BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c35788_g1_i1 len=482 path=[483:0-481]

Length=482
                                                                      Score     E

ref|XP_006346047.1|  PREDICTED: uncharacterized protein LOC102583514  99.0    5e-23   
ref|XP_006441033.1|  hypothetical protein CICLE_v10023629mg           97.4    1e-22   
ref|XP_004244324.1|  PREDICTED: uncharacterized protein LOC101257489  98.2    1e-22   
gb|KEH38353.1|  seed maturation protein                               94.0    2e-21   
gb|KDP25128.1|  hypothetical protein JCGZ_22663                       92.8    4e-21   
gb|ABB72387.1|  seed maturation protein                               92.0    8e-21   Glycine latifolia
gb|ABB72392.1|  seed maturation protein                               91.7    1e-20   Glycine tomentella [wooly glycine]
ref|XP_010694911.1|  PREDICTED: uncharacterized protein LOC104907651  91.3    2e-20   
ref|XP_002513426.1|  conserved hypothetical protein                   90.9    2e-20   Ricinus communis
gb|ABB72396.1|  seed maturation protein                               90.5    3e-20   Glycine tomentella [wooly glycine]
ref|NP_001237986.1|  seed maturation protein PM28                     90.5    3e-20   
ref|NP_187902.1|  uncharacterized protein                             90.1    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004488877.1|  PREDICTED: uncharacterized protein LOC101490336  90.9    3e-20   
gb|ABB72394.1|  seed maturation protein                               90.1    4e-20   Glycine tomentella [wooly glycine]
gb|ABB72393.1|  seed maturation protein                               90.1    4e-20   Glycine tomentella [wooly glycine]
gb|ABB72388.1|  seed maturation protein                               89.7    5e-20   Glycine latifolia
gb|ABB72391.1|  seed maturation protein                               89.7    5e-20   Glycine tabacina
emb|CBI27345.3|  unnamed protein product                              90.5    6e-20   
ref|XP_002272245.1|  PREDICTED: uncharacterized protein LOC100247337  89.0    1e-19   Vitis vinifera
ref|XP_009764171.1|  PREDICTED: uncharacterized protein LOC104215930  87.4    3e-19   
ref|XP_004294215.1|  PREDICTED: uncharacterized protein LOC101306413  88.2    4e-19   
ref|XP_008226090.1|  PREDICTED: uncharacterized protein LOC103325688  87.8    4e-19   
ref|XP_008392311.1|  PREDICTED: uncharacterized protein LOC103454502  87.4    1e-18   
gb|ABB72386.1|  seed maturation protein                               85.5    2e-18   Glycine canescens
ref|XP_002882798.1|  hypothetical protein ARALYDRAFT_478659           84.3    4e-18   
ref|XP_006407277.1|  hypothetical protein EUTSA_v10022193mg           84.0    9e-18   
ref|XP_008444288.1|  PREDICTED: uncharacterized protein LOC103487654  83.6    1e-17   
ref|XP_011097654.1|  PREDICTED: uncharacterized protein LOC105176531  84.0    2e-17   
ref|XP_006299041.1|  hypothetical protein CARUB_v10015178mg           82.8    3e-17   
ref|XP_007149270.1|  hypothetical protein PHAVU_005G056100g           82.4    4e-17   
ref|XP_010060834.1|  PREDICTED: uncharacterized protein LOC104448665  81.6    7e-17   
ref|XP_010246804.1|  PREDICTED: uncharacterized protein LOC104590007  82.8    8e-17   
ref|XP_009124692.1|  PREDICTED: uncharacterized protein LOC103849726  80.9    1e-16   
emb|CDY24233.1|  BnaC01g38130D                                        80.9    1e-16   
emb|CDY43385.1|  BnaA01g30160D                                        80.9    1e-16   
ref|XP_009361774.1|  PREDICTED: uncharacterized protein LOC103951988  80.1    4e-16   
ref|XP_008783375.1|  PREDICTED: uncharacterized protein LOC103702643  79.0    5e-16   
gb|KFK38634.1|  hypothetical protein AALP_AA3G139900                  78.2    1e-15   
ref|WP_033581571.1|  hypothetical protein                             75.1    2e-14   
gb|EMT20079.1|  hypothetical protein F775_43732                       74.7    3e-14   
gb|EMS66610.1|  hypothetical protein TRIUR3_06375                     73.6    5e-14   
emb|CAN64204.1|  hypothetical protein VITISV_007158                   73.9    1e-13   Vitis vinifera
ref|XP_009386678.1|  PREDICTED: uncharacterized protein LOC103973756  69.7    2e-12   
ref|XP_009353345.1|  PREDICTED: uncharacterized protein LOC103944587  67.0    1e-11   
ref|XP_010234245.1|  PREDICTED: uncharacterized protein LOC104583524  65.9    7e-11   
ref|XP_008371717.1|  PREDICTED: uncharacterized protein LOC103435103  63.2    2e-10   
gb|EAZ05298.1|  hypothetical protein OsI_27503                        62.0    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_002443706.1|  hypothetical protein SORBIDRAFT_07g000625        60.1    8e-09   Sorghum bicolor [broomcorn]
ref|NP_001145613.1|  uncharacterized protein LOC100279096             59.7    1e-08   Zea mays [maize]
gb|AFW74221.1|  hypothetical protein ZEAMMB73_326753                  59.3    2e-08   
ref|XP_006377864.1|  hypothetical protein POPTR_0011s14740g           58.5    2e-08   
ref|XP_002467005.1|  hypothetical protein SORBIDRAFT_01g018170        58.5    2e-08   Sorghum bicolor [broomcorn]
ref|NP_001060778.1|  Os08g0104400                                     57.8    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006478067.1|  PREDICTED: uncharacterized protein LOC102620642  54.3    5e-07   
ref|XP_006659738.1|  PREDICTED: uncharacterized protein LOC102710429  47.8    1e-04   
ref|XP_004972423.1|  PREDICTED: uncharacterized protein LOC101785689  47.8    2e-04   



>ref|XP_006346047.1| PREDICTED: uncharacterized protein LOC102583514 [Solanum tuberosum]
Length=134

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            MAKSKDDITYG AQARLSEDDALR+ YK G PLEGGKIA+S+PVDLFS+A NIE Q+ + 
Sbjct  1    MAKSKDDITYGIAQARLSEDDALRIRYKAGTPLEGGKIADSQPVDLFSSARNIENQQGK-  59

Query  288  TAESDQPAGERRPSQAAAAASHE  220
             A+S QP      +Q  AAA  +
Sbjct  60   IADS-QPVELSSSAQKIAAAKQK  81



>ref|XP_006441033.1| hypothetical protein CICLE_v10023629mg [Citrus clementina]
 gb|ESR54273.1| hypothetical protein CICLE_v10023629mg [Citrus clementina]
Length=99

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 4/83 (5%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            MAKSKDDI YG AQARLSED+A+RV YK G PLEGGKIA+SEPVDLFS+AHN+      E
Sbjct  1    MAKSKDDIKYGTAQARLSEDEAVRVRYKHGTPLEGGKIADSEPVDLFSSAHNLSS----E  56

Query  288  TAESDQPAGERRPSQAAAAASHE  220
            T ++ QP  +   +  AA A H+
Sbjct  57   TPKNHQPPSDDGSTHQAAGAGHQ  79



>ref|XP_004244324.1| PREDICTED: uncharacterized protein LOC101257489 [Solanum lycopersicum]
Length=134

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            MAKSKDDITYG AQARLSEDDALR+ YK G PLEGGKIA+S+PVDLFS+  NIE Q+ + 
Sbjct  1    MAKSKDDITYGTAQARLSEDDALRIRYKAGTPLEGGKIADSQPVDLFSSVRNIENQQGK-  59

Query  288  TAESDQPAGERRPSQAAAAASHE  220
             A+S QP      +Q  AAA  +
Sbjct  60   IADS-QPVELSSSAQKIAAAKQK  81



>gb|KEH38353.1| seed maturation protein [Medicago truncatula]
Length=105

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK-QRRR  292
            MAKSKDDI YG AQA+LSED+ LRV YK G PLEGGKIA+SEPVDLFS+A NI K  +++
Sbjct  1    MAKSKDDIKYGTAQAKLSEDEVLRVRYKHGTPLEGGKIADSEPVDLFSSAQNISKSDQQQ  60

Query  291  ETAESDQPAGER  256
            +TA+S+Q   +R
Sbjct  61   QTADSNQSQLQR  72



>gb|KDP25128.1| hypothetical protein JCGZ_22663 [Jatropha curcas]
Length=89

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 58/77 (75%), Gaps = 2/77 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            MAKSKDDI YG AQA+LSED++LR+ YK G PLEGGKIA+SE VDLFS+AHNI K    +
Sbjct  1    MAKSKDDIKYGTAQAKLSEDESLRMRYKHGTPLEGGKIADSETVDLFSSAHNIPKS--SD  58

Query  288  TAESDQPAGERRPSQAA  238
            +A S   +   RPS AA
Sbjct  59   SATSTDQSQSHRPSNAA  75



>gb|ABB72387.1| seed maturation protein [Glycine latifolia]
Length=89

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK--QRR  295
            MAKSK+DITYG +QARLSED+A+RV Y  G PLEGGKIA+S+PVDLFS+AHN+ K  Q  
Sbjct  1    MAKSKEDITYGTSQARLSEDEAVRVAYVHGTPLEGGKIADSQPVDLFSSAHNMPKSGQTT  60

Query  294  RETAESDQPAGER  256
             ++  SDQ   +R
Sbjct  61   TDSNTSDQSQMQR  73



>gb|ABB72392.1| seed maturation protein [Glycine tomentella]
 gb|ABB72397.1| seed maturation protein [Glycine tomentella]
 gb|ABB72402.1| seed maturation protein [Glycine tomentella]
Length=89

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK--QRR  295
            MAKSK+DITY  +QARLSED+A+RV Y+ G PLEGGKIA+S+PVDLFS+AHNI K  Q  
Sbjct  1    MAKSKEDITYATSQARLSEDEAVRVAYEHGTPLEGGKIADSQPVDLFSSAHNIPKSGQTT  60

Query  294  RETAESDQPAGER  256
             ++  SDQ   +R
Sbjct  61   MDSNTSDQSQMQR  73



>ref|XP_010694911.1| PREDICTED: uncharacterized protein LOC104907651 [Beta vulgaris 
subsp. vulgaris]
Length=98

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK  304
            MA SK+D+ YG AQARL EDDA RV YK G PLEGGKIAESEPVD FSAAHNI+K
Sbjct  1    MATSKEDLKYGTAQARLREDDATRVAYKAGTPLEGGKIAESEPVDFFSAAHNIDK  55



>ref|XP_002513426.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48829.1| conserved hypothetical protein [Ricinus communis]
Length=93

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            MAKSKDDI YG AQA+LS+D+A+RV YK G PLEGGKIA+SEPVDLFS+AHNI      +
Sbjct  1    MAKSKDDIKYGTAQAKLSDDEAVRVRYKHGTPLEGGKIADSEPVDLFSSAHNISSNPSDD  60

Query  288  TAESDQ  271
            +  + Q
Sbjct  61   STSTHQ  66



>gb|ABB72396.1| seed maturation protein [Glycine tomentella]
Length=89

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK--QRR  295
            MAKSK+DITY  +QARLSED+A+RV Y  G PLEGGKIA+S+PVDLFS+AHNI K  Q  
Sbjct  1    MAKSKEDITYATSQARLSEDEAVRVAYGHGTPLEGGKIADSQPVDLFSSAHNIPKSGQTT  60

Query  294  RETAESDQPAGER  256
             ++  SDQ   +R
Sbjct  61   MDSNTSDQSQMQR  73



>ref|NP_001237986.1| seed maturation protein PM28 [Glycine max]
 gb|AAD30427.1|AF117724_1 seed maturation protein PM28 [Glycine max]
 gb|ABB72389.1| seed maturation protein [Glycine soja]
 gb|ABB72390.1| seed maturation protein [Glycine soja]
 gb|KHN26806.1| hypothetical protein glysoja_011398 [Glycine soja]
Length=89

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK--QRR  295
            MAKSK+DITY  +QARLSED+A+RV Y+ G PLEGGKIA+S+PVDLFS+AHN+ K  Q  
Sbjct  1    MAKSKEDITYATSQARLSEDEAVRVAYEHGSPLEGGKIADSQPVDLFSSAHNMPKSGQTT  60

Query  294  RETAESDQPAGER  256
             ++  SDQ   +R
Sbjct  61   MDSNTSDQSQMQR  73



>ref|NP_187902.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02504.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAT46040.1| At3g12960 [Arabidopsis thaliana]
 gb|AAU84689.1| At3g12960 [Arabidopsis thaliana]
 gb|AEE75267.1| uncharacterized protein AT3G12960 [Arabidopsis thaliana]
Length=86

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            MAK+KDDI Y  AQA+LSED+A+RV YK G PLEGGKIAESEPV+LFS+A  IEK + + 
Sbjct  1    MAKNKDDIKYATAQAKLSEDEAIRVSYKHGTPLEGGKIAESEPVELFSSAQRIEKGKEQS  60

Query  288  TAESDQPAGER  256
             A  DQ   +R
Sbjct  61   AASGDQTQIQR  71



>ref|XP_004488877.1| PREDICTED: uncharacterized protein LOC101490336 [Cicer arietinum]
Length=108

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSA-AHNIEKQRRR  292
            MAKSKDDI YG AQARLSED+A+RV YK G PLEGGKIA+SE VDLF++ AHNI K  ++
Sbjct  1    MAKSKDDIKYGTAQARLSEDEAVRVVYKHGTPLEGGKIADSEQVDLFTSDAHNISKNDQK  60

Query  291  ETAESDQ  271
            + A+S+Q
Sbjct  61   QNADSNQ  67



>gb|ABB72394.1| seed maturation protein [Glycine tomentella]
 gb|ABB72395.1| seed maturation protein [Glycine tomentella]
 gb|ABB72398.1| seed maturation protein [Glycine tomentella]
 gb|ABB72399.1| seed maturation protein [Glycine tomentella]
 gb|ABB72401.1| seed maturation protein [Glycine tomentella]
 gb|ABB72403.1| seed maturation protein [Glycine tomentella]
 gb|ABB72404.1| seed maturation protein [Glycine tomentella]
Length=89

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK--QRR  295
            MAKSK+DITY  +QARLSED+A+RV Y  G PLEGGKIA+++PVDLFS+AHNI K  Q  
Sbjct  1    MAKSKEDITYATSQARLSEDEAVRVAYVHGTPLEGGKIADTQPVDLFSSAHNIPKSGQTT  60

Query  294  RETAESDQPAGER  256
             ++  SDQ   +R
Sbjct  61   MDSNTSDQSQMQR  73



>gb|ABB72393.1| seed maturation protein [Glycine tomentella]
Length=89

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK--QRR  295
            MAKSK+DITY  +QARLSED+A+RV Y  G PLEGGKIA+++PVDLFS+AHNI K  Q  
Sbjct  1    MAKSKEDITYATSQARLSEDEAVRVAYVHGTPLEGGKIADTQPVDLFSSAHNIPKSGQTT  60

Query  294  RETAESDQPAGER  256
             ++  SDQ   +R
Sbjct  61   MDSNTSDQSQMQR  73



>gb|ABB72388.1| seed maturation protein [Glycine latifolia]
Length=89

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK--QRR  295
            MAKSK+DITYG +QARLSED+A+R  Y  G PLEGGKIA+S+PVDLFS+AHN+ K  Q  
Sbjct  1    MAKSKEDITYGTSQARLSEDEAVRAAYVHGTPLEGGKIADSQPVDLFSSAHNMPKSGQTT  60

Query  294  RETAESDQPAGER  256
             ++  SDQ   +R
Sbjct  61   TDSNTSDQSQMQR  73



>gb|ABB72391.1| seed maturation protein [Glycine tabacina]
 gb|ABB72400.1| seed maturation protein [Glycine tomentella]
Length=89

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK--QRR  295
            MAKSK+DITY  +QARLSED+A+RV Y  G PLEGGKIA+S+PVDLFS+AHN+ K  Q  
Sbjct  1    MAKSKEDITYATSQARLSEDEAVRVAYVHGTPLEGGKIADSQPVDLFSSAHNMPKSGQTT  60

Query  294  RETAESDQPAGER  256
             ++  SDQ   +R
Sbjct  61   MDSNTSDQSQMQR  73



>emb|CBI27345.3| unnamed protein product [Vitis vinifera]
Length=112

 Score = 90.5 bits (223),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            MAKSKDDI Y  AQA+LSED+ALRV YK G PLEGGKIAESEPVDLFS+A NI
Sbjct  1    MAKSKDDIKYATAQAKLSEDEALRVRYKSGTPLEGGKIAESEPVDLFSSARNI  53



>ref|XP_002272245.1| PREDICTED: uncharacterized protein LOC100247337 [Vitis vinifera]
 emb|CBI25650.3| unnamed protein product [Vitis vinifera]
Length=89

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            MAKSKDDI Y  AQA+LSED+ALRV YK G PLEGGKIAESEPVDLFS+A NI
Sbjct  1    MAKSKDDIKYATAQAKLSEDEALRVRYKSGTPLEGGKIAESEPVDLFSSARNI  53



>ref|XP_009764171.1| PREDICTED: uncharacterized protein LOC104215930 [Nicotiana sylvestris]
Length=64

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 4/64 (6%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            M KSKDDIT    QARLSEDDALR+ YK G PLEGGKIAES+PVDLFS+A NI+ Q+  +
Sbjct  1    MGKSKDDIT----QARLSEDDALRIRYKAGTPLEGGKIAESQPVDLFSSARNIQNQQDSK  56

Query  288  TAES  277
             A+S
Sbjct  57   IAQS  60



>ref|XP_004294215.1| PREDICTED: uncharacterized protein LOC101306413 [Fragaria vesca 
subsp. vesca]
Length=103

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            MA SKDDI Y  +QAR SED+A+RVGY  G PLE GKIAESEPVDLF AAHNI K     
Sbjct  1    MAGSKDDIKYATSQARHSEDEAVRVGYVNGTPLEAGKIAESEPVDLFPAAHNISKSTDSH  60

Query  288  TAE--SDQPAGERRPSQAAAAASHE  220
            + +  S+Q    R PS    AA HE
Sbjct  61   SHDDSSNQSQMRREPSDNIQAA-HE  84



>ref|XP_008226090.1| PREDICTED: uncharacterized protein LOC103325688 [Prunus mume]
Length=100

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK  304
            MA SKDDI YG +QARL+ED+A+RV YK G PLEGGKIA+SEPVDLFS+AH I K
Sbjct  5    MANSKDDIMYGTSQARLNEDEAVRVAYKHGTPLEGGKIADSEPVDLFSSAHIIPK  59



>ref|XP_008392311.1| PREDICTED: uncharacterized protein LOC103454502 [Malus domestica]
Length=116

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK-QRRR  292
            M+KSKDDI Y  +QARL ED+A+R  YK G PLEGGKIAESEPVDLFS+A NI K Q R 
Sbjct  1    MSKSKDDIXYATSQARLDEDEAVRTAYKHGTPLEGGKIAESEPVDLFSSARNIPKAQPRD  60

Query  291  ETAESDQ  271
            E + +D+
Sbjct  61   EDSSNDR  67



>gb|ABB72386.1| seed maturation protein [Glycine canescens]
Length=89

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK--QRR  295
            MAKSK+DITY  +QARLSED+A+RV Y  G PLEGGKIA+S+PVDLFS+A N+ K  Q  
Sbjct  1    MAKSKEDITYATSQARLSEDEAVRVAYVHGTPLEGGKIADSQPVDLFSSAPNMPKSGQTT  60

Query  294  RETAESDQPAGER  256
             ++  SDQ   +R
Sbjct  61   MDSNTSDQSQMQR  73



>ref|XP_002882798.1| hypothetical protein ARALYDRAFT_478659 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59057.1| hypothetical protein ARALYDRAFT_478659 [Arabidopsis lyrata subsp. 
lyrata]
Length=61

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK  304
            MAK+KDDI Y  AQA+LSED+ +RV YK G PLEGGKIAESEPV+LFS+A  IEK
Sbjct  1    MAKNKDDIKYATAQAKLSEDEPIRVSYKHGTPLEGGKIAESEPVELFSSAQRIEK  55



>ref|XP_006407277.1| hypothetical protein EUTSA_v10022193mg [Eutrema salsugineum]
 gb|ESQ48730.1| hypothetical protein EUTSA_v10022193mg [Eutrema salsugineum]
Length=89

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 7/68 (10%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            MAK+KDDI Y  AQA+LSED+ +RV YK G PLEGGKI ESEPV+LFS+A  IEK +   
Sbjct  1    MAKNKDDIKYATAQAKLSEDEPIRVSYKHGTPLEGGKIVESEPVELFSSAQCIEKGK---  57

Query  288  TAESDQPA  265
                DQPA
Sbjct  58   ----DQPA  61



>ref|XP_008444288.1| PREDICTED: uncharacterized protein LOC103487654 [Cucumis melo]
 gb|ADN33756.1| seed maturation protein [Cucumis melo subsp. melo]
Length=102

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            MAKSKDDITYG AQA+LSED+ALRV YK G PLE GKI++S+ VDLFS+AH I
Sbjct  1    MAKSKDDITYGAAQAKLSEDEALRVAYKHGTPLESGKISDSDTVDLFSSAHKI  53



>ref|XP_011097654.1| PREDICTED: uncharacterized protein LOC105176531 [Sesamum indicum]
Length=111

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQR  298
            MA+SKDD+ Y  AQA++SED+A+RV YKGG PLEGGKIA+SE VDLFS A NI +Q+
Sbjct  26   MAQSKDDVKYATAQAKVSEDEAVRVRYKGGTPLEGGKIADSEAVDLFSGARNISRQQ  82



>ref|XP_006299041.1| hypothetical protein CARUB_v10015178mg [Capsella rubella]
 gb|EOA31939.1| hypothetical protein CARUB_v10015178mg [Capsella rubella]
Length=85

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK  304
            MAK+KDDI Y  AQA+LSED+ +RV YK G PLEGGKIAESEPV+LFS+A  IE+
Sbjct  1    MAKNKDDIEYATAQAKLSEDEPIRVSYKHGTPLEGGKIAESEPVELFSSAQRIEQ  55



>ref|XP_007149270.1| hypothetical protein PHAVU_005G056100g [Phaseolus vulgaris]
 gb|ESW21264.1| hypothetical protein PHAVU_005G056100g [Phaseolus vulgaris]
Length=89

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 52/70 (74%), Gaps = 8/70 (11%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            MAKSK+DI YG AQARLSED+A+RV Y  G PLEGGKI++S+PVD+++ A NI       
Sbjct  1    MAKSKEDIKYGTAQARLSEDEAVRVAYVNGTPLEGGKISDSQPVDMYANARNI-------  53

Query  288  TAESDQPAGE  259
             A+SD PA +
Sbjct  54   -AKSDTPAAK  62



>ref|XP_010060834.1| PREDICTED: uncharacterized protein LOC104448665 [Eucalyptus grandis]
Length=91

 Score = 81.6 bits (200),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            MAKSK+DI YG AQA+L+ D+ LRV YK G PLEGG IAESE VDLFS+AHNI
Sbjct  1    MAKSKEDIKYGTAQAKLAVDETLRVAYKHGTPLEGGHIAESERVDLFSSAHNI  53



>ref|XP_010246804.1| PREDICTED: uncharacterized protein LOC104590007 [Nelumbo nucifera]
Length=149

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            MAK+KDDI YG AQA+LSED+ LRV YK G P+EGGKIA+SEPVDLFS A  I
Sbjct  1    MAKNKDDIKYGTAQAKLSEDETLRVRYKAGTPIEGGKIADSEPVDLFSGARRI  53



>ref|XP_009124692.1| PREDICTED: uncharacterized protein LOC103849726 [Brassica rapa]
Length=88

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK  304
            MAK+KDDI Y  AQ + SED+A+RV YK G PLEGGKIAESEPV+LFS+A  IEK
Sbjct  1    MAKNKDDIKYATAQTKQSEDEAIRVRYKHGTPLEGGKIAESEPVELFSSAQGIEK  55



>emb|CDY24233.1| BnaC01g38130D [Brassica napus]
Length=88

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK  304
            MAK+KDDI Y  AQ + SED+A+RV YK G PLEGGKIAESEPV+LFS+A  IEK
Sbjct  1    MAKNKDDIKYATAQTKQSEDEAIRVRYKHGTPLEGGKIAESEPVELFSSAQGIEK  55



>emb|CDY43385.1| BnaA01g30160D [Brassica napus]
Length=88

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK  304
            MAK+KDDI Y  AQ + SED+A+RV YK G PLEGGKIAESEPV+LFS+A  IEK
Sbjct  1    MAKNKDDIKYATAQTKQSEDEAIRVRYKHGTPLEGGKIAESEPVELFSSAQGIEK  55



>ref|XP_009361774.1| PREDICTED: uncharacterized protein LOC103951988 [Pyrus x bretschneideri]
Length=106

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLF--SAAHNIEK  304
            M+KSKDDI Y  +QARL ED+A+R  YK G PLEGGKIAESEPVDLF  S+A NI K
Sbjct  1    MSKSKDDIRYATSQARLDEDEAVRTAYKRGTPLEGGKIAESEPVDLFSCSSARNIPK  57



>ref|XP_008783375.1| PREDICTED: uncharacterized protein LOC103702643 [Phoenix dactylifera]
Length=78

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQR  298
            MA+SKDDI +G AQA+LSED+ LRV YK G PLEGGKIA+SEPVDLF+ A  I +++
Sbjct  1    MAQSKDDIKHGTAQAKLSEDEMLRVRYKHGTPLEGGKIADSEPVDLFADARRIAREK  57



>gb|KFK38634.1| hypothetical protein AALP_AA3G139900 [Arabis alpina]
Length=81

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 7/68 (10%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRE  289
            MAK+K+DI Y  AQ++LSED+A+RV YK G P+EGGKIA+SEPVD F++A N+ K +   
Sbjct  1    MAKNKEDIQYATAQSKLSEDEAIRVRYKHGTPVEGGKIADSEPVDPFASAKNVRKGK---  57

Query  288  TAESDQPA  265
                DQPA
Sbjct  58   ----DQPA  61



>ref|WP_033581571.1| hypothetical protein, partial [Dickeya zeae]
Length=85

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  459  SKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEK  304
            +KDDI Y  AQ + SED+A+RV YK G PLEGGKIAESEPV+LFS+A  IEK
Sbjct  1    NKDDIKYATAQTKQSEDEAIRVRYKHGTPLEGGKIAESEPVELFSSAQGIEK  52



>gb|EMT20079.1| hypothetical protein F775_43732 [Aegilops tauschii]
Length=96

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 4/69 (6%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI----EKQ  301
            MA SK+DI +G AQARL+ DD LR GY  G PLEGGKIA+S+PVDLF+ A ++    ++Q
Sbjct  1    MATSKEDIKHGTAQARLTVDDELRTGYFNGTPLEGGKIADSDPVDLFAQARHVADASQQQ  60

Query  300  RRRETAESD  274
             RR+  E +
Sbjct  61   PRRDLGEEE  69



>gb|EMS66610.1| hypothetical protein TRIUR3_06375 [Triticum urartu]
Length=81

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            MA SK+DI +G AQARL+ DD LR GY  G PLEGGKIA+S+PVDLF+ A ++
Sbjct  1    MATSKEDIKHGTAQARLTVDDELRTGYFNGSPLEGGKIADSDPVDLFAQARHV  53



>emb|CAN64204.1| hypothetical protein VITISV_007158 [Vitis vinifera]
Length=116

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  441  YGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            Y  AQA+LSED+ALRV YK G PLEGGKIAESEPVDLFS+A NI
Sbjct  31   YATAQAKLSEDEALRVRYKSGTPLEGGKIAESEPVDLFSSARNI  74



>ref|XP_009386678.1| PREDICTED: uncharacterized protein LOC103973756 [Musa acuminata 
subsp. malaccensis]
Length=93

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  474  GSMAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            G   +S+DDI +G AQA+LS+D+ LRVGYK G PLE GKI+++EPVDLF  A  I
Sbjct  10   GGRWQSRDDIKHGAAQAKLSDDEMLRVGYKHGTPLESGKISDAEPVDLFVDARRI  64



>ref|XP_009353345.1| PREDICTED: uncharacterized protein LOC103944587 [Pyrus x bretschneideri]
Length=58

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRV-GYKGGDPLEGGKIAESEPVDLF  328
            MAKS DDI Y  +QARL ED+ +R   YK G PLEGGKIAESEPVD F
Sbjct  1    MAKSWDDIKYATSQARLDEDEVVRTTAYKHGTPLEGGKIAESEPVDFF  48



>ref|XP_010234245.1| PREDICTED: uncharacterized protein LOC104583524 [Brachypodium 
distachyon]
Length=112

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  474  GSMAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSA  322
            G   + +  + +GRAQARLS+DD LR GY G  PLEGGKIA+SEPVDLF+ 
Sbjct  18   GKTVEREKKMEHGRAQARLSDDDMLRTGYVGETPLEGGKIADSEPVDLFNV  68



>ref|XP_008371717.1| PREDICTED: uncharacterized protein LOC103435103 [Malus domestica]
Length=61

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRV-GYKGGDPLEGGKIAESEPVDLFSAAHN  313
            MAKS DDI Y  +QARL ED+ +R   YK G PLEGGKIAESEP++  +   N
Sbjct  1    MAKSWDDIKYATSQARLDEDEVVRTTAYKHGTPLEGGKIAESEPIEQMNKREN  53



>gb|EAZ05298.1| hypothetical protein OsI_27503 [Oryza sativa Indica Group]
Length=103

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDD-ALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRR  292
            MA SK ++ +G AQA+++ DD  LR G+  G PLE GK+A+S+PVDLF  A  + +Q+++
Sbjct  1    MATSKKEVRHGTAQAKVNGDDEMLRTGFINGTPLEAGKVADSQPVDLFDQARRVSQQQQQ  60

Query  291  ETAESDQ-PAGERR  253
               E ++  AG R+
Sbjct  61   NRPEEEEDEAGSRK  74



>ref|XP_002443706.1| hypothetical protein SORBIDRAFT_07g000625 [Sorghum bicolor]
 gb|EES13201.1| hypothetical protein SORBIDRAFT_07g000625 [Sorghum bicolor]
Length=108

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDD-ALRVGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQ  301
            MA SK +I  GRA  +++ DD  LR G+  G PLEGGKIA+S+PVDLF+AA  +  Q
Sbjct  1    MAHSKREIKPGRAHTKVAGDDEMLRTGFYDGTPLEGGKIADSKPVDLFAAARRVADQ  57



>ref|NP_001145613.1| uncharacterized protein LOC100279096 [Zea mays]
 gb|ACG48906.1| hypothetical protein [Zea mays]
Length=129

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDD-ALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            MA SK +I  GRA  +++ DD  LR G+  G PLEGGKIA+S+PVDLF+AA  +
Sbjct  1    MAHSKREIKPGRAHTKVAGDDEMLRTGFFDGTPLEGGKIADSQPVDLFAAARRV  54



>gb|AFW74221.1| hypothetical protein ZEAMMB73_326753 [Zea mays]
Length=129

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDD-ALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            MA SK +I  GRA  +++ DD  LR G+  G PLEGGKIA+S+PVDLF+AA  +
Sbjct  1    MAHSKREIKPGRAHTKVAGDDEMLRTGFFDGTPLEGGKIADSQPVDLFAAARRV  54



>ref|XP_006377864.1| hypothetical protein POPTR_0011s14740g [Populus trichocarpa]
 gb|ERP55661.1| hypothetical protein POPTR_0011s14740g [Populus trichocarpa]
Length=77

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 36/52 (69%), Gaps = 13/52 (25%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDDALRVGYKGGDPLEGGKIAESEPVDLFSAAHN  313
            MAKSKDD+ +G AQA+LSED             E GKIA+SEPVDLFS+AHN
Sbjct  1    MAKSKDDVKHGTAQAKLSED-------------EIGKIADSEPVDLFSSAHN  39



>ref|XP_002467005.1| hypothetical protein SORBIDRAFT_01g018170 [Sorghum bicolor]
 gb|EER94003.1| hypothetical protein SORBIDRAFT_01g018170 [Sorghum bicolor]
Length=93

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDD-ALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            MA SK +I  GRA  +++ DD  LR G+  G PLEGGKIA+S+PVDLF+AA  +
Sbjct  1    MAHSKREIKPGRAHTKVAGDDEMLRTGFYDGTPLEGGKIADSKPVDLFAAARRV  54



>ref|NP_001060778.1| Os08g0104400 [Oryza sativa Japonica Group]
 dbj|BAD33178.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22692.1| Os08g0104400 [Oryza sativa Japonica Group]
 dbj|BAG89039.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82768.1| hypothetical protein OsI_27504 [Oryza sativa Indica Group]
Length=96

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -3

Query  468  MAKSKDDITYGRAQARLSEDD-ALRVGYKGGDPLEGGKIAESEPVDLFSAAHNI  310
            MA SK ++ +G AQA+++ DD  LR G+  G PLE GK+A+S+PVDLF  A  +
Sbjct  1    MATSKKEVRHGTAQAKVNGDDEMLRTGFINGTPLEAGKVADSQPVDLFDQARRV  54



>ref|XP_006478067.1| PREDICTED: uncharacterized protein LOC102620642, partial [Citrus 
sinensis]
Length=84

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 4/59 (7%)
 Frame = -3

Query  396  VGYKGGDPLEGGKIAESEPVDLFSAAHNIEKQRRRETAESDQPAGERRPSQAAAAASHE  220
            + +  G PLEGGKIA+SEPVDLFS+AHN+      ET ++ QP  +   +  AA A H+
Sbjct  10   ICHPYGTPLEGGKIADSEPVDLFSSAHNLSS----ETPKNHQPPSDDDSTHQAAGAGHQ  64



>ref|XP_006659738.1| PREDICTED: uncharacterized protein LOC102710429 [Oryza brachyantha]
Length=93

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -3

Query  447  ITYGRAQARLSEDD-ALRVGYKGGDPLEGGKIAESEPVDLF  328
            + +G AQ +++ DD  LR G+  G PLEGGKIA+S PV LF
Sbjct  11   MKHGTAQTKVNGDDEMLRTGFVDGTPLEGGKIADSHPVHLF  51



>ref|XP_004972423.1| PREDICTED: uncharacterized protein LOC101785689 [Setaria italica]
Length=121

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 3/53 (6%)
 Frame = -3

Query  468  MAKSKDDIT--YGRAQARLSEDD-ALRVGYKGGDPLEGGKIAESEPVDLFSAA  319
            MA+ + D+   +G A+ +++ DD  LR G+  G PLE GKIA+S+PVDLF+ A
Sbjct  1    MAQRERDMLMKHGTARTKVAGDDEMLRTGFHNGTPLEAGKIADSQPVDLFAPA  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519922816592