN  349

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E++RLYPP ++LPRM FED  LGDL+IPKGL+IWIPVLAIHHSE++WGKD NEF PERF 
Sbjct  350  ESMRLYPPASVLPRMVFEDIVLGDLYIPKGLSIWIPVLAIHHSEKLWGKDANEFNPERFT  409

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            S+S+ PGR FLPFA+GPRNCVGQ++ALMEAKI+LAMLISRFSF IS+NYRHAPVVV+++K
Sbjct  410  SKSFVPGR-FLPFASGPRNCVGQAFALMEAKIILAMLISRFSFTISENYRHAPVVVLTIK  468

Query  895  PKYGVQIRLNPL  930
            PKYGVQ+ L PL
Sbjct  469  PKYGVQVCLKPL  480



>ref|XP_010032635.1| PREDICTED: cytokinin hydroxylase-like [Eucalyptus grandis]
Length=522

 Score =   484 bits (1246),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 225/310 (73%), Positives = 267/310 (86%), Gaps = 1/310 (0%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              DIISRTEFGSSYEKGK+IF LLTVLQ+ C+Q++RHLC PG+RF+P++YN EIKTL +E
Sbjct  205  TTDIISRTEFGSSYEKGKQIFHLLTVLQQRCAQASRHLCLPGSRFFPTRYNKEIKTLKME  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SRKDCAEIGR  TYGDDLLG+LL E++    N +    ++ +IMDECKTF
Sbjct  265  VERLLMEIIESRKDCAEIGRSCTYGDDLLGMLLSEIKMTGRNKSACSPSMQVIMDECKTF  324

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+T ALLLTWT+MLLATN SWQ+KVR EV +VC+G+ PS+  L KL+LL+ VINE+
Sbjct  325  FFAGHDTAALLLTWTIMLLATNRSWQDKVRAEVTRVCDGENPSVHHLPKLSLLNMVINES  384

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP +LLPRMAFED KLGDLH+PKGL+IWIPVLAIHHSEE+WGKDVNEF PERF S+
Sbjct  385  LRLYPPASLLPRMAFEDIKLGDLHVPKGLSIWIPVLAIHHSEELWGKDVNEFNPERFASK  444

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             +S GR F+PFA G RNCVGQ +A+MEAKI+LAML+SRFSF ISD+YRHAPV V++VKPK
Sbjct  445  PFSSGR-FMPFAMGQRNCVGQYFAMMEAKIILAMLVSRFSFTISDSYRHAPVTVLTVKPK  503

Query  901  YGVQIRLNPL  930
            YGVQI L PL
Sbjct  504  YGVQICLKPL  513



>ref|XP_003532338.1| PREDICTED: cytokinin hydroxylase-like [Glycine max]
Length=520

 Score =   484 bits (1245),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 230/312 (74%), Positives = 273/312 (88%), Gaps = 3/312 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFG+SY+KGK+IF LLT+LQ  C+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  208  TADIISRTEFGTSYQKGKKIFHLLTLLQTRCAQASRHLCIPGSRFFPSKYNREIKSLKME  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGF--RLNLPLIMDECK  354
            VE LLMEIIQSRKDC EIGR ++YG+DLLG+LL EMQ+ KGN N     +NL L+MD+CK
Sbjct  268  VETLLMEIIQSRKDCVEIGRSNSYGNDLLGMLLNEMQKKKGNGNNNNSSINLQLVMDQCK  327

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
            TFFFAGHETTALLLTWTVMLLA+N SWQ+KVR EV  VC+G  PS++QLSKLTLL  VIN
Sbjct  328  TFFFAGHETTALLLTWTVMLLASNKSWQDKVRAEVTNVCDGGIPSLDQLSKLTLLHMVIN  387

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E++RLYPP ++LPRM FED  LGDL+IPKGL+IWIPVLAIHHSE++WGKD NEF PERF 
Sbjct  388  ESMRLYPPASVLPRMVFEDIVLGDLYIPKGLSIWIPVLAIHHSEKLWGKDANEFNPERFT  447

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            S+S+ PGR FLPFA+GPRNCVGQ++ALMEAKI+LAMLISRFSF IS+NYRHAPVVV+++K
Sbjct  448  SKSFVPGR-FLPFASGPRNCVGQAFALMEAKIILAMLISRFSFTISENYRHAPVVVLTIK  506

Query  895  PKYGVQIRLNPL  930
            PKYGVQ+ L PL
Sbjct  507  PKYGVQVCLKPL  518



>ref|XP_004141504.1| PREDICTED: cytokinin hydroxylase-like [Cucumis sativus]
Length=552

 Score =   484 bits (1246),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 233/313 (74%), Positives = 268/313 (86%), Gaps = 5/313 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SS+EKGK+IF LLTVLQ LC+Q++RHLC PG+RF+PSKYN EIK L  +
Sbjct  241  TADIISRTEFESSFEKGKQIFHLLTVLQHLCAQASRHLCLPGSRFFPSKYNREIKALKGK  300

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENK--GNSNGFRLNLPLIMDECK  354
            VE LLMEIIQSR+DC EIGR S+YG+DLLG+LL EMQ+ K  GN NG  LNL +IMDECK
Sbjct  301  VEELLMEIIQSRRDCVEIGRSSSYGNDLLGMLLNEMQKKKLDGN-NGLSLNLQIIMDECK  359

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
            TFFFAGHETTALLLTWTVMLLATNP+WQ KVR EVM VC  + PS   LSKL+LLS VIN
Sbjct  360  TFFFAGHETTALLLTWTVMLLATNPTWQNKVRAEVMAVCGSETPSFHHLSKLSLLSMVIN  419

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E+LRLYPP ++LPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD NEF PERF 
Sbjct  420  ESLRLYPPASILPRMAFEDIKLGDLEIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFA  479

Query  715  -SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
             S+ ++ G  F+PFA+GPRNCVGQS+ALME KI+LAMLIS+FSF ISD+YRHAPVVV+++
Sbjct  480  NSKPFTSGG-FIPFASGPRNCVGQSFALMETKIILAMLISKFSFTISDSYRHAPVVVLTI  538

Query  892  KPKYGVQIRLNPL  930
            KPKYGVQ+ L PL
Sbjct  539  KPKYGVQVCLEPL  551



>ref|XP_004163729.1| PREDICTED: cytokinin hydroxylase-like [Cucumis sativus]
Length=552

 Score =   484 bits (1245),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 233/313 (74%), Positives = 268/313 (86%), Gaps = 5/313 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SS+EKGK+IF LLTVLQ LC+Q++RHLC PG+RF+PSKYN EIK L  +
Sbjct  241  TADIISRTEFESSFEKGKQIFHLLTVLQHLCAQASRHLCLPGSRFFPSKYNREIKALKGK  300

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENK--GNSNGFRLNLPLIMDECK  354
            VE LLMEIIQSR+DC EIGR S+YG+DLLG+LL EMQ+ K  GN NG  LNL +IMDECK
Sbjct  301  VEELLMEIIQSRRDCVEIGRSSSYGNDLLGMLLNEMQKKKLDGN-NGLSLNLQIIMDECK  359

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
            TFFFAGHETTALLLTWTVMLLATNP+WQ KVR EVM VC  + PS   LSKL+LLS VIN
Sbjct  360  TFFFAGHETTALLLTWTVMLLATNPTWQNKVRAEVMAVCGSETPSFHHLSKLSLLSMVIN  419

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E+LRLYPP ++LPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD NEF PERF 
Sbjct  420  ESLRLYPPASILPRMAFEDIKLGDLEIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFA  479

Query  715  -SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
             S+ ++ G  F+PFA+GPRNCVGQS+ALME KI+LAMLIS+FSF ISD+YRHAPVVV+++
Sbjct  480  NSKPFTSGG-FIPFASGPRNCVGQSFALMETKIILAMLISKFSFTISDSYRHAPVVVLTI  538

Query  892  KPKYGVQIRLNPL  930
            KPKYGVQ+ L PL
Sbjct  539  KPKYGVQVCLKPL  551



>ref|XP_003541283.1| PREDICTED: cytokinin hydroxylase-like [Glycine max]
 gb|KHN47661.1| Cytokinin hydroxylase [Glycine soja]
Length=512

 Score =   482 bits (1241),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 225/310 (73%), Positives = 270/310 (87%), Gaps = 6/310 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFG+SY+KGK+IF LLT LQ   +Q+TRHL +PG+RF+PSKYN EIK++ +E
Sbjct  207  TADIISRTEFGTSYQKGKQIFYLLTQLQSRVAQATRHLFFPGSRFFPSKYNREIKSMKME  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SRKDC E+GR ++YG+DLLG+LL E+++  G      LNL L+MDECKTF
Sbjct  267  VERLLMEIIESRKDCVEMGRSNSYGNDLLGILLDEIKKEGGT-----LNLQLVMDECKTF  321

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWT MLLA+NP WQ+KVR EV +V  G+ PS++QLSKLTLL  VINE+
Sbjct  322  FFAGHETTALLLTWTAMLLASNPHWQDKVRAEVKEVFKGEIPSVDQLSKLTLLHMVINES  381

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            +RLYPP TLLPRMAF+D +LGDLHIPKGL+IWIPVLAIHHSEE+WGKD NEF PERF SR
Sbjct  382  MRLYPPATLLPRMAFKDIELGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFASR  441

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S+ PGR F+PFA+GPRNCVGQ++A+MEAKI+LAMLISRFSF IS+NYRHAPVVV+++KPK
Sbjct  442  SFMPGR-FIPFASGPRNCVGQTFAIMEAKIILAMLISRFSFTISENYRHAPVVVLTIKPK  500

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  501  YGVQVCLKPL  510



>ref|XP_003552729.2| PREDICTED: cytokinin hydroxylase-like [Glycine max]
 gb|KHN17316.1| Cytokinin hydroxylase [Glycine soja]
Length=519

 Score =   479 bits (1234),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 226/312 (72%), Positives = 270/312 (87%), Gaps = 3/312 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFG+SY+KGK+IF LLT+LQ  C+Q++RHLC PG+RF+PSKYN EIK+L +E
Sbjct  207  TADIISRTEFGTSYQKGKKIFHLLTLLQSRCAQASRHLCIPGSRFFPSKYNREIKSLKME  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLN--LPLIMDECK  354
            VE LLMEIIQSRKDC EIGR ++YG+DLLG+LL EMQ+ K  +     +  L L+MD+CK
Sbjct  267  VETLLMEIIQSRKDCVEIGRSNSYGNDLLGMLLNEMQKKKKGNGNNNSSINLQLVMDQCK  326

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
            TFFFAGHETTALLLTWTVMLLA+N SWQ+KVR EV  VCNG  PS++QLSKLTLL  VIN
Sbjct  327  TFFFAGHETTALLLTWTVMLLASNTSWQDKVRAEVKSVCNGGIPSLDQLSKLTLLHMVIN  386

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E++RLYPP ++LPRM FED  LGDL+IPKGL+IWIPVLAIHHSE++WGKD NEF PERF 
Sbjct  387  ESMRLYPPASVLPRMVFEDIVLGDLYIPKGLSIWIPVLAIHHSEKLWGKDANEFNPERFT  446

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            S+S+ PGR FLPFA+GPRNCVGQ++ALMEAKI+LAMLISRFSF IS+NYRHAPVV++++K
Sbjct  447  SKSFVPGR-FLPFASGPRNCVGQAFALMEAKIILAMLISRFSFTISENYRHAPVVILTIK  505

Query  895  PKYGVQIRLNPL  930
            PKYGVQ+ L PL
Sbjct  506  PKYGVQVCLKPL  517



>emb|CAN79415.1| hypothetical protein VITISV_009963 [Vitis vinifera]
Length=530

 Score =   479 bits (1234),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 229/325 (70%), Positives = 271/325 (83%), Gaps = 17/325 (5%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGN---------------RF  135
             ADIIS+TEF SSYEKGK+IF LLT LQ LC+Q+++H C P                 ++
Sbjct  206  TADIISKTEFDSSYEKGKQIFHLLTELQNLCAQASKHFCLPEESGRLLSFELTTDSAFKY  265

Query  136  YPSKYNSEIKTLNIEVERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNG  315
            +PSKYN EIK L  EVERLLMEIIQSRKDC EIGR S+YG+DLLGLLL EMQ+ +G+  G
Sbjct  266  FPSKYNREIKALKTEVERLLMEIIQSRKDCVEIGRSSSYGNDLLGLLLNEMQKKRGS--G  323

Query  316  FRLNLPLIMDECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIE  495
            F LNL LIMDECKTFFFAGHETTALLLTWT MLLA+NP+WQ+KVR +V +VCNG+ PS++
Sbjct  324  FSLNLQLIMDECKTFFFAGHETTALLLTWTSMLLASNPTWQDKVRAQVAEVCNGETPSVD  383

Query  496  QLSKLTLLSAVINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIW  675
             LSKLTLL+ VINE++RLYPP T+LPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+W
Sbjct  384  HLSKLTLLNMVINESMRLYPPATVLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELW  443

Query  676  GKDVNEFKPERFISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISD  855
            GKD NEF P+RF  + ++PGR F+PFAAGPRNCVGQS+A+MEAKI+LAML+SRFSF IS 
Sbjct  444  GKDANEFNPDRFAGKMFAPGRHFIPFAAGPRNCVGQSFAMMEAKIILAMLVSRFSFTISQ  503

Query  856  NYRHAPVVVISVKPKYGVQIRLNPL  930
            NYRHAPV+++++KPKYGVQI L PL
Sbjct  504  NYRHAPVIILTIKPKYGVQICLKPL  528



>ref|XP_010528474.1| PREDICTED: cytokinin hydroxylase [Tarenaya hassleriana]
Length=516

 Score =   469 bits (1207),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 228/311 (73%), Positives = 270/311 (87%), Gaps = 4/311 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIIS+T FGSSY+KGK+IF+LL  LQRLC+Q+TRH  +PG+RF+PSKYN EIK+   E
Sbjct  207  TADIISKTMFGSSYDKGKQIFQLLYTLQRLCAQATRHFYFPGSRFFPSKYNREIKSQKRE  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE LLMEIIQSR+DC EIGR S+YG+DLLGLLL +M +NK  ++   LNL LIMDECKTF
Sbjct  267  VEGLLMEIIQSRRDCVEIGRSSSYGNDLLGLLLDDMHKNKSKNH---LNLQLIMDECKTF  323

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FFAGHETTALLLTWT MLLA NP+WQ+KVR+EV QVC  D  PS++ L KLT L+ VINE
Sbjct  324  FFAGHETTALLLTWTAMLLAGNPTWQDKVRDEVRQVCGPDGVPSVDHLPKLTTLNVVINE  383

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGLAIWIPVLAIHHSEE+WGKD NEF PERF++
Sbjct  384  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLAIWIPVLAIHHSEELWGKDANEFNPERFMT  443

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            ++++PGR FLPFAAGPRNC+GQ+YA+MEAKI+LAMLIS+FSF IS+NYRHAPVVV+++KP
Sbjct  444  KTFAPGRHFLPFAAGPRNCIGQTYAMMEAKIILAMLISKFSFTISENYRHAPVVVLTIKP  503

Query  898  KYGVQIRLNPL  930
            K+GVQ+ L PL
Sbjct  504  KHGVQVILKPL  514



>ref|XP_010693131.1| PREDICTED: cytokinin hydroxylase [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   468 bits (1204),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 215/310 (69%), Positives = 262/310 (85%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISR EFGS++EKG +IF LL +LQ+ C+Q++RHLC PG+RF+PSKYN +IK+L  E
Sbjct  206  TADIISRIEFGSNFEKGSKIFNLLNILQKKCAQASRHLCLPGSRFFPSKYNKDIKSLKTE  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE LLMEII+SRK C E+GR  +YG+D+LG+L+ E++  K   +GF LNL LIMDECKTF
Sbjct  266  VEGLLMEIIESRKTCVEMGRSESYGNDILGILMNELKNKK--RDGFSLNLQLIMDECKTF  323

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWT+MLLA+NP WQEK+REEV QVCNG  PS++ L KL LLS +INE+
Sbjct  324  FFAGHETTALLLTWTIMLLASNPEWQEKLREEVAQVCNGATPSMDHLPKLRLLSMIINES  383

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHH +E+WG D NEF P+RF S+
Sbjct  384  LRLYPPATLLPRMAFEDIKLGDLLIPKGLSIWIPVLAIHHDKELWGNDANEFNPDRFASK  443

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S+   R FLPF AGPRNC+GQS+A+MEAKI+LAML+S+F F ISDNYRH+PVVV+++KPK
Sbjct  444  SFVSSR-FLPFGAGPRNCIGQSFAVMEAKIILAMLVSKFRFKISDNYRHSPVVVLTIKPK  502

Query  901  YGVQIRLNPL  930
            +GVQ+ L PL
Sbjct  503  HGVQVCLEPL  512



>gb|KEH25339.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=509

 Score =   467 bits (1201),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 217/310 (70%), Positives = 262/310 (85%), Gaps = 7/310 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIIS+TEF +SY+KGK+IF LLT LQ LC+Q+TR    PG+R++PS YN EIK+L +E
Sbjct  205  TADIISKTEFSTSYKKGKQIFHLLTQLQGLCAQATRQHSLPGSRYFPSTYNKEIKSLKME  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR  +YG+DLLG+LL E+Q++        LNL L+MDECKTF
Sbjct  265  VERLLMEIIQSRKDCVEIGRSKSYGNDLLGMLLDEIQKSGS------LNLQLVMDECKTF  318

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWT MLLA+NPSWQEKVR EV ++ N   PSI+Q SKL +L  VINE+
Sbjct  319  FFAGHETTALLLTWTAMLLASNPSWQEKVRIEVKEIFNQGTPSIDQFSKLNVLHMVINES  378

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            +RLYPP TLLPRMAF+D  LGDL+IPKGL++WIPVLAIHHSEE+WGKD NEF P+RF S+
Sbjct  379  MRLYPPATLLPRMAFQDIVLGDLYIPKGLSVWIPVLAIHHSEELWGKDANEFNPQRFASK  438

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S+ PGR F+PFA+GPRNCVGQS+A+MEAKI+LAMLIS+FSF IS+NY+HAP+ V+++KPK
Sbjct  439  SFMPGR-FIPFASGPRNCVGQSFAMMEAKIILAMLISKFSFTISENYKHAPITVLTIKPK  497

Query  901  YGVQIRLNPL  930
            YGVQI L PL
Sbjct  498  YGVQICLKPL  507



>ref|XP_010263673.1| PREDICTED: cytokinin hydroxylase-like [Nelumbo nucifera]
Length=519

 Score =   465 bits (1196),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 227/310 (73%), Positives = 270/310 (87%), Gaps = 2/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              DIISRTEF SSYEKGK+IF LLT LQ LC+QS+RHLC+PG+RF+PS++N EIK+L +E
Sbjct  210  TGDIISRTEFNSSYEKGKQIFHLLTSLQHLCAQSSRHLCFPGSRFFPSRFNREIKSLKME  269

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE+LLMEIIQSRKDC EIGR ++YG+DLLG+LL E Q+ +  ++GF   L ++MDECKTF
Sbjct  270  VEKLLMEIIQSRKDCVEIGRSTSYGNDLLGMLLAETQKKR--ASGFNFTLQMLMDECKTF  327

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +F GHETT+LLLTWT MLLATNP+WQEKVR EV QVC G+ P+ EQLSKL LL+ VINE+
Sbjct  328  YFTGHETTSLLLTWTTMLLATNPTWQEKVRTEVFQVCGGEAPTAEQLSKLNLLNMVINES  387

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP +LLPRMAFED KLGDLHIPKGL+IWIPVLAIHHSEE+WGKDV+EF PERF  R
Sbjct  388  LRLYPPASLLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDVHEFNPERFAGR  447

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
             ++PGR F+PFAAGPRNCVGQS+ALME+K +LAMLISRFSF IS NYRHAPV+V+++KPK
Sbjct  448  PFAPGRHFIPFAAGPRNCVGQSFALMESKTILAMLISRFSFTISKNYRHAPVMVMTLKPK  507

Query  901  YGVQIRLNPL  930
            +GVQI L PL
Sbjct  508  HGVQICLKPL  517



>ref|XP_007151648.1| hypothetical protein PHAVU_004G0646000g, partial [Phaseolus vulgaris]
 gb|ESW23642.1| hypothetical protein PHAVU_004G0646000g, partial [Phaseolus vulgaris]
Length=418

 Score =   457 bits (1175),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 214/310 (69%), Positives = 262/310 (85%), Gaps = 6/310 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFG+SY+KGK+IF LLT LQ   +QSTR L  PG+RF+P+KYN EIK +  E
Sbjct  113  TADIISRTEFGTSYKKGKQIFYLLTQLQTRVAQSTRRLLLPGSRFFPNKYNREIKRMKKE  172

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE+LL EII+ R D  E+GR ++ G+DLLG+LL EM++  G+     LNL L+MDECKTF
Sbjct  173  VEKLLKEIIKGRADYVEMGRSNSCGNDLLGILLDEMKKEGGS-----LNLQLVMDECKTF  227

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHETTALLLTWTVMLLA+NP WQ+KVR EV ++C G+ PS++QLSKLTLL  VINE+
Sbjct  228  FFAGHETTALLLTWTVMLLASNPHWQDKVRAEVKEICKGETPSLDQLSKLTLLQMVINES  287

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            +RLYPP T+LPRM FED +LGDLHIPKGL+IWIPVLAIHHSEE+WG+D NEF P+RF S+
Sbjct  288  MRLYPPATVLPRMVFEDIELGDLHIPKGLSIWIPVLAIHHSEELWGEDANEFNPQRFASK  347

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++PGR F+PFA GPRNCVGQS+A+MEAKI+LAM IS+FSF IS++YRHAPVVV+++KPK
Sbjct  348  SFTPGR-FIPFATGPRNCVGQSFAIMEAKIILAMFISQFSFTISESYRHAPVVVLTIKPK  406

Query  901  YGVQIRLNPL  930
            YGVQ+ L PL
Sbjct  407  YGVQVCLKPL  416



>ref|XP_004516675.1| PREDICTED: cytokinin hydroxylase-like [Cicer arietinum]
Length=511

 Score =   455 bits (1170),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 215/310 (69%), Positives = 259/310 (84%), Gaps = 7/310 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFG++Y+KG +IF LLT LQ LC+QSTR LC PG+RF+PS YN EIK+L +E
Sbjct  207  TADIISRTEFGTNYKKGNQIFNLLTQLQSLCAQSTRKLCLPGSRFFPSTYNREIKSLKME  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC E+GR ++YG+DLLG+LL E+Q++        LNL L+MDECKTF
Sbjct  267  VERLLMEIIQSRKDCVEMGRSNSYGNDLLGMLLDEIQKSG------TLNLQLVMDECKTF  320

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHET ALLLTWT MLLA+NP WQ+KVR EV ++ N   PSI+QLSKL +L  VINE+
Sbjct  321  FFAGHETIALLLTWTAMLLASNPIWQDKVRIEVKELFNQGVPSIDQLSKLNVLHMVINES  380

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP TLLPRMAF+D  LGDL+IPKGL+IWIPVLAIHHSEE+WGKD NEF P+RF S+
Sbjct  381  LRLYPPATLLPRMAFQDIVLGDLYIPKGLSIWIPVLAIHHSEELWGKDANEFNPQRFASK  440

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S+  G  F+PFA GPRNCVGQS+A+MEAKI+L MLIS+F F+IS+NY+HAP+ V+++KPK
Sbjct  441  SFMSG-CFIPFAFGPRNCVGQSFAIMEAKIILTMLISKFRFNISENYKHAPITVLTIKPK  499

Query  901  YGVQIRLNPL  930
            YGVQI L  L
Sbjct  500  YGVQICLKAL  509



>ref|XP_009410074.1| PREDICTED: cytokinin hydroxylase-like [Musa acuminata subsp. 
malaccensis]
Length=518

 Score =   452 bits (1164),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 213/310 (69%), Positives = 253/310 (82%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              DIISRTEF SSYEKG++IF+LL  LQ L + S+R+L  PG+RF PS++  EIK + + 
Sbjct  210  TGDIISRTEFDSSYEKGRQIFQLLERLQSLTALSSRYLWIPGSRFLPSRFRREIKQMKVR  269

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQS KD  EIGR S+YG  LLG+LL E Q+ +    GF  +LPL+MDECKTF
Sbjct  270  VERLLMEIIQSSKDGVEIGRSSSYGRGLLGMLLSEAQKKR---EGFSYSLPLVMDECKTF  326

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHET+ALLLTWTVMLLATNP+WQE+ R EV QVC  DPPS E L KLTLL+ +INE+
Sbjct  327  FFAGHETSALLLTWTVMLLATNPTWQERARAEVAQVCGDDPPSSEHLPKLTLLTMIINES  386

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP TLLPRMAFED +LGDLHIPKGL+IWIPVLAIHH   IWG+DV+EF PERF  R
Sbjct  387  LRLYPPATLLPRMAFEDIRLGDLHIPKGLSIWIPVLAIHHDATIWGEDVHEFNPERFAGR  446

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++  R FLPFA+GPRNCVGQ+YA+MEAKI+LAML+S FSF IS+NYRHAP+ V+++KPK
Sbjct  447  SFALTRHFLPFASGPRNCVGQAYAMMEAKIILAMLLSSFSFAISNNYRHAPINVLTLKPK  506

Query  901  YGVQIRLNPL  930
            YGV + L PL
Sbjct  507  YGVPVHLRPL  516



>ref|XP_008801159.1| PREDICTED: cytokinin hydroxylase-like [Phoenix dactylifera]
Length=515

 Score =   449 bits (1154),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 213/310 (69%), Positives = 253/310 (82%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF+L+  LQ+L +Q+ R+L  PG+RF+PSKY SEIK +  E
Sbjct  207  TADIISRTEFASSYEKGKKIFKLIEKLQKLTAQAGRYLWIPGSRFFPSKYYSEIKEVRGE  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERL+ EII+SRKD  EIGR S+YG DLLG+LL E Q+     +GF  NL ++MDECKTF
Sbjct  267  VERLMTEIIESRKDGVEIGRSSSYGKDLLGMLLAETQKK---GDGFSYNLEMVMDECKTF  323

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
             FAGHET+ALLLTWT+MLLATNP WQEK R EV QVC  +PPS + LSKL LL+ +INE+
Sbjct  324  IFAGHETSALLLTWTIMLLATNPLWQEKARAEVEQVCGDEPPSTDHLSKLNLLNMIINES  383

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPPV++LPRM FED KLG+LHIPKGL+IWIPVLAIHH  EIWGKD +EF PERF SR
Sbjct  384  LRLYPPVSVLPRMVFEDIKLGNLHIPKGLSIWIPVLAIHHDSEIWGKDAHEFNPERFASR  443

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++  R FLPFA+GPRNCVGQ +A MEAKIVLAML+S FSF I+ NYRHAP+ V+++KPK
Sbjct  444  SFALTRNFLPFASGPRNCVGQGFATMEAKIVLAMLLSHFSFTITKNYRHAPINVLTLKPK  503

Query  901  YGVQIRLNPL  930
            YGV I L PL
Sbjct  504  YGVPIHLKPL  513



>ref|XP_009391406.1| PREDICTED: cytokinin hydroxylase-like [Musa acuminata subsp. 
malaccensis]
Length=515

 Score =   444 bits (1141),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 207/310 (67%), Positives = 253/310 (82%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              DII+ TEFGSSYE G++IF LL  LQ L ++++R++  PGNRF+PSK++ EIK LN +
Sbjct  207  TGDIIAGTEFGSSYENGRQIFHLLEQLQNLTARTSRYIWIPGNRFFPSKFSREIKELNRK  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V +LLM+ IQSR+D AEIGR S+YG+ LL  LL E Q+    +NGF  +L L++DECKTF
Sbjct  267  VGKLLMDSIQSRRDVAEIGRSSSYGNGLLATLLAETQKR---TNGFSYSLQLVIDECKTF  323

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHET+ALLLTW +MLLATNP+WQEK R EV QVC  DPPS E L KLT+L+ +INE 
Sbjct  324  FFAGHETSALLLTWAMMLLATNPAWQEKARAEVAQVCGDDPPSWEHLPKLTVLNMIINET  383

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP +LLPRMAFED KLGDLHIPKGL++WIPVLAIHH EEIWG+D +EFKPERF  +
Sbjct  384  LRLYPPASLLPRMAFEDIKLGDLHIPKGLSLWIPVLAIHHDEEIWGRDAHEFKPERFAGK  443

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S+S  R FLPFA+GPRNCVGQ+YA+MEAKIVLAML+S FSF IS NYRHAP+ V++++PK
Sbjct  444  SFSINRYFLPFASGPRNCVGQTYAMMEAKIVLAMLLSSFSFTISKNYRHAPINVLTLRPK  503

Query  901  YGVQIRLNPL  930
            +GV I L PL
Sbjct  504  HGVPIHLTPL  513



>ref|XP_006405768.1| hypothetical protein EUTSA_v10027726mg [Eutrema salsugineum]
 gb|ESQ47221.1| hypothetical protein EUTSA_v10027726mg [Eutrema salsugineum]
Length=515

 Score =   441 bits (1135),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 234/311 (75%), Positives = 271/311 (87%), Gaps = 2/311 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS+EKGK +F  LTVLQR C+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  204  TADIISRTEFGSSFEKGKELFHHLTVLQRRCAQATRHLCFPGSRFLPSKYNREIKSLKKE  263

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLL+EIIQSR+DCAE+GR ST+GDDLLGLLL EM +++ N+N    NL LIMDECKTF
Sbjct  264  VERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEM-DSQKNNNKDNNNLQLIMDECKTF  322

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FFAGHETTALLLTWT+MLLA NPSWQEKVR+EV +VC  D  PS++QLSKLT L+ VINE
Sbjct  323  FFAGHETTALLLTWTMMLLADNPSWQEKVRDEVREVCGCDGLPSVDQLSKLTSLNKVINE  382

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD NEF PERF  
Sbjct  383  SLRLYPPATLLPRMAFEDIKLGDLTIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFGG  442

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            R ++PGR F+PFAAGPRNC+GQS+A+MEAKI+LA LIS+FSF IS NYRHAP+VV+++KP
Sbjct  443  RPFAPGRHFIPFAAGPRNCIGQSFAMMEAKIILATLISKFSFTISKNYRHAPIVVLTIKP  502

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  503  KYGVQVILKPL  513



>ref|XP_002888577.1| CYP735A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64836.1| CYP735A2 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   437 bits (1123),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 226/311 (73%), Positives = 269/311 (86%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS +KGK +F LLTVLQRLC+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  205  TADIISRTEFGSSCDKGKELFSLLTVLQRLCAQATRHLCFPGSRFLPSKYNREIKSLKTE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SR+D  EIGR S+YGDDLLGLLL +M  NK N     LN+ +IMDECKTF
Sbjct  265  VERLLMEIIESRRDSVEIGRSSSYGDDLLGLLLNQMDRNKNN-----LNVQMIMDECKTF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQ+KVR+EV QVC  D  PS+EQLS LT L+ VINE
Sbjct  320  FFTGHETTSLLLTWTLMLLAHNPTWQDKVRDEVRQVCGQDGVPSVEQLSSLTSLNKVINE  379

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG+D NEF PERF +
Sbjct  380  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSKELWGEDANEFNPERFTT  439

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            RS++  R F+PFAAGPRNC+GQ++A+MEAKI+LAML+S+FSF+IS+NYRHAP+VV+++KP
Sbjct  440  RSFASSRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFEISENYRHAPIVVLTIKP  499

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  500  KYGVQLVLKPL  510



>gb|KFK33247.1| hypothetical protein AALP_AA6G349900 [Arabis alpina]
Length=480

 Score =   435 bits (1119),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 228/311 (73%), Positives = 270/311 (87%), Gaps = 2/311 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS+EKGK +F  LT+LQR C+Q+TRHLC+PG+RF P+KYN EIK+L  E
Sbjct  169  TADIISRTEFGSSFEKGKELFNHLTILQRRCAQATRHLCFPGSRFIPTKYNREIKSLKQE  228

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLL+EIIQSR++CAE+GR ST+GDDLLGLLL EM  +K N+N    N  LIMDECKTF
Sbjct  229  VERLLIEIIQSRRECAEMGRSSTHGDDLLGLLLNEMDSHKNNNN-DNNNFQLIMDECKTF  287

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FFAGHETTALLLTWT+MLLA NP+WQEKVR+EV +VC  D  PS++QLSKLT L+ VINE
Sbjct  288  FFAGHETTALLLTWTMMLLADNPTWQEKVRDEVKEVCGCDGLPSVDQLSKLTSLNKVINE  347

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WGKD NEF PERF  
Sbjct  348  SLRLYPPATLLPRMAFEDIKLGDLTIPKGLSIWIPVLAIHHSKELWGKDANEFNPERFGG  407

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            R ++PGR F+PFAAGPRNC+GQS+A+MEAKI+LA LIS+F+F IS+NYRHAP+VV+++KP
Sbjct  408  RPFAPGRHFIPFAAGPRNCIGQSFAMMEAKIILATLISKFNFTISNNYRHAPIVVLTIKP  467

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  468  KYGVQVILKPL  478



>ref|XP_009139787.1| PREDICTED: cytokinin hydroxylase [Brassica rapa]
Length=518

 Score =   435 bits (1119),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 230/311 (74%), Positives = 269/311 (86%), Gaps = 2/311 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS+EKGK +F  LTVLQR C+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  207  TADIISRTEFGSSFEKGKELFNHLTVLQRRCAQATRHLCFPGSRFLPSKYNREIKSLKKE  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLL+EIIQSR+DCAE+GR ST+GDDLLGLLL EM ++  N N    NL LIMDECKTF
Sbjct  267  VERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEM-DSHKNKNNDNNNLQLIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FFAGHETTALLLTWT+MLLA NP+WQEKVR+E+ +VC  D  PS++QLSKLT L+ VINE
Sbjct  326  FFAGHETTALLLTWTMMLLADNPTWQEKVRDEIREVCGCDGLPSVDQLSKLTSLNKVINE  385

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD NEF PERF  
Sbjct  386  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFGG  445

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            + ++PGR F+PFAAGPRNC+GQS+A+MEAKI+LA LIS+F+F IS NYRHAP+VV+++KP
Sbjct  446  KPFAPGRHFIPFAAGPRNCIGQSFAMMEAKIILATLISKFNFAISKNYRHAPIVVLTIKP  505

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  506  KYGVQVILKPL  516



>ref|NP_176882.1| cytokinin hydroxylase [Arabidopsis thaliana]
 sp|Q9ZW95.1|C7352_ARATH RecName: Full=Cytokinin hydroxylase; AltName: Full=Cytochrome 
P450 35A2 [Arabidopsis thaliana]
 gb|AAD10659.1| putative Cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAS47628.1| At1g67110 [Arabidopsis thaliana]
 gb|AAT06445.1| At1g67110 [Arabidopsis thaliana]
 gb|AEE34597.1| cytokinin hydroxylase [Arabidopsis thaliana]
Length=512

 Score =   434 bits (1116),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 226/311 (73%), Positives = 265/311 (85%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS +KGK +F LLTVLQRLC+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  205  TADIISRTEFGSSCDKGKELFSLLTVLQRLCAQATRHLCFPGSRFLPSKYNREIKSLKTE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII SRKD  EIGR S+YGDDLLGLLL +M  NK N     LN+ +IMDECKTF
Sbjct  265  VERLLMEIIDSRKDSVEIGRSSSYGDDLLGLLLNQMDSNKNN-----LNVQMIMDECKTF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQ+ VR+EV QVC  D  PS+EQLS LT L+ VINE
Sbjct  320  FFTGHETTSLLLTWTLMLLAHNPTWQDNVRDEVRQVCGQDGVPSVEQLSSLTSLNKVINE  379

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS E+WG+D NEF PERF +
Sbjct  380  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSNELWGEDANEFNPERFTT  439

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            RS++  R F+PFAAGPRNC+GQ++A+MEAKI+LAML+S+FSF IS+NYRHAP+VV+++KP
Sbjct  440  RSFASSRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFAISENYRHAPIVVLTIKP  499

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  500  KYGVQLVLKPL  510



>emb|CDY01664.1| BnaC04g30880D [Brassica napus]
Length=511

 Score =   434 bits (1116),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 229/311 (74%), Positives = 268/311 (86%), Gaps = 2/311 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS+EKGK +F  LTVLQR C+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  200  TADIISRTEFGSSFEKGKELFNHLTVLQRRCAQATRHLCFPGSRFLPSKYNREIKSLKKE  259

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLL+EIIQSR+DCAE+GR ST+GDDLLGLLL EM ++  N N    NL LIMDECKTF
Sbjct  260  VERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEM-DSHKNKNNDNNNLQLIMDECKTF  318

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FFAGHETTALLLTWT+MLLA NP+WQEKVR+E+ +VC  D  PS++QLSKLT L+ VINE
Sbjct  319  FFAGHETTALLLTWTMMLLADNPTWQEKVRDEIREVCGCDGLPSVDQLSKLTSLNKVINE  378

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD NEF PERF  
Sbjct  379  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFGG  438

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            + ++PGR F+PFAAGPRNC+GQS+A+MEAKI+LA LIS+F+F IS NYRHAP+VV+++KP
Sbjct  439  KPFAPGRHFIPFAAGPRNCIGQSFAMMEAKIILATLISKFNFAISKNYRHAPIVVLTIKP  498

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L P 
Sbjct  499  KYGVQVILKPF  509



>gb|KFK41112.1| hypothetical protein AALP_AA2G087500 [Arabis alpina]
Length=473

 Score =   432 bits (1112),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 224/311 (72%), Positives = 267/311 (86%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSSY+KGK +F LLTVLQRLCSQ+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  166  TADIISRTEFGSSYDKGKELFSLLTVLQRLCSQATRHLCFPGSRFLPSKYNREIKSLKTE  225

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLM+II SR+D  EIGR S++GDDLLGLLL +M  N+ N     LN+ +IMDECKTF
Sbjct  226  VERLLMDIIDSRRDSIEIGRSSSHGDDLLGLLLNQMDRNRNN-----LNVQMIMDECKTF  280

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQ+KVR EV QVC  D  PS+EQLS LT L+ VINE
Sbjct  281  FFTGHETTSLLLTWTLMLLAHNPTWQDKVRHEVRQVCGEDGVPSVEQLSSLTSLNKVINE  340

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGD+ IPKGL+IWIPVLAIHHS+E+WG+D +EF PERF +
Sbjct  341  SLRLYPPATLLPRMAFEDIKLGDIIIPKGLSIWIPVLAIHHSKELWGEDADEFNPERFTA  400

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            RS++  R F+PFAAGPRNC+GQS+A+MEAKI+LAML+S+FSF IS+NYRHAP+VV+++KP
Sbjct  401  RSFASSRHFMPFAAGPRNCIGQSFAMMEAKIILAMLVSKFSFTISENYRHAPIVVLTIKP  460

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  461  KYGVQLVLKPL  471



>ref|XP_010511627.1| PREDICTED: cytokinin hydroxylase [Camelina sativa]
Length=512

 Score =   433 bits (1114),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 224/311 (72%), Positives = 266/311 (86%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS +KGK +F LLTVLQRLC+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  205  TADIISRTEFGSSCDKGKELFSLLTVLQRLCAQATRHLCFPGSRFLPSKYNREIKSLKTE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SR+D  EIGR S+YGDDLLGLLL +M  NK N     LN+ +IMDECKTF
Sbjct  265  VERLLMEIIESRRDSVEIGRSSSYGDDLLGLLLNQMDSNKNN-----LNVQMIMDECKTF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQ+KVR+EV QVC  D  PS+EQLS  T L+ VINE
Sbjct  320  FFTGHETTSLLLTWTLMLLAHNPTWQDKVRDEVRQVCGQDGVPSVEQLSSFTSLNKVINE  379

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG+D NEF PERF +
Sbjct  380  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSKELWGEDANEFNPERFAT  439

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            RS++  R F+PFAAGPRNC+GQ++A+MEAKI+LAML+S+FSF +SD YRHAP+VV+++KP
Sbjct  440  RSFASNRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFAVSDTYRHAPIVVLTIKP  499

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  500  KYGVQLILKPL  510



>ref|XP_010435747.1| PREDICTED: cytokinin hydroxylase [Camelina sativa]
Length=518

 Score =   433 bits (1114),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 231/312 (74%), Positives = 271/312 (87%), Gaps = 4/312 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS+EKGK +F  LTVLQR C+Q+TRHLC+PG+RF PSKYN EIK+L +E
Sbjct  207  TADIISRTEFGSSFEKGKELFNHLTVLQRRCAQATRHLCFPGSRFLPSKYNREIKSLKME  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLL+EIIQSR+DCAE+GR ST+GDDLLGLLL EM  +K N+N    NL LIMDECKTF
Sbjct  267  VERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEMDSDKNNNN-NNNNLQLIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQV--CNGDPPSIEQLSKLTLLSAVIN  534
            FFAGHETTALLLTWT+MLLA NP+WQEKVR+EV +V  C+G  PS+++LSKLT LS VIN
Sbjct  326  FFAGHETTALLLTWTMMLLADNPTWQEKVRDEVREVFGCDG-LPSVDRLSKLTSLSKVIN  384

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E+LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD N+F PERF 
Sbjct  385  ESLRLYPPATLLPRMAFEDLKLGDLTIPKGLSIWIPVLAIHHSEELWGKDANQFNPERFG  444

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
             R ++ GR F+PFAAGPRNC+GQ +ALMEAKI+LA LIS+F+F IS+NYRHAP+VV+++K
Sbjct  445  GRPFASGRHFIPFAAGPRNCIGQQFALMEAKIILATLISKFNFTISNNYRHAPIVVLTIK  504

Query  895  PKYGVQIRLNPL  930
            PKYGVQ+ L PL
Sbjct  505  PKYGVQVILKPL  516



>ref|XP_006300450.1| hypothetical protein CARUB_v10020158mg [Capsella rubella]
 gb|EOA33348.1| hypothetical protein CARUB_v10020158mg [Capsella rubella]
Length=512

 Score =   433 bits (1113),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 225/311 (72%), Positives = 267/311 (86%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS +KGK +F LLTVLQRLC+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  205  TADIISRTEFGSSCDKGKELFSLLTVLQRLCAQATRHLCFPGSRFLPSKYNREIKSLKTE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SR+D  EIGR S+YGDDLLGLLL +M  NK N     LN+ +IMDECKTF
Sbjct  265  VERLLMEIIESRRDSVEIGRSSSYGDDLLGLLLNQMDRNKNN-----LNVQMIMDECKTF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQ+KVREEV QVC  D  PS+EQLS  T L+ VINE
Sbjct  320  FFTGHETTSLLLTWTLMLLAHNPTWQDKVREEVRQVCGQDGVPSVEQLSSFTSLNKVINE  379

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG+D +EF P+RF +
Sbjct  380  SLRLYPPATLLPRMAFEDIKLGDLVIPKGLSIWIPVLAIHHSKELWGEDADEFNPDRFGT  439

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            RS++  R F+PFAAGPRNC+GQ++A+MEAKI+LAML+S+FSF ISDNYRHAP+VV+++KP
Sbjct  440  RSFASNRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFAISDNYRHAPIVVLTIKP  499

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  500  KYGVQLVLKPL  510



>emb|CDX74524.1| BnaA04g08650D [Brassica napus]
Length=473

 Score =   431 bits (1109),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 229/311 (74%), Positives = 268/311 (86%), Gaps = 2/311 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS+EKGK +F  L VLQR C+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  162  TADIISRTEFGSSFEKGKELFNPLPVLQRRCAQATRHLCFPGSRFLPSKYNREIKSLKKE  221

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLL+EIIQSR+DCAE+GR ST+GDDLLGLLL EM ++  N N    NL LIMDECKTF
Sbjct  222  VERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEM-DSHKNKNNDNNNLQLIMDECKTF  280

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FFAGHETTALLLTWT+MLLA NP+WQEKVR+E+ +VC  D  PS++QLSKLT L+ VINE
Sbjct  281  FFAGHETTALLLTWTMMLLADNPTWQEKVRDEIREVCGCDGLPSVDQLSKLTSLNKVINE  340

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD NEF PERF  
Sbjct  341  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFGG  400

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            + ++PGR F+PFAAGPRNC+GQS+A+MEAKI+LA LIS+F+F IS NYRHAP+VV+++KP
Sbjct  401  KPFAPGRHFIPFAAGPRNCIGQSFAMMEAKIILATLISKFNFAISKNYRHAPIVVLTIKP  460

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  461  KYGVQVILKPL  471



>ref|XP_006285498.1| hypothetical protein CARUB_v10006940mg [Capsella rubella]
 gb|EOA18396.1| hypothetical protein CARUB_v10006940mg [Capsella rubella]
Length=520

 Score =   433 bits (1113),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 231/312 (74%), Positives = 269/312 (86%), Gaps = 2/312 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS+EKGK +F  LTVLQR C+Q+TRHLC+PG+RF PSKYN EIK+L +E
Sbjct  207  TADIISRTEFGSSFEKGKELFNHLTVLQRRCAQATRHLCFPGSRFLPSKYNREIKSLKME  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLN-LPLIMDECKT  357
            VERLL+EIIQSR+DCAE+GR ST+GDDLLGLLL EM  +K N+N    N L LIMDECKT
Sbjct  267  VERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEMDSDKNNNNNNNNNNLQLIMDECKT  326

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVIN  534
            FFFAGHETTALLLTWT+MLLA NP+WQEKVR+EV +V   D  PS+++LSKLT LS VIN
Sbjct  327  FFFAGHETTALLLTWTMMLLADNPTWQEKVRDEVREVFGCDSLPSVDRLSKLTSLSKVIN  386

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E+LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD NEF PERF 
Sbjct  387  ESLRLYPPATLLPRMAFEDLKLGDLTIPKGLSIWIPVLAIHHSEELWGKDANEFNPERFG  446

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
             R ++ GR F+PFAAGPRNC+GQ +ALMEAKI+LA LIS+F+F IS+NYRHAP+VV+++K
Sbjct  447  GRPFASGRHFIPFAAGPRNCIGQQFALMEAKIILATLISKFNFTISNNYRHAPMVVLTIK  506

Query  895  PKYGVQIRLNPL  930
            PKYGVQ+ L PL
Sbjct  507  PKYGVQVILKPL  518



>emb|CDY42343.1| BnaC02g17200D [Brassica napus]
Length=538

 Score =   433 bits (1114),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 228/315 (72%), Positives = 268/315 (85%), Gaps = 5/315 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSSY+KGK +F LLTVLQRLC+QSTRHLC+PG+RF PSKYN EIK+L  +
Sbjct  222  TADIISRTEFGSSYDKGKELFSLLTVLQRLCAQSTRHLCFPGSRFLPSKYNREIKSLKTD  281

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFR----LNLPLIMDE  348
            VERLLMEII+SRKD  EIGR  +YGDDLLGLLL +M  NK N N  R    LN+ +IMDE
Sbjct  282  VERLLMEIIESRKDNVEIGRSISYGDDLLGLLLNQMDRNKNNLNMDRNKNNLNVQIIMDE  341

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSA  525
            CKTFFF GHETT+LLLTWT+MLLA NP+WQEKVR EV QVC  D  PS+EQLS LT L+ 
Sbjct  342  CKTFFFTGHETTSLLLTWTLMLLAHNPTWQEKVRHEVRQVCGQDGIPSVEQLSSLTSLNK  401

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            VINE+LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG+D  EF PE
Sbjct  402  VINESLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSKELWGEDATEFNPE  461

Query  706  RFISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
            RF SR+++  R F+PFAAGPRNC+GQ++A+MEAK++LAML+S+FSF IS+NYRHAP+VV+
Sbjct  462  RFSSRNFASSRHFMPFAAGPRNCIGQNFAMMEAKLILAMLVSKFSFTISENYRHAPIVVL  521

Query  886  SVKPKYGVQIRLNPL  930
            ++KPKYGVQ+ L PL
Sbjct  522  TIKPKYGVQLILKPL  536



>ref|XP_006391474.1| hypothetical protein EUTSA_v10018406mg [Eutrema salsugineum]
 gb|ESQ28760.1| hypothetical protein EUTSA_v10018406mg [Eutrema salsugineum]
Length=518

 Score =   432 bits (1112),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 224/311 (72%), Positives = 268/311 (86%), Gaps = 5/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSSY+KGK +F LLTVLQRLC+Q+TRHLC+PG+RF PSKYN +IK+L  E
Sbjct  210  TADIISRTEFGSSYDKGKELFSLLTVLQRLCAQATRHLCFPGSRFLPSKYNRDIKSLKTE  269

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SR+D  EIGR S++GDDLLGLLL +M  NK N+    LN+ +IMDECKTF
Sbjct  270  VERLLMEIIESRRDNVEIGRSSSHGDDLLGLLLNQMDRNKKNN----LNVQMIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQ+KVR EV +VC  D  PS EQLS LT L+ VINE
Sbjct  326  FFTGHETTSLLLTWTLMLLAHNPTWQDKVRREVREVCGQDGVPSAEQLSSLTSLNKVINE  385

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG+D NEF PERF +
Sbjct  386  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSKELWGEDANEFNPERFTT  445

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            RS++  R F+PFAAGPRNC+GQ++A+MEAKI+LAML+S+FSF IS+NYRHAP+VV+++KP
Sbjct  446  RSFASSRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFTISENYRHAPIVVLTIKP  505

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  506  KYGVQLILKPL  516



>ref|XP_010470607.1| PREDICTED: cytokinin hydroxylase-like isoform X2 [Camelina sativa]
 ref|XP_010470608.1| PREDICTED: cytokinin hydroxylase-like isoform X3 [Camelina sativa]
Length=522

 Score =   432 bits (1112),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/311 (72%), Positives = 266/311 (86%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS +KGK +F LLTVLQRLC+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  205  TADIISRTEFGSSCDKGKELFSLLTVLQRLCAQATRHLCFPGSRFLPSKYNREIKSLKTE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SR+D  EIGR S+YGDDLLGLLL +M  NK N     LN+ +IMDECKTF
Sbjct  265  VERLLMEIIESRRDSVEIGRSSSYGDDLLGLLLNQMDSNKNN-----LNVQMIMDECKTF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQ+KVR+EV QVC  D  PS+EQLS  T L+ VINE
Sbjct  320  FFTGHETTSLLLTWTLMLLAHNPTWQDKVRDEVRQVCGQDGVPSVEQLSSFTSLNKVINE  379

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG+D NEF PERF +
Sbjct  380  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSKELWGEDANEFNPERFAT  439

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            +S++  R F+PFAAGPRNC+GQ++A+MEAKI+LAML+S+FSF ISD YRHAP+VV+++KP
Sbjct  440  KSFASNRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFAISDTYRHAPIVVLTIKP  499

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  500  KYGVQLVLKPL  510



>ref|XP_010470606.1| PREDICTED: cytokinin hydroxylase-like isoform X1 [Camelina sativa]
Length=522

 Score =   432 bits (1112),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/311 (72%), Positives = 266/311 (86%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS +KGK +F LLTVLQRLC+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  205  TADIISRTEFGSSCDKGKELFSLLTVLQRLCAQATRHLCFPGSRFLPSKYNREIKSLKTE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SR+D  EIGR S+YGDDLLGLLL +M  NK N     LN+ +IMDECKTF
Sbjct  265  VERLLMEIIESRRDSVEIGRSSSYGDDLLGLLLNQMDSNKNN-----LNVQMIMDECKTF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQ+KVR+EV QVC  D  PS+EQLS  T L+ VINE
Sbjct  320  FFTGHETTSLLLTWTLMLLAHNPTWQDKVRDEVRQVCGQDGVPSVEQLSSFTSLNKVINE  379

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG+D NEF PERF +
Sbjct  380  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSKELWGEDANEFNPERFAT  439

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            +S++  R F+PFAAGPRNC+GQ++A+MEAKI+LAML+S+FSF ISD YRHAP+VV+++KP
Sbjct  440  KSFASNRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFAISDTYRHAPIVVLTIKP  499

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  500  KYGVQLVLKPL  510



>ref|XP_002868774.1| CYP735A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45033.1| CYP735A1 [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   432 bits (1111),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 231/311 (74%), Positives = 267/311 (86%), Gaps = 2/311 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS+EKGK +F  LTVLQR C+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  207  TADIISRTEFGSSFEKGKELFNHLTVLQRRCAQATRHLCFPGSRFLPSKYNREIKSLKKE  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLL+EIIQSR+DCAE+GR ST+GDDLLGLLL EM  +K N+N    NL LIMDECKTF
Sbjct  267  VERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEMDSDKNNNN-NNNNLQLIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FFAGHETTALLLTWT+MLLA NP+WQEKVREEV +V   +  PS++QLSKLT LS VINE
Sbjct  326  FFAGHETTALLLTWTMMLLADNPTWQEKVREEVREVFGRNGLPSVDQLSKLTSLSKVINE  385

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD N+F PERF  
Sbjct  386  SLRLYPPATLLPRMAFEDLKLGDLTIPKGLSIWIPVLAIHHSEELWGKDANQFNPERFGG  445

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            R ++ GR F+PFAAGPRNC+GQ +ALMEAKI+LA LIS+F+F IS NYRHAP+VV+++KP
Sbjct  446  RPFAAGRHFIPFAAGPRNCIGQQFALMEAKIILATLISKFNFTISKNYRHAPIVVLTIKP  505

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  506  KYGVQVILKPL  516



>ref|XP_010450909.1| PREDICTED: cytokinin hydroxylase-like [Camelina sativa]
Length=518

 Score =   432 bits (1110),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 231/312 (74%), Positives = 269/312 (86%), Gaps = 4/312 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS+EKGK +F  LTVLQR C+Q+TRHLC+PG+RF PSKYN EIK L +E
Sbjct  207  TADIISRTEFGSSFEKGKELFNHLTVLQRRCAQATRHLCFPGSRFLPSKYNREIKYLKME  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLL+EIIQSR+DCAE+GR ST+GDDLLGLLL EM  +K N+N    NL LIMDECKTF
Sbjct  267  VERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEMDSDKNNNN-NNNNLQLIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQV--CNGDPPSIEQLSKLTLLSAVIN  534
            FFAGHETTALLLTWT+MLLA NP+WQEKVR+EV +V  C+G  PS+++LSKLT LS VIN
Sbjct  326  FFAGHETTALLLTWTMMLLADNPTWQEKVRDEVREVFGCDG-LPSVDRLSKLTSLSKVIN  384

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E+LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD N+F PERF 
Sbjct  385  ESLRLYPPATLLPRMAFEDLKLGDLTIPKGLSIWIPVLAIHHSEELWGKDANQFNPERFG  444

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
             R ++ GR F+PFAAGPRNC+GQ +ALMEAKI+LA LIS+F F IS+NYRHAP+VV+++K
Sbjct  445  GRPFASGRHFIPFAAGPRNCIGQQFALMEAKIILATLISKFKFTISNNYRHAPIVVLTIK  504

Query  895  PKYGVQIRLNPL  930
            PKYGVQ+ L PL
Sbjct  505  PKYGVQVILKPL  516



>emb|CDY12618.1| BnaA02g12860D [Brassica napus]
Length=529

 Score =   431 bits (1108),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 226/311 (73%), Positives = 266/311 (86%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSSY+KGK +F LLTVLQRLC+QSTRHLC+PG+RF PSKYN EIK+L  +
Sbjct  222  TADIISRTEFGSSYDKGKELFSLLTVLQRLCAQSTRHLCFPGSRFLPSKYNREIKSLKTD  281

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SRKD  EIGR  +YGDDLLGLLL +M  NK N     LN+ +IMDECKTF
Sbjct  282  VERLLMEIIESRKDNVEIGRSISYGDDLLGLLLNQMDRNKNN-----LNVQIIMDECKTF  336

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQEKVR EV QVC  D  PS+EQLS LT L+ VINE
Sbjct  337  FFTGHETTSLLLTWTLMLLAHNPTWQEKVRHEVRQVCGQDGIPSVEQLSSLTSLNKVINE  396

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG+D  EF PERF S
Sbjct  397  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSKELWGEDATEFNPERFSS  456

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            R+++  R F+PFAAGPRNC+GQ++A+MEAK++LAML+S+FSF IS+NYRHAP+VV+++KP
Sbjct  457  RNFASSRHFMPFAAGPRNCIGQNFAMMEAKLILAMLVSKFSFTISENYRHAPIVVLTIKP  516

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  517  KYGVQLILKPL  527



>ref|XP_009127524.1| PREDICTED: cytokinin hydroxylase [Brassica rapa]
Length=517

 Score =   427 bits (1098),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 224/311 (72%), Positives = 265/311 (85%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSSY+KGK +F LLTVLQRLC+QSTRHLC+PG+RF PSKYN EIK+L  +
Sbjct  210  TADIISRTEFGSSYDKGKELFSLLTVLQRLCAQSTRHLCFPGSRFLPSKYNREIKSLKTD  269

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SRKD  EIGR  +YGDDLLGLLL +M  +K N     LN+ +IMDECKTF
Sbjct  270  VERLLMEIIESRKDNVEIGRSISYGDDLLGLLLNQMDRSKNN-----LNVQIIMDECKTF  324

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQEKVR EV QV   D  PS+EQLS LT L+ VINE
Sbjct  325  FFTGHETTSLLLTWTLMLLAHNPTWQEKVRREVRQVSGQDGIPSVEQLSSLTSLNKVINE  384

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG+D  EF PERF S
Sbjct  385  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSKELWGEDATEFNPERFSS  444

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            R+++  R F+PFAAGPRNC+GQ++A+MEAK++LAML+S+FSF IS+NYRHAP+VV+++KP
Sbjct  445  RNFASSRHFMPFAAGPRNCIGQNFAMMEAKLILAMLVSKFSFTISENYRHAPIVVLTIKP  504

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  505  KYGVQLILKPL  515



>ref|XP_010910276.1| PREDICTED: cytokinin hydroxylase-like isoform X2 [Elaeis guineensis]
Length=525

 Score =   427 bits (1098),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/310 (69%), Positives = 251/310 (81%), Gaps = 3/310 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEF SSYEKGK+IF+LL  LQ L +Q++R+L  PG RF+PSKY SEIK +  E
Sbjct  217  TADIISRTEFASSYEKGKKIFKLLDKLQSLTAQASRYLWIPGGRFFPSKYYSEIKEVRGE  276

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERL+ EII SRKD  EIGR S+YG DLLG+LL E Q+     +GF  NL ++MDECKTF
Sbjct  277  VERLMTEIIGSRKDGVEIGRSSSYGKDLLGILLAEAQKK---GDGFSYNLEMVMDECKTF  333

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
             FAGHET+ALLLTWT+MLLA NPSWQ+K R EV QVC   PPS + LSKL LL+ +INE+
Sbjct  334  IFAGHETSALLLTWTMMLLAVNPSWQDKARAEVDQVCGDKPPSADHLSKLNLLNMIINES  393

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP T+LPRM FED KLGDLH+PKGL+IWIPVLAIHH  EIWGKD N+F PERF SR
Sbjct  394  LRLYPPATVLPRMVFEDIKLGDLHVPKGLSIWIPVLAIHHDREIWGKDANDFNPERFASR  453

Query  721  SYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKPK  900
            S++  R FLPFA+GPRNCVGQ++A MEAKIVLAML+S FSF IS NYRHAP+ V++++PK
Sbjct  454  SFALTRNFLPFASGPRNCVGQAFATMEAKIVLAMLLSHFSFTISKNYRHAPINVLTLRPK  513

Query  901  YGVQIRLNPL  930
            YGV I+L PL
Sbjct  514  YGVPIKLKPL  523



>ref|NP_198661.1| cytochrome P450, family 735, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 sp|Q9FF18.1|C7351_ARATH RecName: Full=Cytokinin hydroxylase; AltName: Full=Cytochrome 
P450 35A1 [Arabidopsis thaliana]
 dbj|BAB09357.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AED94318.1| cytochrome P450, family 735, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=518

 Score =   424 bits (1091),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 230/312 (74%), Positives = 267/312 (86%), Gaps = 2/312 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRT+FGSS+EKGK +F  LTVLQR C+Q+TRHLC+PG+RF PSKYN EIK+L  E
Sbjct  207  TADIISRTKFGSSFEKGKELFNHLTVLQRRCAQATRHLCFPGSRFLPSKYNREIKSLKKE  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLL+EIIQSR+DCAE+GR ST+GDDLLGLLL EM  +K N+N    NL LIMDECKTF
Sbjct  267  VERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEMDIDKNNNN-NNNNLQLIMDECKTF  325

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FFAGHETTALLLTWT MLLA NP+WQEKVREEV +V   +  PS++QLSKLT LS VINE
Sbjct  326  FFAGHETTALLLTWTTMLLADNPTWQEKVREEVREVFGRNGLPSVDQLSKLTSLSKVINE  385

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHSEE+WGKD N+F PERF  
Sbjct  386  SLRLYPPATLLPRMAFEDLKLGDLTIPKGLSIWIPVLAIHHSEELWGKDANQFNPERFGG  445

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            R ++ GR F+PFAAGPRNC+GQ +ALMEAKI+LA LIS+F+F IS NYRHAP+VV+++KP
Sbjct  446  RPFASGRHFIPFAAGPRNCIGQQFALMEAKIILATLISKFNFTISKNYRHAPIVVLTIKP  505

Query  898  KYGVQIRLNPLI  933
            KYGVQ+ L PL+
Sbjct  506  KYGVQVILKPLV  517



>ref|XP_010415267.1| PREDICTED: cytokinin hydroxylase-like isoform X4 [Camelina sativa]
Length=473

 Score =   423 bits (1087),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 263/311 (85%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS +KGK +F LLTVLQRLC+Q+TRHLC+PG+RF PSKYN +IK+L  E
Sbjct  166  TADIISRTEFGSSCDKGKELFSLLTVLQRLCAQATRHLCFPGSRFLPSKYNRKIKSLKTE  225

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SR+D  EIGR  +YGDDLLGLLL +M  NK N     LN+ +IMDECKTF
Sbjct  226  VERLLMEIIESRRDSVEIGRSISYGDDLLGLLLNQMDSNKNN-----LNVQMIMDECKTF  280

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQ+KVR+EV QVC  +  PS+EQLS  T L+ VINE
Sbjct  281  FFTGHETTSLLLTWTLMLLAHNPTWQDKVRDEVRQVCGQNGVPSVEQLSSFTSLNKVINE  340

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG D NEF PERF +
Sbjct  341  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSKELWGDDANEFNPERFAT  400

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            ++++  R F+PFAAGPRNC+GQ++A+MEAKI+LAML+ +FSF ISD YRHAP+VV+++KP
Sbjct  401  KTFASNRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVPKFSFAISDTYRHAPIVVLTIKP  460

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  461  KYGVQLVLKPL  471



>ref|XP_010415263.1| PREDICTED: cytokinin hydroxylase-like isoform X1 [Camelina sativa]
 ref|XP_010415264.1| PREDICTED: cytokinin hydroxylase-like isoform X2 [Camelina sativa]
 ref|XP_010415266.1| PREDICTED: cytokinin hydroxylase-like isoform X3 [Camelina sativa]
Length=512

 Score =   423 bits (1087),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 263/311 (85%), Gaps = 6/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFGSS +KGK +F LLTVLQRLC+Q+TRHLC+PG+RF PSKYN +IK+L  E
Sbjct  205  TADIISRTEFGSSCDKGKELFSLLTVLQRLCAQATRHLCFPGSRFLPSKYNRKIKSLKTE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEII+SR+D  EIGR  +YGDDLLGLLL +M  NK N     LN+ +IMDECKTF
Sbjct  265  VERLLMEIIESRRDSVEIGRSISYGDDLLGLLLNQMDSNKNN-----LNVQMIMDECKTF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINE  537
            FF GHETT+LLLTWT+MLLA NP+WQ+KVR+EV QVC  +  PS+EQLS  T L+ VINE
Sbjct  320  FFTGHETTSLLLTWTLMLLAHNPTWQDKVRDEVRQVCGQNGVPSVEQLSSFTSLNKVINE  379

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP TLLPRMAFED KLGDL IPKGL+IWIPVLAIHHS+E+WG D NEF PERF +
Sbjct  380  SLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSKELWGDDANEFNPERFAT  439

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            ++++  R F+PFAAGPRNC+GQ++A+MEAKI+LAML+ +FSF ISD YRHAP+VV+++KP
Sbjct  440  KTFASNRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVPKFSFAISDTYRHAPIVVLTIKP  499

Query  898  KYGVQIRLNPL  930
            KYGVQ+ L PL
Sbjct  500  KYGVQLVLKPL  510



>ref|XP_010910275.1| PREDICTED: cytokinin hydroxylase-like isoform X1 [Elaeis guineensis]
Length=530

 Score =   421 bits (1082),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 251/315 (80%), Gaps = 8/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRF-----YPSKYNSEIK  165
             ADIISRTEF SSYEKGK+IF+LL  LQ L +Q++R+L  PG RF     +PSKY SEIK
Sbjct  217  TADIISRTEFASSYEKGKKIFKLLDKLQSLTAQASRYLWIPGGRFTIFRFFPSKYYSEIK  276

Query  166  TLNIEVERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMD  345
             +  EVERL+ EII SRKD  EIGR S+YG DLLG+LL E Q+     +GF  NL ++MD
Sbjct  277  EVRGEVERLMTEIIGSRKDGVEIGRSSSYGKDLLGILLAEAQKK---GDGFSYNLEMVMD  333

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECKTF FAGHET+ALLLTWT+MLLA NPSWQ+K R EV QVC   PPS + LSKL LL+ 
Sbjct  334  ECKTFIFAGHETSALLLTWTMMLLAVNPSWQDKARAEVDQVCGDKPPSADHLSKLNLLNM  393

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            +INE+LRLYPP T+LPRM FED KLGDLH+PKGL+IWIPVLAIHH  EIWGKD N+F PE
Sbjct  394  IINESLRLYPPATVLPRMVFEDIKLGDLHVPKGLSIWIPVLAIHHDREIWGKDANDFNPE  453

Query  706  RFISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
            RF SRS++  R FLPFA+GPRNCVGQ++A MEAKIVLAML+S FSF IS NYRHAP+ V+
Sbjct  454  RFASRSFALTRNFLPFASGPRNCVGQAFATMEAKIVLAMLLSHFSFTISKNYRHAPINVL  513

Query  886  SVKPKYGVQIRLNPL  930
            +++PKYGV I+L PL
Sbjct  514  TLRPKYGVPIKLKPL  528



>ref|XP_010553918.1| PREDICTED: cytokinin hydroxylase [Tarenaya hassleriana]
Length=515

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 225/312 (72%), Positives = 266/312 (85%), Gaps = 6/312 (2%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            ADIIS T FGS+Y+KGK IF LL VLQRLCSQ+TRHLC+PG+RF PSKYN EIK+L  EV
Sbjct  205  ADIISVTVFGSNYDKGKHIFRLLYVLQRLCSQATRHLCFPGSRFLPSKYNREIKSLKTEV  264

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTFF  363
            ER+LMEIIQ R+D  EI R S+YG+DLLGLLL +M  NK N+    LNL +IMDECKTFF
Sbjct  265  ERMLMEIIQGRRDRVEICRSSSYGNDLLGLLLNDMDNNKTNNL---LNLQIIMDECKTFF  321

Query  364  FAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVINEA  540
            FAGHETT LLLTWTVMLLA NP+WQ+KVR+EV +VC+ D  PS++ LSKLT+L  VINE+
Sbjct  322  FAGHETTTLLLTWTVMLLAGNPTWQDKVRDEVRRVCDRDGVPSVDHLSKLTMLGMVINES  381

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLYPP TLLPRMAFED KLGDL +PKGL+IWIPVLAIHHSE++WGKD NEF P RF ++
Sbjct  382  LRLYPPATLLPRMAFEDIKLGDLIVPKGLSIWIPVLAIHHSEDLWGKDANEFNPGRFAAK  441

Query  721  SYSP--GRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            ++ P  GR F+PFAAGPRNC+GQS+A+MEAKI+LAMLIS+FSF IS+NYRHAPVVV+++K
Sbjct  442  TFGPAGGRHFMPFAAGPRNCIGQSFAMMEAKIILAMLISKFSFTISENYRHAPVVVLTIK  501

Query  895  PKYGVQIRLNPL  930
            PKYGVQ+ L PL
Sbjct  502  PKYGVQVILKPL  513



>ref|NP_001175823.1| Os09g0403300 [Oryza sativa Japonica Group]
 dbj|BAD36323.1| putative cytochrome P450 monooxygenase CYP72A5 [Oryza sativa 
Japonica Group]
 dbj|BAD36321.1| putative cytochrome P450 monooxygenase CYP72A5 [Oryza sativa 
Japonica Group]
 dbj|BAH94551.1| Os09g0403300 [Oryza sativa Japonica Group]
Length=535

 Score =   392 bits (1007),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 193/319 (61%), Positives = 240/319 (75%), Gaps = 10/319 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             DIISRTEF +SY+ GKRIF LL  LQRL S+S+RHL  PG++++PSKY  EI+ LN E+
Sbjct  215  GDIISRTEFNTSYDTGKRIFLLLEHLQRLTSRSSRHLWIPGSQYFPSKYRREIRRLNGEL  274

Query  184  ERLLMEIIQSRKDCAEIGR--ISTYGDDLLGLLLKEMQENKGNSNG----FRLNLPLIMD  345
            E +LME I+  ++ A+ GR  ++TYG  LL +LL EM+E + N  G    F  +  L++D
Sbjct  275  EAVLMESIRRSREIADEGRAAVATYGRGLLAMLLSEMEEKEKNGGGGGGEFSYDAQLVID  334

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECKTFFFAGHET+ALLLTW +MLLATNP+WQEK R EV  VC   PPS + LSKLT+L  
Sbjct  335  ECKTFFFAGHETSALLLTWAIMLLATNPAWQEKARTEVAAVCGDHPPSADHLSKLTVLQM  394

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            +I E LRLYPP TLLPRMAFED +LG L +P+GL++WIPVLAIHH E IWG D +EF+PE
Sbjct  395  IIQETLRLYPPATLLPRMAFEDIQLGGLRLPRGLSVWIPVLAIHHDESIWGPDAHEFRPE  454

Query  706  RFISRSYSPGRI----FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAP  873
            RF   +  P       FLPFAAGPRNCVGQ+YAL+EAK+VLAML+S F F ISDNYRHAP
Sbjct  455  RFAPGARRPSAAGAARFLPFAAGPRNCVGQAYALVEAKVVLAMLLSAFRFAISDNYRHAP  514

Query  874  VVVISVKPKYGVQIRLNPL  930
              V++++PK+GV + L PL
Sbjct  515  ENVLTLRPKHGVPVHLRPL  533



>ref|XP_002445526.1| hypothetical protein SORBIDRAFT_07g020940 [Sorghum bicolor]
 gb|EES15021.1| hypothetical protein SORBIDRAFT_07g020940 [Sorghum bicolor]
Length=528

 Score =   382 bits (982),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 186/322 (58%), Positives = 241/322 (75%), Gaps = 11/322 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A DII+RTEF +SY+ GKRIF+L+  LQRL ++S+RHL  PG+++ PSKY  EIK LN E
Sbjct  209  AGDIIARTEFDTSYDTGKRIFDLIEELQRLTARSSRHLWVPGSQYLPSKYRREIKRLNGE  268

Query  181  VERLLMEIIQSRKDCAEIGRI--STYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECK  354
            +E+LL E I+  ++ A+ GR   S  G  LLG+LL EM++NK N      +  +++DECK
Sbjct  269  LEQLLKESIERSREIADEGRTPSSACGMGLLGMLLAEMEKNK-NDGELGYDAQMMIDECK  327

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
            TFFFAGHET+ALLLTW +MLLATNPSWQ+K R EV  VC G PP+ + L KLT+L  VIN
Sbjct  328  TFFFAGHETSALLLTWAIMLLATNPSWQDKARAEVAGVCGGAPPTADHLPKLTVLQMVIN  387

Query  535  EALRLYPPVTLLPRMAFEDFKLG-----DLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFK  699
            E LRLYPP TLLPRMAFED  LG     +L +PKG ++WIP+LAIHH E +WG D +EF+
Sbjct  388  ETLRLYPPATLLPRMAFEDITLGSGPGDELRVPKGASLWIPLLAIHHDEAVWGADAHEFR  447

Query  700  PERFISRSYSP--GRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAP  873
            P+RF      P  GR FLPFA+GPRNCVGQ+YA++EAK+VLA++++ F F ISD YRHAP
Sbjct  448  PDRFAPGRPRPWAGR-FLPFASGPRNCVGQAYAMVEAKVVLAVMLASFRFGISDEYRHAP  506

Query  874  VVVISVKPKYGVQIRLNPLI*Q  939
            V V++++P++GV +RL PL  Q
Sbjct  507  VNVLTLRPRHGVPVRLLPLTPQ  528



>dbj|BAK00632.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   379 bits (974),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 246/316 (78%), Gaps = 7/316 (2%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             DIISRTEF +SYE GKRIF LL  LQRL ++S+R+L  PG++++PSKY  EI  LN E+
Sbjct  211  GDIISRTEFDTSYETGKRIFHLLEDLQRLTARSSRYLWIPGSQYFPSKYRREIGRLNGEL  270

Query  184  ERLLMEIIQSRKDCAEIGRI-STYGDDLLGLLLKEMQENK----GNSNGFRLNLPLIMDE  348
            E +++E I+  ++ A+ GR  STYG  LL +LL E+++ +    G+   F  +  L++DE
Sbjct  271  EGVVLESIRRSREIADEGRTTSTYGRGLLAMLLAEVEKKREKGAGDDGKFSYDTRLVIDE  330

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CKTFFFAGHET+ALLLTWT+MLLAT+P WQ+K R EV QVC  DPPS +QLSKLT+L  +
Sbjct  331  CKTFFFAGHETSALLLTWTLMLLATHPEWQDKARAEVAQVCGDDPPSADQLSKLTVLQMI  390

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            I+E LRLYPP TLLPRMAFED +LGDLH+P+GL++WIPVLAIHH E IWG D +EF PER
Sbjct  391  IHETLRLYPPATLLPRMAFEDIRLGDLHLPRGLSVWIPVLAIHHDESIWGADAHEFHPER  450

Query  709  FIS--RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
            F +  RS +    FLPFAAGPRNCVGQ+YAL+EAK+VLAML++ F F ISD+YRHAPV V
Sbjct  451  FAAGRRSSAGAGRFLPFAAGPRNCVGQAYALVEAKVVLAMLLANFRFTISDDYRHAPVNV  510

Query  883  ISVKPKYGVQIRLNPL  930
            ++++PKYGV + L PL
Sbjct  511  LTLRPKYGVPVHLRPL  526



>ref|XP_004973486.1| PREDICTED: cytokinin hydroxylase-like [Setaria italica]
Length=530

 Score =   378 bits (971),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/322 (57%), Positives = 238/322 (74%), Gaps = 13/322 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A DI++RTEF +SY+ GKR+F L+  LQRL ++S+R+L  PG++++PSKY  EIK LN E
Sbjct  209  AGDIVARTEFDTSYDTGKRVFHLIEELQRLTARSSRYLWVPGSQYFPSKYRREIKRLNGE  268

Query  181  VERLLMEIIQSRKDCAEIGRI--STYGDDLLGLLLKEMQENKGNSNGFR------LNLPL  336
            +E+LL E IQ  ++ A+ GR   S  G  LLG+LL EM++ +  +   R       +   
Sbjct  269  LEQLLKESIQRSREIADEGRTPSSACGMGLLGMLLAEMEKKEKKTTRPREGGELGYDTQT  328

Query  337  IMDECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTL  516
            I+DECKTFFFAGHET+ALLLTW +MLLATNPSWQ+K R EV  VC G PP+ + L KLT+
Sbjct  329  IVDECKTFFFAGHETSALLLTWAIMLLATNPSWQDKARAEVAAVCGGAPPTADHLPKLTV  388

Query  517  LSAVINEALRLYPPVTLLPRMAFEDFKL--GDLHIPKGLAIWIPVLAIHHSEEIWGKDVN  690
            L  VI E LRLYPP TLLPRMAFED  L  G+L +P+G ++WIPVLAIHH E +WG D +
Sbjct  389  LQMVIKETLRLYPPATLLPRMAFEDITLGGGELRVPRGASVWIPVLAIHHDEAVWGADAH  448

Query  691  EFKPERFISRSYSP--GRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYR  864
            EF+P+RF      P  GR FLPFA+GPRNCVGQ+YA++EAK+VLAM+++ F F ISD YR
Sbjct  449  EFRPDRFAPGRARPWAGR-FLPFASGPRNCVGQAYAMVEAKVVLAMMLASFRFGISDEYR  507

Query  865  HAPVVVISVKPKYGVQIRLNPL  930
            HAPV V++++P++GV +RL PL
Sbjct  508  HAPVTVLTLRPRHGVPVRLLPL  529



>ref|NP_001146669.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ACL54497.1| unknown [Zea mays]
 gb|AFW62241.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=418

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 236/328 (72%), Gaps = 23/328 (7%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A DII+ TEF ++Y+ GKRIF L+  LQRL + S+R+L  PG++++PSKY  EIK LN E
Sbjct  95   AGDIIACTEFDTTYDTGKRIFRLIEELQRLTACSSRYLWVPGSQYFPSKYRREIKRLNGE  154

Query  181  VERLLMEIIQSRKDCAEIGRI--STYGDDLLGLLLKEMQENKGNSN------GFRLNLPL  336
            +E+LL E IQ  ++ A+ GR   S  G  LLG+LL E ++N+  +       G   +   
Sbjct  155  LEQLLKESIQRSREIADEGRTPSSACGMGLLGMLLAETEKNRNRTKSSNGELGLGYDAQT  214

Query  337  IMDECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTL  516
            ++DECKTFFFAGHET+ALLLTW +MLLATNPSWQ+K R EV  VC   PP+ + L KLT+
Sbjct  215  MIDECKTFFFAGHETSALLLTWAIMLLATNPSWQDKARAEVASVCGDAPPTADHLPKLTV  274

Query  517  LSAVINEALRLYPPVTLLPRMAFEDFKLG----DLHIPKGLAIWIPVLAIHHSEEIWGKD  684
            L  VINE LRLYPP TLLPRMAFED  LG    +L +PKG ++WIPVLAIHH E +WG D
Sbjct  275  LQMVINETLRLYPPATLLPRMAFEDITLGSGADELRVPKGASLWIPVLAIHHDEAVWGAD  334

Query  685  VNEFKPERFISRSYSPGRI------FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFD  846
             +EF+P+RF     +PGR       FLPFA+GPRNCVGQ+YA++EAK+VLAML++ F F 
Sbjct  335  AHEFRPDRF-----APGRARPWAGRFLPFASGPRNCVGQAYAMVEAKVVLAMLLASFRFG  389

Query  847  ISDNYRHAPVVVISVKPKYGVQIRLNPL  930
            ISD YRHAPV V++++ ++GV +RL PL
Sbjct  390  ISDEYRHAPVNVLTLRARHGVPVRLLPL  417



>gb|EAZ09049.1| hypothetical protein OsI_31310 [Oryza sativa Indica Group]
Length=525

 Score =   373 bits (957),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 232/319 (73%), Gaps = 20/319 (6%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             DIISRTEF +SY+ GKRIF LL  LQRL S+S+RHL  PG++++PSKY  EI+ LN E+
Sbjct  215  GDIISRTEFNTSYDTGKRIFLLLEHLQRLTSRSSRHLWIPGSQYFPSKYRREIRRLNGEL  274

Query  184  ERLLMEIIQSRKDCAEIGR--ISTYGDDLLGLLLKEMQENKGNSNG----FRLNLPLIMD  345
            E +LME I+  ++ A+ GR  ++TYG  LL +L+ EM+E + N  G    F  +  L++D
Sbjct  275  EAVLMESIRRSREIADEGRAAVATYGRGLLAMLMSEMEEKEKNGGGGGGEFSYDAQLVID  334

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECKTFFFAGHET+ALLLTW +MLLATNP+WQEK R EV  VC   PP          L  
Sbjct  335  ECKTFFFAGHETSALLLTWAIMLLATNPAWQEKARTEVAAVCGDHPP----------LQM  384

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            +I E LRLYPP TLLPRMAFED +LG L +P+GL++WIPVLAIHH E IWG D +EF+PE
Sbjct  385  IIQETLRLYPPATLLPRMAFEDIQLGGLRLPRGLSVWIPVLAIHHDESIWGPDAHEFRPE  444

Query  706  RFISRSYSPGRI----FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAP  873
            RF   +  P       FLPFAAGPRNCVGQ+YAL+EAK+VLAML+S F F ISDNYRHAP
Sbjct  445  RFAPGARRPSAAGAARFLPFAAGPRNCVGQAYALVEAKVVLAMLLSAFRFAISDNYRHAP  504

Query  874  VVVISVKPKYGVQIRLNPL  930
              V++++PK+GV + L PL
Sbjct  505  ENVLTLRPKHGVPVHLRPL  523



>dbj|BAC24945.1| putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
Length=534

 Score =   363 bits (932),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 228/311 (73%), Gaps = 9/311 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D+I+RTEF +SYE GKRIF L+  LQRL ++S+R+L  PG++++PSKY  EIK LN E
Sbjct  211  AGDVIARTEFDTSYETGKRIFLLIEELQRLTARSSRYLWVPGSQYFPSKYRREIKRLNGE  270

Query  181  VERLLMEIIQSRKDCAEIGRI---STYGDDLLGLLLKEMQENKGNSNGFRL---NLPLIM  342
            +ERLL E I   ++ A+ GR    S  G  LLG+LL EM++ +   NG      +  +++
Sbjct  271  LERLLKESIDRSREIADEGRTPSASPCGRGLLGMLLAEMEKKEAGGNGGGEVGYDAQMMI  330

Query  343  DECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLS  522
            DECKTFFFAGHET+ALLLTW +MLLAT+P+WQ+K R EV  VC G  PS + L KL +L 
Sbjct  331  DECKTFFFAGHETSALLLTWAIMLLATHPAWQDKARAEVAAVCGGGAPSPDSLPKLAVLQ  390

Query  523  AVINEALRLYPPVTLLPRMAFEDFKLGD--LHIPKGLAIWIPVLAIHHSEEIWGKDVNEF  696
             VINE LRLYPP TLLPRMAFED +LG   L +P G ++WIPVLAIHH E  WG+D +EF
Sbjct  391  MVINETLRLYPPATLLPRMAFEDIELGGGALRVPSGASVWIPVLAIHHDEGAWGRDAHEF  450

Query  697  KPERFI-SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAP  873
            +P+RF   R   P   FLPFAAGPRNCVGQ+YA++EAK+ LAML+S F F ISD YRHAP
Sbjct  451  RPDRFAPGRPRPPAGAFLPFAAGPRNCVGQAYAMVEAKVALAMLLSSFRFAISDEYRHAP  510

Query  874  VVVISVKPKYG  906
            V V++++P++G
Sbjct  511  VNVLTLRPRHG  521



>gb|EAZ07069.1| hypothetical protein OsI_29315 [Oryza sativa Indica Group]
Length=534

 Score =   363 bits (932),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 228/311 (73%), Gaps = 9/311 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D+I+RTEF +SYE GKRIF L+  LQRL ++S+R+L  PG++++PSKY  EIK LN E
Sbjct  211  AGDVIARTEFDTSYETGKRIFLLIEELQRLTARSSRYLWVPGSQYFPSKYRREIKRLNGE  270

Query  181  VERLLMEIIQSRKDCAEIGRI---STYGDDLLGLLLKEMQENKGNSNGFRL---NLPLIM  342
            +ERLL E I   ++ A+ GR    S  G  LLG+LL EM++ +   NG      +  +++
Sbjct  271  LERLLKESIDRSREIADEGRTPSASPCGRGLLGMLLAEMEKKEAGGNGGGEVGYDAQMMI  330

Query  343  DECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLS  522
            DECKTFFFAGHET+ALLLTW +MLLAT+P+WQ+K R EV  VC G  PS + L KL +L 
Sbjct  331  DECKTFFFAGHETSALLLTWAIMLLATHPAWQDKARAEVAAVCGGGAPSPDSLPKLAVLQ  390

Query  523  AVINEALRLYPPVTLLPRMAFEDFKLGD--LHIPKGLAIWIPVLAIHHSEEIWGKDVNEF  696
             VINE LRLYPP TLLPRMAFED +LG   L +P G ++WIPVLAIHH E  WG+D +EF
Sbjct  391  MVINETLRLYPPATLLPRMAFEDIELGGGALRVPSGASVWIPVLAIHHDEGAWGRDAHEF  450

Query  697  KPERFI-SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAP  873
            +P+RF   R   P   FLPFAAGPRNCVGQ+YA++EAK+ LAML+S F F ISD YRHAP
Sbjct  451  RPDRFAPGRPRPPAGAFLPFAAGPRNCVGQAYAMVEAKVALAMLLSSFRFAISDEYRHAP  510

Query  874  VVVISVKPKYG  906
            V V++++P++G
Sbjct  511  VNVLTLRPRHG  521



>ref|XP_003572218.1| PREDICTED: cytokinin hydroxylase-like [Brachypodium distachyon]
Length=535

 Score =   359 bits (922),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 180/323 (56%), Positives = 238/323 (74%), Gaps = 13/323 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D+I+RTEFG+SYE GKRIF L+  LQRL ++++R+L  PG++++PSKY  +IK LN E
Sbjct  209  AGDVIARTEFGTSYETGKRIFVLIEELQRLTAKASRYLWVPGSQYFPSKYRRQIKRLNGE  268

Query  181  VERLLMEIIQSRKDCAEIGRI----STYGDDLLGLLLKEMQENKG-NSNGFRLNLPLIMD  345
            +E++L E IQ  ++ A+ GR     +  G  LLG+LL E ++ K  N+ G   +   ++D
Sbjct  269  LEQVLKESIQRSREIADEGRAPSDAACGGRGLLGMLLAETEKKKNENAAGGYYDAQTMID  328

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECKTFFFAGHET+ALLLTW +MLL+T+P WQ+K R EV  VC G PP+ + L KLT+L  
Sbjct  329  ECKTFFFAGHETSALLLTWAIMLLSTHPEWQDKARAEVAHVCGGGPPTADHLPKLTVLQM  388

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGD-----LHIPKGLAIWIPVLAIHHSEEIWGKDVN  690
            VINE LRLYPP TLLPRMAFED  LGD     L +PKG ++WIPVLAIHH E +WG D +
Sbjct  389  VINETLRLYPPATLLPRMAFEDITLGDRESGGLRVPKGASVWIPVLAIHHDEAVWGADAH  448

Query  691  EFKPERFIS---RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNY  861
            EF+P+RF +    S   G  FLPFAAGPRNCVGQ+YA++EAK+VLA +++ F F ISD Y
Sbjct  449  EFRPDRFAASGGGSRPGGGRFLPFAAGPRNCVGQAYAMVEAKVVLATMLAGFRFGISDEY  508

Query  862  RHAPVVVISVKPKYGVQIRLNPL  930
            RHAPV V++++P++GV +RL PL
Sbjct  509  RHAPVNVLTLRPRHGVPVRLLPL  531



>ref|NP_001183425.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ACR36731.1| unknown [Zea mays]
 tpg|DAA61374.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=527

 Score =   358 bits (920),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 187/315 (59%), Positives = 236/315 (75%), Gaps = 11/315 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             DIISRTEF +SY+ GK IF LL  LQRL + S+RHL  PG++++PSKY  EI+ LN E+
Sbjct  216  GDIISRTEFDTSYDTGKLIFHLLEDLQRLTASSSRHLWIPGSQYFPSKYRREIRRLNGEL  275

Query  184  ERLLMEIIQSRKDCAEIGRI-STYGDDLLGLLLKEMQENK--GNSNGFRLNLPLIMDECK  354
            E +L E I  R++ A+ GR  S YG  LL +LL EM++ K    +  F  +L L++DECK
Sbjct  276  EAVLTESIGRRREIADEGRTTSAYGRGLLAMLLAEMEKKKDVAAAERFSYDLQLVIDECK  335

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
            TFFFAGH+T+ALLLTW +MLLAT+P WQ++ R EV +VC  DPPS + LSKLT+L  +I+
Sbjct  336  TFFFAGHDTSALLLTWALMLLATHPEWQDRARAEVARVCGEDPPSYDDLSKLTVLQMIIH  395

Query  535  EALRLYPPVTLLPRMAFEDFKL-GDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
            E LRLYPP TLLPRM FED  L G LH+P+GL++WIPVLAIHH   IWG D +EFKPERF
Sbjct  396  ETLRLYPPATLLPRMVFEDIHLTGGLHLPRGLSVWIPVLAIHHDVSIWGPDAHEFKPERF  455

Query  712  ISRSYSPGR--IFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
             +     GR   FLPFAAGPRNCVGQ+YAL+EAK+VLAML+S F   ISD+YRHAPV V+
Sbjct  456  AA-----GRRPAFLPFAAGPRNCVGQAYALVEAKVVLAMLLSHFRIAISDDYRHAPVNVL  510

Query  886  SVKPKYGVQIRLNPL  930
            +++PK+GV + L PL
Sbjct  511  TLRPKHGVPVHLRPL  525



>ref|XP_002462357.1| hypothetical protein SORBIDRAFT_02g024330 [Sorghum bicolor]
 gb|EER98878.1| hypothetical protein SORBIDRAFT_02g024330 [Sorghum bicolor]
Length=536

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 235/322 (73%), Gaps = 18/322 (6%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             DIISRTEF +SY+ GK IF LL  LQRL + S+RHL  PG++++PSKY  EI  LN E+
Sbjct  218  GDIISRTEFDTSYDTGKLIFRLLEDLQRLTASSSRHLWIPGSQYFPSKYRREITRLNGEL  277

Query  184  ERLLMEIIQSRKDCAEIGRI-STYGDDLLGLLLKEMQENKGNSNG-------FRLNLPLI  339
            E +L E I   ++ A+ GR  S YG  LL +LL EM++ K            F  +L L+
Sbjct  278  EAVLTESIGRSREIADEGRTTSAYGRGLLAMLLAEMEKKKKQDGAAAAEQQQFSYDLQLV  337

Query  340  MDECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLL  519
            +DECKTFFFAGH+T+ALLLTW +MLLAT+P WQ++ R EV +VC  DPPS + LSKLT+L
Sbjct  338  IDECKTFFFAGHDTSALLLTWALMLLATHPEWQDRARAEVARVCGDDPPSYDDLSKLTVL  397

Query  520  SAVINEALRLYPPVTLLPRMAFEDFKL---GDLHIPKGLAIWIPVLAIHHSEEIWGKDVN  690
              +I+E LRLYPP TLLPRM FED +L   G LH+P+GL++WIPVLAIHH E IWG D +
Sbjct  398  QMIIHETLRLYPPATLLPRMVFEDIRLTAAGGLHLPRGLSVWIPVLAIHHDESIWGPDAH  457

Query  691  EFKPERFISRSYSPGR--IFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYR  864
            EF+PERF +     GR   FLPFA+GPRNCVGQ+YAL+EAK+VLAML+S F   ISD+YR
Sbjct  458  EFRPERFAA-----GRRPAFLPFASGPRNCVGQAYALVEAKVVLAMLLSHFRIAISDDYR  512

Query  865  HAPVVVISVKPKYGVQIRLNPL  930
            HAPV V++++PK+GV + L PL
Sbjct  513  HAPVNVLTLRPKHGVPVHLRPL  534



>ref|XP_003578093.1| PREDICTED: cytokinin hydroxylase-like [Brachypodium distachyon]
Length=535

 Score =   353 bits (907),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 236/324 (73%), Gaps = 14/324 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A DIISRTEF +SYE GKRIF LL  LQRL ++S R+L  PG++++PSKY  EI  LN E
Sbjct  210  AGDIISRTEFDTSYETGKRIFHLLEDLQRLTARSGRYLWIPGSQYFPSKYRREIGRLNGE  269

Query  181  VERLLMEIIQSRKDCAEIGRI-STYGDDLLGLLLKEMQENK------GNSNGFRLNLPLI  339
            +E ++ME I+   + A+ GR  STYG  LL +LL EM++ K       +   F  +  L+
Sbjct  270  LECVVMESIRRSGEIADEGRTTSTYGRGLLAMLLAEMEKKKEKAGSTADDGKFSYDTRLV  329

Query  340  MDECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLL  519
            +DECKTFFFAGHET+ALLLTWT+MLLAT+P WQ+K R EV  VC   PPS + L KLT+L
Sbjct  330  IDECKTFFFAGHETSALLLTWTLMLLATHPEWQDKARAEVATVCGDQPPSADHLPKLTVL  389

Query  520  SAVINEALRLYPPVTLLPRMAFEDFKLGD--LHIPKGLAIWIPVLAIHHSEEIWGKDVNE  693
              +I+E LRLYPP TLLPRMAFED  LG+  L +P+GL++WIPVLAIHH E IWG D +E
Sbjct  390  QMIIHETLRLYPPATLLPRMAFEDMTLGEGRLRLPRGLSVWIPVLAIHHDEFIWGADAHE  449

Query  694  FKPERFI-----SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDN  858
            F+PERF        S S    FLPFAAGPRNCVGQ+YAL EAK+VLAML++ F F ISD+
Sbjct  450  FRPERFAPGARRGSSSSGAARFLPFAAGPRNCVGQTYALFEAKVVLAMLLAEFRFAISDD  509

Query  859  YRHAPVVVISVKPKYGVQIRLNPL  930
            YRHAPV V++++PK+GV + L PL
Sbjct  510  YRHAPVNVLTLRPKHGVPVHLRPL  533



>gb|EEE69674.1| hypothetical protein OsJ_29302 [Oryza sativa Japonica Group]
Length=454

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 223/315 (71%), Gaps = 31/315 (10%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             DIISRTEF +SY+ GKRIF LL  LQRL S+S+RHL  PG++++PSKY  EI+ LN E+
Sbjct  163  GDIISRTEFNTSYDTGKRIFLLLEHLQRLTSRSSRHLWIPGSQYFPSKYRREIRRLNGEL  222

Query  184  ERLLMEIIQSRKDCAEIGR--ISTYGDDLLGLLLKEMQENKGNSNG----FRLNLPLIMD  345
            E +LME I+  ++ A+ GR  ++TYG  LL +LL EM+E + N  G    F  +  L++D
Sbjct  223  EAVLMESIRRSREIADEGRAAVATYGRGLLAMLLSEMEEKEKNGGGGGGEFSYDAQLVID  282

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECKTFFFAGHET+ALLLTW +MLLATNP+WQEK R EV  VC   PPS + LSKLT+L  
Sbjct  283  ECKTFFFAGHETSALLLTWAIMLLATNPAWQEKARTEVAAVCGDHPPSADHLSKLTVLQM  342

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            +I E LRLYPP TLLPRMAFED +LG L +P+GL++WIPVLAIHH E IWG D +EF+PE
Sbjct  343  IIQETLRLYPPATLLPRMAFEDIQLGGLRLPRGLSVWIPVLAIHHDESIWGPDAHEFRPE  402

Query  706  RFISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
            R                         +YAL+EAK+VLAML+S F F ISDNYRHAP  V+
Sbjct  403  R-------------------------AYALVEAKVVLAMLLSAFRFAISDNYRHAPENVL  437

Query  886  SVKPKYGVQIRLNPL  930
            +++PK+GV + L PL
Sbjct  438  TLRPKHGVPVHLRPL  452



>ref|XP_004956775.1| PREDICTED: cytokinin hydroxylase-like [Setaria italica]
Length=542

 Score =   347 bits (889),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 186/329 (57%), Positives = 236/329 (72%), Gaps = 25/329 (8%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             DIISRTEF +SY+ GKRIF LL  LQRL ++S+RHL  PG++++PSKY  EI+ LN E+
Sbjct  217  GDIISRTEFDTSYDTGKRIFHLLEDLQRLTARSSRHLWIPGSQYFPSKYRREIRRLNGEL  276

Query  184  ERLLMEIIQSRKDCAEIGR-ISTYGDDLLGLLLKEMQENK---GNSNG-------FRLNL  330
            E +L E I   ++ A+ GR  S YG  LL +LL EM+  K   G + G       F  +L
Sbjct  277  EAVLTESIGRSREIADEGRATSAYGRGLLAMLLTEMERKKQDDGAAAGGRKQQQQFSYDL  336

Query  331  PLIMDECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKL  510
             L++DECKTFFFAGH+T+ALLLTW +MLLAT+  WQ++ R EV +VC   PPS + LSKL
Sbjct  337  QLVIDECKTFFFAGHDTSALLLTWALMLLATHHEWQDRARAEVARVCGDAPPSYDDLSKL  396

Query  511  TLLSAVINEALRLYPPVTLLPRMAFEDFKLG-------DLHIPKGLAIWIPVLAIHHSEE  669
             +L  +I+E LRLYPP TLLPRM FED +LG        LH+P GL++WIPVLAIHH E 
Sbjct  397  NVLQMIIHETLRLYPPATLLPRMVFEDIRLGGGIGGGESLHLPAGLSVWIPVLAIHHDES  456

Query  670  IWGKDVNEFKPERFISRSYSPGR--IFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSF  843
            IWG D +EF+PERF S     GR   FLPFAAGPRNCVGQ+YAL+EAK+VLAML+ +F  
Sbjct  457  IWGPDAHEFRPERFAS-----GRRPAFLPFAAGPRNCVGQAYALVEAKVVLAMLLQQFRL  511

Query  844  DISDNYRHAPVVVISVKPKYGVQIRLNPL  930
             ISD+YRHAPV V++++PK+GV + L PL
Sbjct  512  AISDDYRHAPVNVLTLRPKHGVPVHLRPL  540



>gb|EPS57598.1| hypothetical protein M569_17219, partial [Genlisea aurea]
Length=264

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 179/271 (66%), Positives = 218/271 (80%), Gaps = 12/271 (4%)
 Frame = +1

Query  130  RFYPSKYNSEIKTLNIEVERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS  309
            R++PSKYN EI+ L  EVERLLMEIIQ R+D  EIGR S+YG+DLLG+LL+  + ++   
Sbjct  1    RYFPSKYNREIRALKSEVERLLMEIIQCRRDAVEIGRSSSYGNDLLGVLLEREKSSE---  57

Query  310  NGFRLNLPLIMDECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQ---VCNG-  477
                LNL LIMDE KTFFFAGH+TTALLLTWT +LLA NP+WQ+KVR EV     V  G 
Sbjct  58   ----LNLQLIMDELKTFFFAGHDTTALLLTWTALLLAQNPTWQDKVRAEVNHAWGVGGGP  113

Query  478  DPPSIEQLSKLTLLSAVINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIH  657
             P S++QLSKLT L+ VINE+LRLYPP  LLPR AFED +L DLHIPKGL+IWIPVLAIH
Sbjct  114  TPSSVDQLSKLTTLNMVINESLRLYPPAALLPRTAFEDIQLDDLHIPKGLSIWIPVLAIH  173

Query  658  HSEEIWGKDVNEFKPERFISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRF  837
            HSEEIWG+D NEF P RF + + S  R FLPFA+GPRNC+GQ +A+ME KI+LA+LI+RF
Sbjct  174  HSEEIWGEDANEFNPARFKTSNPS-RRTFLPFASGPRNCLGQGFAMMEVKIILAILIARF  232

Query  838  SFDISDNYRHAPVVVISVKPKYGVQIRLNPL  930
             F IS+NYRHAPVVV+++KPKYGV++RL+P+
Sbjct  233  KFAISENYRHAPVVVLTLKPKYGVRLRLSPV  263



>ref|XP_008671701.1| PREDICTED: cytokinin hydroxylase-like [Zea mays]
Length=671

 Score =   338 bits (868),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 224/300 (75%), Gaps = 11/300 (4%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             DIIS TEF +SY+ GK IF LL  LQRL + S+RHL  PG+++ PSKY SEI+ LN E+
Sbjct  242  GDIISHTEFDTSYDTGKLIFRLLEDLQRLTASSSRHLWIPGSQYIPSKYRSEIRRLNGEL  301

Query  184  ERLLMEIIQSRKDCAEIGRI-STYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            E +L E I   ++ A+ GR  S YG  LL +LL EM+E K     F  +L L++DECKTF
Sbjct  302  EAVLTESIGRSREIADEGRTTSAYGRGLLAMLLAEMEEKKAEQ--FSYDLQLVVDECKTF  359

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+T+ALLLTW +MLLAT+P WQ + R EV +VC  D PS + LSKLT+L  +I+E 
Sbjct  360  FFAGHDTSALLLTWALMLLATHPEWQNRARAEVARVCGDDLPSYDDLSKLTVLQMIIHET  419

Query  541  LRLYPPVTLLPRMAFEDFKL-GDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            LRLYPP TLLPRM FED +L G LH+P+GL++WIPVLAIHH E IWG D NEF+PERF +
Sbjct  420  LRLYPPATLLPRMVFEDIRLTGGLHLPRGLSVWIPVLAIHHDESIWGPDANEFRPERFAA  479

Query  718  RSYSPGR--IFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
                 GR  +FLPFA+GPRNCVGQ+YAL+EAK+VLAML+S F   ISD+YRHAPV V+++
Sbjct  480  -----GRRPLFLPFASGPRNCVGQAYALVEAKVVLAMLLSHFRIAISDDYRHAPVNVLTL  534



>ref|XP_002992582.1| hypothetical protein SELMODRAFT_186869 [Selaginella moellendorffii]
 gb|EFJ06388.1| hypothetical protein SELMODRAFT_186869 [Selaginella moellendorffii]
Length=529

 Score =   300 bits (767),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 145/316 (46%), Positives = 211/316 (67%), Gaps = 9/316 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYP-SKYNSEIKTLNIE  180
            ADIIS T FGSSY KG+++FE L  +Q   S+  R+   PG    P S+ N  I+    +
Sbjct  210  ADIISHTAFGSSYLKGQKVFETLRAIQEELSKVDRYNYVPGKSMNPFSELNRAIRNGQKK  269

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKG-NSNGFRLNLPL----IMD  345
            V+ LL+EI+ +R+   + G  S YG DLLGL+L E+  ++  + +G +  L      +++
Sbjct  270  VDNLLLEIVHARQQLKDSGASSNYGSDLLGLMLDEVDSSRSFSGSGIKPELAFTSESLIE  329

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECKTF+ AGHETTA L+TW +MLLATNP+WQE+ R EV++VC    P  E  SKL ++  
Sbjct  330  ECKTFYVAGHETTAKLITWAMMLLATNPTWQERARAEVLEVCKSGVPDSEAASKLKIVGM  389

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            V+NE LRLYPP   L R A ED KLG+L +P+G  + +P+L+I H +E+WG+D NEF P+
Sbjct  390  VLNETLRLYPPAVFLVRTAMEDTKLGNLMVPEGTGVLVPILSILHDKEVWGEDANEFNPQ  449

Query  706  RFISRSYSPGR---IFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            RF     +  +    FLPF+ GPR C+GQ +ALMEAK+ L M++ RFSF+IS +Y+H+PV
Sbjct  450  RFADGVANASKHPFAFLPFSHGPRVCLGQGFALMEAKVALTMILHRFSFEISPSYQHSPV  509

Query  877  VVISVKPKYGVQIRLN  924
            + +++ PK+G+ + L+
Sbjct  510  LRLTLTPKHGMPLLLS  525



>gb|ACN39923.1| unknown [Picea sitchensis]
Length=460

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/309 (46%), Positives = 207/309 (67%), Gaps = 5/309 (2%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            ADIIS T FGSSY +GK +FEL   LQ + +++ + +  PG+++ P++ NS    ++  V
Sbjct  143  ADIISHTAFGSSYNEGKEVFELQRQLQEMAAKAEQSVFIPGSQYIPTRKNSHAWKIDRRV  202

Query  184  ERLLMEIIQSRKDCAEIGRIST-YGDDLLGLLLKEMQENKGNSN-GFRLNLPLIMDECKT  357
            + +L  IIQSR +     R    YG DLLG+++   Q+  G S     + +  IM+ECKT
Sbjct  203  KEILNSIIQSRLEPRTTTRAHVGYGSDLLGIMMTANQKELGGSQRNLSMTIDEIMNECKT  262

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFFAGH+TT+ LLTW V LL+ NP WQE +R+EV+ VC  D P  + LSK+  ++ V+NE
Sbjct  263  FFFAGHDTTSNLLTWAVFLLSINPEWQEILRKEVISVCGTDIPDADMLSKMKSMTMVLNE  322

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPP + + R A++  KLG   +PKG  +   +LA+HH+E+ WG D N FKPERF  
Sbjct  323  TLRLYPPASKIIRKAYKAIKLGQFSLPKGAVLSFSILAMHHNEKFWGLDANLFKPERFAA  382

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             +S++      F PF+ GPRNCVGQ++A++EAK VLAM++ R SF +S  Y+HAP+ V++
Sbjct  383  GVSKAAIHPNAFFPFSLGPRNCVGQNFAMLEAKTVLAMILQRLSFSLSPAYKHAPIAVLT  442

Query  889  VKPKYGVQI  915
            ++P+YG+QI
Sbjct  443  LQPQYGMQI  451



>gb|ABR16167.1| unknown [Picea sitchensis]
 gb|ABR16842.1| unknown [Picea sitchensis]
Length=530

 Score =   296 bits (759),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 142/309 (46%), Positives = 207/309 (67%), Gaps = 5/309 (2%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            ADIIS T FGSSY +GK +FEL   LQ + +++ + +  PG+++ P++ NS    ++  V
Sbjct  213  ADIISHTAFGSSYNEGKEVFELQRQLQEMAAKAEQSVFIPGSQYIPTRKNSHAWKIDRRV  272

Query  184  ERLLMEIIQSRKDCAEIGRIST-YGDDLLGLLLKEMQENKGNSN-GFRLNLPLIMDECKT  357
            + +L  IIQSR +     R    YG DLLG+++   Q+  G S     + +  IM+ECKT
Sbjct  273  KEILNSIIQSRLEPRTTTRAHVGYGSDLLGIMMTANQKELGGSQRNLSMTIDEIMNECKT  332

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFFAGH+TT+ LLTW V LL+ NP WQE +R+EV+ VC  D P  + LSK+  ++ V+NE
Sbjct  333  FFFAGHDTTSNLLTWAVFLLSINPEWQEILRKEVISVCGTDIPDADMLSKMKSMTMVLNE  392

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPP + + R A++  KLG   +PKG  +   +LA+HH+E+ WG D N FKPERF  
Sbjct  393  TLRLYPPASKIIRKAYKAIKLGQFSLPKGAVLSFSILAMHHNEKFWGLDANLFKPERFAA  452

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             +S++      F PF+ GPRNCVGQ++A++EAK VLAM++ R SF +S  Y+HAP+ V++
Sbjct  453  GVSKAAIHPNAFFPFSLGPRNCVGQNFAMLEAKTVLAMILQRLSFSLSPAYKHAPIAVLT  512

Query  889  VKPKYGVQI  915
            ++P+YG+QI
Sbjct  513  LQPQYGMQI  521



>ref|XP_002972525.1| hypothetical protein SELMODRAFT_97810 [Selaginella moellendorffii]
 gb|EFJ26611.1| hypothetical protein SELMODRAFT_97810 [Selaginella moellendorffii]
Length=529

 Score =   294 bits (753),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 209/316 (66%), Gaps = 9/316 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYP-SKYNSEIKTLNIE  180
            ADIIS T FGSSY KG+++FE L  +    S+  R+   PG    P S+ N  I+    +
Sbjct  210  ADIISHTAFGSSYLKGQKVFETLRAIPEELSKVDRYNYVPGKSMNPFSELNRAIRNGQKK  269

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKG-NSNGFRLNLPL----IMD  345
            V  LL+EI+ +R+   + G  S YG DLLGL+L E+  ++  + +G +  L      +++
Sbjct  270  VNNLLLEIVHARQQLKDSGASSNYGSDLLGLMLDEVDSSRSFSGSGIKPALAFTSESLIE  329

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECKTF+ AGHETTA L+TW +MLLATNP+WQE+ R EV++VC    P  E  SKL ++  
Sbjct  330  ECKTFYVAGHETTAKLITWAMMLLATNPTWQERARAEVLEVCKSGVPDSEAASKLKIVGM  389

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            V+NE LRLYPP   L R A ED KLG+L +P+G  + +P+L+I H +E+WG+D NEF P+
Sbjct  390  VLNETLRLYPPAVFLVRTAMEDTKLGNLIVPEGTGVLVPILSILHDKEVWGEDANEFNPQ  449

Query  706  RFISRSYSPGR---IFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            RF     +  +    FLPF+ GPR C+GQ +ALMEAK+ L M++ RFSF+IS +Y+H+PV
Sbjct  450  RFADGVANASKHPFAFLPFSHGPRVCLGQGFALMEAKVALTMILHRFSFEISPSYQHSPV  509

Query  877  VVISVKPKYGVQIRLN  924
            + +++ PK+G+ + L+
Sbjct  510  LRLTLTPKHGMPLLLS  525



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 216/316 (68%), Gaps = 11/316 (3%)
 Frame = +1

Query  7    DIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEVE  186
            D+ISR  FGSSYE+G+RIF LL     L +++ + L  PG RF P+K N ++K ++ E++
Sbjct  209  DVISRAAFGSSYEEGRRIFLLLDEQTNLLTETVQSLYVPGWRFLPTKTNKKLKLMDKEIK  268

Query  187  RLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDECK  354
              L E++++R+   + G +    DDLLG+L+    KE++E+ G+     +++  ++DECK
Sbjct  269  DSLRELVKNREKAVKAGEVKN--DDLLGILVESNFKEIEEH-GDRKNMGMSIQDVVDECK  325

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
             F+ AG ETT++LL WT++LLA NP WQ K REEV QV +   P  + LS L +++ ++N
Sbjct  326  LFYIAGQETTSVLLVWTMVLLARNPDWQTKAREEVFQVFSDGKPDPDGLSHLKVMTMILN  385

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF-  711
            E LRLYPPV +L R   +D KLG L +P G  I IPVL IHH +EIWG D +EF+PERF 
Sbjct  386  EVLRLYPPVVMLGRSMAKDMKLGKLLLPAGAVISIPVLLIHHDQEIWGDDAHEFRPERFA  445

Query  712  --ISRSYSPGRI-FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
              +S++    ++ F PF  GPR C+GQ++ALMEAK+VLAM++ RF F++S +Y H+P+ V
Sbjct  446  EGVSKATKSNQLAFFPFGGGPRICIGQNFALMEAKMVLAMILKRFRFELSPSYAHSPITV  505

Query  883  ISVKPKYGVQIRLNPL  930
            I+++P++G  + L+ L
Sbjct  506  ITLRPQHGAHLILHKL  521



>ref|XP_002988271.1| hypothetical protein SELMODRAFT_183651 [Selaginella moellendorffii]
 gb|EFJ10690.1| hypothetical protein SELMODRAFT_183651 [Selaginella moellendorffii]
Length=519

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 200/315 (63%), Gaps = 7/315 (2%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            +DIISR  FGSSY++G R+FELL  +  L  +    L +  ++   SK N +IK +N EV
Sbjct  204  SDIISRAAFGSSYKQGHRVFELLDQVGELVYRKFSSL-WIQSKLPFSKINRDIKAVNAEV  262

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQ-ENKGNSNGFRLNLPLIMDECKTF  360
               L EI+Q RKD    G I  YG DLLG++LKE+  E+     G    +  +M+ECKTF
Sbjct  263  RSTLEEIVQVRKDQTAAGEIEGYGSDLLGVMLKEVDAEHYDAKTGLSFTIDGLMEECKTF  322

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            + AG ET+A  L WT+MLLA NPSWQE+ REEV QVC    P  E LSKL ++  V+NE+
Sbjct  323  YIAGQETSAKWLAWTMMLLAINPSWQERAREEVRQVCQSQAPDAESLSKLKIVGMVLNES  382

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFISR  720
            LRLY P   + R  F+D KLG L  P+G  + IP+L + H ++IWG D NEF+PERF   
Sbjct  383  LRLYSPAVAIVRSCFKDAKLGHLSFPEGSGVIIPILYLLHDKDIWGDDANEFRPERFADG  442

Query  721  SYSPGRI-----FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
              S  +      FLPF+ G R C+GQS+A  EAKI +AM++ RFSF +S NYRH+PV  I
Sbjct  443  ISSASKTQHLFAFLPFSQGQRVCLGQSFAHTEAKIAVAMILQRFSFQLSPNYRHSPVHRI  502

Query  886  SVKPKYGVQIRLNPL  930
            +++P +G+ + L  L
Sbjct  503  ALQPLHGMPLLLQRL  517



>ref|XP_002967823.1| hypothetical protein SELMODRAFT_88220 [Selaginella moellendorffii]
 gb|EFJ31170.1| hypothetical protein SELMODRAFT_88220 [Selaginella moellendorffii]
Length=542

 Score =   289 bits (740),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 203/320 (63%), Gaps = 18/320 (6%)
 Frame = +1

Query  4    ADIISRTEFGS--SYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNI  177
            AD+I+RT F S  S+EKGKR+F+LLT LQ++ +QS R L  P NR  P+  N     +  
Sbjct  214  ADVIARTAFSSTSSHEKGKRVFQLLTCLQKVFAQSNRFLWLPCNRMLPTAANRRASRIKR  273

Query  178  EVERLLMEIIQSRKDCAEIGRIS-TYGDDLLGLLLKEMQENKGNSNGF--RLNLPLIMDE  348
            ++ER L E++  R+     GR    YG D LGL+L E + +K  +     + + P +++E
Sbjct  274  DMERALRELVLERR----AGRQKHGYGSDFLGLMLSESERDKSEAAAAAQQFDTPELVEE  329

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQ--VCNGDPPSIEQLSKLTLLS  522
            CKT FF GHETT+ LLTWT+MLLA NP WQ++ R EVM+        P  + L KL +L 
Sbjct  330  CKTIFFTGHETTSALLTWTLMLLALNPEWQQRGRAEVMEHLPSKSSVPDADVLPKLKILG  389

Query  523  AVINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKP  702
             ++NE LRLYPP   L R +  D  + D+  P+G   WIP++A+HHS+++WG D   F P
Sbjct  390  MILNEVLRLYPPAPALVRESLVDLSIQDVKYPRGTTFWIPIVALHHSKDVWGDDALHFNP  449

Query  703  ERFISRSYSPGRI-------FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNY  861
             RF     +  ++       F+PF+ GPR C+GQS+A+MEAK+VLAM++ RF F IS NY
Sbjct  450  ARFADGVAAACKLQHQKLWSFMPFSLGPRACLGQSFAMMEAKVVLAMILQRFEFKISPNY  509

Query  862  RHAPVVVISVKPKYGVQIRL  921
            RHAPV  I++KP+YG+Q+ L
Sbjct  510  RHAPVTAITLKPRYGMQLML  529



>ref|XP_002981694.1| hypothetical protein SELMODRAFT_115032 [Selaginella moellendorffii]
 gb|EFJ17176.1| hypothetical protein SELMODRAFT_115032 [Selaginella moellendorffii]
Length=542

 Score =   289 bits (740),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 202/320 (63%), Gaps = 18/320 (6%)
 Frame = +1

Query  4    ADIISRTEFGS--SYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNI  177
            AD+I+RT F S  S+EKGKR+F+LLT LQ++ +QS R L  P NR  P+  N     +  
Sbjct  214  ADVIARTAFSSTSSHEKGKRVFQLLTCLQKVFAQSNRFLWLPCNRMLPTAANRRASRIKR  273

Query  178  EVERLLMEIIQSRKDCAEIGRIS-TYGDDLLGLLLKEMQENKGNSNGF--RLNLPLIMDE  348
            ++ER L E++  R+     GR    YG D LGL+L E + +K  +     + + P +++E
Sbjct  274  DMERALRELVLERR----AGRQKHGYGSDFLGLMLSESERDKSEAAAAAQQFDTPELVEE  329

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQ--VCNGDPPSIEQLSKLTLLS  522
            CKT FF GHETT+ LLTWT+MLLA NP WQ++ R EVM+        P  + L KL +L 
Sbjct  330  CKTIFFTGHETTSALLTWTLMLLALNPEWQQRGRAEVMEHLPSKSSVPDADVLPKLKILG  389

Query  523  AVINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKP  702
             ++NEALRLYPP   L R +  D  + D+  P+G   WIP++A+HHS+++WG D   F P
Sbjct  390  MILNEALRLYPPAPALVRESLVDLSIQDVKYPRGTTFWIPIVALHHSKDVWGDDALHFNP  449

Query  703  ERFISRSYSPGRI-------FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNY  861
             RF        ++       F+PF+ GPR C+GQS+A+MEAK+VLAM++ RF   IS NY
Sbjct  450  ARFADGVAGACKLQHQKLWSFMPFSLGPRACLGQSFAMMEAKVVLAMILQRFELKISPNY  509

Query  862  RHAPVVVISVKPKYGVQIRL  921
            RHAPV  I++KPKYG+Q+ L
Sbjct  510  RHAPVTAITLKPKYGMQLML  529



>emb|CBI39923.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 212/317 (67%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D+ISRT FGSSYE+G+RIF+L      L  Q TR +  PG RF+P+K N  ++ ++ E
Sbjct  143  AGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQISNE  202

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R+   ++G  + +  DLLGLL+    ++MQEN    N   +++  +++E
Sbjct  203  VNALLKGIIEKREKAMKVGETANH--DLLGLLMESNYRDMQENDERKN-VGMSIKDVIEE  259

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ + +WQ + REEV++V     P  + L+ L +++ +
Sbjct  260  CKLFYLAGQETTSVLLLWTMVLLSKHSNWQTRAREEVLRVFGNKKPDGDGLNHLKIVTMI  319

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV++L R  F D ++G L++P G+ I +P+L +HH  EIWG+D  EF P R
Sbjct  320  FHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILLLHHDHEIWGEDAKEFNPGR  379

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR CVGQ++A+MEAK+ LAM++ RFSF++S +Y HAP+ 
Sbjct  380  FSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPIS  439

Query  880  VISVKPKYGVQIRLNPL  930
            +I+++P+YG  + L+ L
Sbjct  440  LITMQPQYGAHLILHGL  456



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 211/317 (67%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSYE+G+RIF+L +    L  ++ + +  PG RF P+K N+ +K +  E
Sbjct  205  TADVISRTAFGSSYEEGRRIFQLQSEQAGLVIKALQSIYIPGLRFLPTKRNNRMKEIYGE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
               LL +I+  R+   +IG    + DDLLGLL+    KE+ +N  NS  F + +  ++DE
Sbjct  265  ARVLLRDIVNKREKAMKIGE--AHNDDLLGLLMESNFKEITDNV-NSKNFGMTIDEVIDE  321

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT+ LL WT+++L+ +P WQEK REEV+QV  G  P  + L+ L +++ +
Sbjct  322  CKLFYFAGQETTSTLLVWTMVVLSMHPDWQEKAREEVLQVFGGKDPDFDGLNHLKIVTMI  381

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPP  L+ R  ++  KLG++ +P G+ + +P L +HH  E+WG+D  +F PER
Sbjct  382  LYEVLRLYPPAVLMARGTYKTMKLGEITLPAGVHLAMPTLLVHHDRELWGEDAEDFNPER  441

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF+ GPR C+GQ++AL+E+K+ +AM++ RFSF++S  Y HAP  
Sbjct  442  FSGGVSKATKNQVSFFPFSWGPRICIGQNFALLESKMAIAMILQRFSFELSSTYVHAPYT  501

Query  880  VISVKPKYGVQIRLNPL  930
            VI+++P++G Q+ L+ L
Sbjct  502  VITLQPQHGAQLILHKL  518



>gb|ABR16379.1| unknown [Picea sitchensis]
Length=528

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 201/310 (65%), Gaps = 5/310 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             A+IIS T FGSSY +GK +FEL   LQ + +++ R +  PG+++ P++ N     ++  
Sbjct  212  TANIISHTAFGSSYNEGKEVFELQRELQEMAAKAERSVFIPGSQYIPTRKNRYAWKIDRR  271

Query  181  VERLLMEIIQSRKDCAEIGRIST-YGDDLLGLLLKEMQENKGNSN-GFRLNLPLIMDECK  354
            ++ +L  IIQSR +     R    YG DLLG+++   Q   G S     + +  IMDECK
Sbjct  272  IKEILNSIIQSRLEPRTTTRTHVGYGSDLLGIMMTANQNELGGSQRNLSMTIDEIMDECK  331

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
            TFFFAGHETT+ LLTW   LL+ N  WQE +R+EV+ +C  D P  + LS++  ++ V+N
Sbjct  332  TFFFAGHETTSNLLTWAAFLLSINLDWQEILRKEVISICGTDIPDADMLSRMKSMTMVLN  391

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF-  711
            E LRLYPP   + R A++  KLG   +PKG  +   +LA+HH E++WG D N FKPERF 
Sbjct  392  ETLRLYPPAGRITRKAYKAIKLGHFSLPKGAVMSFSILAMHHDEKLWGPDANLFKPERFA  451

Query  712  --ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
              +S +      F PF+ GPRNC GQ++A++EAK VLAM++ RFSF +S  Y+HAP+ V+
Sbjct  452  AGVSNAAIHPNAFCPFSMGPRNCDGQNFAMLEAKSVLAMILQRFSFSLSPAYKHAPIAVL  511

Query  886  SVKPKYGVQI  915
            +++P++G+QI
Sbjct  512  TLQPQHGMQI  521



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   284 bits (726),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 210/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D+ISRT FGSSYE+G+RIF+L      L  Q ++ +  PG RF P+K N  ++ ++ E
Sbjct  202  AGDVISRTAFGSSYEEGRRIFQLQKEQAHLAVQVSQSIYIPGWRFVPTKTNKRMRQISNE  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R+   ++G   T  DDLLGLL+    KEMQE+ G      ++   +++E
Sbjct  262  VNALLKGIIERREKAMKVG--ETANDDLLGLLMESNYKEMQEH-GERKNVGMSNKDVIEE  318

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ + +WQ + REEV+QV     P  + L+ L +++ +
Sbjct  319  CKLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVFGNKKPDGDGLNHLKIVTMI  378

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPP ++L R  + D ++G +++P G+ + +P+L +HH  EIWG D  +F PER
Sbjct  379  FHEVLRLYPPASMLIRSVYADTEVGGMYLPDGVQVSLPILLLHHDHEIWGDDAKDFNPER  438

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR C+GQ++A+MEAK+ LAM++ RFSF++S +Y HAP+ 
Sbjct  439  FSEGVSKATKGQFAFFPFGYGPRVCIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPIS  498

Query  880  VISVKPKYGVQIRLNPL  930
            VI+++P+YG  + L+ L
Sbjct  499  VITIQPQYGAHLILHGL  515



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   284 bits (726),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/316 (42%), Positives = 206/316 (65%), Gaps = 7/316 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISR  FGSSYE+G+RIFEL        +++   +  PG+RF+P+K N  +K    E
Sbjct  217  TSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKE  276

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQ---ENKGNSNGFRLNLPLIMDEC  351
            V   +  +I +R    E G      DDLLG+LL+      E  GN   F +++P +++EC
Sbjct  277  VRETITRLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKK-FGMSIPEVIEEC  335

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ETT++LL WT++LL  NP WQE+ REEV Q    D P+ ++L +L +++ ++
Sbjct  336  KLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDKPTFDELYRLKIVTMIL  395

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E+LRLYPP+    R   E+ KLG+L +PKG  ++IP + +H  +EIWG+D +EF PERF
Sbjct  396  YESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLDKEIWGEDADEFNPERF  455

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               ++++      + PF AGPR C+GQ++A++EAK+ +AM++ RFSF++S +Y H+P  V
Sbjct  456  SEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQRFSFELSPSYTHSPYTV  515

Query  883  ISVKPKYGVQIRLNPL  930
            +++KPKYG  + ++ L
Sbjct  516  VTLKPKYGAPLIMHRL  531



>ref|XP_008778644.1| PREDICTED: cytochrome P450 734A6-like isoform X2 [Phoenix dactylifera]
Length=517

 Score =   283 bits (725),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/314 (46%), Positives = 205/314 (65%), Gaps = 8/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+IS T FGSSY +GK +F+    LQ L  +S  ++  PG +++PS+ N     L   
Sbjct  206  TADVISHTAFGSSYVEGKEVFQAQKELQTLAGESLLNMNIPGYKYFPSRRNLHRWKLERR  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECKT  357
            V   LM IIQ R D  +    S+Y +DLLGL+++  + N      G  L++  I+DECKT
Sbjct  266  VRNTLMHIIQGRLDSKD----SSYANDLLGLMMESCRSNHDQERKGQILSMNEIIDECKT  321

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFFAG ETT+ LLTWTV+LL TN  WQE++REEV++ C    P+ + LSKL L++ V+ E
Sbjct  322  FFFAGQETTSHLLTWTVLLLCTNEEWQERLREEVLRECGTGIPNADMLSKLKLVTMVLLE  381

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
            ALRLY P  ++ RMA +D  LG+L IPK   + IP+  IH ++E+WG D +EF P R+  
Sbjct  382  ALRLYGPAVMMQRMAAKDLTLGNLVIPKDTRLAIPIAIIHRNKEVWGADADEFNPLRYKN  441

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             IS++       L F+ GPR C+GQS+A++EAKIV+AM++ RFS  +S NY HAP  +++
Sbjct  442  GISKAAKHPNALLAFSIGPRACIGQSFAMLEAKIVIAMILQRFSLSLSPNYIHAPADMLT  501

Query  889  VKPKYGVQIRLNPL  930
            ++P+YG+ I L PL
Sbjct  502  LQPQYGLPILLRPL  515



>ref|XP_008778643.1| PREDICTED: cytochrome P450 734A6-like isoform X1 [Phoenix dactylifera]
Length=518

 Score =   283 bits (725),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 206/315 (65%), Gaps = 9/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPG-NRFYPSKYNSEIKTLNI  177
             AD+IS T FGSSY +GK +F+    LQ L  +S  ++  PG NR++PS+ N     L  
Sbjct  206  TADVISHTAFGSSYVEGKEVFQAQKELQTLAGESLLNMNIPGYNRYFPSRRNLHRWKLER  265

Query  178  EVERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECK  354
             V   LM IIQ R D  +    S+Y +DLLGL+++  + N      G  L++  I+DECK
Sbjct  266  RVRNTLMHIIQGRLDSKD----SSYANDLLGLMMESCRSNHDQERKGQILSMNEIIDECK  321

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
            TFFFAG ETT+ LLTWTV+LL TN  WQE++REEV++ C    P+ + LSKL L++ V+ 
Sbjct  322  TFFFAGQETTSHLLTWTVLLLCTNEEWQERLREEVLRECGTGIPNADMLSKLKLVTMVLL  381

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF-  711
            EALRLY P  ++ RMA +D  LG+L IPK   + IP+  IH ++E+WG D +EF P R+ 
Sbjct  382  EALRLYGPAVMMQRMAAKDLTLGNLVIPKDTRLAIPIAIIHRNKEVWGADADEFNPLRYK  441

Query  712  --ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
              IS++       L F+ GPR C+GQS+A++EAKIV+AM++ RFS  +S NY HAP  ++
Sbjct  442  NGISKAAKHPNALLAFSIGPRACIGQSFAMLEAKIVIAMILQRFSLSLSPNYIHAPADML  501

Query  886  SVKPKYGVQIRLNPL  930
            +++P+YG+ I L PL
Sbjct  502  TLQPQYGLPILLRPL  516



>ref|XP_010644760.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
 emb|CBI39892.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 205/317 (65%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G+RIF+L      L  +    +  PG RF+P+K N  +K ++ E
Sbjct  95   TGDVISRTAFGSSYEEGRRIFQLQKEQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQISKE  154

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R+   E G   T   DLLG+L+    +E+QE++ N+    ++   ++DE
Sbjct  155  VHALLGGIINKREKAMEAGE--TANSDLLGILMESNFREIQEHQNNTK-IGMSAKDVIDE  211

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ +  WQ + REEV+QV   + P  + L+ L +++ +
Sbjct  212  CKLFYLAGQETTSVLLLWTMVLLSQHTDWQARAREEVLQVFGNNKPENDGLNHLKIVTMI  271

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPVT+L RM  +D ++GD++ P G+ + +P + +HH  EIWG D  EF PER
Sbjct  272  FHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTILVHHDHEIWGDDAKEFNPER  331

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      FLPF  GPR C+GQ++A+MEAK  LAM++ RFSF++S +Y HAP  
Sbjct  332  FAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKTALAMILQRFSFELSPSYAHAPFS  391

Query  880  VISVKPKYGVQIRLNPL  930
            +I+++P+YG  + L  L
Sbjct  392  LITIQPQYGAHLILRGL  408



>gb|AFK44453.1| unknown [Lotus japonicus]
Length=287

 Score =   276 bits (705),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            AADIISRTEFG+SY+KGK+IF LL VLQ  C+Q++RHLC+PG+RF+PSKYN EIK L +E
Sbjct  106  AADIISRTEFGTSYKKGKKIFHLLKVLQSRCAQASRHLCFPGSRFFPSKYNREIKALKME  165

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VE LLMEIIQSRKDC EIGR ++YG+DLLG+LL EMQ+ +G+ N   LNL L+MDECKTF
Sbjct  166  VETLLMEIIQSRKDCVEIGRSNSYGNDLLGILLNEMQKKRGDGNS--LNLQLVMDECKTF  223

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLS  522
            FFAGHETTALLLTWTVMLLA+NPSWQ+KVR EV +VCNG+ PS++ LSKLTL+S
Sbjct  224  FFAGHETTALLLTWTVMLLASNPSWQDKVRAEVKRVCNGETPSVDLLSKLTLVS  277



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 212/317 (67%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D+ISRT FGSSYE+G+RIF+L      L  Q TR +  PG RF+P+K N  ++ ++ E
Sbjct  202  AGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQISNE  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R+   ++G  + +  DLLGLL+    ++MQEN    N   +++  +++E
Sbjct  262  VNALLKGIIEKREKAMKVGETANH--DLLGLLMESNYRDMQENDERKN-VGMSIKDVIEE  318

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ + +WQ + REEV++V     P  + L+ L +++ +
Sbjct  319  CKLFYLAGQETTSVLLLWTMVLLSKHSNWQTRAREEVLRVFGNKKPDGDGLNHLKIVTMI  378

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV++L R  F D ++G L++P G+ I +P+L +HH  EIWG+D  EF P R
Sbjct  379  FHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILLLHHDHEIWGEDAKEFNPGR  438

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR CVGQ++A+MEAK+ LAM++ RFSF++S +Y HAP+ 
Sbjct  439  FSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPIS  498

Query  880  VISVKPKYGVQIRLNPL  930
            +I+++P+YG  + L+ L
Sbjct  499  LITMQPQYGAHLILHGL  515



>emb|CBI39937.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 209/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D+ISRT FGSSYE+G+RIF+L      L  Q TR +  PG RF+P+K N  ++ ++ E
Sbjct  143  AGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQISNE  202

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R+   ++G  + +  DLLGLL+    ++MQEN    N   +++  +++E
Sbjct  203  VNALLKGIIEKREKAMKVGETANH--DLLGLLMESNYRDMQENDERKN-VGMSIKDVIEE  259

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ + +WQ   REEV++V     P  + L+ L +++ +
Sbjct  260  CKLFYLAGQETTSVLLLWTMVLLSKHSNWQTHAREEVLRVFGNKKPDGDGLNHLKIVTMI  319

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV++L R  F D ++G L++P G+ I +P+L +HH  EIWG+D  EF P R
Sbjct  320  FHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILLLHHDHEIWGEDAKEFNPGR  379

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR CVGQ++A+MEAK+ LAM++ RFSF++S +Y HAP+ 
Sbjct  380  FSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPIS  439

Query  880  VISVKPKYGVQIRLNPL  930
            +++  P+YG  + L+ L
Sbjct  440  LLTTHPQYGAHLILHGL  456



>ref|XP_007211745.1| hypothetical protein PRUPE_ppa006307mg [Prunus persica]
 gb|EMJ12944.1| hypothetical protein PRUPE_ppa006307mg [Prunus persica]
Length=418

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 212/315 (67%), Gaps = 10/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISR  FGSSYE+G++IF+LL    ++ + + R +  PG RF P+K N + K ++ E
Sbjct  105  TSDVISRAAFGSSYEEGRKIFQLLREEAKVYTVAVRSVYIPGWRFLPTKQNKKTKEIHNE  164

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++ LL  II  R++  + G  +   DDLLG+L+    +E+QE+ GN+    +++  ++ E
Sbjct  165  IKGLLKGIINKREEAMKAGEATK--DDLLGILMESNFREIQEH-GNNKNAGMSIEDVIGE  221

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ N  WQ + REEV+QV   + P+ E+LS L +++ +
Sbjct  222  CKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVLQVFGSNIPTYEELSHLKVVTMI  281

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYP V  LPR   +  +LG L +P G+ + +P+L +HH +E+WG+D NEFKPER
Sbjct  282  LLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILLVHHDKELWGEDANEFKPER  341

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      + PF  GPR C+GQ++A+MEAK+ L++++  F+F++S  Y HAP V
Sbjct  342  FSEGVSKATKNQFTYFPFGGGPRICIGQNFAMMEAKLALSLILQHFTFELSPQYSHAPSV  401

Query  880  VISVKPKYGVQIRLN  924
             I+++P+YG  + L+
Sbjct  402  TITLQPQYGAHLILH  416



>emb|CBI39917.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 210/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G+RIF+L      L  Q TR +  PG RF+P+K N  ++ ++ E
Sbjct  143  TGDVISRTAFGSSYEEGRRIFQLQKEQALLAVQVTRSVYVPGWRFFPTKTNRRMRQISSE  202

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V+ LL  II+ R+   + G   T  DDLLGLL+    +EMQEN    N   +++  +++E
Sbjct  203  VDALLKGIIEKREKAMQAGE--TANDDLLGLLMESNYREMQENDERKN-VGMSIKDVIEE  259

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ + +WQ   REEV++V     P  + L+ L +++ +
Sbjct  260  CKLFYLAGQETTSVLLLWTMVLLSKHSNWQACAREEVLRVFGNKKPDGDDLNHLKIVTMI  319

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV +L R  F D ++G L++P G+ I +P+L IHH ++IWG+D  EF P R
Sbjct  320  FHEVLRLYPPVPMLTRAVFADSQVGGLYLPDGVQIALPILLIHHDDKIWGEDAKEFNPGR  379

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR CVGQ++A+MEAK+ LAM++ RFSF++S +Y HAP+ 
Sbjct  380  FSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPIS  439

Query  880  VISVKPKYGVQIRLNPL  930
            +++++P++G  + L+ L
Sbjct  440  LLTMQPQHGAHLILHGL  456



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/316 (42%), Positives = 206/316 (65%), Gaps = 7/316 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISR  FGSSYE+G+RIFEL        +++   +  PG+RF+P+K N  +K    E
Sbjct  207  TSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKE  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQ---ENKGNSNGFRLNLPLIMDEC  351
            V   +  +I +R    E G      DDLLG+LL+      E  GN   F +++P +++EC
Sbjct  267  VRETITCLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKK-FGMSIPEVIEEC  325

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ETT++LL WT++LL  NP WQE+ REEV Q    D P+ ++L +L +++ ++
Sbjct  326  KLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDKPTFDELYRLKIVTMIL  385

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E+LRLYPP+    R   E+ KLG+L +PKG  ++IP + +H  +EIWG+D +EF PERF
Sbjct  386  YESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLDKEIWGEDADEFNPERF  445

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               ++++      + PF AGPR C+GQ++A++EAK+ +AM++ RFSF++S +Y H+P  V
Sbjct  446  SEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQRFSFELSPSYTHSPYTV  505

Query  883  ISVKPKYGVQIRLNPL  930
            +++KPKYG  + ++ L
Sbjct  506  VTLKPKYGAPLIMHRL  521



>ref|XP_008804072.1| PREDICTED: cytochrome P450 72A15-like [Phoenix dactylifera]
Length=523

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/314 (43%), Positives = 207/314 (66%), Gaps = 9/314 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            AD+ISRT FGS++ +G+RIF L      L   + +++  PG RF P+K N  +K +NIE+
Sbjct  210  ADVISRTAFGSNFREGQRIFHLQEEQAELVIPALQNIYIPGFRFLPTKKNKRMKEINIEI  269

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDEC  351
            + LL  +I  R+     G   T  +DLLGLL+    +  +EN+G S    +++  +++EC
Sbjct  270  QSLLRSMIDRREVAIRKG--GTSNEDLLGLLMESNFRHSKENEGGSKNSGMSIEDVIEEC  327

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAGHETT++LLTWT++ L+ +PSWQ + REEV+QV  G+ P  + LS+L +++ V+
Sbjct  328  KLFYFAGHETTSVLLTWTLVALSLHPSWQARAREEVLQVFGGNKPDYDGLSRLKIVTMVL  387

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPP   L RM +++ KLG    P+G+ + +P++ IHH  E WG+D +EF PERF
Sbjct  388  YEVLRLYPPAVFLLRMTYKEMKLGQFTFPEGVQLLLPIIFIHHDPEFWGEDASEFNPERF  447

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               +S++      F+PF  GPR C+GQS+A+MEAK+ LA ++  F+F +S +Y HAP  V
Sbjct  448  AEGVSKASKIQGAFIPFGGGPRICIGQSFAMMEAKMALARILQHFTFQLSPSYAHAPYTV  507

Query  883  ISVKPKYGVQIRLN  924
             ++ P++G QI L+
Sbjct  508  ATLHPQHGAQIILH  521



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/316 (42%), Positives = 205/316 (65%), Gaps = 7/316 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISR  FGSSYE+G+RIFEL        +++   +  PG+RF+P+K N  +K    E
Sbjct  207  TSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKE  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQ---ENKGNSNGFRLNLPLIMDEC  351
            V   +  +I +R    E G      DDLLG+LL+      E  GN   F +++P +++EC
Sbjct  267  VRETITCLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKK-FGMSIPEVIEEC  325

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ETT++LL WT++LL  NP WQE+ REEV Q    D P+ ++L +L +++ ++
Sbjct  326  KLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDKPTFDELYRLKIVTMIL  385

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E+LRLYPP+    R   E+ KLG+L +PKG  ++IP + +H   EIWG+D +EF PERF
Sbjct  386  YESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLDREIWGEDADEFNPERF  445

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               ++++      + PF AGPR C+GQ++A++EAK+ +AM++ RFSF++S +Y H+P  V
Sbjct  446  SEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQRFSFELSPSYTHSPYTV  505

Query  883  ISVKPKYGVQIRLNPL  930
            +++KPKYG  + ++ L
Sbjct  506  VTLKPKYGAPLIMHRL  521



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 206/317 (65%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G RIF+L      L  +    +  PG RF+P+K N  +K ++ E
Sbjct  202  TGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQISKE  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R+   E G   T   DLLG+L+    +E+QE++ N+    ++   ++DE
Sbjct  262  VHALLGGIINKREKAMEAGE--TANSDLLGILMESNFREIQEHQNNTK-IGMSAKDVIDE  318

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ +P WQ + REEV+QV   + P  + L+ L +++ +
Sbjct  319  CKLFYLAGQETTSVLLLWTMVLLSQHPDWQARAREEVLQVFGNNKPENDGLNHLKIVTMI  378

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPVT+L RM  +D ++GD++ P G+ + +P + +HH  EIWG D  EF PER
Sbjct  379  FHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTILVHHDHEIWGDDAKEFNPER  438

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      FLPF  GPR C+GQ++A+MEAKI LAM++ RFSF++S +Y HAP  
Sbjct  439  FAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKIALAMILQRFSFELSPSYAHAPYS  498

Query  880  VISVKPKYGVQIRLNPL  930
            +I+++P+YG  + L  L
Sbjct  499  LITIQPQYGAHLILRGL  515



>emb|CBI39929.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 208/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G+RIF+L      L  Q TR +  PG RF+P+K N  ++ ++ E
Sbjct  143  TGDVISRTAFGSSYEEGRRIFQLQKEQALLTVQVTRSVYVPGWRFFPTKTNRRMRQISSE  202

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V+ LL  II+ R+   + G   T  DDLLGLL+    +EMQEN    N   +++  +++E
Sbjct  203  VDALLKGIIEKREKAMQAG--ETANDDLLGLLMESNYREMQENDERKN-VGMSIKDVIEE  259

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT+ LL WT++LL+ + +WQ + REEV++V     P  + L+ L +++ +
Sbjct  260  CKLFYLAGQETTSALLLWTMVLLSKHSNWQARAREEVLRVFGNKKPDGDGLNHLKIVTMI  319

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPP  +L R  F D ++G L++P G+ I +P+L IHH ++IWG D  EF P R
Sbjct  320  FHEVLRLYPPAPMLTRAVFADSQVGGLYLPDGVQIALPILLIHHDDKIWGDDAKEFNPGR  379

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR CVGQ++A+MEAK+ LAM++ RFSF++S +Y HAP+ 
Sbjct  380  FSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPIS  439

Query  880  VISVKPKYGVQIRLNPL  930
            +++++P++G  + L+ L
Sbjct  440  LLTMQPQHGAHLILHGL  456



>gb|ABK25130.1| unknown [Picea sitchensis]
Length=517

 Score =   281 bits (718),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 204/313 (65%), Gaps = 5/313 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT  GSSY + K IF L      L ++    +  PG RF P++ N +   L  E
Sbjct  203  TADVISRTALGSSYAEAKHIFNLQDQQMLLTAELVLSVYVPGFRFLPTRKNRQRWKLEKE  262

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECKT  357
            + + + ++I++R+  A+I +  +YG DLLGL++    +  G      R+    I+DECKT
Sbjct  263  IRKCMRQVIEARERTADIEQSGSYGTDLLGLMMSAKNKRVGGKLQDVRMTTEEIIDECKT  322

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP-PSIEQLSKLTLLSAVIN  534
            F+FAGHETT++LLTWT++LL  +  WQ++ R+EV++VC  +  P  + ++ L ++  ++N
Sbjct  323  FYFAGHETTSILLTWTIILLGMHQDWQDRGRKEVLEVCGKNVVPDADSVNHLKIVGMILN  382

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF-  711
            EALRLYPP   L R A +  +LG L IP G  + +P+LAIHH + +WG D NEF P RF 
Sbjct  383  EALRLYPPAVFLQRQAVKPMQLGRLSIPAGTQLLLPILAIHHDQCLWGNDANEFNPARFS  442

Query  712  --ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
              I+++      F+PF  GPR CVGQ++AL+EAK+VLAM++ RFSF  S +Y HAPV+V+
Sbjct  443  EGIAKAVKHPLAFMPFGFGPRICVGQNFALLEAKVVLAMILQRFSFVTSPSYAHAPVMVV  502

Query  886  SVKPKYGVQIRLN  924
            +V+P++G Q+ L+
Sbjct  503  TVRPQHGAQVILH  515



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   281 bits (720),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 206/317 (65%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G RIF+L      L  +    +  PG RF+P+K N  +K ++ E
Sbjct  202  TGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQISKE  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R+   E G   T   DLLG+L+    +E+QE++ N+    ++   ++DE
Sbjct  262  VHALLGGIINKREKAMEAGE--TANSDLLGILMESNFREIQEHQNNTK-IGMSAKDVIDE  318

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ +P WQ + REEV+QV   + P  + L+ L +++ +
Sbjct  319  CKLFYLAGQETTSVLLLWTMVLLSQHPDWQARAREEVLQVFGNNKPENDGLNHLKIVTMI  378

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPVT+L RM  +D ++GD++ P G+ + +P + +HH  EIWG D  EF PER
Sbjct  379  FHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTILVHHDHEIWGDDAKEFNPER  438

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      FLPF  GPR C+GQ++A+MEAKI LAM++ RFSF++S +Y HAP  
Sbjct  439  FAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKIALAMILQRFSFELSPSYAHAPYS  498

Query  880  VISVKPKYGVQIRLNPL  930
            +I+++P+YG  + L  L
Sbjct  499  LITIQPQYGAHLILRGL  515



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score =   281 bits (718),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 204/315 (65%), Gaps = 10/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D ISRT FGS+YE+G+ IFEL     +L  Q ++  C PG RF P+K N  +K    E
Sbjct  205  TGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSQSACIPGWRFLPTKSNKRMKQNRKE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R+   + G   T  DDLLG+LL    KE+QE+ GN     +++  ++DE
Sbjct  265  VNELLWGIIDKREKAMKAG--ETLNDDLLGILLESNFKEIQEH-GNDKNVGMSIKDVIDE  321

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ +P+WQ + REEV+ V   + P  + L+ L ++  +
Sbjct  322  CKIFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMI  381

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            ++E LRLYPPV LL R  +ED ++GD+++P G+ + +P + +HH  EIWG+D  EF PER
Sbjct  382  LHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHHDHEIWGEDAREFNPER  441

Query  709  FISRSYSPGR---IFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +    +    F PF  G R C+GQ++A++EAK+VLAM++ RFSF +S +Y HAP  
Sbjct  442  FSQGALKATKSLVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQRFSFSLSPSYSHAPCS  501

Query  880  VISVKPKYGVQIRLN  924
            ++++KP+YG  + L+
Sbjct  502  LVTLKPQYGAHLILH  516



>ref|XP_002265784.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=526

 Score =   281 bits (718),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 210/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G+RIF+L      L  Q TR +  PG RF+P+K N  ++ ++ E
Sbjct  213  TGDVISRTAFGSSYEEGRRIFQLQKEQALLAVQVTRSVYVPGWRFFPTKTNRRMRQISSE  272

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V+ LL  II+ R+   + G   T  DDLLGLL+    +EMQEN    N   +++  +++E
Sbjct  273  VDALLKGIIEKREKAMQAG--ETANDDLLGLLMESNYREMQENDERKN-VGMSIKDVIEE  329

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ + +WQ   REEV++V     P  + L+ L +++ +
Sbjct  330  CKLFYLAGQETTSVLLLWTMVLLSKHSNWQACAREEVLRVFGNKKPDGDDLNHLKIVTMI  389

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV +L R  F D ++G L++P G+ I +P+L IHH ++IWG+D  EF P R
Sbjct  390  FHEVLRLYPPVPMLTRAVFADSQVGGLYLPDGVQIALPILLIHHDDKIWGEDAKEFNPGR  449

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR CVGQ++A+MEAK+ LAM++ RFSF++S +Y HAP+ 
Sbjct  450  FSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPIS  509

Query  880  VISVKPKYGVQIRLNPL  930
            +++++P++G  + L+ L
Sbjct  510  LLTMQPQHGAHLILHGL  526



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 209/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D+ISRT FGSSYE+G+RIF+L      L  Q TR +  PG RF+P+K N  ++ ++ E
Sbjct  202  AGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQISNE  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R+   ++G  + +  DLLGLL+    ++MQEN    N   +++  +++E
Sbjct  262  VNALLKGIIEKREKAMKVGETANH--DLLGLLMESNYRDMQENDERKN-VGMSIKDVIEE  318

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ + +WQ   REEV++V     P  + L+ L +++ +
Sbjct  319  CKLFYLAGQETTSVLLLWTMVLLSKHSNWQTHAREEVLRVFGNKKPDGDGLNHLKIVTMI  378

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV++L R  F D ++G L++P G+ I +P+L +HH  EIWG+D  EF P R
Sbjct  379  FHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILLLHHDHEIWGEDAKEFNPGR  438

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR CVGQ++A+MEAK+ LAM++ RFSF++S +Y HAP+ 
Sbjct  439  FSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPIS  498

Query  880  VISVKPKYGVQIRLNPL  930
            +++  P+YG  + L+ L
Sbjct  499  LLTTHPQYGAHLILHGL  515



>ref|XP_002992583.1| hypothetical protein SELMODRAFT_135558 [Selaginella moellendorffii]
 gb|EFJ06389.1| hypothetical protein SELMODRAFT_135558 [Selaginella moellendorffii]
Length=508

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 200/306 (65%), Gaps = 16/306 (5%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            AADIIS T FGSSY KG+++F+ L  +    S+  R+   PG RF P   N  ++ L  +
Sbjct  209  AADIISHTAFGSSYLKGQKVFQFLRAIPEQHSKIDRYNYLPGKRFLPFPANFRLRKLYGD  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            ++ LL+ +I+ R+D       S    DLLGL+L E     GNS+    +   +M+ECKTF
Sbjct  269  LDSLLLALIKERRDQ------SGQSHDLLGLMLAE----AGNSS---FDDRAVMEECKTF  315

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            + AGHETTA LLTW++MLLA +P WQE+ R E  +   G  P  + +SKL L++ +++E+
Sbjct  316  YLAGHETTASLLTWSMMLLALHPEWQERARVEAQEAFGGVTPEADSISKLKLINMILHES  375

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPV    R  FED  LGD+ +PKG+ I  PVLAIHH +E+WG+D +EF PERF   
Sbjct  376  LRLYPPVVYFMRACFEDTTLGDILVPKGVGITFPVLAIHHDKELWGEDAHEFNPERFKDG  435

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            ++++      FL F+ GPR CVGQS+ALMEAKI LA ++ RF F +S +YRH PV  +++
Sbjct  436  VAKASKHPNAFLAFSLGPRVCVGQSFALMEAKIALATILQRFRFRLSPSYRHCPVFKVTL  495

Query  892  KPKYGV  909
            +P++G+
Sbjct  496  RPRHGL  501



>gb|EAZ42814.1| hypothetical protein OsJ_27399 [Oryza sativa Japonica Group]
Length=513

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 181/254 (71%), Gaps = 13/254 (5%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D+I+RTEF +SYE GKRIF L+  LQRL ++S+R+L  PG++++PSKY  EIK LN E
Sbjct  211  AGDVIARTEFDTSYETGKRIFLLIEELQRLTARSSRYLWVPGSQYFPSKYRREIKRLNGE  270

Query  181  VERLLMEIIQSRKDCAEIGRI---STYGDDLLGLLLKEMQENKGNSNGFRL---NLPLIM  342
            +ERLL E I   ++ A+ GR    S  G  LLG+LL EM++ +   NG      +  +++
Sbjct  271  LERLLKESIDRSREIADEGRTPSASPCGRGLLGMLLAEMEKKEAGGNGGGEVGYDAQMMI  330

Query  343  DECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLS  522
            DECKTFFFAGHET+ALLLTW +MLLAT+P+WQ+K R EV  VC G  PS + L KL +L 
Sbjct  331  DECKTFFFAGHETSALLLTWAIMLLATHPAWQDKARAEVAAVCGGGAPSPDSLPKLAVLQ  390

Query  523  AVINEALRLYPPVTLLPRMAFEDFKLGD--LHIPKGLAIWIPVLAIHHSEEIWGKDVNEF  696
             VINE LRLYPP TLLPRMAFED +LG   L +P G ++WIPVLAIHH E  WG+D +EF
Sbjct  391  MVINETLRLYPPATLLPRMAFEDIELGGGALRVPSGASVWIPVLAIHHDEGAWGRDAHEF  450

Query  697  KPERFISRSYSPGR  738
            +P+RF     +PGR
Sbjct  451  RPDRF-----APGR  459



>ref|XP_006830577.1| hypothetical protein AMTR_s00117p00134960 [Amborella trichopoda]
 gb|ERM97993.1| hypothetical protein AMTR_s00117p00134960 [Amborella trichopoda]
Length=509

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/314 (43%), Positives = 209/314 (67%), Gaps = 9/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+GKR+F+L    Q L  Q+ R++  PG RF P+K N   K ++ +
Sbjct  201  TGDVISRTAFGSSYEEGKRLFQLQREQQDLVIQAIRNIYIPGFRFLPTKKNIRRKKIDKK  260

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V  +L  IIQ +++    G  +++  DLLGLLL   + N+ N +  R+ +  +++ECK F
Sbjct  261  VRGILKGIIQRKEEAINSGTYNSH--DLLGLLL---ESNRTNDHKNRMTMEDVVEECKLF  315

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQ-VCNGDPPSIEQLSKLTLLSAVINE  537
            +FAGHETT++LLTWT+++L+ +P+WQE+ R+EV+Q V +  PP+++QLS L +++ +++E
Sbjct  316  YFAGHETTSMLLTWTMVVLSKHPTWQERARDEVLQLVGSSTPPTLDQLSHLKIVNMILHE  375

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPP+ L+ R  ++    G L  P G+ + +P + IHH  ++WG D  EFKPERF  
Sbjct  376  VLRLYPPILLIVRETYKKINAGGLDFPPGIQLALPTIIIHHDRDLWGDDAKEFKPERFSD  435

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             +S +      F PF  GPR C+GQ++AL+EAKI L M++  FSF +S +Y HAP   I+
Sbjct  436  GVSNAAKHPLAFFPFGWGPRTCIGQNFALIEAKIALTMILQHFSFHLSPSYTHAPYAQIT  495

Query  889  VKPKYGVQIRLNPL  930
            ++P++G  I L+ L
Sbjct  496  MQPQHGAPIILHKL  509



>ref|XP_010911572.1| PREDICTED: cytochrome P450 CYP72A219-like [Elaeis guineensis]
Length=522

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 207/314 (66%), Gaps = 10/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G+RIF+L T    L  Q+ + +  PG RF P+  N+  K ++ E
Sbjct  209  TGDVISRTAFGSSYEEGRRIFQLQTEQAGLLIQAAQTVYIPGYRFLPTPINNRRKKIDRE  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLL----LKEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R+    +G  S   DDLL L+    LK  QE+ GNS   R+    +++E
Sbjct  269  VRALLRGIIEKREKAINLGEASN--DDLLDLMIKSNLKHFQEH-GNSKNTRMTTEEVIEE  325

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LLTWT+++L+ +PSWQ + REEV+++     P  + L++L +++ +
Sbjct  326  CKLFYFAGQETTSVLLTWTMVVLSMHPSWQVRAREEVLELFGKHRPDYDGLNRLKIVTMI  385

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYP V  L R  ++  K+GD+  P G+ + +PV+ IHH  E WGKD +EF PER
Sbjct  386  LYEVLRLYPSVIQLNRRTYKTMKIGDITCPAGVLLLLPVIFIHHDPEFWGKDASEFNPER  445

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   IS++    + F PF  GPR C+GQS+AL+EAK+ L+M++  FSF++S +Y HAP  
Sbjct  446  FAQGISKASKGQQAFFPFGWGPRTCIGQSFALLEAKMGLSMILQHFSFELSPSYVHAPYT  505

Query  880  VISVKPKYGVQIRL  921
            VI+++P++G QIRL
Sbjct  506  VITLQPQHGAQIRL  519



>ref|XP_008805359.1| PREDICTED: cytochrome P450 734A6-like [Phoenix dactylifera]
Length=518

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/314 (46%), Positives = 207/314 (66%), Gaps = 8/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+IS T FGSSY +GK +F+    LQ L ++S  ++  PG+++ PS+ N     L   
Sbjct  207  TADVISHTAFGSSYAEGKEVFQAQKELQTLAAESLLNVNIPGDKYLPSRRNLHRWKLERR  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECKT  357
            V   LM IIQ R D  +    S+YG+DLLGL+++  + + G    G  L++  I+DECKT
Sbjct  267  VRNTLMHIIQGRLDSKD----SSYGNDLLGLMMESCRSDPGQERKGQILSMNEIIDECKT  322

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFFAG ETT+ LLTWTV LL TN   QE++REEV++ C  + P+ + LSKL L++ V+ E
Sbjct  323  FFFAGQETTSHLLTWTVFLLCTNQELQERLREEVLRECGTEIPNADMLSKLKLVTMVLLE  382

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
            ALRLY PV ++ RMA +D  LG+L IPK   + IP+  IH ++++WG D +EF P RF  
Sbjct  383  ALRLYGPVVVMQRMAAKDMTLGNLVIPKDTRLSIPIAIIHRNKKVWGADADEFNPLRFKN  442

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             IS++       L F+ GPR C+GQ++A++EAK V+AM++ RFS  +S NY HAP  +++
Sbjct  443  GISKAAKHPNALLAFSIGPRACIGQNFAMLEAKTVIAMILQRFSLSLSPNYIHAPADILT  502

Query  889  VKPKYGVQIRLNPL  930
            ++P+YG+ I L PL
Sbjct  503  LQPQYGLPILLRPL  516



>gb|KEH38477.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=353

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/317 (42%), Positives = 210/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A+D+ISR  FGSSYE+GKRIF+L T    L ++    +  PG RF P+     +K ++ +
Sbjct  38   ASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRD  97

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++  L ++I +R+   + G  +   DDLLG+LL    KEM+E+ GN+    ++L  +++E
Sbjct  98   IKASLTDMINNRERALKAGEATK--DDLLGILLESNHKEMEEH-GNNKDVGMSLDDVIEE  154

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+  P WQ + REEV+QV   + P  + LS L +++ +
Sbjct  155  CKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKIVTMI  214

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPPV  L R   +D KLG+L +P G+ +++ ++ +HH  E+WG+D   F PER
Sbjct  215  LYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVFNPER  274

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   + ++ +    F PFA GPR C+GQ+++++EAK+ +AM++ RFSF++S +Y HAP  
Sbjct  275  FSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAHAPAT  334

Query  880  VISVKPKYGVQIRLNPL  930
            VI+++P+YG  I L+ L
Sbjct  335  VITLQPQYGAHIILHKL  351



>ref|XP_002963468.1| hypothetical protein SELMODRAFT_80290 [Selaginella moellendorffii]
 gb|EFJ35339.1| hypothetical protein SELMODRAFT_80290 [Selaginella moellendorffii]
Length=514

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 196/314 (62%), Gaps = 7/314 (2%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRL-CSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            +DIISR  FGSSY+KG ++FELL  +  L C    +   +  +     K N EIKT N +
Sbjct  199  SDIISRAAFGSSYKKGHKVFELLDQVGGLTCFPLAKRFTHCHSMLPICKLNREIKTANSK  258

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQE-NKGNSNGFRLNLPLIMDECKT  357
            +   L EI+Q+R+D    G I  YG DLLG++L E+   +  +  G       +M+ECKT
Sbjct  259  LRSTLEEIVQARRDQKLAGEIDNYGSDLLGIMLDEVDAGHHDDKTGLSFTTDSLMEECKT  318

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            F+ AG ET+A  L WT+MLLA NPSWQE+ REEV QVC    P  E LSKL ++  V+NE
Sbjct  319  FYIAGQETSAKWLAWTMMLLAANPSWQEQAREEVRQVCQSQAPDAESLSKLKIVGMVLNE  378

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP     R  ++D KLG L  P+G  + IP+L + H ++IWG D NEF P+RF  
Sbjct  379  SLRLYPPAVFNVRSCYKDAKLGHLSFPEGSGVIIPILYLLHDKDIWGDDANEFNPQRFAD  438

Query  718  RSYSPGR-----IFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               S  +      FLPF+ G R C+GQS+A +EAK+ +AM++ RFSF +S  YRH+PV  
Sbjct  439  GISSASKSRHSCAFLPFSQGQRVCLGQSFAQIEAKVAMAMILQRFSFRLSPTYRHSPVHR  498

Query  883  ISVKPKYGVQIRLN  924
            ++++P++G+ + L 
Sbjct  499  LALQPQHGLPLLLG  512



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 208/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G+RIF+L      L  Q TR +  PG RF+P+K N  ++ ++ E
Sbjct  202  TGDVISRTAFGSSYEEGRRIFQLQKEQALLTVQVTRSVYVPGWRFFPTKTNRRMRQISSE  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V+ LL  II+ R+   + G   T  DDLLGLL+    +EMQEN    N   +++  +++E
Sbjct  262  VDALLKGIIEKREKAMQAG--ETANDDLLGLLMESNYREMQENDERKN-VGMSIKDVIEE  318

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT+ LL WT++LL+ + +WQ + REEV++V     P  + L+ L +++ +
Sbjct  319  CKLFYLAGQETTSALLLWTMVLLSKHSNWQARAREEVLRVFGNKKPDGDGLNHLKIVTMI  378

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPP  +L R  F D ++G L++P G+ I +P+L IHH ++IWG D  EF P R
Sbjct  379  FHEVLRLYPPAPMLTRAVFADSQVGGLYLPDGVQIALPILLIHHDDKIWGDDAKEFNPGR  438

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR CVGQ++A+MEAK+ LAM++ RFSF++S +Y HAP+ 
Sbjct  439  FSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPIS  498

Query  880  VISVKPKYGVQIRLNPL  930
            +++++P++G  + L+ L
Sbjct  499  LLTMQPQHGAHLILHGL  515



>ref|XP_008798317.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Phoenix dactylifera]
Length=527

 Score =   279 bits (714),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/314 (44%), Positives = 208/314 (66%), Gaps = 10/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSY +G+RIF+L      L  ++ + +  PG RF P+  N+  K +  E
Sbjct  214  TGDVISRTAFGSSYAEGRRIFQLQAEQAELVIKAVQTVYIPGYRFLPTPINNRRKEIYRE  273

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLL----LKEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R+   ++G  S   DDLLG++    LK  QE+ GNS    +    +++E
Sbjct  274  VRALLRGIIEKREKAIKLGEASN--DDLLGVMIEYNLKHFQEH-GNSKNTGMTTEEVIEE  330

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LLTWT+++L+ +PSWQ + REEV+++   + P  + L++L +++ +
Sbjct  331  CKLFYFAGQETTSVLLTWTMIVLSMHPSWQVRAREEVLELFGKNRPDYDGLNRLKIVTMI  390

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPPV LL R+ ++  KLGD+  P G+ + +PV+ IHH  EIWGKD +EF PER
Sbjct  391  LYEVLRLYPPVILLNRITYKTMKLGDITYPAGVLLTLPVIFIHHDPEIWGKDASEFNPER  450

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   IS++      F PF  GPR C+GQS+AL+EAK+ L+M++  +SF++S +Y HAP  
Sbjct  451  FAEGISKASKGQLAFFPFGWGPRTCIGQSFALLEAKMGLSMILQHYSFELSPSYVHAPYA  510

Query  880  VISVKPKYGVQIRL  921
             I+++P++G QIRL
Sbjct  511  AITLQPQHGAQIRL  524



>ref|XP_008775781.1| PREDICTED: cytochrome P450 734A6-like [Phoenix dactylifera]
Length=444

 Score =   276 bits (707),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 203/314 (65%), Gaps = 8/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+IS T FGSSY +GK +F+    LQ L ++S  ++  PG ++ PS+ N     L   
Sbjct  133  TSDVISHTAFGSSYVEGKEVFQAQKELQTLAAKSFLNVNIPGYQYLPSRRNLPRWKLERR  192

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECKT  357
            V   LM IIQ R D  +    S+YG+DLLGL+++  + + G    G  L++  IMDECKT
Sbjct  193  VRNTLMHIIQGRLDSKD----SSYGNDLLGLMMESCRSDLGQERKGQLLSMNEIMDECKT  248

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFF G ETT+ LLTWTV LL TN  WQE++REEV++ C    P+ + LSKL L++ V+ E
Sbjct  249  FFFVGQETTSHLLTWTVFLLCTNQQWQERLREEVLKECGTGIPNADMLSKLKLVTMVLLE  308

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
            +LRLY PV ++ RMA +D  LG+L IPK   + IP+  IH ++E+WG D +EF P RF  
Sbjct  309  SLRLYGPVVMMQRMAAKDMTLGNLVIPKDTRLVIPIAIIHRNKEVWGADADEFNPLRFKN  368

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             IS++       L F+ GPR C+GQ++A++EAK V+ M++ RFS  +S NY HAP  ++ 
Sbjct  369  GISKAAKHPNALLAFSIGPRACIGQNFAMLEAKTVITMILQRFSLSLSPNYIHAPADMLF  428

Query  889  VKPKYGVQIRLNPL  930
            ++P+YG+ I L P+
Sbjct  429  LQPQYGLPILLRPM  442



>ref|XP_010090129.1| Secologanin synthase [Morus notabilis]
 gb|EXB38926.1| Secologanin synthase [Morus notabilis]
Length=446

 Score =   276 bits (706),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 212/320 (66%), Gaps = 14/320 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            +AD+ISR  FGSSYE+GK+IFEL   L +L  ++ ++L  PG RF P++ N   K L+ E
Sbjct  131  SADVISRVAFGSSYEEGKKIFELQKELIKLTLEAMQNLYIPGFRFVPTRKNRRRKKLDKE  190

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQEN------KGN-SNGFRLNLPLI  339
            +  LL +II+++ +  + G+     DDLLGLLL+   +N      +GN S+G  + +  +
Sbjct  191  ITSLLRKIIENKTNSMKTGQSKV--DDLLGLLLQSNNQNNLSEHARGNKSDG--MTVEEV  246

Query  340  MDECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLL  519
            ++ECK F+ AG ETT+  LTW +++LA +  WQEK R+EV+++C    P+ E +S L ++
Sbjct  247  IEECKQFYLAGQETTSTWLTWIMIILAIHTEWQEKARQEVLELCGKKQPNFEAISHLKIV  306

Query  520  SAVINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFK  699
            + ++NE LRLYPPV  L + A+++ K+G + IP G+ + +P L IHH +E+WG D  EFK
Sbjct  307  TMILNEVLRLYPPVIALYQHAYKETKVGHITIPAGVDLNLPTLLIHHDQELWGDDAEEFK  366

Query  700  PERF---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHA  870
            P+RF   ++++      F PF  GPR C+GQS A++EAK  LAM++  FS ++S +Y HA
Sbjct  367  PDRFSEGVAKACKDQLAFFPFGWGPRTCIGQSLAMLEAKFALAMILQHFSLELSPSYAHA  426

Query  871  PVVVISVKPKYGVQIRLNPL  930
            P  V++++P++G QI L+ L
Sbjct  427  PYTVMTLQPQHGAQIILHQL  446



>ref|XP_008776849.1| PREDICTED: cytochrome P450 734A6-like [Phoenix dactylifera]
Length=517

 Score =   278 bits (712),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 143/314 (46%), Positives = 202/314 (64%), Gaps = 8/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+IS T FGSSY +GK +F+    LQ L ++S  ++  PG ++ PS+ N     L   
Sbjct  206  TSDVISHTAFGSSYVEGKEVFQAQKELQTLAAESLLNVNIPGYQYLPSRRNLHRWKLERR  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECKT  357
            V   LM IIQ R D  +    S+YG+DLLGL+++  + + G    G  L++  IMDECKT
Sbjct  266  VRNTLMHIIQGRLDSKD----SSYGNDLLGLMMESCRSDPGQERKGQLLSMNEIMDECKT  321

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFF G ETT+ LLTWTV LL TN  WQE++REEV++ C    P+ + LSKL L++ V+ E
Sbjct  322  FFFVGQETTSHLLTWTVFLLCTNQEWQERLREEVLRECGTGIPNADMLSKLKLVTMVLLE  381

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
            ALRLY PV ++ RMA +D  LG+L IPK   + IP+  IH ++E+WG D +EF P RF  
Sbjct  382  ALRLYGPVVMMQRMAAKDMTLGNLVIPKDTRLVIPIAIIHRNKEVWGADADEFNPLRFKN  441

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             IS++       L F+ GPR C+GQ++A++EAK V+ M++ RFS  +S NY HAP  +  
Sbjct  442  GISKAAKHPNALLAFSIGPRACIGQNFAMLEAKTVITMILQRFSLSLSPNYIHAPADMFF  501

Query  889  VKPKYGVQIRLNPL  930
            ++P+YG+ I L PL
Sbjct  502  LQPQYGLPILLRPL  515



>ref|XP_008806616.1| PREDICTED: cytochrome P450 734A6-like [Phoenix dactylifera]
Length=517

 Score =   278 bits (711),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 205/314 (65%), Gaps = 8/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             A++IS T FGSSY +GK +F+    LQ L ++S  ++  PG ++ PSK N     L   
Sbjct  206  TANVISHTAFGSSYVEGKEVFQAQKELQALAAESLLNVNIPGYKYLPSKRNLHRWKLERR  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECKT  357
            V   LM IIQ R D  +    S+YG+DLLGL+++  + + G    G  L++  I+DECKT
Sbjct  266  VRNTLMHIIQGRLDSKD----SSYGNDLLGLMMESCRSDPGQERKGQILSMNEIIDECKT  321

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFFAG +TT+  LTWTV LL +N  WQE++REEV++ C    P+ + LSKL L++ V+ E
Sbjct  322  FFFAGQDTTSHWLTWTVFLLCSNQEWQERLREEVLRECGTGIPNADMLSKLKLVTMVLLE  381

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
            ALRLY PV ++ RMA +D  LG+L IPK   + IP+  IH ++E+WG D +EF P RF  
Sbjct  382  ALRLYGPVVVMQRMAAKDMTLGNLVIPKDTRLAIPIAIIHRNKEVWGADADEFNPLRFKN  441

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             IS++       L F+ GPR C+GQ++A++EAK V+AM++ RFS  +S NY HAP  +++
Sbjct  442  GISKAAKHPNALLAFSIGPRACIGQNFAMLEAKTVIAMIVQRFSLSLSPNYIHAPADMLT  501

Query  889  VKPKYGVQIRLNPL  930
            ++P+YG+ I L PL
Sbjct  502  LQPQYGLPIFLRPL  515



>ref|XP_002526971.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF35458.1| cytochrome P450, putative [Ricinus communis]
Length=413

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/314 (43%), Positives = 207/314 (66%), Gaps = 8/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D+ISR  FGS+YE+GK IF+ L  L RL  Q    +  PG RF P+K N  IK ++ E
Sbjct  104  ACDVISRAAFGSNYEEGKMIFDNLKELARLIMQGFLSVYLPGWRFMPTKTNRRIKQIDRE  163

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKE-MQENKGNSNGFRLNLPLIMDECKT  357
            ++  L  II  R+   + G  +   DDLLG+L++  ++E + NS G  L++  +MDEC+ 
Sbjct  164  IQASLRSIIDKREKAMKAGEATN--DDLLGILMESNLREIEENSMG--LSIQEVMDECRL  219

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            F+FAG ETT++LL WT++LL+  P WQE+ R+EV+QV  G  P  + L++L +++ +++E
Sbjct  220  FYFAGQETTSVLLVWTMILLSKYPHWQEQARQEVLQVFGGKMPEFDGLNRLKVVTMILHE  279

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPPV +L R   ED +L D+ +P G+ + +P + IH   E+WG D +EFKPERF  
Sbjct  280  VLRLYPPVPVLSRSVDEDIRLDDVMLPAGVYVSLPTILIHQDPELWGDDASEFKPERFSG  339

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             I+++      F PF  GPR C+GQ++AL EAK+ LA+++  F+F++S +Y HAP  VI+
Sbjct  340  GIAKATKNQISFFPFGWGPRICIGQNFALAEAKMALAIILQHFTFELSPSYTHAPTTVIT  399

Query  889  VKPKYGVQIRLNPL  930
            ++P++G Q+ L  L
Sbjct  400  LRPEHGAQLILGKL  413



>ref|XP_002988180.1| hypothetical protein SELMODRAFT_127819 [Selaginella moellendorffii]
 gb|EFJ10599.1| hypothetical protein SELMODRAFT_127819 [Selaginella moellendorffii]
Length=514

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 195/314 (62%), Gaps = 7/314 (2%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRL-CSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            +DIISR  FGSSY+KG ++FELL  +  L C    +   +  +     K N EIKT N +
Sbjct  199  SDIISRAAFGSSYKKGHKVFELLDQVGGLTCFPLAKRFTHCHSMLPICKVNREIKTANSK  258

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQE-NKGNSNGFRLNLPLIMDECKT  357
            +   L EI+Q+R+D    G I  YG DLLG++L E+   +  +  G       +M+ECKT
Sbjct  259  LRSTLEEIVQARRDQKLAGEIDNYGSDLLGIMLDEVDAGHHDDKTGLSFTTDSLMEECKT  318

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            F+ AG ET+A  L WT+MLLA NPSWQE+ REEV QVC    P  E LSKL ++  V+NE
Sbjct  319  FYIAGQETSAKWLAWTMMLLAANPSWQEQAREEVRQVCQSQAPDAESLSKLKIVGMVLNE  378

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
            +LRLYPP     R  ++D KL  L  P+G  + IP+L + H ++IWG D NEF P+RF  
Sbjct  379  SLRLYPPAVFNVRTCYKDAKLRHLSFPEGSGVIIPILYLLHDKDIWGDDANEFNPQRFAD  438

Query  718  RSYSPGR-----IFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               S  +      FLPF+ G R C+GQS+A +EAK+ +AM++ RFSF +S  YRH+PV  
Sbjct  439  GISSASKSHHSCAFLPFSQGQRVCLGQSFAQIEAKVAMAMILQRFSFRLSPTYRHSPVHR  498

Query  883  ISVKPKYGVQIRLN  924
            ++++P++GV + L 
Sbjct  499  LALQPQHGVPLLLG  512



>gb|KDP28356.1| hypothetical protein JCGZ_14127 [Jatropha curcas]
Length=522

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 199/308 (65%), Gaps = 6/308 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +DII+ T FGSSY +GK  FE    LQ  C+ S   +  PG+ + P+  N ++  L+ +
Sbjct  208  TSDIIAHTAFGSSYSRGKEAFEAQNELQHYCAASVLDVLVPGSHYLPTASNRQLWKLDRK  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            +   L +II+SR D A       YGDDLLGL++ E  E   N +G +LN+  I++ECKTF
Sbjct  268  IRNSLRQIIKSRLDSASSD--CNYGDDLLGLMI-EASETDQNKDGLKLNMDDIVEECKTF  324

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGHET++ +LTWT+ LL+ +  WQ K+R+EV++ C    P  + L++L L+  V+ E 
Sbjct  325  FFAGHETSSNVLTWTIFLLSIHQDWQTKLRQEVLEECGSKIPDSDMLARLKLVHMVLLEV  384

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLY PV    R A +D KLGDL IPK   + IP+  +H S++ WG+D NEF P RF   
Sbjct  385  LRLYCPVVETFREATKDMKLGDLMIPKESWVCIPITELHRSKKYWGQDANEFNPSRFANG  444

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            IS++      F+ F  GPR CVGQ++A++E K V+AM++ RFSF IS +Y+HAP+  I++
Sbjct  445  ISKAAKHPNAFIAFGMGPRTCVGQNFAMLEVKTVIAMILQRFSFSISPDYKHAPIDNIAL  504

Query  892  KPKYGVQI  915
            +P++G+ I
Sbjct  505  QPQFGIPI  512



>ref|XP_010909557.1| PREDICTED: cytochrome P450 734A6-like [Elaeis guineensis]
Length=517

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 209/314 (67%), Gaps = 8/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+I+ T FGSSY +GK +F     LQ L ++S  ++  PG ++ P++ N   + L   
Sbjct  206  TADVIAHTAFGSSYAEGKVVFLAQKELQSLAAESILNVSIPGYKYLPTRRNLHKRKLERR  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGN-SNGFRLNLPLIMDECKT  357
            V+  LM IIQ R D  +    S++G+DLLGL+++  + + G    G  L++  I+DECKT
Sbjct  266  VKSTLMHIIQGRLDSKD----SSHGNDLLGLMMESCRLDPGQEQKGQILSINEIIDECKT  321

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFFAG +TT+ LLTWTV LL TN  WQE++REEV++ C  + P+ + LSKL L++ V+ E
Sbjct  322  FFFAGQDTTSHLLTWTVFLLCTNQEWQERLREEVLRECGTEIPNADMLSKLKLVTMVLLE  381

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
            ALRLY PV ++ R A +D  LG+L IPK   + IP++ IH ++E+WG D +EF P RF  
Sbjct  382  ALRLYGPVVMMQRNAAKDMTLGNLVIPKNTRLTIPIVIIHRNKEVWGADADEFNPLRFKN  441

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             IS++       L F+ GPR C+GQ++A++EAK V AM++ RF+  +S NY HAPV +++
Sbjct  442  GISKAAKHPNALLAFSIGPRACIGQNFAMLEAKTVTAMILQRFTLSLSPNYIHAPVEMLT  501

Query  889  VKPKYGVQIRLNPL  930
            ++P+YG+ I L+PL
Sbjct  502  LRPQYGLPILLSPL  515



>emb|CDX97592.1| BnaA05g24870D [Brassica napus]
Length=512

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 203/313 (65%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+RIFEL   L +L  Q+ R    PG R+ P+K N  +K    E
Sbjct  205  TADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGYRYLPTKENRMMKAKARE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+ +L  I+  R    E G   +  DDLLG+LL   + N G   G  ++   +++ECK F
Sbjct  265  VQDILRGIVNKRLRAREAGEAPS--DDLLGILL---ESNLGQVKGNGMSTEDVIEECKLF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LL WT++LL+ +  WQ K REEV QV     P I+ L++L +++ ++ E 
Sbjct  320  YFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGDKVPDIDGLNQLKVMTMILYEV  379

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPVT + R   ++ KLGDL +P G+ I +P+L + H  E+WG D +EFKPERF   
Sbjct  380  LRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQHDTELWGDDASEFKPERFKEG  439

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            +S++      F PFA GPR C+GQ++AL+EAK+ +A+++ RFSF++S +Y HAP  VI++
Sbjct  440  LSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPSYVHAPYTVITI  499

Query  892  KPKYGVQIRLNPL  930
             P+YG  + L  +
Sbjct  500  HPQYGAHLILKKI  512



>emb|CBI39912.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 202/317 (64%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G+RIF+L      L  Q T  +  PG RF P+K N  +K ++ E
Sbjct  125  TGDVISRTAFGSSYEEGRRIFQLQKEQTHLAIQVTMSVYIPGWRFLPTKTNRRMKQISKE  184

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R+   + G   T   DLLG+L+    +E+QE++ N    R+++  +++E
Sbjct  185  VYALLRGIINKREKAMKAGE--TANSDLLGILMESNFREIQEHQNNKK-IRMSVKDVIEE  241

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ +P+WQ + REEV+QV     P    L+ L +++ +
Sbjct  242  CKLFYLAGQETTSVLLVWTMVLLSEHPNWQARAREEVLQVFGNKKPEAAGLNHLKIVTMI  301

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV +L R  ++D ++GD+  P G+ + +P + +HH  EIWG D  EF PER
Sbjct  302  FHEVLRLYPPVAMLARAVYKDTQVGDMCFPAGVQVVLPTILVHHDHEIWGDDAKEFNPER  361

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   + ++      F PF  GPR C+GQ++A+MEAKI LAM++  FSF++S +Y HAP  
Sbjct  362  FAEGVLKATKNQVSFFPFGWGPRVCIGQNFAMMEAKIALAMILQHFSFELSPSYAHAPFS  421

Query  880  VISVKPKYGVQIRLNPL  930
            +++++P+YG  + L  L
Sbjct  422  ILTMQPQYGAHLILRGL  438



>gb|KEH43175.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=518

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 208/318 (65%), Gaps = 17/318 (5%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             A+II+ T FG+S+  G+  F+  T L + C  S   +  PG +++P+K N EI  L+ +
Sbjct  208  TANIIAHTAFGTSFVHGREAFDAQTQLHKHCVASNSDVFIPGTQYFPTKSNIEIWKLDRK  267

Query  181  VERLLMEIIQSR-----KDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMD  345
            +++ L  II+SR      DC+       YGDDLLG+++   + N   S   ++N   IMD
Sbjct  268  MKKSLQCIIESRLQNSQSDCS-------YGDDLLGVMMDTEKTNDHGSKKLKMNE--IMD  318

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECKTFFFAGHETT+ LL WTV LL+ +  WQ+K+R+EV Q+C  + P  + LSKL +++ 
Sbjct  319  ECKTFFFAGHETTSNLLNWTVFLLSLHKDWQDKLRQEVQQICGMEIPDADMLSKLKMVNM  378

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            V+ EALRLY P   L R+A +D KLG+L IP+G  + IP+  IH S++ WG+D NEF P 
Sbjct  379  VLLEALRLYCPAIQLERVASQDMKLGNLIIPQGTCLTIPITMIHTSKKYWGEDANEFNPM  438

Query  706  RF---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            RF   IS++ +     L F+ GPRNC+GQ++A++EAK V+ +++ RFS+ +S +Y HAPV
Sbjct  439  RFINGISKASNHPNALLAFSVGPRNCIGQNFAMLEAKTVMTLILQRFSWSLSSDYEHAPV  498

Query  877  VVISVKPKYGVQIRLNPL  930
              ++++P++G+ I + PL
Sbjct  499  NNLTLQPQHGLPIIIKPL  516



>ref|XP_010242111.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=510

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 209/317 (66%), Gaps = 16/317 (5%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              DIISRT FG+SYE+G RIF+LL    ++  Q   +   PG R  P+K N  IK +N E
Sbjct  203  TGDIISRTAFGTSYEEGMRIFQLLNEHAKIIIQDLIYTFIPGYRLLPTKMNKRIKEINRE  262

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            VE LL  II+ R+   ++G  +   DDLLGLLL    KE+QE+   SN        +M+E
Sbjct  263  VEALLRGIIKQRELSIKLGEATK--DDLLGLLLESNFKEIQEHGAMSN------EELMEE  314

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETTA LL WT+++L+ +  WQ++ REEV+++   + P  +QL++L ++  +
Sbjct  315  CKLFYFAGQETTANLLLWTIVVLSMHQVWQKRAREEVLEIFGENKPDFDQLNRLKIVPMI  374

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPPV L  R + +  KLG   +P G+ + IP+++IHHS E WG+D  EFKPER
Sbjct  375  LYEVLRLYPPVFLSARCSDKKIKLGKTCLPPGIQLLIPIISIHHSREFWGEDAEEFKPER  434

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++ +  + F PF  GPR C+GQ++A+ EAK+ LAM++  FSF++S +Y HAP+ 
Sbjct  435  FYEGVSKA-AKTQAFFPFGWGPRICIGQNFAMAEAKVALAMILQHFSFELSPSYTHAPMG  493

Query  880  VISVKPKYGVQIRLNPL  930
            VI+++P+YG QI L+ L
Sbjct  494  VITLQPQYGAQIILHKL  510



>ref|XP_009394815.1| PREDICTED: cytochrome P450 72A15-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 212/316 (67%), Gaps = 11/316 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             D+ISR  F S+YE+G+RIF+L   L +L  Q+      PG RF P+  N+ IK +N E+
Sbjct  211  GDVISRAAFSSNYEEGRRIFQLQLELAQLVVQAIHSAYIPGYRFLPTPMNNRIKAINKEI  270

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDEC  351
              LL  II+ R++  + G  S  G DLLGLL+    K+ QE+ GN N   + +  ++DEC
Sbjct  271  RSLLRGIIRKREEAMKTGEAS--GQDLLGLLMESNIKQFQEH-GNKNA-GMTIDEVVDEC  326

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ETTA+LLTWT+++L+ +P WQE+ REEV+QV   D P I+ L++L +++ ++
Sbjct  327  KLFYFAGQETTAILLTWTMVVLSMHPEWQERAREEVLQVLGKDKPEIDGLNRLKIVTMIL  386

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPP+ L+ R  ++  ++G++  P G  + +P++ +HH + +WG+D +EFKPERF
Sbjct  387  YEVLRLYPPLLLIQRRTYKTVEIGNVSYPPGTLLAMPIVFLHHDQILWGEDASEFKPERF  446

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               I+++      F PF  GPR C+GQ++AL+EAK+ L+ ++ RF F++S +Y HAP   
Sbjct  447  AEGIAKASRDQVAFFPFGGGPRVCIGQNFALLEAKMGLSTILQRFWFELSPSYAHAPHNA  506

Query  883  ISVKPKYGVQIRLNPL  930
            ++++P++G Q+RL+ L
Sbjct  507  VTLRPQHGAQLRLHKL  522



>emb|CBI39938.3| unnamed protein product [Vitis vinifera]
Length=455

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 209/317 (66%), Gaps = 11/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G+RIF+L      L +Q T+ +  PG RF+P+K N  ++ +  E
Sbjct  143  TGDVISRTAFGSSYEEGRRIFQLQKEQAHLVAQVTQSVYVPGWRFFPTKINRRMRQIRNE  202

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R+   ++G  + +  DLLGLL+    +EMQEN    N   +++  +++E
Sbjct  203  VNALLKGIIEKREKAMKVGETANH--DLLGLLMESNYREMQENDERKN-VGMSIKDVIEE  259

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ + +WQ + REEV+QV     P  + L+ L +++ +
Sbjct  260  CKLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVFGNKKPDGDGLNHLKIVTMI  319

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPP ++L R  F D ++G L++  G+ I +P+L IHH+ EIWG+D  EF P R
Sbjct  320  FHEVLRLYPPASMLIRTVFADSQVGGLYLSDGVLIALPILLIHHNHEIWGEDAKEFNPGR  379

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR CVGQ++A+MEAK+ LAM++ RFSFD+S +Y HAP  
Sbjct  380  FSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFDLSPSYAHAPSS  439

Query  880  VISVKPKYGVQIRLNPL  930
            ++ ++P++G  + L+ L
Sbjct  440  LL-MQPQHGAHLILHGL  455



>ref|XP_009394811.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=526

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/316 (42%), Positives = 211/316 (67%), Gaps = 11/316 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             D+ISR  FGS+YE+G+RIF+L   L +L  Q+      PG RF P+  N+ IK +N E+
Sbjct  211  GDVISRAAFGSNYEEGRRIFQLQLELAQLVVQAIHSGYIPGYRFLPTPKNNRIKAINKEI  270

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDEC  351
              LL  II+ R++  + G  S  G DLLGLL+    K+ QE+     G  + +  +++EC
Sbjct  271  RSLLRGIIKKREEAMKTGEAS--GQDLLGLLMESNIKQFQEHGNKKAG--MTIDEVVEEC  326

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ETTA+LLTWT+++L+ +P WQE+ REEV+QV   D P  + L++L +++ ++
Sbjct  327  KLFYFAGQETTAVLLTWTMIVLSMHPEWQERAREEVLQVLGKDKPEFDGLNRLKIVTMIL  386

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPP+ L+ R  ++  ++G++  P G  + +P++ +HH + +WG+D +EFKPERF
Sbjct  387  YEVLRLYPPLLLIQRRTYKTVEIGNVSYPPGTLLALPIVFLHHDQILWGEDASEFKPERF  446

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               I+++      F PF  GPR C+GQ++AL+EAK+ L+ ++ RF F++S +Y HAP  V
Sbjct  447  AEGIAKASRDQVAFFPFGGGPRVCIGQNFALLEAKMGLSTILQRFWFELSPSYAHAPHSV  506

Query  883  ISVKPKYGVQIRLNPL  930
            ++++P++G Q+RL+ L
Sbjct  507  VTLRPQHGAQLRLHKL  522



>ref|XP_010275170.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 208/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSY++G+RIF+L     +L  Q+   +  PG    P+K N+ +K ++ E
Sbjct  204  TGDVISRTAFGSSYDEGRRIFQLQNEQAKLVVQAALSIYIPGYSLLPTKRNNRMKEIDRE  263

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R+   ++G  S   +DLLGLLL    KE+QE+  N+    +N+  +++E
Sbjct  264  VRGLLRGIINKREKAIKLGEASQ--NDLLGLLLESNFKEIQEHD-NAKNLGMNIDDVIEE  320

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETTA LL WT+++L+ +P WQ + REEV+Q    D P  + L+ L +++ +
Sbjct  321  CKLFYFAGQETTANLLVWTMVVLSMHPEWQIRSREEVLQAFGKDKPDFDGLNHLKVVTMI  380

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPP  +L R  ++  KLG +++P G+ + +P + IHHS E+WG+D  EFKPER
Sbjct  381  LYEVLRLYPPAVILTRHTYKKIKLGGIYLPPGVELLLPTILIHHSRELWGEDAQEFKPER  440

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR C+GQ++A+ EAK+ LA+++ +FSF++S +Y HAP  
Sbjct  441  FSSGVSKATKNQVSFFPFGWGPRICIGQNFAMTEAKMALALILQQFSFELSPSYAHAPYT  500

Query  880  VISVKPKYGVQIRLNPL  930
            +I+++P+YG QI L+ L
Sbjct  501  IITLQPQYGAQIILHKL  517



>ref|XP_009394810.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=530

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/316 (42%), Positives = 211/316 (67%), Gaps = 11/316 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             D+ISR  FGS+YE+G+RIF+L   L +L  Q+      PG RF P+  N+ IK +N E+
Sbjct  215  GDVISRAAFGSNYEEGRRIFQLQLELAQLVVQAIHSGYIPGYRFLPTPKNNRIKAINKEI  274

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDEC  351
              LL  II+ R++  + G  S  G DLLGLL+    K+ QE+     G  + +  +++EC
Sbjct  275  RSLLRGIIKKREEAMKTGEAS--GQDLLGLLMESNIKQFQEHGNKKAG--MTIDEVVEEC  330

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ETTA+LLTWT+++L+ +P WQE+ REEV+QV   D P  + L++L +++ ++
Sbjct  331  KLFYFAGQETTAVLLTWTMIVLSMHPEWQERAREEVLQVLGKDKPEFDGLNRLKIVTMIL  390

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPP+ L+ R  ++  ++G++  P G  + +P++ +HH + +WG+D +EFKPERF
Sbjct  391  YEVLRLYPPLLLIQRRTYKTVEIGNVSYPPGTLLALPIVFLHHDQILWGEDASEFKPERF  450

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               I+++      F PF  GPR C+GQ++AL+EAK+ L+ ++ RF F++S +Y HAP  V
Sbjct  451  AEGIAKASRDQVAFFPFGGGPRVCIGQNFALLEAKMGLSTILQRFWFELSPSYAHAPHSV  510

Query  883  ISVKPKYGVQIRLNPL  930
            ++++P++G Q+RL+ L
Sbjct  511  VTLRPQHGAQLRLHKL  526



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 212/315 (67%), Gaps = 10/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISR  FGSSYE+G++IF+LL    ++ + + R +  PG RF P+K N + K ++ E
Sbjct  205  TSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMRSVYIPGWRFLPTKQNKKAKEIHNE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++ LL  II  R++  + G  +   DDLLG+L+    +E+QE+ GN+    +++  ++ E
Sbjct  265  IKGLLKGIINKREEAMKAGEATK--DDLLGILMESNFREIQEH-GNNKNAGMSIEDVIGE  321

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ N  WQ + REEV+QV   + P+ E+LS+L +++ +
Sbjct  322  CKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVLQVFGSNIPTYEELSQLKVVTMI  381

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYP V  LPR   +  +LG L +P G+ + +P+L +HH +E+WG+D NEFKPER
Sbjct  382  LLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILLVHHDKELWGEDANEFKPER  441

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      + PF  GPR C+GQ++A+MEAK+ L++++  F+ ++S  Y HAP V
Sbjct  442  FSEGVSKATKNQFTYFPFGGGPRICIGQNFAMMEAKLALSLILRHFALELSPLYAHAPSV  501

Query  880  VISVKPKYGVQIRLN  924
             I+++P+YG  I L+
Sbjct  502  TITLQPQYGAHIILH  516



>dbj|BAJ95825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/312 (44%), Positives = 210/312 (67%), Gaps = 8/312 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            AD+IS T FGSSYE+GK++F     LQ L   +   +  P  R+ P++ N +I  L+ EV
Sbjct  206  ADVISHTAFGSSYEQGKKVFLAQRELQFLAFSTVFSVQIPAFRYLPTEKNLKIWKLDKEV  265

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTFF  363
              +LM II+SR    +      YG+DLLGL+L+      G++    L++  I+DECKTFF
Sbjct  266  RTMLMNIIESRLATKDT---MGYGNDLLGLMLEACAAEGGHTP--ILSMDEIIDECKTFF  320

Query  364  FAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEAL  543
            FAGH+T++ LLTWTV LL+T+P WQEK+REEV++ C  + P+ + L+KL L++  + E L
Sbjct  321  FAGHDTSSHLLTWTVFLLSTHPEWQEKLREEVLRECGSEVPTGDMLNKLHLVNMFLLETL  380

Query  544  RLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---I  714
            RLY PV+L+ R A  D ++G + +P+G  + IP+  IH  +E+WG+D NEFKP RF   +
Sbjct  381  RLYAPVSLIQRKAGSDLEVGGIKVPEGTVLTIPIATIHRDKEVWGEDANEFKPMRFENGV  440

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            +R+       L F++GPR+C+GQS+A++EAK V+A+++ RFSF +S  Y HAP+ VI+++
Sbjct  441  ARAGKHPNALLSFSSGPRSCIGQSFAMIEAKAVIAVILQRFSFSLSPKYVHAPMDVITLR  500

Query  895  PKYGVQIRLNPL  930
            PK+G+ + L  +
Sbjct  501  PKFGLPMILKSI  512



>gb|KDP28354.1| hypothetical protein JCGZ_14125 [Jatropha curcas]
Length=524

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/314 (44%), Positives = 203/314 (65%), Gaps = 4/314 (1%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+I+ T FGSSY++G+  F     LQ+ C+ S   +  PG ++ P+  N  I  L+ +
Sbjct  209  TSDVIAHTAFGSSYKEGREAFYAQKELQKCCAASISDVFIPGTQYLPTPMNLRIWKLDKQ  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNS-NGFRLNLPLIMDECKT  357
            +   L  II+SR   A+      YGDDLLG++++ +      S N  +L++  IM++CKT
Sbjct  269  LTNTLKGIIESRLKTAQSSLDGCYGDDLLGIMIESLVSKTAESKNSPKLSMCEIMEDCKT  328

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFFAG ETTA LLTWT  LL+ +  WQEK+REEV++ C  + P  + L+KL L++ V+ E
Sbjct  329  FFFAGQETTANLLTWTTFLLSLHTDWQEKLREEVLKECGMEIPDADMLAKLKLVNMVLLE  388

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
            ALRLY PV +L R   ED KLGDL IPK  ++ IP++ IH S+E WG+D NEF P RF  
Sbjct  389  ALRLYGPVIMLIRKTSEDMKLGDLMIPKDTSLTIPLVKIHRSKEYWGEDANEFNPLRFAN  448

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             +S++       L FA GPR C+GQ++A++EAK VLA+++ RFS  +S  Y+HAPV  ++
Sbjct  449  GVSKAAKHPNALLAFAIGPRICIGQNFAMLEAKTVLALILQRFSLSLSPEYKHAPVDYLT  508

Query  889  VKPKYGVQIRLNPL  930
            + P+YG+Q+ +  L
Sbjct  509  LHPEYGLQVNVKSL  522



>ref|XP_002968296.1| hypothetical protein SELMODRAFT_231182 [Selaginella moellendorffii]
 gb|EFJ30550.1| hypothetical protein SELMODRAFT_231182 [Selaginella moellendorffii]
Length=481

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 205/313 (65%), Gaps = 15/313 (5%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADII+ T FGSSY  G ++F  LT +Q+L  QS ++L  PG+R  P++ N +I+ L  E
Sbjct  170  TADIIATTAFGSSYSDGIKLFHTLTSIQKLFVQSNKYLWLPGSRLLPTRTNRKIRKLQRE  229

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGN---SNGFRLNLPLIMDEC  351
            ++ LL ++I++R     +G       DLL L+L  ++E+ GN   S+ F+  +  +++EC
Sbjct  230  MQALLQDLIKARLSSPSLG------TDLLALMLSAVEEDPGNKVQSSKFKFTIQQLIEEC  283

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSI--EQLSKLTLLSA  525
            +TFFF GHETT +L+TW +MLL  +P WQ+  R+E  QV       +  + L+KL  +  
Sbjct  284  QTFFFVGHETTLMLVTWAMMLLCLHPEWQDLARKEARQVLQESNRVVNADTLAKLKTVGM  343

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            +INE LRLYPP   L R A +D  +GDL++PKG   WIP+LA+H  + +WG+D +EF+P+
Sbjct  344  IINETLRLYPPAPNLVRAALQDTCVGDLYVPKGTTFWIPILALHQDKHLWGEDAHEFRPQ  403

Query  706  RF---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            RF   +SR+      FLPF++GPR CVGQS+A+MEAK++LAM++  +   +S  Y+H+PV
Sbjct  404  RFSQGVSRA-CKTYDFLPFSSGPRICVGQSFAIMEAKLILAMILQHYHLGLSPRYKHSPV  462

Query  877  VVISVKPKYGVQI  915
              +++KP  G+Q+
Sbjct  463  SSVTLKPGLGMQL  475



>ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 209/318 (66%), Gaps = 12/318 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISRT FGSSYE+G+RIF+L   L  L  Q  R +  PG RF P+K N  +K ++ E
Sbjct  204  TSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGWRFLPTKRNRRMKEIDKE  263

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSN-GFRLNLPLIMD  345
            +   LM II++R+     G  +   DDLLG+L+    +E++E+  N N GF +N   +++
Sbjct  264  IRASLMGIIKNREKAMRAGEAAN--DDLLGILMETSFREIEEHGNNKNVGFSMND--VIE  319

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECK F+FAG ETT++LL WT++LL+ +  WQE+ R+EV+QV   + P  + L+ L ++  
Sbjct  320  ECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDYDGLNHLKIVQM  379

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            ++ E LRLYPPVT+L R  F++ KLG+L +P G+ I +P++ +H   E+WG D  EFKPE
Sbjct  380  ILYEVLRLYPPVTVLSRAVFKETKLGNLTLPAGVQIGLPMILVHQDPELWGDDAVEFKPE  439

Query  706  RF---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            RF   IS++      + PFA GPR CVGQ++AL+EAK+  AM++  +SF++S +Y HAP 
Sbjct  440  RFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMATAMILQNYSFELSPSYVHAPT  499

Query  877  VVISVKPKYGVQIRLNPL  930
             V ++ P+ G Q+ L  L
Sbjct  500  AVPTLHPELGTQLILRKL  517



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/315 (43%), Positives = 202/315 (64%), Gaps = 10/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D ISRT FGS+YE+G+ IFEL     +L  Q +     PG RF P+K N  +K    E
Sbjct  205  TGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIPGWRFLPTKSNKRMKQNRKE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R+   + G   T  DDLLG+LL    KE+QE+ GN     +++  ++DE
Sbjct  265  VNELLWGIIDKREKAMKAG--ETLNDDLLGILLESNFKEIQEH-GNDKNVGMSIKDVIDE  321

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ +P+WQ + REEV+ V   + P  + L+ L ++  +
Sbjct  322  CKIFYFAGQETTSVLLLWTMILLSKHPNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMI  381

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            ++E LRLYPPV LL R  +ED ++GD+++P G+ + +P + +HH  EIWG+D  EF PER
Sbjct  382  LHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHHDHEIWGEDAREFNPER  441

Query  709  FISRSYSPGR---IFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +    +    F PF  G R C+GQ++A++EAK+VLAM++ RFSF +S +Y HAP  
Sbjct  442  FSQGALKATKSLVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQRFSFSLSPSYSHAPCS  501

Query  880  VISVKPKYGVQIRLN  924
            ++++KP+YG  + L+
Sbjct  502  LVTLKPQYGAHLILH  516



>ref|XP_010644766.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=460

 Score =   274 bits (701),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 202/317 (64%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G+RIF+L      L  Q T  +  PG RF P+K N  +K ++ E
Sbjct  145  TGDVISRTAFGSSYEEGRRIFQLQKEQTHLAIQVTMSVYIPGWRFLPTKTNRRMKQISKE  204

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R+   + G   T   DLLG+L+    +E+QE++ N    R+++  +++E
Sbjct  205  VYALLRGIINKREKAMKAG--ETANSDLLGILMESNFREIQEHQNNKK-IRMSVKDVIEE  261

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+ AG ETT++LL WT++LL+ +P+WQ + REEV+QV     P    L+ L +++ +
Sbjct  262  CKLFYLAGQETTSVLLVWTMVLLSEHPNWQARAREEVLQVFGNKKPEAAGLNHLKIVTMI  321

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV +L R  ++D ++GD+  P G+ + +P + +HH  EIWG D  EF PER
Sbjct  322  FHEVLRLYPPVAMLARAVYKDTQVGDMCFPAGVQVVLPTILVHHDHEIWGDDAKEFNPER  381

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   + ++      F PF  GPR C+GQ++A+MEAKI LAM++  FSF++S +Y HAP  
Sbjct  382  FAEGVLKATKNQVSFFPFGWGPRVCIGQNFAMMEAKIALAMILQHFSFELSPSYAHAPFS  441

Query  880  VISVKPKYGVQIRLNPL  930
            +++++P+YG  + L  L
Sbjct  442  ILTMQPQYGAHLILRGL  458



>ref|XP_006377690.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP55487.1| cytochrome P450 family protein [Populus trichocarpa]
Length=353

 Score =   271 bits (692),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 206/316 (65%), Gaps = 11/316 (3%)
 Frame = +1

Query  7    DIISRTEFGSSYEKGKRIFELLTVLQRLCSQST-RHLCYPGNRFYPSKYNSEIKTLNIEV  183
            D ISRT FGS+YE+GKRIF+LL  L  L +    + +  PG RF P   N  +K ++ E+
Sbjct  41   DAISRTSFGSNYEEGKRIFDLLKELTNLTAHVIIKAIVIPGYRFLPIPSNRRLKAIDKEI  100

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDEC  351
            +  L  +I  R+     G  +    DLLGLLL    +E+QE+ GN+    +++  ++DEC
Sbjct  101  KASLNALINKREKAMSAGEEAK--KDLLGLLLESNFREIQEH-GNTKSVGMSIEDVIDEC  157

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ETT +LLTWT++LLA  P+WQ + REEV+QV     P  + L+ L +++ ++
Sbjct  158  KLFYFAGQETTLVLLTWTMVLLAQYPNWQARAREEVVQVFGNKKPDFDGLNHLKVVTMIL  217

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPPV +L R   E+ KLG+L +P G+ + +P++ +H   E+WG D +EFKPERF
Sbjct  218  YEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQVSLPIILLHQDHELWGDDASEFKPERF  277

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               IS++      FLPF  GPR CVGQ++AL+EAK+ LAM++ R+SF++S +Y HAP  V
Sbjct  278  AEGISKATKSQVSFLPFGWGPRICVGQNFALIEAKMALAMVLQRYSFELSSSYIHAPRTV  337

Query  883  ISVKPKYGVQIRLNPL  930
            I+++P++G  + L  L
Sbjct  338  ITLQPQHGAPMILRKL  353



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   276 bits (705),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 212/315 (67%), Gaps = 10/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISR  FGSSYE+G++IF+LL    ++ + + R +  PG RF P+K N + K ++ E
Sbjct  208  TSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMRSVYIPGWRFLPTKQNKKAKEIHNE  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++ LL  II  R++  + G  +   DDLLG+L+    +E+QE+ GN+    +++  ++ E
Sbjct  268  IKGLLKGIINKREEAMKAGEATK--DDLLGILMESNFREIQEH-GNNKNAGMSIEDVIGE  324

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ N  WQ + REEV+QV   + P+ E+LS+L +++ +
Sbjct  325  CKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVLQVFGSNIPTYEELSQLKVVTMI  384

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYP V  LPR   +  +LG L +P G+ + +P+L +HH +E+WG+D NEFKPER
Sbjct  385  LLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILLVHHDKELWGEDANEFKPER  444

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      + PF  GPR C+GQ++A+MEAK+ L++++  F+ ++S  Y HAP V
Sbjct  445  FSEGVSKATKNQFTYFPFGGGPRICIGQNFAMMEAKLALSLILRHFALELSPLYAHAPSV  504

Query  880  VISVKPKYGVQIRLN  924
             I+++P+YG  I L+
Sbjct  505  TITLQPQYGAHIILH  519



>ref|XP_002976081.1| hypothetical protein SELMODRAFT_416039 [Selaginella moellendorffii]
 gb|EFJ22986.1| hypothetical protein SELMODRAFT_416039 [Selaginella moellendorffii]
Length=524

 Score =   276 bits (705),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 133/312 (43%), Positives = 205/312 (66%), Gaps = 15/312 (5%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            ADII+ T FGSSY  G ++F  LT +Q+L  QS ++L  PG+R  P++ N +I+ L  E+
Sbjct  214  ADIIATTAFGSSYSDGIKLFHTLTSIQKLFVQSNKYLWLPGSRLLPTRTNRKIRKLQREM  273

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGN---SNGFRLNLPLIMDECK  354
            + LL ++I++R     +G       DLL L+L  ++E+ GN   S+ F+  +  +++EC+
Sbjct  274  QALLQDLIKARLSSPSLG------TDLLALMLSAVEEDPGNKVQSSKFKFTIQQLIEECQ  327

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSI--EQLSKLTLLSAV  528
            TFFF GHETT +L+TW +MLL  +P WQ+  R+E  QV       +  + L+KL  +  +
Sbjct  328  TFFFVGHETTLMLVTWAMMLLCLHPEWQDLARKEARQVLQESNRVVNADTLAKLKTVGMI  387

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            INE LRLYPP   L R A +D  +GDL++PKG   WIP+LA+H  + +WG+D +EF+P+R
Sbjct  388  INETLRLYPPAPNLVRAALQDTCVGDLYVPKGTTFWIPILALHQDKHLWGEDAHEFRPQR  447

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +SR+      FLPF++GPR CVGQS+A+MEAK++LAM++  +   +S  Y+H+PV 
Sbjct  448  FSQGVSRA-CKTYDFLPFSSGPRICVGQSFAIMEAKLILAMILQHYHLGLSPRYKHSPVS  506

Query  880  VISVKPKYGVQI  915
             +++KP  G+Q+
Sbjct  507  SVTLKPGLGMQL  518



>ref|XP_006477950.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Citrus 
sinensis]
Length=420

 Score =   272 bits (696),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 206/317 (65%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGS+YE+G+RIF+L + L  L  Q  R +  PG RF P+K N  +K L+ E
Sbjct  107  TGDVISRTAFGSNYEEGRRIFQLQSELAELTIQVIRSVYIPGWRFLPTKRNKRMKELDKE  166

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            +   LM II++R+   + G  +   DDLLG+L+    +E++E+ GN+    ++   +M+E
Sbjct  167  ISTALMGIIKNREKAMKAGEAAN--DDLLGILMDTNFREIEEH-GNNKNVGMSFNDVMEE  223

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ +  WQE+ R+EV+QV   + P  + L+ L ++  +
Sbjct  224  CKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDYDGLNHLKIVQMI  283

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             NE LRLYPP  +L R   ++ KLG+L +  G+ I +PV+ +HH  E+WG D  EFKPER
Sbjct  284  FNEVLRLYPPAVMLARAVNKETKLGNLILLAGVQISLPVIMVHHDPELWGDDAIEFKPER  343

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   IS+       + PFA GPR C+G ++AL+EAKI LAM++  FSF++S +Y HAP  
Sbjct  344  FSEGISKVNRNQVSYFPFAWGPRICIGLNFALVEAKIALAMILQNFSFELSPSYVHAPTA  403

Query  880  VISVKPKYGVQIRLNPL  930
            V+++ P++G  + L  L
Sbjct  404  VLTLHPEFGTHLILRKL  420



>ref|XP_002992584.1| hypothetical protein SELMODRAFT_448822 [Selaginella moellendorffii]
 gb|EFJ06390.1| hypothetical protein SELMODRAFT_448822 [Selaginella moellendorffii]
Length=512

 Score =   275 bits (703),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 204/305 (67%), Gaps = 16/305 (5%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            ADIIS T FGSSY KG++ FE L  +Q   S+  R+   PG RF P   N  ++ L  ++
Sbjct  214  ADIISHTAFGSSYLKGQKAFETLRAIQEELSKVNRYNYIPGKRFLPFPANFRLRKLYSDL  273

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTFF  363
            + LL+ +I+ R+  A+ G+      DLLGL+L E     GNS+    +   +M+ECKTF+
Sbjct  274  DSLLLGLIKERR--AQSGQ----SHDLLGLMLAEC----GNSS---FDDRAVMEECKTFY  320

Query  364  FAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEAL  543
            FAGHETTA+LLTW++MLLA +P WQE+ R E  +VC G  P  + +SKL L++ +++E L
Sbjct  321  FAGHETTAILLTWSIMLLALHPEWQERARAEAQEVCEGATPEADSISKLKLINMILHETL  380

Query  544  RLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---I  714
            RLYPPV ++ R  FED  LGD+ +PKG A+  P+LAIHH +E+WG+D +EF PERF   +
Sbjct  381  RLYPPVGVMMRSCFEDTILGDILVPKGAAVSFPILAIHHDKELWGEDAHEFNPERFKDGV  440

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            +++      F+PF+ GPR CVGQS+ LMEAKI LA ++  F F +S +YRH PV  ++++
Sbjct  441  TKASKHPNAFMPFSLGPRVCVGQSFVLMEAKIALATILQHFRFRLSPSYRHCPVFKLTLR  500

Query  895  PKYGV  909
            P++ +
Sbjct  501  PRHSL  505



>ref|XP_009146334.1| PREDICTED: cytochrome P450 72A15 [Brassica rapa]
Length=512

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 203/313 (65%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+RIFEL   L +L  Q+ R    PG R+ P+K N  +K    E
Sbjct  205  TADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGYRYLPTKENRMMKAKARE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+ +L  I+  R    E G   +  DDLLG+LL   + N G   G  ++   +++ECK F
Sbjct  265  VQAILRGIVNKRLRAREAGEAPS--DDLLGILL---ESNLGQVKGNGMSNEDVIEECKLF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LL WT++LL+ +  WQ K REEV QV     P I+ L++L +++ ++ E 
Sbjct  320  YFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGDKVPDIDGLNQLKVMTMILYEV  379

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPVT + R   ++ KLGDL +P G+ I +P+L + H  E+WG D  EFKPERF   
Sbjct  380  LRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQHDTELWGNDAAEFKPERFKEG  439

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            +S++      F PFA GPR C+GQ++AL+EAK+ +A+++ RFSF++S +Y HAP  VI++
Sbjct  440  LSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPSYVHAPYTVITI  499

Query  892  KPKYGVQIRLNPL  930
             P++G  + L+ L
Sbjct  500  HPQFGAHLILHKL  512



>ref|XP_004301212.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=516

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 205/315 (65%), Gaps = 11/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSY++G +IF+LL     L ++++  +  PG RF P+K N  +K    E
Sbjct  202  TGDVISRTAFGSSYKEGLKIFQLLREQAVLVTKTSHLVIIPGWRFLPTKINKRMKQNAKE  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            VE LL  II  R++    G      DDLLG+LL    KE+QE+ GN    RL+   I+DE
Sbjct  262  VEGLLERIINKREEAIRGGEAPK--DDLLGILLDSNSKEIQEH-GNRKNIRLSRKDIIDE  318

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQV-CNGDPPSIEQLSKLTLLSA  525
            CK F+F G ETT+ L+ W V+LL  NPSWQ + REEV+QV  N  P   +++++L +++ 
Sbjct  319  CKLFYFGGQETTSALVVWAVILLCQNPSWQTRAREEVLQVFGNNRPDDFQEMNQLKVMTM  378

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            V+ E LRLYPPV  L R  ++  +LG L +P G+ + +P L +H ++E+WG D  EFKPE
Sbjct  379  VLREVLRLYPPVATLNRTTYKKTQLGTLSLPAGVEVSVPTLLMHQNKELWGDDAEEFKPE  438

Query  706  RF---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            RF   +S++     +F PF  GPR C+GQ++A+MEAKIVL++++ +F  ++S +Y HAP 
Sbjct  439  RFSEGVSKATKGQSLFFPFGGGPRICIGQNFAVMEAKIVLSLILQQFILELSPSYAHAPS  498

Query  877  VVISVKPKYGVQIRL  921
             VI+++P+YGV + L
Sbjct  499  SVITLQPQYGVPVIL  513



>ref|XP_010275181.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 208/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSY++G+RIF+L     ++       +  PG R  P+K N+ +K ++ E
Sbjct  204  TGDVISRTAFGSSYDEGRRIFQLQNEQAKIVMDVALSIYIPGYRLLPTKRNNRMKEIDRE  263

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  I+  R+   ++G  S   DDLLGLLL    KE++E+ GN     +N+  +++E
Sbjct  264  VRGLLRRIVNKREKAIKLGEASK--DDLLGLLLESNFKEIREH-GNEKNIGMNVDEVIEE  320

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT+ LL WT+++L+ +P WQ + REEV+Q    D P  + ++ L ++S +
Sbjct  321  CKLFYFAGQETTSNLLVWTMVVLSMHPEWQMRAREEVLQSFGKDKPDFDGINHLKVVSMI  380

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPP   L R  ++  KLGD+++P  + + +P + IHHS E+WG+D  EFKPER
Sbjct  381  LYEVLRLYPPAVALTRQTYKKVKLGDVYLPPRVELSLPTILIHHSRELWGEDAQEFKPER  440

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++ +    F+PF  GPR C+GQ++A++EAK+ LA+++  FSF++S +Y HAP  
Sbjct  441  FLGGVSKAANNQVSFIPFGWGPRICIGQNFAMIEAKMALALILQHFSFELSPSYAHAPCT  500

Query  880  VISVKPKYGVQIRLNPL  930
            +I+++P+YG QI L+ L
Sbjct  501  IITLQPQYGAQIILHKL  517



>ref|XP_004495852.1| PREDICTED: cytochrome P450 734A1-like [Cicer arietinum]
Length=518

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/314 (44%), Positives = 210/314 (67%), Gaps = 10/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADII+ T FGSS+  G+  F   T+LQ+ C  S+  +  PG++++PS+ N EI  L+ +
Sbjct  209  TADIIAHTAFGSSFAHGRETFNAQTLLQKHCVASSSDVFIPGSQYFPSQTNIEIWKLDRK  268

Query  181  VERLLMEIIQSR-KDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKT  357
            +++ L  II+SR +  +E  +  +YGDDLLG+    M + +      +L +  IM+ECKT
Sbjct  269  MKKSLECIIESRLQQYSESDK--SYGDDLLGV----MMDAEKTDGVLKLKMNEIMEECKT  322

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFFAGHETT+ LL WTV LL+ +  WQ K+R+E++Q+C    P  + LSKL +++ V+ E
Sbjct  323  FFFAGHETTSNLLIWTVFLLSLHSDWQHKLRQEILQICGMQIPDADMLSKLKMVNMVLLE  382

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI-  714
            ALRLY P   + R+A +D KLGDL IP+G  + IPV+ I  +E+ WG+D NEF P RFI 
Sbjct  383  ALRLYCPAIEIIRVASQDMKLGDLMIPRGTCLTIPVIMIQRNEKYWGEDANEFNPIRFIN  442

Query  715  --SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
              S++       L F+ GPRNC+GQ++A++EAK V+A++I RFS+ +S +Y+HAP   ++
Sbjct  443  GVSKAAKHPNALLAFSVGPRNCIGQNFAMLEAKTVMALIIQRFSWSLSPDYQHAPANNLT  502

Query  889  VKPKYGVQIRLNPL  930
            ++P++G+ I L PL
Sbjct  503  LQPQHGLPIILKPL  516



>ref|XP_006840143.1| hypothetical protein AMTR_s00089p00051730 [Amborella trichopoda]
 gb|ERN01818.1| hypothetical protein AMTR_s00089p00051730 [Amborella trichopoda]
Length=424

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 206/316 (65%), Gaps = 13/316 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+R+FEL      L S++ ++   PG RF P++ N   K ++ E
Sbjct  116  TADVISRTAFGSSYKEGRRLFELQGEQANLVSEALQNFYIPGFRFLPTQKNKRRKEIDRE  175

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V  +L  +IQ R++  + G  +    DLLGLLL    E+      +++ L  ++ ECK F
Sbjct  176  VRGILKGLIQRRENAIQAGHGNN--QDLLGLLL----ESNNKEKNYKMTLEDLIGECKLF  229

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGD--PPSIEQLSKLTLLSAVIN  534
            +FAGHETT++LLTWT++ L+ +P+WQ+  REEVM+V      P + + L+ L +++ V++
Sbjct  230  YFAGHETTSVLLTWTLVALSMHPAWQQTAREEVMRVVGSSSTPLTFDHLTNLKVVNMVLH  289

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFI  714
            E LRLYPPV+ + R      KLG LH P+G+ + +P++ IHH  E+WG  V EF+PERF 
Sbjct  290  EVLRLYPPVSHIIRQTSARVKLGGLHFPEGIQLVLPMIMIHHDRELWGDSVEEFRPERF-  348

Query  715  SRSYSPGRI----FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
            S+  S   I    F PF  GPR C+GQ++A +EAK+ LAM++ RFSF +S +Y HAP + 
Sbjct  349  SQGVSKASIYPLAFFPFGWGPRFCIGQNFAFIEAKMALAMILQRFSFCLSPSYVHAPCIK  408

Query  883  ISVKPKYGVQIRLNPL  930
            I+++P+YGV + LN L
Sbjct  409  ITMQPQYGVPVILNKL  424



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 209/317 (66%), Gaps = 11/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSSYE+G+RIF+L      L +Q T+ +  PG RF+P+K N  ++ +  E
Sbjct  202  TGDVISRTAFGSSYEEGRRIFQLQKEQAHLVAQVTQSVYVPGWRFFPTKINRRMRQIRNE  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R+   ++G  + +  DLLGLL+    +EMQEN    N   +++  +++E
Sbjct  262  VNALLKGIIEKREKAMKVGETANH--DLLGLLMESNYREMQENDERKN-VGMSIKDVIEE  318

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ + +WQ + REEV+QV     P  + L+ L +++ +
Sbjct  319  CKLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVFGNKKPDGDGLNHLKIVTMI  378

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPP ++L R  F D ++G L++  G+ I +P+L IHH+ EIWG+D  EF P R
Sbjct  379  FHEVLRLYPPASMLIRTVFADSQVGGLYLSDGVLIALPILLIHHNHEIWGEDAKEFNPGR  438

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR CVGQ++A+MEAK+ LAM++ RFSFD+S +Y HAP  
Sbjct  439  FSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFDLSPSYAHAPSS  498

Query  880  VISVKPKYGVQIRLNPL  930
            ++ ++P++G  + L+ L
Sbjct  499  LL-MQPQHGAHLILHGL  514



>ref|XP_010927481.1| PREDICTED: cytochrome P450 CYP72A219-like [Elaeis guineensis]
Length=535

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 199/316 (63%), Gaps = 8/316 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FG S+++G+RIF+LL     L  Q  R++  PG RF P+K N  +  ++ E
Sbjct  210  TGDVISRTAFGCSFKEGRRIFQLLEEQAELTFQVIRNIYIPGYRFVPTKTNKRMMEIHRE  269

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLK---EMQENKGNSNGFRLNLPLIMDEC  351
               LL  +I+ R+      +     DDLLGLL++      + +G S    +    +++EC
Sbjct  270  TRALLSRMIEQRERAMR--KAGAANDDLLGLLMESNFRYSQEQGGSTNAGMTKDDVIEEC  327

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAGHETT++LLTWT++ L  +PSWQ + REEV+Q+   + P  + LS+L +++ ++
Sbjct  328  KLFYFAGHETTSVLLTWTMVALGMHPSWQARAREEVLQIFGKNKPDFDGLSQLKIVTMIL  387

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
            +E LRLYPP   L R  ++  KLGD   P+G+ + +P+L IHH  E WG+D +EF PERF
Sbjct  388  HEVLRLYPPTAFLLRETYKKMKLGDFSFPQGVQLVLPLLLIHHDPEFWGEDASEFNPERF  447

Query  712  ISRSYSPGRI---FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
                 +  +I   F+PF  GPR CVGQS+A+MEAK+VLA ++  FSF+ S +Y HAP  V
Sbjct  448  ARGVSNASKIQGAFIPFGWGPRICVGQSFAMMEAKMVLATILQNFSFEPSPSYAHAPYTV  507

Query  883  ISVKPKYGVQIRLNPL  930
            +++ P+YG QI L  L
Sbjct  508  MTIHPQYGAQIILRRL  523



>gb|KHN47456.1| Secologanin synthase [Glycine soja]
Length=537

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 208/315 (66%), Gaps = 11/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A+D+ISRT FGSSYE+G+RIF+LL     L  Q+   +  PG RF P+  +  +K +N +
Sbjct  223  ASDVISRTAFGSSYEEGRRIFQLLKEQTELTIQTFLKVNIPGWRFVPTTTHRRMKEINKD  282

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            +E  LM++I  R+   + G  +   ++LL +LL    KE+QE +GN N   +NL  +++E
Sbjct  283  IEASLMDMINKRETALKAGEATK--NNLLDILLESNHKEIQE-QGNKN-VGMNLEEVIEE  338

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+  P WQ + REEV+QV     P+ E L+ L +++ +
Sbjct  339  CKLFYFAGQETTSVLLVWTMILLSMYPDWQTRAREEVLQVFGNRKPNFEGLNHLKIVTMI  398

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            +NE LRLYPPV  L R   ED KLG+L +P G+ I +P++ +HH  E+WG D  EFKPER
Sbjct  399  LNEVLRLYPPVVGLARKVNEDVKLGNLSLPAGVQISLPIVLVHHDCELWGDDAKEFKPER  458

Query  709  FISR--SYSPGRI-FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F       + GR+ F  F  GPR C+GQ+++ +EAKI L+M++ RFSF++S  Y HAP  
Sbjct  459  FSEGLLKATNGRVSFFAFGGGPRICIGQNFSFLEAKIALSMILQRFSFELSPTYTHAPTS  518

Query  880  VISVKPKYGVQIRLN  924
            VI+++P++G  + L+
Sbjct  519  VITLQPQHGAHLILH  533



>ref|XP_003543171.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=537

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 208/315 (66%), Gaps = 11/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A+D+ISRT FGSSYE+G+RIF+LL     L  Q+   +  PG RF P+  +  +K +N +
Sbjct  223  ASDVISRTAFGSSYEEGRRIFQLLKEQTELTIQTFLKVNIPGWRFVPTTTHRRMKEINKD  282

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            +E  LM++I  R+   + G  +   ++LL +LL    KE+QE +GN N   +NL  +++E
Sbjct  283  IEASLMDMINKRETALKAGEATK--NNLLDILLESNHKEIQE-QGNKN-VGMNLEEVIEE  338

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+  P WQ + REEV+QV     P+ E L+ L +++ +
Sbjct  339  CKLFYFAGQETTSVLLVWTMILLSMYPDWQTRAREEVLQVFGNRKPNFEGLNHLKIVTMI  398

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            +NE LRLYPPV  L R   ED KLG+L +P G+ I +P++ +HH  E+WG D  EFKPER
Sbjct  399  LNEVLRLYPPVVGLARKVNEDVKLGNLSLPAGVQISLPIVLVHHDCELWGDDAKEFKPER  458

Query  709  FISR--SYSPGRI-FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F       + GR+ F  F  GPR C+GQ+++ +EAKI L+M++ RFSF++S  Y HAP  
Sbjct  459  FSEGLLKATNGRVSFFAFGGGPRICIGQNFSFLEAKIALSMILQRFSFELSPTYTHAPTS  518

Query  880  VISVKPKYGVQIRLN  924
            VI+++P++G  + L+
Sbjct  519  VITLQPQHGAHLILH  533



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 208/315 (66%), Gaps = 12/315 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A+D+I+RT FGSS+E+GKRIF+L   L  L  +    +  PG RF P+  N  +K ++  
Sbjct  181  ASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYIPGWRFVPTATNRRMKEIDRY  240

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++  LM++I+ R+   + G  +   DDLLG+LL    KE+QE++ N N   +NL  +++E
Sbjct  241  IKASLMDMIKKREKAPKTGEATR--DDLLGILLESNHKEIQEHRNNKN-VGMNLNDVIEE  297

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+  P WQ + REEV+QV     P+ + LS L +++ +
Sbjct  298  CKLFYFAGQETTSVLLVWTMVLLSRYPDWQSRAREEVLQVFGKQAPNFDGLSHLKIVTMI  357

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPP   L R    D KLG+L +P G+ + +P++ +HH  E+WG D  EF PER
Sbjct  358  LYEVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQVSLPIIMVHHDRELWGDDAKEFNPER  417

Query  709  F---ISRSYSPGRI-FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            F   +S++ + GR+ F PF  GPR C+GQ+++L+EAK+ L+M++  FSF++S  Y HAP 
Sbjct  418  FSEGVSKATN-GRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYTHAPF  476

Query  877  VVISVKPKYGVQIRL  921
             VI+++P+YG  + L
Sbjct  477  TVITLQPQYGAHVIL  491



>ref|XP_010943694.1| PREDICTED: cytochrome P450 734A6-like [Elaeis guineensis]
Length=517

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 206/314 (66%), Gaps = 8/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+I+ T FGSSY +GK +F     LQ L ++S  ++  PG  + P++ N   + L   
Sbjct  206  TADVIAHTAFGSSYAEGKVVFLAQKELQSLAAESILNVNIPGYEYLPTRRNLHKRKLERR  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGN-SNGFRLNLPLIMDECKT  357
            V   LM IIQ R D  +    S+YG+DLLGL+++  + + G    G  L++  I+DECKT
Sbjct  266  VRSTLMHIIQGRLDSKD----SSYGNDLLGLMMESCRLDPGQEQKGQILSINEIIDECKT  321

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            FFFAG +TT+ LLTWT+ LL TN  WQE++REEV++ C  + P+ + LSKL L++ V+ E
Sbjct  322  FFFAGQDTTSHLLTWTMFLLCTNQEWQERLREEVLRECGTEIPNADMLSKLKLVTMVLLE  381

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
            ALRLY PV ++ R A +D  LG+L IPK   + IP++ IH ++E+WG D  EF P RF  
Sbjct  382  ALRLYGPVVMMQRNAAKDMTLGNLVIPKNTRLTIPIVIIHRNKEVWGADAAEFNPLRFKN  441

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             IS++       L F+ GPR C+GQ++A++EAK V AM++ RF+  +S NY HAPV +++
Sbjct  442  GISKAAKHPNALLAFSIGPRACIGQNFAMLEAKTVTAMILQRFTLSLSPNYIHAPVEMLT  501

Query  889  VKPKYGVQIRLNPL  930
            ++P+YG+ I L+PL
Sbjct  502  LQPQYGLPILLSPL  515



>ref|XP_002516294.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF46296.1| cytochrome P450, putative [Ricinus communis]
Length=488

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/311 (45%), Positives = 197/311 (63%), Gaps = 7/311 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A DIISR  FGS+YE+GK+IFEL   L  L  ++ + L  PG RF P+K N   K LNIE
Sbjct  174  AKDIISRAAFGSNYEEGKKIFELQHELMMLTIEAMQTLYIPGFRFVPTKKNRRRKKLNIE  233

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFR---LNLPLIMDEC  351
            +  +L +I++ +++    G+ S   D L  LL    Q + GN +G R   L +  +++EC
Sbjct  234  ITSMLRDIVERKQNAMRTGQ-SKVDDLLSLLLHSSEQNSSGNESGRRSDGLTIEEVIEEC  292

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+ AG ETT+ LLTWT+++LA +  WQEK REEV+QVC    P  E L+ L  ++ ++
Sbjct  293  KVFYLAGQETTSSLLTWTIIVLAMHQDWQEKAREEVLQVCGKKEPDFEALTHLKTVTMIL  352

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
            NE LRLYPP   L +   E  K+GD+ IP G+ I +P + IH   E WG D  EFKPERF
Sbjct  353  NEVLRLYPPAIALYQHTREATKIGDISIPAGVDITLPTMLIHRDPEFWGDDAEEFKPERF  412

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               I+++      F PF  GPR C+GQS++L+EAK VLAM++  FSF++S +Y HAP  V
Sbjct  413  AAGITKASKDHLAFFPFGWGPRICIGQSFSLLEAKTVLAMILQHFSFELSPSYAHAPYTV  472

Query  883  ISVKPKYGVQI  915
            ++++P+ G Q+
Sbjct  473  MTLQPQRGAQL  483



>gb|KEH38476.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=493

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/317 (42%), Positives = 210/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A+D+ISR  FGSSYE+GKRIF+L T    L ++    +  PG RF P+     +K ++ +
Sbjct  178  ASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRD  237

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++  L ++I +R+   + G  +   DDLLG+LL    KEM+E+ GN+    ++L  +++E
Sbjct  238  IKASLTDMINNRERALKAGEATK--DDLLGILLESNHKEMEEH-GNNKDVGMSLDDVIEE  294

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+  P WQ + REEV+QV   + P  + LS L +++ +
Sbjct  295  CKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKIVTMI  354

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPPV  L R   +D KLG+L +P G+ +++ ++ +HH  E+WG+D   F PER
Sbjct  355  LYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVFNPER  414

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   + ++ +    F PFA GPR C+GQ+++++EAK+ +AM++ RFSF++S +Y HAP  
Sbjct  415  FSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAHAPAT  474

Query  880  VISVKPKYGVQIRLNPL  930
            VI+++P+YG  I L+ L
Sbjct  475  VITLQPQYGAHIILHKL  491



>ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 209/318 (66%), Gaps = 12/318 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISRT FGSSYE+G+RIF+L   L  L  Q  R +  PG RF P+K N  +K ++ E
Sbjct  204  TSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGWRFLPTKRNRRMKEIDKE  263

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSN-GFRLNLPLIMD  345
            +   LM II++R+     G  +   +DLLG+L+    +E++E+  N N GF +N   +++
Sbjct  264  IRASLMGIIKNREKAMRAGEAAN--NDLLGILMETSFREIEEHGNNKNVGFSMND--VIE  319

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECK F+FAG ETT++LL WT++LL+ +  WQE+ R+EV+QV   + P  + L+ L ++  
Sbjct  320  ECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDYDGLNHLKIVQM  379

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            ++ E LRLYPPVT+L R  F++ KLG+L +P G+ I +P++ +H   E+WG D  EFKPE
Sbjct  380  ILYEVLRLYPPVTVLSRAVFKETKLGNLTLPAGVQIGLPMILVHQDPELWGDDAVEFKPE  439

Query  706  RF---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            RF   IS++      + PFA GPR CVGQ++AL+EAK+  AM++  +SF++S +Y HAP 
Sbjct  440  RFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMATAMILQNYSFELSPSYVHAPT  499

Query  877  VVISVKPKYGVQIRLNPL  930
             V ++ P+ G Q+ L  L
Sbjct  500  AVPTLHPELGTQLILRKL  517



>gb|EMT31416.1| Secologanin synthase [Aegilops tauschii]
Length=461

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 209/313 (67%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+IS T FGSSYE+GK++F     LQ L   +  ++  P  R+ P++ N +I  L+ E
Sbjct  152  TADVISHTAFGSSYEQGKKVFLAQRELQFLAYSTVFNVQIPALRYLPTEKNLKIWKLDKE  211

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V  +LM II++R +  +      YG+DLLGL+L+      G +    L++  I+DECKTF
Sbjct  212  VRSMLMNIIKTRLENKDT---MGYGNDLLGLMLEACAPEHGQNP--ILSMDEIIDECKTF  266

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+T++ LLTWT+ LL+T+P WQEK+REEV++ C    P+ + L+KL L++  + E 
Sbjct  267  FFAGHDTSSHLLTWTMFLLSTHPEWQEKLREEVLRECGNGAPTGDMLNKLQLVNMFLLET  326

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLY PV ++ R A  D ++G + +P+G  + IP+  IH  +E+WG+D NEFKP RF   
Sbjct  327  LRLYGPVAVIQRKACSDLEVGGIKVPEGTVLTIPIATIHRDKEVWGEDANEFKPMRFENG  386

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            ++R+       L F++GPR+C+GQ++A++EAK V+AM++ RFSF +S  Y HAP+ +I+V
Sbjct  387  VTRAGKHPNALLSFSSGPRSCIGQNFAMIEAKAVIAMILQRFSFSLSPKYVHAPMGMITV  446

Query  892  KPKYGVQIRLNPL  930
            +PK+G+ + L  L
Sbjct  447  RPKFGLPMVLMSL  459



>gb|KEH21517.1| cytochrome P450 family protein [Medicago truncatula]
Length=375

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 155/174 (89%), Gaps = 5/174 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIISRTEFG+SY+KG++IF LLTVLQ LC+Q++RHLC+PG+RF+PSKYN EIK+L +E
Sbjct  206  TADIISRTEFGASYQKGRKIFHLLTVLQTLCAQASRHLCFPGSRFFPSKYNREIKSLKME  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            VERLLMEIIQSRKDC EIGR ++YG+DLLG+LL EMQ+ + +     LNL L+MDECKTF
Sbjct  266  VERLLMEIIQSRKDCVEIGRSNSYGNDLLGILLNEMQKKETS-----LNLQLVMDECKTF  320

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLS  522
            FF+GHETTALLLTWTVMLLA+NPSWQEKVR+EV +VCNG  PS+++LSKL+++S
Sbjct  321  FFSGHETTALLLTWTVMLLASNPSWQEKVRDEVKRVCNGGIPSLDKLSKLSMVS  374



>gb|AAL66766.1| cytochrome P450 monooxygenase CYP72A5 [Zea mays subsp. mays]
Length=316

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 201/313 (64%), Gaps = 5/313 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGS+Y++G+RIFEL   L     QS + +  PG  F P+K N  ++ +++E
Sbjct  4    TGDVISRTAFGSNYQEGRRIFELQGELAERLIQSVQTIFIPGYWFLPTKNNRRMRAIDVE  63

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            + ++L EII  R+   +  R +   D L  LL    +++ GN++   L    +++ECK F
Sbjct  64   IRKILREIIGKREKDTK-NRETNNDDLLGLLLESNTRQSNGNAS-LGLTTEDVIEECKLF  121

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LLTWT+++L+ +P WQE+ REEV+       P  + LS+L  ++ +++E 
Sbjct  122  YFAGMETTSVLLTWTLIVLSMHPEWQERAREEVLSHFGRTTPDYDSLSRLKTITMILHEV  181

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPP T L R  +++ +LG +  P G+ + +PV+ IHH  +IWGKD +EF PERF   
Sbjct  182  LRLYPPATFLTRRTYKEMELGGIKYPAGVDLLLPVIFIHHDPDIWGKDASEFNPERFANG  241

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            IS +      F PF  GPR C+GQS+AL+EAK+ L  ++ RFSF++S +Y HAP  VI++
Sbjct  242  ISSATRHQAAFFPFGGGPRICIGQSFALLEAKMTLCTILQRFSFELSPSYTHAPYTVITL  301

Query  892  KPKYGVQIRLNPL  930
             P++G QIRL  L
Sbjct  302  HPQHGAQIRLKKL  314



>dbj|BAJ97266.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97333.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/313 (44%), Positives = 207/313 (66%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+IS T FGSSY++GK++F     LQ L   +  ++  P  R+ P++ N +I  L+ E
Sbjct  205  TADVISHTAFGSSYQQGKKVFLAQRELQFLAFSTVFNVQIPAFRYLPTEKNLKIWKLDKE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V  +LM II++R D  +      YG+DLLGL+L+      G +    L++  I+DECKTF
Sbjct  265  VRGMLMNIIKTRLDTKDT---MGYGNDLLGLMLEACALEHGQNP--ILSMDEIIDECKTF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+T++ LLTWT+ LL+ +P WQEK+REEV++ C    P+ + L+KL L++  + E 
Sbjct  320  FFAGHDTSSHLLTWTMFLLSMHPEWQEKLREEVLRECGNGAPTGDMLNKLHLVNMFLLET  379

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLY PV  + R A  D ++G + +PKG  I IP+  IH  +E+WG+D NEFKP RF   
Sbjct  380  LRLYGPVAAIQRKAGSDLEVGGIKVPKGTVITIPIATIHRDKEVWGEDANEFKPMRFENG  439

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            ++R+       L F++GPR+C+GQ++A++EAK V+AM++ RFSF +S  Y HAP+ VI++
Sbjct  440  VTRAGKHPNALLSFSSGPRSCIGQNFAMIEAKAVIAMILQRFSFSLSPKYVHAPMDVITL  499

Query  892  KPKYGVQIRLNPL  930
            +PK+G+ + L  L
Sbjct  500  RPKFGLPMILKSL  512



>ref|XP_010542332.1| PREDICTED: cytochrome P450 72A13-like [Tarenaya hassleriana]
Length=509

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 201/313 (64%), Gaps = 11/313 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY +G+RIF+L   L +L  Q+ R    PG R+ P+K N  +K ++ E
Sbjct  205  TADVISRTAFGSSYREGQRIFQLQAELAQLIVQAFRKAYIPGWRYLPTKSNRRMKEIDRE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            +  +L  II  R+   E        +DLLG+LL   + N G S G  ++L  +M+ECK F
Sbjct  265  IRAILSGIIGKREKARE-----GPNNDLLGILL---ESNSGQSKGNGMSLEEVMEECKLF  316

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LL WT++LL+ +  WQ + REEVMQV     P ++ L++L +++ +  E 
Sbjct  317  YFAGQETTSVLLVWTMVLLSQHQDWQARAREEVMQVLGDKKPDMDSLNQLKVITMIFYEV  376

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPV  L R   ++ KLGDL +P G+ + +P++ I    E+WG D  EFKPERF   
Sbjct  377  LRLYPPVVQLNRAVHKEQKLGDLTLPSGVHLSLPIMLIQRDTELWGSDAGEFKPERFKDG  436

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            IS++      FLPF  GPR C+GQ++AL+EAK+ LA+++ RFSF++S  Y HAP  V+++
Sbjct  437  ISKATRNQVSFLPFGWGPRICIGQNFALIEAKMALALILQRFSFELSPTYIHAPYTVVTI  496

Query  892  KPKYGVQIRLNPL  930
             P++G  + L+ L
Sbjct  497  HPQFGAHLVLHKL  509



>ref|XP_006830579.1| hypothetical protein AMTR_s00117p00135700 [Amborella trichopoda]
 gb|ERM97995.1| hypothetical protein AMTR_s00117p00135700 [Amborella trichopoda]
Length=513

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 206/316 (65%), Gaps = 11/316 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSS+E+GKRIFEL      LC Q+ R +  PG RF P++ N   K ++ +
Sbjct  203  TVDVISRTAFGSSFEEGKRIFELQQEQADLCIQAVRIIYIPGFRFVPTEKNMRRKKIHKK  262

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V  ++ E+IQ ++   EI   + Y  DLLGLLL   + N  N N  +L L  +++ECK F
Sbjct  263  VRGIIQELIQKKE--TEIKSGTLYNHDLLGLLL---ESNNTNDNKSKLTLDDVIEECKLF  317

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDP---PSIEQLSKLTLLSAVI  531
            +FAG ETT+ LLTWT+++L+ +P+WQ++ R+EVMQV        P++EQLS L +++ ++
Sbjct  318  YFAGQETTSTLLTWTMVVLSMHPTWQQRARDEVMQVIGSQYTYLPTLEQLSHLKIVNMIL  377

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
            NE LRLYPP  LL R  ++   L  +  P G+ + +PV+ IHH  E+WG D +EF+P RF
Sbjct  378  NEVLRLYPPGPLLLRQTYKRISLRGIDFPAGVELALPVIMIHHDRELWGDDADEFQPTRF  437

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               +S++      F PF  GPR C+GQ++AL+EAK+VLAM++ +FSF +S  Y HAP   
Sbjct  438  SDGVSKASKHPFAFFPFGGGPRICIGQNFALIEAKMVLAMVLMKFSFHLSPLYTHAPCQQ  497

Query  883  ISVKPKYGVQIRLNPL  930
            ++++P++G  I L+ L
Sbjct  498  LTLQPQHGAPIILHKL  513



>ref|XP_010241316.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=518

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 206/317 (65%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            + DIISR  FGSSYE+G+RIF++      L  Q    +  PG RF P+K N+ +K +  E
Sbjct  205  SGDIISRAAFGSSYEEGRRIFQIQEEQASLIMQDAMSIHIPGLRFLPTKRNNRMKEMERE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R+    +G   T  +DLLGLL+    KE+QE+ GN     +++  ++ E
Sbjct  265  VRALLEGIISKREKAMRMGEACT--NDLLGLLMEFNFKEIQEH-GNLKNVGMSIDEVIGE  321

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LLTWT+++L+ +  WQ + REEV+QV   + P   +L++L +++ +
Sbjct  322  CKLFYFAGRETTSILLTWTMLVLSMHSEWQLRAREEVLQVFGKNKPDFNELNQLKIVTMI  381

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPPV  + R  ++  KLG++ +P G+ + +P++ +HHS E WG D  EFKPER
Sbjct  382  LYEVLRLYPPVFRISRWTYKKIKLGEIFLPPGVELSLPIILLHHSIEFWGDDAQEFKPER  441

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF+ GPR C+GQ++ALM  K+ LAM++ RFSF++S  Y HAP  
Sbjct  442  FAGGVSKATKNQVTFFPFSWGPRICIGQNFALMVVKMALAMILQRFSFELSPTYCHAPCT  501

Query  880  VISVKPKYGVQIRLNPL  930
            V++++P+YG QI L+ L
Sbjct  502  VLTLQPQYGAQILLHKL  518



>ref|XP_002961570.1| hypothetical protein SELMODRAFT_266618 [Selaginella moellendorffii]
 gb|EFJ36830.1| hypothetical protein SELMODRAFT_266618 [Selaginella moellendorffii]
Length=518

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 205/332 (62%), Gaps = 27/332 (8%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLT--------VLQRLCSQSTRHLCYPGNRFYPSKYNS  156
              D+IS T FG+SY KG+R+F +LT        +L R           PG RF P   N 
Sbjct  203  TGDVISHTAFGTSYLKGQRVFVILTKEIPDLFPILFRFS------WILPGVRFLPLPVNL  256

Query  157  EIKTLNIEVERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPL  336
            ++   + E++ L+  II  R++  + GR  +YG+DLLGL+LKE      +SN    N  L
Sbjct  257  KLWKFHQELDSLITGIIDERRESVKCGRSDSYGNDLLGLMLKECD----SSNSKFTNKDL  312

Query  337  IMDECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTL  516
            I +ECKTF+FAGHETTA LLTWT+MLL   P WQ++ R EV +VC  + P  E +SKL L
Sbjct  313  I-EECKTFYFAGHETTASLLTWTLMLLGGYPEWQDRARAEVHEVCGTETPDGENVSKLKL  371

Query  517  LSAVINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEF  696
            + A++ E LRLYPP   + R    +  L DLH+PKG+ +   V+ +HH +E+WG+D  EF
Sbjct  372  IGAILYETLRLYPPAVEMTRECMVETWLQDLHVPKGVTLAFQVIGMHHDKELWGEDATEF  431

Query  697  KPERF---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRH  867
             P+RF   IS +      F+PF+ GPR CVGQS+A++EAK++LAM++ RFSF +S NYRH
Sbjct  432  NPDRFKDGISNACKHPNAFIPFSLGPRVCVGQSFAMIEAKVILAMILQRFSFRLSPNYRH  491

Query  868  APVVVISVKPKYGVQIRLNPLI*QGLGKHSDN  963
             P +   +KP +GV     PL+ + +G+  ++
Sbjct  492  NPAMKFGLKPIHGV-----PLVLETVGRFQES  518



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 205/316 (65%), Gaps = 12/316 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D ISRT FGS+YE+G+ IFEL     +L  Q +     PG RF P+K N  +K +  E
Sbjct  205  TGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIPGWRFLPTKSNKRMKQIRKE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R    + G   T  DDLLG+LL    KE+QE++ + N   +++  +++E
Sbjct  265  VNALLWGIIDKRGKAMKAG--ETLNDDLLGILLESNFKEIQEHENDKN-VGMSIKDVIEE  321

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ +P+WQ + REEV+ V   + P  + L+ L ++  +
Sbjct  322  CKLFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMI  381

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            ++E LRLYPPV LL R  +ED ++GD+++P G+ + +P + +HH  EIWG+D  EF PER
Sbjct  382  LHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHHDHEIWGEDAREFNPER  441

Query  709  F----ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            F    +  + SP   F PF  G R C+GQ++A++EAK+VLAM++ RFSF +S +Y HAP 
Sbjct  442  FSQGVLKATKSPVS-FFPFGWGSRLCIGQNFAILEAKMVLAMILQRFSFSLSPSYSHAPC  500

Query  877  VVISVKPKYGVQIRLN  924
             ++++KP+YG  + L+
Sbjct  501  SLVTLKPQYGAHLILH  516



>ref|XP_002971244.1| hypothetical protein SELMODRAFT_94751 [Selaginella moellendorffii]
 gb|EFJ27842.1| hypothetical protein SELMODRAFT_94751 [Selaginella moellendorffii]
Length=518

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 205/332 (62%), Gaps = 27/332 (8%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLT--------VLQRLCSQSTRHLCYPGNRFYPSKYNS  156
              D+IS T FG+SY KG+R+F +LT        +L R           PG RF P   N 
Sbjct  203  TGDVISHTAFGTSYLKGQRVFVILTKEIPDLFPILFRFS------WILPGFRFLPFPVNL  256

Query  157  EIKTLNIEVERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPL  336
            ++   + E++ L+  II  R++  + GR  +YG+DLLGL+LKE      +SN    N  L
Sbjct  257  KLWKFHQELDSLITGIIDERRESVKCGRSDSYGNDLLGLMLKECD----SSNSKFTNKDL  312

Query  337  IMDECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTL  516
            I +ECKTF+FAGHETTA LLTWT+MLL   P WQ++ R EV +VC  + P  E +SKL L
Sbjct  313  I-EECKTFYFAGHETTASLLTWTLMLLGGYPEWQDRARAEVHEVCGTETPDGENVSKLKL  371

Query  517  LSAVINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEF  696
            + A++ E LRLYPP   + R    +  L DLH+PKG+ +   V+ +HH +E+WG+D  EF
Sbjct  372  IGAILYETLRLYPPAVEMTRECMVETWLQDLHVPKGVTLAFQVIGMHHDKELWGEDATEF  431

Query  697  KPERF---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRH  867
             P+RF   IS +      F+PF+ GPR CVGQS+A++EAK++LAM++ RFSF +S NYRH
Sbjct  432  NPDRFKDGISNACKHPNAFIPFSLGPRVCVGQSFAMIEAKVILAMILQRFSFRLSPNYRH  491

Query  868  APVVVISVKPKYGVQIRLNPLI*QGLGKHSDN  963
             P +   +KP +GV     PL+ + +G+  ++
Sbjct  492  NPAMKFGLKPIHGV-----PLVLETVGRFQES  518



>dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=518

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/317 (42%), Positives = 210/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A+D+ISR  FGSSYE+GKRIF+L T    L ++    +  PG RF P+     +K ++ +
Sbjct  203  ASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRD  262

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++  L ++I +R+   + G  +   DDLLG+LL    KEM+E+ GN+    ++L  +++E
Sbjct  263  IKASLTDMINNRERALKAGEATK--DDLLGILLESNHKEMEEH-GNNKDVGMSLDDVIEE  319

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+  P WQ + REEV+QV   + P  + LS L +++ +
Sbjct  320  CKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKIVTMI  379

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPPV  L R   +D KLG+L +P G+ +++ ++ +HH  E+WG+D   F PER
Sbjct  380  LYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVFNPER  439

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   + ++ +    F PFA GPR C+GQ+++++EAK+ +AM++ RFSF++S +Y HAP  
Sbjct  440  FSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAHAPAT  499

Query  880  VISVKPKYGVQIRLNPL  930
            VI+++P+YG  I L+ L
Sbjct  500  VITLQPQYGAHIILHKL  516



>gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
Length=518

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/317 (42%), Positives = 210/317 (66%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A+D+ISR  FGSSYE+GKRIF+L T    L ++    +  PG RF P+     +K ++ +
Sbjct  203  ASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRD  262

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++  L ++I +R+   + G  +   DDLLG+LL    KEM+E+ GN+    ++L  +++E
Sbjct  263  IKASLTDMINNRERALKAGEATK--DDLLGILLESNHKEMEEH-GNNKDVGMSLDDVIEE  319

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+  P WQ + REEV+QV   + P  + LS L +++ +
Sbjct  320  CKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKIVTMI  379

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPPV  L R   +D KLG+L +P G+ +++ ++ +HH  E+WG+D   F PER
Sbjct  380  LYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVFNPER  439

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   + ++ +    F PFA GPR C+GQ+++++EAK+ +AM++ RFSF++S +Y HAP  
Sbjct  440  FSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAHAPAT  499

Query  880  VISVKPKYGVQIRLNPL  930
            VI+++P+YG  I L+ L
Sbjct  500  VITLQPQYGAHIILHKL  516



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 205/316 (65%), Gaps = 12/316 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D ISRT FGS+YE+G+ IFEL     +L  Q +     PG RF P+K N  +K +  E
Sbjct  205  TGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIPGWRFLPTKSNKRMKQIRKE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II  R    + G   T  DDLLG+LL    KE+QE++ + N   +++  +++E
Sbjct  265  VNALLWGIIDKRGKAMKAG--ETLNDDLLGILLESNFKEIQEHENDKN-VGMSIKDVIEE  321

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ +P+WQ + REEV+ V   + P  + L+ L ++  +
Sbjct  322  CKLFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMI  381

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            ++E LRLYPPV LL R  +ED ++GD+++P G+ + +P + +HH  EIWG+D  EF PER
Sbjct  382  LHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHHDHEIWGEDAREFNPER  441

Query  709  F----ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            F    +  + SP   F PF  G R C+GQ++A++EAK+VLAM++ RFSF +S +Y HAP 
Sbjct  442  FSQGVLKATKSPVS-FFPFGWGSRLCIGQNFAILEAKMVLAMILQRFSFSLSPSYSHAPC  500

Query  877  VVISVKPKYGVQIRLN  924
             ++++KP+YG  + L+
Sbjct  501  SLVTLKPQYGAHLILH  516



>ref|XP_009147881.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   273 bits (698),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 199/311 (64%), Gaps = 8/311 (3%)
 Frame = +1

Query  7    DIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEVE  186
            D+ISRT FGSSY++G+RIFEL T L +L  Q+ R    PG R+ P+K N  IK    E  
Sbjct  207  DVISRTAFGSSYKEGQRIFELQTELAQLIIQAFRKSYIPGYRYLPTKDNRRIKAAAKETH  266

Query  187  RLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTFFF  366
             +L  ++  R    E G      +DLLG+LL   + N G + G  +++  +++ECK F+F
Sbjct  267  DILRGLVNKRLRAREAGEAPN--EDLLGILL---ESNLGQAKGNGMSIDDVIEECKLFYF  321

Query  367  AGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEALR  546
            AG ETT++LL WT++LL+ +  WQ + REEV QV     P  E L+ L +++ +INE +R
Sbjct  322  AGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEPDTEGLNHLKIMTMIINEVIR  381

Query  547  LYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---IS  717
            LYPPVTLL R   ++ KLGDL +P G+ I +P++ +    ++WG D  EFKPERF   +S
Sbjct  382  LYPPVTLLTRTIHKEMKLGDLTLPGGVQINLPIMLVQRDTQLWGNDAAEFKPERFEDGVS  441

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            ++      F PFA GPR C+GQ++AL+EAK+ +A+++ RFSF++S  Y HAP  V ++ P
Sbjct  442  KATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPTYVHAPYTVFTLHP  501

Query  898  KYGVQIRLNPL  930
            +YG  + L+ L
Sbjct  502  QYGAHLILHKL  512



>gb|KEH38472.1| cytochrome P450 family protein [Medicago truncatula]
Length=353

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/314 (41%), Positives = 203/314 (65%), Gaps = 10/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A+D+ISR  FGSSYE+GKRIF+L T   +L       +  PG RF P+  +  +K ++ +
Sbjct  38   ASDVISRAAFGSSYEEGKRIFQLQTEQAKLTMSVMTKVYIPGWRFLPTTTHRRMKEIDRD  97

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V+  L ++I  R+   + G  +   DDLLG+LL    KEM+E+ GN+    ++L  +++E
Sbjct  98   VKASLTDMINKRERALKAGEATK--DDLLGILLESNHKEMEEH-GNNKNVGMSLDDVIEE  154

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+  P WQE+ REEV+QV   + P  + LS L +++ +
Sbjct  155  CKLFYFAGQETTSVLLVWTMVLLSRYPDWQERAREEVLQVFGNNKPDFDGLSHLKIVTMI  214

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPP   L R   +D  LG+L +P G+ +++ ++ +HH  E+WG D   F PER
Sbjct  215  LYEVLRLYPPAIALARSVHKDVILGNLALPAGVQVFLSIILVHHDIELWGDDAKVFNPER  274

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   + ++ +    F PF  GPR C+GQ+++++EAK+ +AM++ RF F++S +Y HAP  
Sbjct  275  FSEGVLKATNGRNSFFPFGGGPRICIGQNFSMLEAKMAIAMILQRFDFELSPSYAHAPAT  334

Query  880  VISVKPKYGVQIRL  921
            VI+++P+YG  I L
Sbjct  335  VITLQPQYGAHIIL  348



>emb|CDX75785.1| BnaC03g38680D [Brassica napus]
Length=374

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/312 (43%), Positives = 200/312 (64%), Gaps = 8/312 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            AD+ISRT FGSSY++G+RIFEL   L +L  Q+      PG  + P+K N  IK  + E+
Sbjct  68   ADVISRTAFGSSYKEGQRIFELQAELAQLIIQTFVKSYIPGYIYLPTKDNRRIKAGSREI  127

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTFF  363
            + +L  II  R    E G   +  DDLLG+LL   + N G + G  +++  +M+ECK F+
Sbjct  128  QVILRGIINKRLRAREAGEAPS--DDLLGILL---ESNSGQAKGNEMSIEDVMEECKLFY  182

Query  364  FAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEAL  543
            FAG ETT++LL W +++L+ +  WQ + REEV QV     P+ E L++L +++ ++ E L
Sbjct  183  FAGQETTSVLLVWIMIMLSQHQDWQARAREEVKQVFGDKEPATEGLNQLKVMTMILYEVL  242

Query  544  RLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---I  714
            RLYPP   L R   ++ KLGDL +P G+ I +P+L +H   ++WG D  EFKPERF   +
Sbjct  243  RLYPPAVQLTRAIHKEMKLGDLTLPGGVQINLPILLVHRDTQLWGNDAAEFKPERFKDGV  302

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            S++      F PFA GPR C+GQ++ALME K+ LA+++ +FSF++S +Y HAP  VI++ 
Sbjct  303  SKATKGQVSFFPFAWGPRICIGQNFALMEIKMALALILKKFSFELSPSYVHAPYTVITMH  362

Query  895  PKYGVQIRLNPL  930
            P++G  + LN +
Sbjct  363  PQFGAHLILNKI  374



>emb|CDY28093.1| BnaC06g02740D [Brassica napus]
Length=512

 Score =   273 bits (698),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 200/311 (64%), Gaps = 8/311 (3%)
 Frame = +1

Query  7    DIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEVE  186
            D+ISRT FGSSY++G+RIFEL T L +L  Q+ R    PG R+ P+K N  IK    E  
Sbjct  207  DVISRTAFGSSYKEGQRIFELQTELAQLIIQAFRKSYIPGYRYLPTKDNRRIKAAAKEAH  266

Query  187  RLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTFFF  366
             +L E++  R    E G      +DLLG+LL   + N G + G  +++  +++ECK F+F
Sbjct  267  DILRELVNKRLRAREAGEAPN--EDLLGILL---ESNLGQAKGNGMSIEDVIEECKLFYF  321

Query  367  AGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEALR  546
            AG ETT++LL WT++LL+ +  WQ + REEV QV     P+ E L+ L +++ +INE +R
Sbjct  322  AGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEPNTEGLNHLKMMTMIINEVIR  381

Query  547  LYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---IS  717
            LYPPVT L R   ++ KLGDL +P G+ I +P++ +    ++WG D  EFKPERF   +S
Sbjct  382  LYPPVTQLSRTIHKEMKLGDLTLPGGVQINLPIMLVQRETQLWGNDAAEFKPERFEDGVS  441

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            ++      F PFA GPR C+GQ++AL+EAK+ +A+++ RFSF++S  Y HAP  V ++ P
Sbjct  442  KATKNQVSFFPFAWGPRICIGQNFALLEAKMSMALILQRFSFELSPTYVHAPYTVFTLHP  501

Query  898  KYGVQIRLNPL  930
            +YG  + L+ L
Sbjct  502  QYGAHLILHKL  512



>ref|XP_010926800.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Elaeis guineensis]
Length=519

 Score =   273 bits (698),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 198/316 (63%), Gaps = 8/316 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISR  FGSS+++G+RIF+L      L  Q+ + +  PG RF P+K N+ +  ++ E
Sbjct  206  TGDVISRAAFGSSFKEGQRIFQLQQEQTELVVQAAQKIYIPGYRFLPTKKNNRMYEIDRE  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLK---EMQENKGNSNGFRLNLPLIMDEC  351
            +  LL  +I+ R+       +S   DDLLGLL++      + +G S    +    +++EC
Sbjct  266  IRALLSRMIEQRERAMRKAGVSN--DDLLGLLIESNLRYSQEQGGSKNTGMTKDDVIEEC  323

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAGHETT++LLTWTV++L  +PSWQ + REEV+QV   + P  + LS+L +++ V+
Sbjct  324  KLFYFAGHETTSVLLTWTVVVLGMHPSWQARAREEVLQVYGKNKPDYDGLSQLRIVTMVL  383

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYP +T L R  +++ KLGD   P G+ + +P+L IHH  + WG D  EF PERF
Sbjct  384  YEVLRLYPAITFLVRRTYKEMKLGDFTFPPGVQLLLPLLFIHHDPQFWGDDATEFNPERF  443

Query  712  ISRSYSPGRI---FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
             S      +I   F PF  GPR C+GQ++A+MEAK+ LA ++  FS + S +Y HAP  V
Sbjct  444  ASGVSKASKIQGTFFPFGGGPRICIGQNFAMMEAKMALARILQHFSLEPSSSYAHAPYTV  503

Query  883  ISVKPKYGVQIRLNPL  930
            I++ P+YG QI L+ L
Sbjct  504  ITLHPQYGAQIMLHRL  519



>ref|XP_010487267.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=547

 Score =   274 bits (700),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 202/313 (65%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+RIFEL   L +L  Q+ R    PG  + P+K N  +K    E
Sbjct  240  TADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAIIPGFSYLPTKGNRRMKAKARE  299

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            ++ +L  I+  R    E G   +  DDLLG+LL   + N G + G  ++   +M+ECK F
Sbjct  300  IQVILRGIVNKRLRAREAGEAPS--DDLLGILL---ESNLGQTKGNGMSTEDLMEECKLF  354

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LL WT++LL+ +  WQ + REEV QV     P  E L++L +++ ++ E 
Sbjct  355  YFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMILYEV  414

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPVT L R   ++ KLGDL +P G+ I +P+L +    E+WGKD  EFKPERF   
Sbjct  415  LRLYPPVTQLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGKDAGEFKPERFKDG  474

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            +S++      F PFA GPR C+GQ++A++EAK+ +A+++ +FSF++S +Y HAP  +I++
Sbjct  475  LSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYLHAPYTIITI  534

Query  892  KPKYGVQIRLNPL  930
             P++G Q+ L  L
Sbjct  535  HPQFGAQLILQKL  547



>ref|XP_009395215.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=518

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 208/317 (66%), Gaps = 12/317 (4%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCY-PGNRFYPSKYNSEIKTLNIE  180
             D+ISR  FGSSYE+G+RIFEL   +  L  Q+ +   Y PG RF P   N  IK ++ E
Sbjct  206  GDVISRAAFGSSYEEGRRIFELQAEIAELIMQTGKTAVYVPGYRFLPILKNRRIKAISKE  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R++  + G  ST  DDLLGLL+    K + E  GN N   + +  +++E
Sbjct  266  VRSLLRGIIRKREEAIKRGEAST--DDLLGLLMESNTKHLHEG-GNKNA-GMTIDEVVEE  321

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETTA+LLTWT+++L+ +P WQ + REEV+QV   D P  + LS L +++ +
Sbjct  322  CKLFYFAGQETTAVLLTWTMVVLSMHPLWQARAREEVLQVLGKDKPEFDALSHLKIVTMI  381

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPP+ L+ R  ++  ++G++  P G  + +P++ IHH   +WG+D +EFKPER
Sbjct  382  LYEVLRLYPPLALIQRRTYKTVEIGNIAYPPGTLLALPIIFIHHDPALWGEDASEFKPER  441

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   I+++      F PF  GPR C+GQ++AL+EAK+ L+ ++ RF F++S +Y HAP  
Sbjct  442  FAEGIAKTSRDQTAFFPFGGGPRVCMGQNFALLEAKMGLSTILQRFWFELSPSYAHAPRT  501

Query  880  VISVKPKYGVQIRLNPL  930
            V++++P++G Q+RL+ L
Sbjct  502  VMTLQPQHGAQLRLHRL  518



>ref|XP_002515162.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF47146.1| cytochrome P450, putative [Ricinus communis]
Length=503

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 202/318 (64%), Gaps = 16/318 (5%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            ADII+ T FGSSY +GK  FE    LQ   + ST +L  PG+ + P+  N ++  L+  V
Sbjct  193  ADIIAHTAFGSSYAQGKEAFEGQNELQHYSAASTLNLFIPGSHYLPTPSNLQLWKLDRRV  252

Query  184  ERLLMEIIQSR-----KDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDE  348
               L  II  R      DC       +YGDDLLGLL+    EN    +G +LN+  I++E
Sbjct  253  RNSLRAIINGRLNSSTSDC-------SYGDDLLGLLMGA-SENAEKKDGPKLNMDEIVEE  304

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CKTFFFAGHET++ LLTWT+ LL+ +  WQ ++REEV++ C  + P  + L +L L++ V
Sbjct  305  CKTFFFAGHETSSNLLTWTLFLLSLHQDWQTRLREEVLKECRMEIPDSDMLGRLKLVNMV  364

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + EALRLY PV  + R A +D KLG+L IPK   I IP+  IH S+E WG+D NEF P R
Sbjct  365  LLEALRLYCPVVDMYRQASKDMKLGNLMIPKDAWITIPLAKIHRSKEHWGEDANEFNPIR  424

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   IS++      FL F  GPR C+GQ++ ++EAK VLAM++ RFSF +S  Y+HAP+ 
Sbjct  425  FANGISKAAKHPNAFLAFGIGPRTCIGQNFGMLEAKAVLAMILQRFSFTLSPEYKHAPIN  484

Query  880  VISVKPKYGVQIRLNPLI  933
             ++++P+YG+ I + PL+
Sbjct  485  NLALQPQYGLPIVIKPLL  502



>ref|XP_009394812.1| PREDICTED: cytochrome P450 72A15-like [Musa acuminata subsp. 
malaccensis]
Length=518

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 205/316 (65%), Gaps = 11/316 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             D+ISR  FGSSYEKG+RIF+L   L ++   + +    PG RF P+  N+ I  +N EV
Sbjct  207  GDVISRAAFGSSYEKGRRIFQLQVELTQVVFHAIQRAYIPGYRFLPTPQNNRINAINREV  266

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLL----LKEMQENKGNSNGFRLNLPLIMDEC  351
              LL  II+ R++    G  +   +DLLGLL    L+  QE+ GN N   +    +++EC
Sbjct  267  RSLLRGIIKERQEAMRTGEATN--NDLLGLLMESNLQHFQEH-GNKNA-GMTSDEVVEEC  322

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ET + LLTWT+++L+ +P WQ + REEV+Q    + P  + LS L +++ ++
Sbjct  323  KLFYFAGQETVSTLLTWTMVVLSMHPEWQVRAREEVLQAFGKNKPDFDGLSHLKIVTMIL  382

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPP  L+ R+A++  KLG++  P G+ + +P++ IHH  ++WGKD +EFKPERF
Sbjct  383  YEVLRLYPPAILIQRIAYKTMKLGNIVYPPGVLLMVPIVFIHHDPDLWGKDASEFKPERF  442

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               I+++      F PF+ GPR C+GQ++AL+EAK  L M++ +FSF++S  Y HAP   
Sbjct  443  AQGIAKASKDQVAFFPFSGGPRVCIGQNFALLEAKTALCMILQQFSFELSPAYTHAPRTF  502

Query  883  ISVKPKYGVQIRLNPL  930
            ++++P++G Q+RL+ L
Sbjct  503  VTLQPQHGAQLRLHKL  518



>ref|XP_008785718.1| PREDICTED: cytochrome P450 CYP72A219-like [Phoenix dactylifera]
Length=522

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 205/317 (65%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FG SYE+G++IF+L      L  Q+ + +  PG RF P+  N+  K ++ E
Sbjct  209  TGDVISRTAFGCSYEEGRQIFQLQAEQAELFIQAAQSVYIPGYRFLPTPMNNRRKEIDRE  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLL----LKEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R    ++G+ S   DDLLGL+    LK  QE+ GN     +    +++E
Sbjct  269  VRALLRGIIEKRDQAIKMGKASN--DDLLGLMMESNLKHFQEH-GNFKNTVMTTDEVIEE  325

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LLTWT+++L+ +P WQ + REEV++    + P  + LS+L +++ V
Sbjct  326  CKLFYFAGQETTSVLLTWTMVVLSMHPIWQLRAREEVLEFFGKNKPDFDGLSRLKIVTMV  385

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPP+ LL R  ++  KLGD+  P G+ + +PV+ IHH  E WGKD +EF P+R
Sbjct  386  LYEVLRLYPPLILLTRRTYKTMKLGDITYPPGVLLSLPVIFIHHDPEFWGKDASEFNPQR  445

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR C+GQ++AL+EAK+ L+M++  FSF++S  Y H+P  
Sbjct  446  FVEGVSKASKDQMAFFPFGWGPRTCIGQNFALLEAKMGLSMILQHFSFELSPTYVHSPCT  505

Query  880  VISVKPKYGVQIRLNPL  930
            VI+++P++G QIR + L
Sbjct  506  VITLQPQHGAQIRFHRL  522



>ref|XP_006477949.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=517

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 206/317 (65%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGS+YE+G+RIF+L + L  L  Q  R +  PG RF P+K N  +K L+ E
Sbjct  204  TGDVISRTAFGSNYEEGRRIFQLQSELAELTIQVIRSVYIPGWRFLPTKRNKRMKELDKE  263

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            +   LM II++R+   + G  +   DDLLG+L+    +E++E+ GN+    ++   +M+E
Sbjct  264  ISTALMGIIKNREKAMKAGEAAN--DDLLGILMDTNFREIEEH-GNNKNVGMSFNDVMEE  320

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ +  WQE+ R+EV+QV   + P  + L+ L ++  +
Sbjct  321  CKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDYDGLNHLKIVQMI  380

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             NE LRLYPP  +L R   ++ KLG+L +  G+ I +PV+ +HH  E+WG D  EFKPER
Sbjct  381  FNEVLRLYPPAVMLARAVNKETKLGNLILLAGVQISLPVIMVHHDPELWGDDAIEFKPER  440

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   IS+       + PFA GPR C+G ++AL+EAKI LAM++  FSF++S +Y HAP  
Sbjct  441  FSEGISKVNRNQVSYFPFAWGPRICIGLNFALVEAKIALAMILQNFSFELSPSYVHAPTA  500

Query  880  VISVKPKYGVQIRLNPL  930
            V+++ P++G  + L  L
Sbjct  501  VLTLHPEFGTHLILRKL  517



>ref|XP_007204041.1| hypothetical protein PRUPE_ppa021108mg [Prunus persica]
 gb|EMJ05240.1| hypothetical protein PRUPE_ppa021108mg [Prunus persica]
Length=503

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 199/319 (62%), Gaps = 11/319 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            +AD+ISR  FGS+YE+GKR+FEL   L  L  ++   L  PG RF P+K N   K L  +
Sbjct  187  SADVISRAAFGSTYEEGKRVFELQKELLVLTFEAMTTLYIPGFRFVPTKKNQRRKKLAKD  246

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLK-----EMQENKGNSNGFR-LNLPLIM  342
            +  +L  IIQ + +    G      DDLLG+LL+     +  E   N+     L +  ++
Sbjct  247  ITSMLRNIIQKKMNAIRAGESRV--DDLLGMLLQSNNQTDFSETARNTRSNEMLTIEEVI  304

Query  343  DECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLS  522
            +ECK F+ AG ETT+  LTWT+++LA +P WQEK R+EV+QVC    P+ E L  L +++
Sbjct  305  EECKQFYLAGQETTSSWLTWTMIVLAMHPDWQEKARQEVLQVCGKKEPNFEALGHLKIVT  364

Query  523  AVINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKP  702
             ++NE LRLYPP     + A+++ K+GD+  P G+ I +P L IHH  E+WG D  EFKP
Sbjct  365  MILNEVLRLYPPAIAQYQHAYKETKIGDIIAPAGVDITLPTLLIHHDPELWGADAGEFKP  424

Query  703  ERF---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAP  873
            ERF   + ++    + F PF  GPR C+GQ++A++EAK+ LAM++  FSF++S +Y HAP
Sbjct  425  ERFSAGVLKASKDQQAFFPFGWGPRTCIGQNFAMIEAKLALAMVLQHFSFELSPSYTHAP  484

Query  874  VVVISVKPKYGVQIRLNPL  930
              V  ++P++G QI L+ L
Sbjct  485  YTVTILQPQHGAQIMLHQL  503



>ref|XP_006407057.1| hypothetical protein EUTSA_v10020855mg [Eutrema salsugineum]
 gb|ESQ48510.1| hypothetical protein EUTSA_v10020855mg [Eutrema salsugineum]
Length=404

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 200/312 (64%), Gaps = 8/312 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            AD+ISRT FGSSY++G+RIFEL   L +L  Q+ R    PG  + P+K N  +K    E+
Sbjct  98   ADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAFIPGYIYLPTKGNRRMKAAAREI  157

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTFF  363
            + +L  I+  R    E G      DDLLG+LL   + N G + G  ++   +M+ECK F+
Sbjct  158  QIILRGIVNKRLTAREAGEAPN--DDLLGILL---ESNLGQAKGNGMSTEEVMEECKLFY  212

Query  364  FAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEAL  543
            FAG ETT++LL WT++LL+ +  WQ + REEV QV     P  E L++L +++ ++ E L
Sbjct  213  FAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMILYEVL  272

Query  544  RLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---I  714
            RLYPPVT + R   ++ KLGDL +P G+ I +P+L +    E+WG D  EFKPERF   +
Sbjct  273  RLYPPVTQVTRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGDDAAEFKPERFKEGL  332

Query  715  SRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVK  894
            S++      F PF  GPR C+GQ++A++EAK+ +A+++ RFSF++S +Y HAP  VI++ 
Sbjct  333  SKATKSQVSFFPFTWGPRICIGQNFAILEAKMAMALILQRFSFELSPSYVHAPYPVITIH  392

Query  895  PKYGVQIRLNPL  930
            P++G Q+ L+ L
Sbjct  393  PQFGAQLILHKL  404



>ref|XP_010465360.1| PREDICTED: cytochrome P450 72A15 [Camelina sativa]
Length=512

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/313 (43%), Positives = 202/313 (65%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+RIFEL   L +L  Q+ R    PG  + P+K N  +K    E
Sbjct  205  TADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAIIPGFSYLPTKGNRRMKAKARE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            ++ +L  I+  R    E G   +  DDLLG+LL   + N G + G  ++   +M+ECK F
Sbjct  265  IQVILRGIVNKRLRAREAGEAPS--DDLLGILL---ESNLGQTKGNGMSTEDLMEECKLF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LL WT++LL+ +  WQ + REEV QV     P  E L++L +++ ++ E 
Sbjct  320  YFAGQETTSVLLVWTMVLLSQHKDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMILYEV  379

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPVT L R   ++ KLGDL +P G+ I +P+L +    E+WG D  EFKPERF   
Sbjct  380  LRLYPPVTQLTRAIHKEIKLGDLTLPGGVQISLPILLVQRDTELWGNDAGEFKPERFKDG  439

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            +S++      F PFA GPR C+GQ++A++EAK+ +A+++ +FSF++S +Y HAP  +I++
Sbjct  440  LSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYLHAPYTIITI  499

Query  892  KPKYGVQIRLNPL  930
             P++G Q+ L+ L
Sbjct  500  HPQFGAQLILHKL  512



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 205/314 (65%), Gaps = 9/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D ISRT FGS YE+G++IFEL     R   ++TR +  PG+RF P+K N  +K +  E
Sbjct  207  TSDAISRTAFGSRYEEGRKIFELQREQARHLVEATRSIYIPGSRFLPTKRNRRMKQIAKE  266

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEM-QENKGNSNGFRLNLPLIMDECKT  357
            VE  + EII +R      G       D+LG+LL+   QE  G S    +    I+ ECK 
Sbjct  267  VEGSIREIINARLKALRAG--EAIDADMLGILLESTSQETDGESG---MTTGEIIQECKL  321

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            F+FAG ETTA+LL WT++LL+ +P WQE+ REEV+Q    D P+ + L++L +++ +++E
Sbjct  322  FYFAGQETTAVLLVWTMILLSMHPDWQERAREEVLQHFGTDMPNFDGLNQLKIVTMILHE  381

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERFIS  717
             LRLYPP   + R   E+ K+G+L IP G  + +P++ +HH  EIWG+DV EFKPERF  
Sbjct  382  VLRLYPPFPNIGRSVAEETKIGNLTIPAGQLLTLPMILLHHDPEIWGQDVKEFKPERFAD  441

Query  718  --RSYSPGRI-FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
               S + G+I + PF  GPR C+GQ++A++EAK+ LAM++ RFSF++S +Y HAP + I+
Sbjct  442  GVSSATKGQIVYFPFGWGPRICIGQNFAMLEAKLALAMILQRFSFELSPSYSHAPHLTIA  501

Query  889  VKPKYGVQIRLNPL  930
            ++P++G  + L+ L
Sbjct  502  IQPQFGAHLMLHKL  515



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 211/317 (67%), Gaps = 11/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISRT FGS+YE+G++IFEL         + +R L  PG RF P+K N  +K +  E
Sbjct  206  TSDVISRTAFGSNYEEGRKIFELQKEQAEHVIEVSRTLYIPGWRFLPTKRNRRMKEIERE  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V+  +  II  R    + G  +T  DDLLG+LL    KE++++ GN N F + +  +++E
Sbjct  266  VQATIRGIIDKRVKGMKAGEANT--DDLLGILLESNFKEIEQH-GNKN-FGMTIKEVIEE  321

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++ L WT++LL+ +P WQ + REEV+QV     P  + L++L +++ +
Sbjct  322  CKLFYFAGQETTSVWLVWTMILLSRHPDWQVRAREEVLQVFGDGMPGFDGLNRLKVVTMI  381

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            ++E+LRLYPPV+ L R      KLG+L++P G+ + +P + +HH +EIWG+D  EFKPER
Sbjct  382  LHESLRLYPPVSALGRRITTKTKLGELNLPAGVMLSLPTILVHHDKEIWGEDATEFKPER  441

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   IS++      F PF AGPR C+G ++A++EAK+ +AM++ RF+F++S +Y HAP  
Sbjct  442  FSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMTMAMILQRFAFELSPSYTHAPQS  501

Query  880  VISVKPKYGVQIRLNPL  930
            VI+++PKYG  + L+ L
Sbjct  502  VITMQPKYGAPLVLHRL  518



>ref|XP_002970897.1| hypothetical protein SELMODRAFT_94367 [Selaginella moellendorffii]
 gb|EFJ28223.1| hypothetical protein SELMODRAFT_94367 [Selaginella moellendorffii]
Length=510

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 203/314 (65%), Gaps = 10/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTV-LQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNI  177
              D+IS T FG+SY KG+R+FE+L+  +  L  +       PG RF P   N  +  L+ 
Sbjct  203  TGDVISHTAFGTSYLKGQRVFEILSKKIPELVPKLFSFSWIPGFRFLPLPINLRLWKLHQ  262

Query  178  EVERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKT  357
            E++ L+  II  R++  + GR +TYG+DLLGL+LKE   +   SN    +L   ++ECKT
Sbjct  263  ELDSLITGIIDERRNSVKSGRSNTYGNDLLGLMLKECDSS---SNFTSRDL---IEECKT  316

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            F+ AGHETTA+LLTWT+MLL   P WQE+ R EV +VC  + P  E +S+L L+  ++ E
Sbjct  317  FYLAGHETTAILLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYE  376

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPPV  + R   E+  L DLH+P+G+++  P++ +H  +E+WG+D  +F P+RF  
Sbjct  377  TLRLYPPVVEMTRECVEESWLQDLHVPRGVSVSFPIVGLHQDKELWGEDAGQFNPDRFKA  436

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             IS +      F+PF+ GPR CVGQS+A++EAK++LAM++ RF F +S NYRH P +   
Sbjct  437  GISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFLFRLSPNYRHNPAMKFG  496

Query  889  VKPKYGVQIRLNPL  930
            +KP +GV + L+ +
Sbjct  497  LKPIHGVPLVLSKM  510



>ref|NP_188079.1| cytochrome P450, family 72, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
 dbj|BAB02393.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAL61910.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAO30051.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AEE75547.1| cytochrome P450, family 72, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
Length=512

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/314 (42%), Positives = 206/314 (66%), Gaps = 9/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+IS T FGSSY++G+RIF+L   L  L +Q+ +    PG+RFYP+K N  +K ++ E
Sbjct  204  TADVISHTAFGSSYKEGQRIFQLQGELAELIAQAFKKSYIPGSRFYPTKSNRRMKAIDRE  263

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+ +L  I+  R+   E G  +   DDLLG+LL   + N   S G  +++  +M ECK F
Sbjct  264  VDVILRGIVSKREKAREAGEPAN--DDLLGILL---ESNSEESQGNGMSVEDVMKECKLF  318

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCN-GDPPSIEQLSKLTLLSAVINE  537
            +FAG ETT++LL WT++LL+ +  WQ + REEVMQV    + P +E L+ L +++ + NE
Sbjct  319  YFAGQETTSVLLVWTMVLLSHHQDWQARAREEVMQVLGENNKPDMESLNNLKVMTMIFNE  378

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPPV  L R+  ++ KLG+L +P G+ I++P + +    E+WG D  +FKPERF  
Sbjct  379  VLRLYPPVAQLKRVVNKEMKLGELTLPAGIQIYLPTILVQRDTELWGDDAADFKPERFRD  438

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             +S++      F PF  GPR C+GQ++A++EAK+ +A+++ +FSF++S +Y HAP  V++
Sbjct  439  GLSKATKNQVSFFPFGWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYVHAPQTVMT  498

Query  889  VKPKYGVQIRLNPL  930
             +P++G  + L+ L
Sbjct  499  TRPQFGAHLILHKL  512



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 204/317 (64%), Gaps = 10/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D ISRT FGSSYE+G+RIF+L      L  +  R +  PG RF P+K N  ++ ++ E
Sbjct  202  AGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFVPTKTNKRMRQISNE  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V  LL  II+ R+   ++G   T  DDLL LL+    +EMQE+    N   +++  +++E
Sbjct  262  VHALLKGIIERREKAMKVG--ETANDDLLSLLMESNFREMQEHDERKN-VGMSIKDVIEE  318

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT+ LL WT++LL+ + +WQ + REEV+QV     P  + L+ L +++ +
Sbjct  319  CKLFYFAGQETTSDLLLWTMVLLSKHSNWQARAREEVLQVFGNKKPDGDGLNHLKIVTII  378

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV++L R    D ++G  + P G  I +P+L IHH  EIWG+D  EF PER
Sbjct  379  FHEVLRLYPPVSMLIRTVVADSQVGGWYFPDGALITLPILLIHHDHEIWGEDAKEFNPER  438

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR C+GQ++A+MEAK+ LAM++ RFSF++S +Y HAP  
Sbjct  439  FSEGVSKATKGQFAFYPFGYGPRVCIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPSN  498

Query  880  VISVKPKYGVQIRLNPL  930
            +I+++P+YG  + L+ L
Sbjct  499  IITIQPQYGAYLILHGL  515



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 208/317 (66%), Gaps = 11/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISRT FGSSYE G+RIFEL     +   ++ R +  PG RF P+K N  +K +  +
Sbjct  206  TSDVISRTAFGSSYEAGRRIFELQKEQAQFLMEAIRSVYIPGWRFLPTKRNRRMKEIEKD  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            V+ L+  II  R    + G ++   +DLLG+LL    KE++++ GN + F +++  ++ E
Sbjct  266  VQALVRGIIDKRVKSMKAGEVNN--EDLLGILLESNFKEIEQH-GNKD-FGMSIEEVIQE  321

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+ +  WQ   REEV+QV     P  + L++L +++ +
Sbjct  322  CKLFYFAGQETTSVLLVWTLILLSRHQDWQALAREEVLQVFGNQKPDFDGLNRLKIVTMI  381

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E+LRLYPPV  L R   ED  LGD+ +P G+ I +PV+ +HH EEIWGKD  +FKPER
Sbjct  382  LYESLRLYPPVVTLTRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAKKFKPER  441

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S +      F PF  GPR C+GQ++A++EAK  LAM++ RFSF++S +Y HAP  
Sbjct  442  FRDGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKTTLAMILQRFSFELSPSYAHAPQS  501

Query  880  VISVKPKYGVQIRLNPL  930
            +I+++P+YG  + L+ +
Sbjct  502  IITLQPQYGAPLILHKI  518



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 203/318 (64%), Gaps = 11/318 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D ISRT FGSSYE+G+RIF+L      L  +  R +  PG RF P+K N  I+ +  E
Sbjct  202  TGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFVPTKTNKRIRQIRNE  261

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            +  LL  II+ R+    +G   T  DDLL LL+    +EMQE+    N   +++  +++E
Sbjct  262  LHALLKGIIEKREKAMLVG--ETANDDLLSLLMESNFREMQEHDERKN-VGMSIDDVIEE  318

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT+ LL WT++LL+ + +WQ + REE++QV     P    L+ L +++ +
Sbjct  319  CKLFYFAGQETTSDLLLWTMILLSKHSNWQARAREEILQVFGNKKPDGNGLNHLKIVTMI  378

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV++L R  F D ++G  + P G  + +P+L IHH  EIWG+D  EF PER
Sbjct  379  FHEVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALPILLIHHDHEIWGEDAKEFNPER  438

Query  709  F---ISRSYSPGRI-FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            F   +S++   G+  F PF  GPR C+GQ++A+MEAK+ LAM++ RFSF++S +Y HAP 
Sbjct  439  FSEGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPF  498

Query  877  VVISVKPKYGVQIRLNPL  930
             VI+V+P+YG  + L+ L
Sbjct  499  NVITVQPQYGAHLILHGL  516



>ref|XP_002972526.1| hypothetical protein SELMODRAFT_441830 [Selaginella moellendorffii]
 gb|EFJ26612.1| hypothetical protein SELMODRAFT_441830 [Selaginella moellendorffii]
Length=508

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/306 (46%), Positives = 203/306 (66%), Gaps = 16/306 (5%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             ADIIS T FGSSY KG+++FE L  +    S+  R+   PG RF P   N  ++ L  +
Sbjct  209  TADIISHTAFGSSYLKGQKVFETLRAIPEQLSKVDRYNYIPGKRFLPFPANFRLRKLYSD  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            ++ LL+ +I+ R+  A+ G+      DLLGL+L E     GNS+    +   +M+ECKTF
Sbjct  269  LDSLLLALIKERR--AQSGQ----SHDLLGLMLAEC----GNSS---FDDRAVMEECKTF  315

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAGHETTA LLTW++ LLA +  WQE+ R E  +VC G  P  + +SKL L++ +++E 
Sbjct  316  YFAGHETTATLLTWSITLLALHREWQERARAEAQEVCEGATPEADSISKLKLINMILHET  375

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPV ++ R  FED  LGD+ +PKG A+  P+LAIHH +E+WG+D +EF PERF   
Sbjct  376  LRLYPPVVVMMRSCFEDTILGDILVPKGAAVSFPILAIHHDKELWGEDAHEFNPERFKDG  435

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            ++++      F+PF+ GPR CVGQS+ LMEAKI LA ++ RF F +S +YRH PV  +++
Sbjct  436  VTKASKHPNAFMPFSLGPRVCVGQSFVLMEAKIALATILQRFRFRLSPSYRHCPVFKLTL  495

Query  892  KPKYGV  909
            +P++G+
Sbjct  496  RPRHGL  501



>ref|XP_002969411.1| hypothetical protein SELMODRAFT_410461 [Selaginella moellendorffii]
 gb|EFJ29499.1| hypothetical protein SELMODRAFT_410461 [Selaginella moellendorffii]
Length=510

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 202/314 (64%), Gaps = 10/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTV-LQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNI  177
              D+IS T FG+SY KG+R+FE+L+  +  L  +       PG RF P   N  +  L+ 
Sbjct  203  TGDVISHTAFGTSYLKGQRVFEILSKKIPELVPKLFSFSWIPGFRFLPLPINLRLWKLHQ  262

Query  178  EVERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKT  357
            E++ L+  II  R++  + GR +TYG+DLLGL+LKE   +   SN    +L   ++ECKT
Sbjct  263  ELDSLITGIIDERRNSVKSGRSNTYGNDLLGLMLKECDSS---SNFTSRDL---IEECKT  316

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            F+ AGHETTA+LLTWT+MLL   P WQE+ R EV +VC  + P  E +S+L L+  ++ E
Sbjct  317  FYLAGHETTAILLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYE  376

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPPV  + R   E+  L DLH+P+G+++  P++ +H  +E+WG+D  +F P RF  
Sbjct  377  TLRLYPPVVEMTRECVEESWLQDLHVPRGVSVSFPIVGLHQDKELWGEDAGQFNPHRFKD  436

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             IS +      F+PF+ GPR CVGQS+A++EAK++LAM++ RF F +S NYRH P +   
Sbjct  437  GISSACRHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFLFRLSPNYRHNPAMKFG  496

Query  889  VKPKYGVQIRLNPL  930
            +KP +GV + L+ +
Sbjct  497  LKPMHGVPLVLSKM  510



>ref|XP_009146340.1| PREDICTED: cytochrome P450 72A13 [Brassica rapa]
Length=550

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 202/315 (64%), Gaps = 10/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+IS T FGSSY++G+RIF+L   L  L +Q+ +    PG RFYP+K N  IK ++ E
Sbjct  241  TADVISHTAFGSSYKEGQRIFQLQGELAELVAQAFKKSYIPGLRFYPTKSNRRIKVIDRE  300

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            ++ +L  ++  R+   E G      +DLLG+LL E    +   NG  +++  +M ECK F
Sbjct  301  IDTILRGLVSKREKAKEAG--EAVNNDLLGILL-ESNSEESQRNG--MSVEEVMKECKLF  355

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGD--PPSIEQLSKLTLLSAVIN  534
            +FAG ETT++LL WT++LL+ +  WQ K REEVMQ   G+   P I+ LS L +++ + N
Sbjct  356  YFAGQETTSVLLVWTMVLLSYHQDWQVKAREEVMQTLGGNNTKPDIDSLSNLKVMTMIFN  415

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF-  711
            E LRLYPPV  L R   ++ KLG+L +P G+ ++IP   +H   E+WG D  EF PERF 
Sbjct  416  EVLRLYPPVAQLKRAVNKEMKLGELTLPAGVQVYIPTALVHRDPELWGDDAAEFNPERFR  475

Query  712  --ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
              +S++      F PF  GPR C+GQS+AL+EAK+ +A+++ RFSF++S +Y HAP  V+
Sbjct  476  DGLSKATKNQVSFFPFGWGPRICIGQSFALLEAKMAMALILQRFSFELSPSYVHAPQTVM  535

Query  886  SVKPKYGVQIRLNPL  930
            + +P++G  + L+ L
Sbjct  536  TTRPQFGAHLILHKL  550



>gb|AAR11387.1| cytochrome P450 [Triticum aestivum]
Length=514

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/313 (44%), Positives = 210/313 (67%), Gaps = 10/313 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            AD+IS T FGSSYE+GK++F     LQ L   +  ++  P  R+ P++ N +I  L+ EV
Sbjct  206  ADVISHTAFGSSYEQGKKVFLAQRELQFLAFSTVFNVQIPAFRYLPTEKNVKIWKLDKEV  265

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQ-ENKGNSNGFRLNLPLIMDECKTF  360
              +LM II+ R    +I     YG+DLLGL+L+    E++ N     L++  I+DECKTF
Sbjct  266  RTMLMNIIKGRLATKDI---MGYGNDLLGLMLEACAPEDRQNP---LLSMDEIIDECKTF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+T++ LLTWT+ LL+T+P WQEK+REEV++ C    P+ + L+KL L++  + E 
Sbjct  320  FFAGHDTSSHLLTWTMFLLSTHPKWQEKLREEVLRECGNGVPTGDMLNKLQLVNMFLLET  379

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLY PV+ + R A  D ++G + +P+G  + IP+  IH  +E+WG+D NEFKP RF   
Sbjct  380  LRLYAPVSAIQRKAGSDLEVGGIKVPEGTVLTIPIATIHRDKEVWGEDANEFKPMRFENG  439

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            ++R+       L F++GPR+C+GQ++A++EAK V+A+++ RFSF +S  Y HAP+ VI++
Sbjct  440  VTRAGKHPNALLSFSSGPRSCIGQNFAMIEAKAVIAVILQRFSFSLSPKYVHAPMDVITL  499

Query  892  KPKYGVQIRLNPL  930
            +PK+G+ + L  L
Sbjct  500  RPKFGLPMVLKSL  512



>ref|XP_010926829.1| PREDICTED: cytochrome P450 72A11-like [Elaeis guineensis]
Length=516

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 201/316 (64%), Gaps = 8/316 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSS+++G+RIF+LL    +L +Q  R++  PG RF P+K N  +K ++ E
Sbjct  203  TGDVISRTAFGSSFKEGQRIFQLLDEQAKLAAQVVRNIYIPGYRFVPTKRNKRMKEIHRE  262

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLK---EMQENKGNSNGFRLNLPLIMDEC  351
            +  +L +II+ R+      +     DDLLGLL++      + +G S    +    ++ EC
Sbjct  263  IRAILCKIIEQREKGMR--KPGATNDDLLGLLMESNFRYSQEQGGSKNTGMTKDDMIKEC  320

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            + F   GH+TTA+LLTWT+++L  +PSWQ + REEV+Q+     P  + LS+L +++ ++
Sbjct  321  RLFHLVGHKTTAVLLTWTMVVLGMHPSWQARAREEVLQIFGKTKPDFDGLSQLKIVTMIL  380

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPP++ + R  ++  KLGD   P G+ + +P+L +HH  E WG+D +EF PERF
Sbjct  381  YEVLRLYPPLSFVLRKTYKKMKLGDFSFPPGVQLLLPILFLHHDPEYWGEDASEFHPERF  440

Query  712  ISRSYSPGRI---FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
                 +  +I   FLPF+ GPR CVGQSYALMEAK+ LA ++  FSF++S +Y HAP +V
Sbjct  441  ARGVSNASKIQGAFLPFSWGPRICVGQSYALMEAKMALATILKNFSFELSPSYAHAPYMV  500

Query  883  ISVKPKYGVQIRLNPL  930
             S+ P+YG  I L  L
Sbjct  501  FSIHPQYGAPIILRRL  516



>emb|CDP04590.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/315 (41%), Positives = 205/315 (65%), Gaps = 10/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              DIISRT FGS++++G +I +L   LQ L  ++ + L  PG RF P++ N   K+L+  
Sbjct  176  TGDIISRTAFGSNFDEGNQILKLQRELQGLVVEAMQSLYIPGLRFIPTRKNRRRKSLDKN  235

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENK-----GNSNGFRLNLPLIMD  345
            +  +L  +I+ ++     G+ +T  DDLLGLLL+   EN       N NG ++ +  I++
Sbjct  236  ITSMLRSLIERKETLMRTGQTNT--DDLLGLLLQSNDENSLQSSPQNKNGNKMTIKEIIE  293

Query  346  ECKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSA  525
            ECK F+ AG ETT+ LLTWT+++LA +P WQE+ REEV+ +C    P  + +S+L  ++ 
Sbjct  294  ECKQFYIAGQETTSSLLTWTMIILAMHPEWQEQAREEVLALCGKQHPDAKTISQLKTVTM  353

Query  526  VINEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPE  705
            +++E LRLYPP   L +  +++ K+G+L +P G+ + +P+L IHH  E+WG D  EFKPE
Sbjct  354  ILHEVLRLYPPAIALYKHTYQETKIGNLSLPAGVDLTLPLLLIHHDPELWGSDAEEFKPE  413

Query  706  RF---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            RF   +S++      F PF  GP+ C+GQ++ALMEAKI L++++  FSF++S +Y HAP 
Sbjct  414  RFSEGLSKASKNQLAFFPFGWGPKTCIGQNFALMEAKIALSIILQNFSFELSPSYTHAPN  473

Query  877  VVISVKPKYGVQIRL  921
             V++++P++G  I L
Sbjct  474  TVMTLQPQHGAPIIL  488



>emb|CDX97588.1| BnaA05g24910D [Brassica napus]
Length=514

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 202/315 (64%), Gaps = 10/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+IS T FGSSY++G+RIF+L   L  L +Q+ +    PG RFYP+K N  IK ++ E
Sbjct  205  TADVISHTAFGSSYKEGQRIFQLQGELAELVAQAFKKSYIPGLRFYPTKSNRRIKVIDRE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            ++ +L  ++  R+   E G      +DLLG+LL+   E +   NG  +++  +M ECK F
Sbjct  265  IDTILRGLVSKREKAKEAG--EAVNNDLLGILLESNSE-ESQRNG--MSVEEVMKECKLF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGD--PPSIEQLSKLTLLSAVIN  534
            +FAG ETT++LL WT++LL+    WQ K REEVMQ   G+   P I+ LS L +++ + N
Sbjct  320  YFAGQETTSVLLVWTMVLLSHYQDWQVKAREEVMQTLGGNNTKPDIDSLSNLKVMTMIFN  379

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF-  711
            E LRLYPPV  L R   ++ KLG+L +P G+ ++IP   +H   E+WG D  EF PERF 
Sbjct  380  EVLRLYPPVAQLKRAVNKEMKLGELTLPSGVQVYIPTALVHRDPELWGDDAAEFNPERFR  439

Query  712  --ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
              +S++      F PF  GPR C+GQS+AL+EAK+ +A+++ RFSF++S +Y HAP  V+
Sbjct  440  DGLSKATKNQVSFFPFGWGPRICIGQSFALLEAKMAMALILQRFSFELSPSYVHAPQTVM  499

Query  886  SVKPKYGVQIRLNPL  930
            + +P++G  + L+ L
Sbjct  500  TTRPQFGAHLILHKL  514



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 207/315 (66%), Gaps = 12/315 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A+D+I+RT FGSS+E+GKRIF+L   L  L  +    +  PG RF P+  N  +K ++  
Sbjct  208  ASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYIPGWRFVPTATNRRMKEIDRY  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++  L ++I+ R+   + G  +   DDLLG+LL    KE+QE++ N N   +NL  +++E
Sbjct  268  IKASLTDMIKKREKAPKTGEATR--DDLLGILLESNHKEIQEHRNNEN-VGMNLNDVIEE  324

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL+  P WQ + REEV+QV     P+ + LS L +++ +
Sbjct  325  CKLFYFAGQETTSVLLVWTMVLLSRYPDWQSRAREEVLQVFGKQAPNFDGLSHLKIVTMI  384

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPP   L R    D KLG+L +P G+ + +P++ +HH  E+WG D  EF PER
Sbjct  385  LYEVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQVSLPIIMVHHDRELWGDDAKEFNPER  444

Query  709  F---ISRSYSPGRI-FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            F   +S++ + GR+ F PF  GPR C+GQ+++L+EAK+ L+M++  FSF++S  Y HAP 
Sbjct  445  FSEGVSKA-TNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYTHAPF  503

Query  877  VVISVKPKYGVQIRL  921
             VI+++P+YG  + L
Sbjct  504  TVITLQPQYGAHVIL  518



>ref|XP_010323670.1| PREDICTED: cytochrome P450 CYP72A219 isoform X2 [Solanum lycopersicum]
Length=431

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 203/317 (64%), Gaps = 11/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +++ISRT FGSSYE+G+ +FEL         +  R +  PG+RF P+K N  +  +  E
Sbjct  119  TSEVISRTAFGSSYEEGRIVFELQKEQAEHVMEVARSIYIPGSRFLPTKRNKRMLEIEKE  178

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++  +  II  R    E G  S   DDLLG+LL    KE++++   S  F +    +++E
Sbjct  179  IQTTIRRIIDKRLRAMEGGETSK--DDLLGILLESNMKEIEQH--GSKDFGMTTVEVIEE  234

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT++LL WT++LL  +P WQ + REEV+QV   D P +E L +L +++ +
Sbjct  235  CKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDKPDLEGLGRLKIVTMI  294

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRL+PP+    R   E+ KLG+L++P G+ + +P + +H+ +EIWG+D  EFKPER
Sbjct  295  LYETLRLFPPLPTFGRTNKEEVKLGELNLPAGVILIVPAILVHYDKEIWGEDAKEFKPER  354

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F+PF  GPR C+GQ++A+MEAK+ LAM++ RFSF++S +Y HAP  
Sbjct  355  FSEGVSKATKGQFSFIPFGGGPRICIGQNFAMMEAKMALAMILQRFSFELSPSYTHAPFA  414

Query  880  VISVKPKYGVQIRLNPL  930
            V+++ P+YG  + +  L
Sbjct  415  VVTIHPQYGAPLLMRKL  431



>ref|XP_009394213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 206/317 (65%), Gaps = 11/317 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            + D+ISRT FGSSYE+G++IF+L +    L  Q  ++L  PG RF P+  N  IK ++ E
Sbjct  210  SGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPTPKNKRIKAIDRE  269

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            +  +L  II+ R+   + G+ ST  DDLLGLL+    K +QE+ GN N   +    +++E
Sbjct  270  IRSILRGIIKKREQDIKTGKAST--DDLLGLLMESNMKHLQED-GNKNA-GMTTEDVIEE  325

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT+ LLTWT++ L+ +P+WQ + REEV++V   + P  + LS L +++ +
Sbjct  326  CKLFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLSHLKIVTMI  385

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPP  L+ R  ++  K+GD+  P G+ + +  + +HH   +WGKD +EF PER
Sbjct  386  LYEVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNLWGKDASEFNPER  445

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR C+GQ++AL+EAK+ L+M++  FSFD+S +Y HAP  
Sbjct  446  FAEGVSKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFSFDLSPSYAHAPHT  505

Query  880  VISVKPKYGVQIRLNPL  930
            V ++ P++G QIRL  L
Sbjct  506  VFTLHPQHGAQIRLRKL  522



>ref|XP_009394814.1| PREDICTED: cytochrome P450 72A13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=526

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 210/316 (66%), Gaps = 11/316 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             D+ISR  F S+YE+G+RIF+L   L +L  Q+      PG RF P+  N+ IK +N E+
Sbjct  211  GDVISRAAFSSNYEEGRRIFQLQLELAQLVVQAIHSAYIPGYRFLPTPMNNRIKAINKEI  270

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDEC  351
              LL  II+ R++  + G  S  G DLLGLL+    K+ QE+ GN N   + +  ++DEC
Sbjct  271  RSLLRGIIRKREEAMKTGEAS--GQDLLGLLMESNIKQFQEH-GNKNA-GMTIDEVVDEC  326

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ETTA+LLTWT+++L+ +P WQ + REEV+QV   D P I+ L++L +++ ++
Sbjct  327  KLFYFAGQETTAILLTWTMVVLSMHPEWQARAREEVLQVLGKDKPEIDGLNRLKIVTMIL  386

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPP+  + R  ++  ++G++  P G  + +P++ +HH + +WG+D +EFKPERF
Sbjct  387  YEVLRLYPPLLHIQRRTYKTVEIGNVSYPPGTLLALPIVFLHHDQILWGEDASEFKPERF  446

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               I+++      F PF  GPR C+GQ++AL+EAK+ L+ ++ RF F++S +Y HAP+ V
Sbjct  447  AQGIAKASRDQIAFFPFGGGPRVCIGQNFALLEAKMGLSAILQRFWFELSPSYAHAPLNV  506

Query  883  ISVKPKYGVQIRLNPL  930
             ++ P++G Q+RL+ L
Sbjct  507  RTLHPQHGAQLRLHKL  522



>tpg|DAA58485.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=359

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 201/313 (64%), Gaps = 5/313 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGS+Y++G+RIFEL   L     QS + +  PG  F P+K N  ++ +++E
Sbjct  47   TGDVISRTAFGSNYQEGRRIFELQGELAERLIQSVQTIFIPGYWFLPTKNNRRMRAIDVE  106

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            + ++L EII  R+   +  R +   D L  LL    +++ GN++   L    +++ECK F
Sbjct  107  IRKILREIIGKREKDTK-NRETNNDDLLGLLLESNTRQSNGNAS-LGLTTEDVIEECKLF  164

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LLTWT+++L+ +P WQE+ REEV+       P  + LS+L  ++ +++E 
Sbjct  165  YFAGMETTSVLLTWTLIVLSMHPEWQERAREEVLSHFGRTTPDYDSLSRLKTITMILHEV  224

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPP T L R  +++ +LG +  P G+ + +PV+ IHH  +IWGKD +EF PERF   
Sbjct  225  LRLYPPATFLTRRTYKEMELGGIKYPAGVDLLLPVIFIHHDPDIWGKDASEFNPERFANG  284

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            IS +      F PF  GPR C+GQS+AL+EAK+ L  ++ RFSF++S +Y HAP  VI++
Sbjct  285  ISSATRHQAAFFPFGGGPRICIGQSFALLEAKMTLCTILQRFSFELSPSYTHAPYTVITL  344

Query  892  KPKYGVQIRLNPL  930
             P++G QIRL  L
Sbjct  345  HPQHGAQIRLKKL  357



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 203/318 (64%), Gaps = 11/318 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D ISRT FGSSYE+G+RIF+L      L  +  R +  PG RF P+K N  I+ +  E
Sbjct  215  TGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFVPTKTNKRIRQIRNE  274

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            +  LL  II+ R+    +G   T  DDLL LL+    +EMQE+    N   +++  +++E
Sbjct  275  LHALLKGIIEKREKAMLVG--ETANDDLLSLLMESNFREMQEHDERKN-VGMSIDDVIEE  331

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT+ LL WT++LL+ + +WQ + REE++QV     P    L+ L +++ +
Sbjct  332  CKLFYFAGQETTSDLLLWTMILLSKHSNWQARAREEILQVFGNKKPDGNGLNHLKIVTMI  391

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
             +E LRLYPPV++L R  F D ++G  + P G  + +P+L IHH  EIWG+D  EF PER
Sbjct  392  FHEVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALPILLIHHDHEIWGEDAKEFNPER  451

Query  709  F---ISRSYSPGRI-FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPV  876
            F   +S++   G+  F PF  GPR C+GQ++A+MEAK+ LAM++ RFSF++S +Y HAP 
Sbjct  452  FSEGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPF  511

Query  877  VVISVKPKYGVQIRLNPL  930
             VI+V+P+YG  + L+ L
Sbjct  512  NVITVQPQYGAHLILHGL  529



>ref|XP_009394813.1| PREDICTED: cytochrome P450 72A13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=530

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 210/316 (66%), Gaps = 11/316 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             D+ISR  F S+YE+G+RIF+L   L +L  Q+      PG RF P+  N+ IK +N E+
Sbjct  215  GDVISRAAFSSNYEEGRRIFQLQLELAQLVVQAIHSAYIPGYRFLPTPMNNRIKAINKEI  274

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDEC  351
              LL  II+ R++  + G  S  G DLLGLL+    K+ QE+ GN N   + +  ++DEC
Sbjct  275  RSLLRGIIRKREEAMKTGEAS--GQDLLGLLMESNIKQFQEH-GNKNA-GMTIDEVVDEC  330

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ETTA+LLTWT+++L+ +P WQ + REEV+QV   D P I+ L++L +++ ++
Sbjct  331  KLFYFAGQETTAILLTWTMVVLSMHPEWQARAREEVLQVLGKDKPEIDGLNRLKIVTMIL  390

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPP+  + R  ++  ++G++  P G  + +P++ +HH + +WG+D +EFKPERF
Sbjct  391  YEVLRLYPPLLHIQRRTYKTVEIGNVSYPPGTLLALPIVFLHHDQILWGEDASEFKPERF  450

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               I+++      F PF  GPR C+GQ++AL+EAK+ L+ ++ RF F++S +Y HAP+ V
Sbjct  451  AQGIAKASRDQIAFFPFGGGPRVCIGQNFALLEAKMGLSAILQRFWFELSPSYAHAPLNV  510

Query  883  ISVKPKYGVQIRLNPL  930
             ++ P++G Q+RL+ L
Sbjct  511  RTLHPQHGAQLRLHKL  526



>ref|XP_010926866.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/316 (42%), Positives = 202/316 (64%), Gaps = 8/316 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
              D+ISRT FGSS+++G+RIF+LL     L  Q  +++  PG RF P+K N  +K ++ E
Sbjct  209  TGDVISRTAFGSSFKEGRRIFQLLEEQAELGIQVIQNIYIPGYRFVPTKTNKRMKEIHRE  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLK---EMQENKGNSNGFRLNLPLIMDEC  351
            +  LL  +I+ R+      +     DDLL LL++      + +G S    +    +++EC
Sbjct  269  IWALLSRMIEHRERSMR--KEGATDDDLLRLLMESNFRYSQEQGGSKNTGMTKDDVIEEC  326

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAGHETT++LLTWT+++L  +PSWQ + REEV+Q+   + P  + LS+L + + ++
Sbjct  327  KLFYFAGHETTSVLLTWTIVVLGMHPSWQARAREEVLQIFGKNKPDFDGLSQLKIATMIL  386

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPP++ + R  ++  KLGD   P G+ +++P+L IHH    WG+D +EF PERF
Sbjct  387  YEVLRLYPPLSAVVRETYKKMKLGDFSFPPGVQLYLPILLIHHDPAFWGEDASEFNPERF  446

Query  712  ISRSYSPGRI---FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
             S      +I   FLPF  GPR CVGQS+A+MEAK+ LA+++  FSF+ S +Y HAP  V
Sbjct  447  ASGVSKASKIQGAFLPFGWGPRICVGQSFAMMEAKMALAIILQNFSFEPSPSYAHAPYTV  506

Query  883  ISVKPKYGVQIRLNPL  930
            +++ P+YG Q+ L+ L
Sbjct  507  VTIHPQYGAQMILHRL  522



>ref|XP_002969404.1| hypothetical protein SELMODRAFT_410445 [Selaginella moellendorffii]
 gb|EFJ29492.1| hypothetical protein SELMODRAFT_410445 [Selaginella moellendorffii]
Length=466

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 200/311 (64%), Gaps = 10/311 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTV-LQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNI  177
              D+IS T FG+SY +G+R+FE+L+  +  L  +       PG RF P   N ++  L+ 
Sbjct  159  TGDVISHTAFGTSYLEGQRVFEILSKKIPELVPKLISFSWIPGFRFLPLPINLQLWKLHQ  218

Query  178  EVERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKT  357
            E++ L+  II  R++  + G  +TYG+DLLGL+LKE   +   SN    NL   ++ECKT
Sbjct  219  ELDSLITGIIDERRNSVKSGGSNTYGNDLLGLMLKECDSS---SNFTSSNL---IEECKT  272

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            F+ AGHETTA LLTWT+MLL   P WQE+ R EV +VC  + P  E +S+L L+  ++ E
Sbjct  273  FYIAGHETTAALLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYE  332

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPPV  + R   E+  L DLH+PKG+++  P++ +H  +E+WG+D  +F P+RF  
Sbjct  333  TLRLYPPVVEMTRECVEESWLQDLHVPKGVSVLFPIVGLHQDKELWGEDAGQFNPDRFKD  392

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             IS +      F+PF+ GPR CVGQS+A++EAK++LAM++ RF F +S NYRH P +   
Sbjct  393  GISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFLFRLSPNYRHNPAMKFG  452

Query  889  VKPKYGVQIRL  921
            +KP +GV + L
Sbjct  453  LKPIHGVPLVL  463



>emb|CDY51036.1| BnaA06g02990D [Brassica napus]
Length=512

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 199/311 (64%), Gaps = 8/311 (3%)
 Frame = +1

Query  7    DIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEVE  186
            D+ISRT FGSSY++G+RIFEL T L +L  Q+ R    PG R+ P+K N  IK    E  
Sbjct  207  DVISRTAFGSSYKEGQRIFELQTELAQLIIQAFRKSYIPGYRYLPTKDNRRIKAAAKETH  266

Query  187  RLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTFFF  366
             +L  ++  R    E G      +DLLG+LL   + N G + G  +++  +++ECK F+F
Sbjct  267  DILRGLVNKRLRAREAGEAPN--EDLLGILL---ESNLGQAKGNGMSIDDVIEECKLFYF  321

Query  367  AGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEALR  546
            AG ETT++LL WT++LL+ +  WQ + REEV QV     P+ E L+ L +++ +INE +R
Sbjct  322  AGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEPNTEGLNHLKIMTMIINEVIR  381

Query  547  LYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---IS  717
            LYPPVT L R   ++ KLGDL +P G+ I +P++ +    ++WG D  EFKPERF   +S
Sbjct  382  LYPPVTQLSRTIHKEMKLGDLTLPGGVQINLPIMLVQRDTQLWGNDAAEFKPERFEDGVS  441

Query  718  RSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISVKP  897
            ++      F PFA GPR C+GQ++AL+EAK+ +A+++ RFSF++S  Y HAP  V ++ P
Sbjct  442  KATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPTYVHAPYTVFTLHP  501

Query  898  KYGVQIRLNPL  930
            +YG  + L+ L
Sbjct  502  QYGAHLILHKL  512



>ref|XP_010465355.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=512

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/313 (43%), Positives = 203/313 (65%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+RIFEL T L  L  Q+   +  PG R+ P+K N  +K  + E
Sbjct  205  TADVISRTAFGSSYKEGQRIFELQTELVHLIIQAFWKVYIPGYRYLPTKNNRRMKAASKE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            ++ +L  I+  R    + G+     DDLLG+LL   + N G + G  ++   +M+ECK F
Sbjct  265  IQDILRGIVNKRLRARDAGKAPN--DDLLGILL---ESNLGQAKGNGMSTEDVMEECKLF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LL WT++LL+ + +WQ + R+EV QV     P  E L++L +++ ++ E 
Sbjct  320  YFAGQETTSVLLVWTMVLLSQHQAWQARARDEVKQVFGDKEPDTEGLNQLKVMTMILYEV  379

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPVT L R   ++ KLGDL +P G+ I +PV+ +    ++WG D  EFKPERF   
Sbjct  380  LRLYPPVTHLTRAIHKEMKLGDLTLPGGVHISLPVMLVQRDTKLWGNDAAEFKPERFKDG  439

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            IS++      F PFA GPR C+GQ++ LMEAK+ +A+++ RFSF++S +Y HAP  V+++
Sbjct  440  ISKATKSQVSFFPFAWGPRICIGQNFTLMEAKMAMALILLRFSFELSPSYVHAPYTVVTI  499

Query  892  KPKYGVQIRLNPL  930
             P++G  + L+ L
Sbjct  500  HPQFGAHLILHKL  512



>ref|XP_010927467.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 204/314 (65%), Gaps = 10/314 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
             D+ISRT FGS++ +G+RIF L     +L  Q+ +++  PG RF P+K N  +K ++IE+
Sbjct  210  GDVISRTAFGSNFREGQRIFHLQEEQAQLVVQALQNIYIPGFRFLPTKKNKRMKEIDIEI  269

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKE----MQENKGNSNGFRLNLPLIMDEC  351
              LL  +I+ R+    I +     DDLLGLL++      +EN G+ N   ++   +++EC
Sbjct  270  RSLLRSMIEQREMV--IRKEGASNDDLLGLLMESNFRYSKENGGSKNS-GMSTEDVIEEC  326

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAGHETT++LLTWT++ L+ +PSWQ + REEV  V   + P  + LS+L +++ V+
Sbjct  327  KLFYFAGHETTSVLLTWTLVALSMHPSWQARAREEVHGVFGKNKPDYDGLSRLKIVTMVL  386

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPPV LL R  F++ KLG    P G+ + +P++ IHH  E WG+D +EF PERF
Sbjct  387  YEVLRLYPPVILLQRKTFKEMKLGQFTFPDGVELSLPIIFIHHDPEFWGEDASEFNPERF  446

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               +S++      F PF+ GPR C+GQS+A+MEAK+ LA ++  F F++S +Y HAP  V
Sbjct  447  AEGVSKASKIPGAFFPFSGGPRICIGQSFAMMEAKMALARILQHFMFELSPSYAHAPYTV  506

Query  883  ISVKPKYGVQIRLN  924
             ++ P++G QI L+
Sbjct  507  ATLHPQHGAQIILH  520



>ref|XP_006299550.1| hypothetical protein CARUB_v10015724mg [Capsella rubella]
 gb|EOA32448.1| hypothetical protein CARUB_v10015724mg [Capsella rubella]
Length=512

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 201/313 (64%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+RIFEL   L +L  Q+ R    PG  + P+K N  +K    E
Sbjct  205  TADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAFIPGYSYLPTKGNRGMKAKARE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            ++ +L  I+  R    E G   +  DDLLG+L+   + N G + G  ++   +M+ECK F
Sbjct  265  IQVILRGIVNKRLRAREAGEAPS--DDLLGILI---ESNLGQTKGNGMSTEDLMEECKLF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LL WT++LL+ +  WQ + REEV QV     P  E L++L +++ ++ E 
Sbjct  320  YFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDTEGLNQLKVMNMILYEV  379

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPVT L R   ++ KLGDL +P G+ I +P+L I H  E+WG D  EFKPERF   
Sbjct  380  LRLYPPVTQLTRAIHKEMKLGDLTLPGGVHISLPILLIQHDTELWGNDAAEFKPERFKDG  439

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            +S++      F PF  GPR C+GQ++AL+EAK+ +A+++ +FSF+IS +Y HAP  +I+V
Sbjct  440  LSKATKSQVSFFPFGWGPRICIGQNFALLEAKMAMALILQKFSFEISPSYLHAPYTIITV  499

Query  892  KPKYGVQIRLNPL  930
             P++G  + L+ L
Sbjct  500  HPQFGAPLILHKL  512



>ref|XP_010535012.1| PREDICTED: cytochrome P450 72A13-like [Tarenaya hassleriana]
Length=510

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 199/313 (64%), Gaps = 11/313 (4%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGS+Y +G+ IF+L   L +L +Q+ R    PG R++P+K N  +K ++ E
Sbjct  206  TADVISRTAFGSNYREGQMIFKLQAELAQLLTQAFRKAYIPGYRYFPTKSNRRMKEIDRE  265

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            +   L  II  R +  E        DDLLG+LL   + N G S G  +++  +M ECK F
Sbjct  266  IRATLSGIIGKRVEARE-----APNDDLLGILL---ESNSGQSKGNGMSIEEVMQECKLF  317

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LL WT++LL+ +  WQ + REEVMQV     P I+ L++L +++ ++ E 
Sbjct  318  YFAGQETTSVLLVWTMILLSQHQDWQARAREEVMQVLGDRKPDIDSLNQLKVVTMILYEV  377

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPP T L R   ++ KLGDL +P G+ + +P+L I    E+WG D  EFKPERF   
Sbjct  378  LRLYPPATQLSRAVHKETKLGDLTLPGGVHVALPILLIQRDVELWGSDAGEFKPERFKDG  437

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            IS++      FLPF  GPR C+GQ++AL+E+K  LA+++ RFSF++S +Y HAP  V ++
Sbjct  438  ISKATKNQVSFLPFGWGPRICIGQNFALLESKTALALILRRFSFELSPSYVHAPYTVFTL  497

Query  892  KPKYGVQIRLNPL  930
             P++G  + L  L
Sbjct  498  HPQFGAHLVLRKL  510



>gb|EMT23743.1| Secologanin synthase [Aegilops tauschii]
Length=514

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/313 (44%), Positives = 210/313 (67%), Gaps = 10/313 (3%)
 Frame = +1

Query  4    ADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEV  183
            AD+IS T FGSSYE+GK++F     LQ L   +  ++  P  R+ P++ N +I  L+ EV
Sbjct  206  ADVISHTAFGSSYEQGKKVFLAQRELQFLAFSTVFNVQIPAFRYLPTEKNLKIWKLDKEV  265

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQ-ENKGNSNGFRLNLPLIMDECKTF  360
              +LM II+ R    +I     YG+DLLGL+L+    E++ N     L++  I+DECKTF
Sbjct  266  RTMLMNIIKGRLATKDI---MGYGNDLLGLMLEACAPEDRQNP---LLSMDEIIDECKTF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            FFAGH+T++ LLTWT+ LL+T+P WQEK+REEV++ C    P+ + L+KL L++  + E 
Sbjct  320  FFAGHDTSSHLLTWTMFLLSTHPKWQEKLREEVLRECGNGVPTGDMLNKLQLVNMFLLET  379

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLY PV+ + R A  D ++G + +P+G  + IP+  IH  +E+WG+D NEFKP RF   
Sbjct  380  LRLYAPVSAIQRKAGSDLEVGGIKVPEGTVLTIPIATIHRDKEVWGEDANEFKPMRFENG  439

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            ++R+       L F++GPR+C+GQ++A++EAK V+A+++ RFSF +S  Y HAP+ VI++
Sbjct  440  VTRAGKHPNALLSFSSGPRSCIGQNFAMIEAKAVIAVILQRFSFSLSPKYVHAPMDVITL  499

Query  892  KPKYGVQIRLNPL  930
            +PK+G+ + L  L
Sbjct  500  RPKFGLPMVLKSL  512



>ref|XP_002882888.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59147.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/314 (43%), Positives = 204/314 (65%), Gaps = 10/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+RIFEL   L +L  Q+ R    PG  + P+K N  +K    E
Sbjct  205  TADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAFIPGFSYLPTKGNRRMKAKARE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKE-MQENKGNSNGFRLNLPLIMDECKT  357
            ++ +L  I+  R    E G   +  DDLLG+LL+  +++ +GN     ++   +M+ECK 
Sbjct  265  IQVILRGIVNKRLRAREAGEAPS--DDLLGILLESNLRQTEGNG----MSTEDLMEECKL  318

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            F+FAG ETT++LL WT++LL+ +  WQ + REEV QV     P  E L++L ++S ++ E
Sbjct  319  FYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMSMILYE  378

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPPVT L R   ++ KLGDL +P G+ I +P+L +    E+WG D  EFKPERF  
Sbjct  379  VLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGNDAAEFKPERFKD  438

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             +S++      F PFA GPR C+GQ++AL+EAK+ +A+++ RFSF++S +Y HAP  VI+
Sbjct  439  GLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILKRFSFELSPSYVHAPYTVIT  498

Query  889  VKPKYGVQIRLNPL  930
            + P++G Q+ ++ L
Sbjct  499  IHPQFGAQLIMHKL  512



>ref|XP_010502007.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=512

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 201/313 (64%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+RIFEL   L +L  Q+ R    PG  + P+K N  +K    E
Sbjct  205  TADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAIIPGFSYLPTKGNRRMKATARE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            ++ +L  I+  R    E G   +  DDLLG+LL   + N G + G  ++   +M+ECK F
Sbjct  265  IQVILRGIVNKRLRAREAGEAPS--DDLLGILL---ESNLGQTKGNGMSTEDLMEECKLF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LL WT++LL+ +  WQ + REEV QV     P  E L++L +++ ++ E 
Sbjct  320  YFAGQETTSVLLVWTMVLLSQHKDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMILYEV  379

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            +RLYPPVT L R   ++ KLGDL +P G+ I +P+L +    E+WG D  EFKPERF   
Sbjct  380  VRLYPPVTQLTRAIHKEIKLGDLTLPGGVQISLPILLVQRDTELWGNDAGEFKPERFKDG  439

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            +S++      F PFA GPR C+GQ++A++EAK+ +A+++ +FSF++S +Y HAP  +I++
Sbjct  440  LSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSLSYLHAPYTIITI  499

Query  892  KPKYGVQIRLNPL  930
             P++G Q+ L  L
Sbjct  500  HPQFGAQLILQKL  512



>ref|XP_006377681.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP55478.1| cytochrome P450 family protein [Populus trichocarpa]
Length=410

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 204/316 (65%), Gaps = 11/316 (3%)
 Frame = +1

Query  7    DIISRTEFGSSYEKGKRIFELLTVLQRLCSQST-RHLCYPGNRFYPSKYNSEIKTLNIEV  183
            D ISRT FGS+YE+GKRIF+LL  L  L +    + +  PG RF P   N  +K ++ E+
Sbjct  98   DAISRTSFGSNYEEGKRIFDLLKELTNLTAHVIIKAIVIPGYRFLPIPSNRRLKAIDKEI  157

Query  184  ERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDEC  351
            +  L  +I  R+     G  +    DLLGLLL    +E+QE+ GN+    +++  ++DEC
Sbjct  158  KASLNALINKREKAMSAGEDAK--KDLLGLLLESNFREIQEH-GNTKSVGMSIEDVIDEC  214

Query  352  KTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVI  531
            K F+FAG ETT +LLTWT++LLA  P+WQ + REEV+QV     P  + L+ L +++ ++
Sbjct  215  KIFYFAGQETTLVLLTWTMILLAQYPNWQARAREEVVQVFGNKKPDFDGLNHLKVVTMIL  274

Query  532  NEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF  711
             E LRLYPPV  L R   E+ KLG+L +P G+ + +P + +H   E+WG D +EFKPERF
Sbjct  275  YEVLRLYPPVITLNRDVHEEIKLGNLLLPAGVQVSLPTILLHQDHELWGDDASEFKPERF  334

Query  712  ---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVV  882
               +S++      FLPF  GPR CVGQ++AL+EAK+ LAM++ R+SF++S +Y HAP  V
Sbjct  335  AEGVSKATKSQVSFLPFGWGPRICVGQNFALIEAKMALAMVLQRYSFELSPSYIHAPRTV  394

Query  883  ISVKPKYGVQIRLNPL  930
            I+++P++G  + L  L
Sbjct  395  ITLQPQHGAPMILRKL  410



>ref|XP_007149362.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
 gb|ESW21356.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
Length=523

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/314 (43%), Positives = 202/314 (64%), Gaps = 10/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            A D ISRT FGSS+E+G+RIF+LL     L  Q    +  PG RF P+  +  +K ++ E
Sbjct  208  ARDAISRTAFGSSFEEGRRIFQLLKEQTELTVQLMLKVYIPGWRFVPTPTHRRMKAIDKE  267

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            ++  LM+II +++   + G  +   +DLLG+LL    KE+QE+ GN+    +N+  ++ E
Sbjct  268  IKASLMDIINNKEKALKAGEATK--NDLLGILLESNHKEIQEH-GNNKNVGMNIEDVIGE  324

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAG ETT+ LL WT++LL+  P WQ + REEV+QV     P  + L+ L +++ +
Sbjct  325  CKLFYFAGQETTSSLLVWTMILLSMYPDWQTRAREEVLQVFGNRKPDFDGLNHLKIVTMI  384

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            +NE  RLYPPV  L R   +D KLG+L +  G+ + IP++ +HH  E+WG D  EFKPER
Sbjct  385  LNEVFRLYPPVIGLARKVSKDVKLGNLSLVAGMQVSIPIILVHHDCELWGDDAKEFKPER  444

Query  709  FISR--SYSPGRI-FLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F       + GR   +PF  GPR C+GQ+++LMEAKI L+M++ RFSF++S  Y HAP  
Sbjct  445  FAEGVLKATKGRASLIPFGGGPRICIGQNFSLMEAKIALSMILQRFSFELSSTYTHAPTP  504

Query  880  VISVKPKYGVQIRL  921
            VI+++P+YG  + L
Sbjct  505  VITIQPQYGANLIL  518



>emb|CDP15978.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/315 (43%), Positives = 209/315 (66%), Gaps = 11/315 (3%)
 Frame = +1

Query  7    DIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIEVE  186
            D ISRT FGS+Y++G RIFEL         ++ R L  PG RF P+K N+ +K +  +V+
Sbjct  208  DAISRTAFGSNYKEGSRIFELQREQTEHFIEAARSLYIPGWRFIPTKRNTRMKQIARDVQ  267

Query  187  RLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDECK  354
              + +II +R    +  +     DDLLG+LL    KE+ ++ GN N F + +  +++ECK
Sbjct  268  ESIKDIINARLKAMKAAKAC--DDDLLGILLESNSKEI-DHHGNKN-FGMTVLEVIEECK  323

Query  355  TFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVIN  534
             F+FAG ETT++LL WT++LL+  P WQ + REEV+Q+   D P  + L+ L L++ +++
Sbjct  324  LFYFAGQETTSVLLVWTMILLSRYPEWQMRAREEVLQLFGTDKPDFDGLNHLKLITMILH  383

Query  535  EALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF-  711
            E LRLYPPVT L R A E+ +LG+L +P GL + +PV+ +HH  EIWG DV EFKPERF 
Sbjct  384  EVLRLYPPVTALFRRAAEETRLGNLTLPAGLLVSLPVMLLHHDPEIWGDDVKEFKPERFA  443

Query  712  --ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVI  885
              +S++      F PF+ GPR C+GQ++A++EAK+ + M++ RFSF++S +Y HAP  + 
Sbjct  444  DGVSKATKGQFAFFPFSWGPRICIGQNFAMLEAKLAMTMILQRFSFELSPSYTHAPRAMA  503

Query  886  SVKPKYGVQIRLNPL  930
            +++P++G Q+ L+ L
Sbjct  504  TLQPQFGAQLILHRL  518



>ref|XP_002972325.1| hypothetical protein SELMODRAFT_172829 [Selaginella moellendorffii]
 gb|EFJ26411.1| hypothetical protein SELMODRAFT_172829 [Selaginella moellendorffii]
Length=508

 Score =   270 bits (691),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 140/306 (46%), Positives = 200/306 (65%), Gaps = 16/306 (5%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
            AADIIS T FGSSY KG+++F+ L  +    S+  R+   PG RF P   N  ++ L  +
Sbjct  209  AADIISHTAFGSSYLKGQKVFQFLRAIPEQHSKIDRYNYLPGKRFLPFPANFRLRKLYSD  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            ++ LL+ +I+ R+D       S    DLLGL+L E     GNS+    +   +M+ECKTF
Sbjct  269  LDSLLLALIKERRDQ------SGQSHDLLGLMLAE----AGNSS---FDDRAVMEECKTF  315

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            + AGHETTA LLTW++MLLA +P WQE+ R E  +   G  P  + +SKL L++ +++E+
Sbjct  316  YLAGHETTASLLTWSMMLLALHPEWQERARVEAQEAFGGATPEADSISKLKLINMILHES  375

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPV    R  FE+  LGD+ +PKG+ I  PVLAIHH +E+WG+D +EF PERF   
Sbjct  376  LRLYPPVVFFMRACFENTTLGDILVPKGVGITFPVLAIHHDKELWGEDAHEFNPERFKDG  435

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            ++++      FL F+ GPR CVGQS+ALMEAKI LA ++ RF F +S +YRH PV  +++
Sbjct  436  VAKASKHPNAFLAFSLGPRVCVGQSFALMEAKIALATILQRFRFRLSPSYRHCPVFKVTL  495

Query  892  KPKYGV  909
            +P++G+
Sbjct  496  RPRHGL  501



>ref|XP_006348402.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=466

 Score =   269 bits (688),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 205/314 (65%), Gaps = 7/314 (2%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             +D+ISRT FGSSY++G +IF+L   L  L  Q+ + +  PG RF P++ N  +K ++ E
Sbjct  156  TSDVISRTAFGSSYQEGMKIFQLQKELAELTRQAFQSVYIPGWRFLPTRRNRRMKGIDNE  215

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLK-EMQENKGNSNGFRLNLPLIMDECKT  357
            ++  L +I+  R     +G      +DLLG+LLK  M+E + N + F +    +++ECK 
Sbjct  216  LKHTLRKIVNKRDRSMNLGETQ---EDLLGILLKSNMKEIQQNGSKFGMTTDEVIEECKV  272

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            F+FAG ET++ LL WT++LL+ + +WQ + REEV QV + + P  E L++L +++ ++NE
Sbjct  273  FYFAGQETSSNLLVWTMVLLSVHQNWQTRAREEVQQVFHNNNPDFEGLNRLKIVTMILNE  332

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPP     R A ++ KLG ++IP  + + IP + IHH+EE+WG DV EFKP+RF  
Sbjct  333  VLRLYPPAPYFLRKANQETKLGKMNIPPEVILMIPTIFIHHNEELWGDDVKEFKPDRFFQ  392

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             I+++      FLPF+ GPR C+G ++A+ME KI LAM++ RF F++S +Y HAP  V++
Sbjct  393  GIAKATKDKLCFLPFSWGPRICIGNNFAMMETKIALAMILQRFEFELSPSYTHAPTYVVT  452

Query  889  VKPKYGVQIRLNPL  930
            ++P+ G  + L  L
Sbjct  453  LQPQCGAHLILKKL  466



>ref|NP_188087.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
 sp|Q9LUC5.1|C7A15_ARATH RecName: Full=Cytochrome P450 72A15 [Arabidopsis thaliana]
 dbj|BAB02401.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92762.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM20382.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75556.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
Length=512

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/314 (43%), Positives = 204/314 (65%), Gaps = 10/314 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+RIFEL   L +L  Q+ R    PG  + P+K N  +K    E
Sbjct  205  TADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAFIPGYSYLPTKSNRRMKAAARE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKE-MQENKGNSNGFRLNLPLIMDECKT  357
            ++ +L  I+  R    E G   +  DDLLG+LL+  +++ +GN     ++   +M+ECK 
Sbjct  265  IQVILRGIVNKRLRAREAGEAPS--DDLLGILLESNLRQTEGNG----MSTEDLMEECKL  318

Query  358  FFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINE  537
            F+FAG ETT++LL WT++LL+ +  WQ + REEV QV     P  E L++L +++ ++ E
Sbjct  319  FYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMILYE  378

Query  538  ALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF--  711
             LRLYPPVT L R   ++ KLGDL +P G+ I +P+L + H  E+WG D  EF P+RF  
Sbjct  379  VLRLYPPVTQLTRAIHKELKLGDLTLPGGVQISLPILLVQHDIELWGNDAAEFNPDRFKD  438

Query  712  -ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVIS  888
             +S++      F PFA GPR C+GQ++AL+EAK+ +A+++ RFSF+IS +Y HAP  VI+
Sbjct  439  GLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILRRFSFEISPSYVHAPYTVIT  498

Query  889  VKPKYGVQIRLNPL  930
            + P++G Q+ ++ L
Sbjct  499  IHPQFGAQLIMHKL  512



>ref|XP_010927457.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   271 bits (692),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 206/315 (65%), Gaps = 10/315 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGS++ +G+RIF L      L  ++ +++  PG RF P+K N  +K ++IE
Sbjct  209  TADVISRTAFGSNFREGQRIFHLQQEQAGLAIRALQNIYIPGFRFLPTKKNKRMKEIDIE  268

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLL----KEMQENKGNSNGFRLNLPLIMDE  348
            +  LLM +I+ R+    I +  T  DDLL LL+    +  +EN G+ N   +++  ++ E
Sbjct  269  IRTLLMRMIERRE--MAIRKEGTSNDDLLSLLMESNFRHSKENGGSKNS-GMSIEEVIQE  325

Query  349  CKTFFFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAV  528
            CK F+FAGHETT++LLTWT++ L+ +PSWQ + REEV  V   + P  + LS+L +++ V
Sbjct  326  CKLFYFAGHETTSVLLTWTLVALSMHPSWQARAREEVNGVFGKNKPDYDGLSRLKIVTMV  385

Query  529  INEALRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPER  708
            + E LRLYPP  LL R  +++ KLG +  P+G+ + +P++ IHH  E WG+D +EF PER
Sbjct  386  LYEVLRLYPPAVLLMRKTYKEMKLGQITFPEGVQLLLPIIFIHHDPEFWGEDASEFNPER  445

Query  709  F---ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVV  879
            F   +S++      F PF  GPR C+GQS+A++EAK+ LA ++  F+F+IS +Y HAP  
Sbjct  446  FADGVSKASKIQGAFFPFGGGPRICIGQSFAVIEAKMALARILQHFTFEISPSYAHAPYT  505

Query  880  VISVKPKYGVQIRLN  924
            V ++ P++G QI L+
Sbjct  506  VATLHPQHGAQIILH  520



>emb|CDX98486.1| BnaC05g38890D [Brassica napus]
Length=512

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 201/313 (64%), Gaps = 8/313 (3%)
 Frame = +1

Query  1    AADIISRTEFGSSYEKGKRIFELLTVLQRLCSQSTRHLCYPGNRFYPSKYNSEIKTLNIE  180
             AD+ISRT FGSSY++G+RIFEL   L +L +Q+ R +  PG R+YP+K N  +K    E
Sbjct  205  TADVISRTAFGSSYKEGQRIFELQAELAQLLTQAFRRIFIPGYRYYPTKGNRRMKAAARE  264

Query  181  VERLLMEIIQSRKDCAEIGRISTYGDDLLGLLLKEMQENKGNSNGFRLNLPLIMDECKTF  360
            V+ +L  I+  R    E G   +  DDLLG LL   + N G + G  +++  +++ECK F
Sbjct  265  VQDILRGIVNKRLRAREAGEAPS--DDLLGTLL---ESNLGQAKGTGMSIEDVIEECKLF  319

Query  361  FFAGHETTALLLTWTVMLLATNPSWQEKVREEVMQVCNGDPPSIEQLSKLTLLSAVINEA  540
            +FAG ETT++LL WT+++L+ +  WQ K REEV QV     P  E L+ L +++ ++ E 
Sbjct  320  YFAGQETTSVLLVWTMVMLSQHQDWQAKAREEVKQVFGDKEPDTEGLNHLKIMTMILYEV  379

Query  541  LRLYPPVTLLPRMAFEDFKLGDLHIPKGLAIWIPVLAIHHSEEIWGKDVNEFKPERF---  711
            LRLYPPV  L R   ++ KLGDL +P G+ I +PV+ +     +WG D  +FKP+RF   
Sbjct  380  LRLYPPVIQLTRAIHKEMKLGDLTLPGGIHISLPVMLVQRDTNLWGNDAGDFKPDRFKDG  439

Query  712  ISRSYSPGRIFLPFAAGPRNCVGQSYALMEAKIVLAMLISRFSFDISDNYRHAPVVVISV  891
            +S++      F+PFA GPR C+GQ++A++EAK+ +A+++ RFSF+ S +Y HAP  V ++
Sbjct  440  VSKATKSQVSFIPFAWGPRICIGQNFAMLEAKMAMALILQRFSFEFSPSYVHAPYNVFTL  499

Query  892  KPKYGVQIRLNPL  930
             P++G  + L+ L
Sbjct  500  HPQFGAHLILHKL  512



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2629592296512