BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3571_g1_i1 len=1577 path=[1:0-524 526:525-1576]

Length=1577
                                                                      Score     E

emb|CDP18022.1|  unnamed protein product                                406   1e-133   
gb|AHA51696.1|  leucine-rich repeat protein                             401   2e-131   
ref|XP_009601505.1|  PREDICTED: leucine-rich repeat receptor-like...    397   8e-130   
emb|CDP18018.1|  unnamed protein product                                395   4e-129   
ref|XP_009797681.1|  PREDICTED: receptor-like protein kinase 5          387   4e-126   
ref|XP_006345540.1|  PREDICTED: LRR receptor-like serine/threonin...    385   3e-125   
ref|XP_011073891.1|  PREDICTED: phytosulfokine receptor 2               383   2e-124   
ref|XP_004240268.1|  PREDICTED: LRR receptor-like serine/threonin...    374   6e-121   
ref|XP_004309839.1|  PREDICTED: probably inactive leucine-rich re...    363   4e-117   
ref|XP_006443000.1|  hypothetical protein CICLE_v10020393mg             358   8e-115   
gb|KDO46275.1|  hypothetical protein CISIN_1g038636mg                   355   1e-113   
ref|XP_010554423.1|  PREDICTED: leucine-rich repeat receptor-like...    352   1e-112   
ref|XP_003597526.1|  Receptor kinase                                    345   7e-110   
ref|XP_004486909.1|  PREDICTED: LRR receptor-like serine/threonin...    342   1e-108   
ref|XP_010672229.1|  PREDICTED: LRR receptor-like serine/threonin...    340   7e-108   
ref|XP_011037112.1|  PREDICTED: leucine-rich repeat receptor-like...    338   5e-107   
ref|XP_006372857.1|  leucine-rich repeat family protein                 338   6e-107   
ref|XP_010526132.1|  PREDICTED: leucine-rich repeat receptor-like...    335   1e-105   
ref|XP_006372855.1|  hypothetical protein POPTR_0017s05710g             333   4e-105   
ref|XP_011037111.1|  PREDICTED: leucine-rich repeat receptor-like...    329   4e-103   
ref|XP_010524152.1|  PREDICTED: leucine-rich repeat receptor-like...    327   6e-103   
ref|XP_006402682.1|  hypothetical protein EUTSA_v10006500mg             325   3e-102   
emb|CDY00622.1|  BnaC04g23030D                                          325   8e-102   
emb|CDX89025.1|  BnaA04g01610D                                          321   2e-100   
ref|NP_191510.1|  leucine-rich repeat-containing protein                320   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290416.1|  hypothetical protein CARUB_v10019143mg             320   4e-100   
ref|XP_010418635.1|  PREDICTED: LRR receptor-like serine/threonin...    319   1e-99    
ref|XP_010513735.1|  PREDICTED: LRR receptor-like serine/threonin...    318   2e-99    
ref|XP_002878275.1|  leucine-rich repeat family protein                 318   3e-99    
gb|KFK35171.1|  hypothetical protein AALP_AA5G249000                    317   8e-99    
emb|CDX98379.1|  BnaC06g17400D                                          315   2e-98    
ref|XP_009104211.1|  PREDICTED: probable LRR receptor-like serine...    315   4e-98    
ref|XP_009138910.1|  PREDICTED: probable LRR receptor-like serine...    315   6e-98    
ref|XP_006858894.1|  hypothetical protein AMTR_s00066p00204410          302   2e-93    
ref|XP_010418636.1|  PREDICTED: LRR receptor-like serine/threonin...    290   1e-89    
gb|KHN33303.1|  LRR receptor-like serine/threonine-protein kinase...    247   7e-74    
gb|EPS68803.1|  hypothetical protein M569_05977                         224   3e-65    
ref|XP_007033918.1|  Leucine-rich repeat (LRR) family protein, pu...    207   1e-58    
ref|XP_010244255.1|  PREDICTED: LRR receptor-like serine/threonin...    197   1e-53    
emb|CDO97212.1|  unnamed protein product                                194   2e-52    
ref|XP_011030411.1|  PREDICTED: polygalacturonase inhibitor 1-like      192   5e-52    
ref|XP_007042511.1|  Leucine-rich repeat (LRR) family protein           192   8e-52    
ref|XP_002285338.2|  PREDICTED: probable LRR receptor-like serine...    192   9e-52    Vitis vinifera
emb|CBI40273.3|  unnamed protein product                                192   1e-51    
gb|ABK24515.1|  unknown                                                 191   4e-51    Picea sitchensis
ref|XP_002965556.1|  hypothetical protein SELMODRAFT_84581              189   1e-50    
gb|EPS62359.1|  hypothetical protein M569_12432                         187   2e-50    
ref|XP_008373089.1|  PREDICTED: probable LRR receptor-like serine...    189   3e-50    
ref|XP_002983042.1|  hypothetical protein SELMODRAFT_117682             187   7e-50    
ref|XP_002298744.2|  hypothetical protein POPTR_0001s30880g             186   7e-50    Populus trichocarpa [western balsam poplar]
ref|XP_006855205.1|  hypothetical protein AMTR_s00051p00180000          186   2e-49    
ref|XP_007143042.1|  hypothetical protein PHAVU_007G038700g             186   2e-49    
ref|XP_002977299.1|  hypothetical protein SELMODRAFT_443476             186   3e-49    
ref|XP_002971932.1|  hypothetical protein SELMODRAFT_412673             184   1e-48    
ref|XP_006829151.1|  hypothetical protein AMTR_s00001p00269630          184   1e-48    
ref|XP_010270975.1|  PREDICTED: probably inactive leucine-rich re...    182   6e-48    
ref|XP_011001048.1|  PREDICTED: leucine-rich repeat receptor-like...    180   2e-47    
ref|XP_009335003.1|  PREDICTED: probably inactive leucine-rich re...    181   2e-47    
ref|XP_006487018.1|  PREDICTED: putative leucine-rich repeat rece...    177   3e-46    
ref|XP_002280730.1|  PREDICTED: receptor-like protein kinase 5          177   9e-46    Vitis vinifera
ref|XP_010547451.1|  PREDICTED: probable LRR receptor-like serine...    176   1e-45    
ref|XP_002313141.2|  hypothetical protein POPTR_0009s10000g             175   2e-45    Populus trichocarpa [western balsam poplar]
ref|XP_004496960.1|  PREDICTED: LRR receptor-like serine/threonin...    175   2e-45    
gb|KDO59800.1|  hypothetical protein CISIN_1g016534mg                   174   3e-45    
ref|XP_002273008.1|  PREDICTED: LRR receptor-like serine/threonin...    174   4e-45    Vitis vinifera
gb|EYU37641.1|  hypothetical protein MIMGU_mgv1a019103mg                173   4e-45    
ref|XP_001781475.1|  predicted protein                                  175   4e-45    
ref|XP_006422949.1|  hypothetical protein CICLE_v10030023mg             172   7e-45    
ref|XP_010531560.1|  PREDICTED: polygalacturonase inhibitor 1           172   1e-44    
ref|XP_011045158.1|  PREDICTED: receptor-like protein kinase 5          171   8e-44    
gb|KDP38584.1|  hypothetical protein JCGZ_04509                         171   8e-44    
ref|XP_011088215.1|  PREDICTED: probable LRR receptor-like serine...    170   9e-44    
gb|KDP47139.1|  hypothetical protein JCGZ_22135                         170   1e-43    
gb|KFK40008.1|  hypothetical protein AALP_AA3G318100                    169   2e-43    
ref|XP_008454983.1|  PREDICTED: leucine-rich repeat receptor-like...    169   3e-43    
gb|KDO71082.1|  hypothetical protein CISIN_1g036985mg                   169   4e-43    
ref|XP_002306903.2|  hypothetical protein POPTR_0005s25580g             169   4e-43    Populus trichocarpa [western balsam poplar]
ref|XP_006425561.1|  hypothetical protein CICLE_v10025688mg             168   8e-43    
ref|XP_009378217.1|  PREDICTED: LRR receptor-like serine/threonin...    168   8e-43    
ref|XP_002885955.1|  leucine-rich repeat family protein                 167   8e-43    
ref|XP_004136962.1|  PREDICTED: probable LRR receptor-like serine...    167   9e-43    
ref|XP_010473835.1|  PREDICTED: LRR receptor-like serine/threonin...    162   1e-42    
ref|XP_009338658.1|  PREDICTED: LRR receptor-like serine/threonin...    168   1e-42    
ref|NP_001241201.1|  probably inactive leucine-rich repeat recept...    167   1e-42    
ref|NP_179134.1|  leucine-rich repeat-containing protein                166   2e-42    Arabidopsis thaliana [mouse-ear cress]
gb|AAM63268.1|  putative leucine-rich repeat disease resistance p...    166   2e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006466890.1|  PREDICTED: probable LRR receptor-like serine...    167   3e-42    
ref|XP_002510474.1|  serine-threonine protein kinase, plant-type,...    166   7e-42    Ricinus communis
gb|KFK28302.1|  hypothetical protein AALP_AA8G499000                    165   8e-42    
ref|XP_006299807.1|  hypothetical protein CARUB_v10016003mg             164   1e-41    
ref|XP_006409562.1|  hypothetical protein EUTSA_v10022724mg             164   2e-41    
gb|KEH44118.1|  LRR receptor-like kinase family protein                 163   3e-41    
ref|XP_010107876.1|  hypothetical protein L484_027463                   163   3e-41    
ref|XP_002982589.1|  hypothetical protein SELMODRAFT_234053             164   3e-41    
ref|NP_201434.1|  leucine-rich repeat-containing protein                163   4e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002518690.1|  serine-threonine protein kinase, plant-type,...    162   5e-41    Ricinus communis
ref|XP_002981118.1|  hypothetical protein SELMODRAFT_114038             163   7e-41    
ref|XP_007017684.1|  Leucine-rich repeat family protein                 162   1e-40    
emb|CDP01941.1|  unnamed protein product                                162   1e-40    
ref|XP_004512092.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-40    
ref|XP_010271508.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-40    
ref|XP_008241777.1|  PREDICTED: receptor-like protein kinase HSL1       162   2e-40    
ref|XP_004289102.1|  PREDICTED: receptor-like protein kinase BRI1...    161   3e-40    
ref|XP_009605875.1|  PREDICTED: LRR receptor-like serine/threonin...    161   3e-40    
ref|XP_009606818.1|  PREDICTED: LRR receptor-like serine/threonin...    159   5e-40    
gb|ACN78489.1|  putative disease resistance protein                     159   5e-40    Arachis hypogaea [goober]
ref|XP_009770154.1|  PREDICTED: LRR receptor-like serine/threonin...    159   6e-40    
ref|XP_004304038.1|  PREDICTED: probable LRR receptor-like serine...    159   9e-40    
ref|XP_010691707.1|  PREDICTED: LRR receptor-like serine/threonin...    159   1e-39    
ref|XP_010467293.1|  PREDICTED: probably inactive leucine-rich re...    158   2e-39    
ref|XP_010488953.1|  PREDICTED: polygalacturonase inhibitor 1-like      158   2e-39    
ref|XP_006401440.1|  hypothetical protein EUTSA_v10013640mg             158   2e-39    
emb|CDY45666.1|  BnaC09g32080D                                          158   4e-39    
ref|XP_009798456.1|  PREDICTED: probable LRR receptor-like serine...    158   4e-39    
ref|XP_010518138.1|  PREDICTED: polygalacturonase inhibitor 1-like      156   6e-39    
gb|EYU31152.1|  hypothetical protein MIMGU_mgv1a007121mg                157   8e-39    
gb|ACN78482.1|  putative disease resistance protein                     156   9e-39    Arachis hypogaea [goober]
ref|XP_002966122.1|  hypothetical protein SELMODRAFT_85778              156   1e-38    
ref|XP_003519880.1|  PREDICTED: LRR receptor-like serine/threonin...    156   1e-38    
ref|XP_010113398.1|  Receptor-like protein 12                           156   1e-38    
ref|XP_008346303.1|  PREDICTED: receptor-like protein 12                156   1e-38    
ref|XP_008236364.1|  PREDICTED: probable LRR receptor-like serine...    155   1e-38    
ref|XP_010550441.1|  PREDICTED: probable LRR receptor-like serine...    156   2e-38    
ref|XP_010679829.1|  PREDICTED: probable LRR receptor-like serine...    156   2e-38    
ref|XP_002533302.1|  serine-threonine protein kinase, plant-type,...    155   2e-38    Ricinus communis
gb|AFK43023.1|  unknown                                                 155   3e-38    
ref|XP_003612103.1|  Leucine-rich repeat receptor protein kinase EXS    155   3e-38    
ref|XP_006291196.1|  hypothetical protein CARUB_v10017324mg             154   7e-38    
ref|XP_009123233.1|  PREDICTED: LRR receptor-like serine/threonin...    153   9e-38    
ref|XP_009120067.1|  PREDICTED: leucine-rich repeat receptor prot...    154   9e-38    
ref|XP_004146484.1|  PREDICTED: probable LRR receptor-like serine...    154   1e-37    
gb|KDP46684.1|  hypothetical protein JCGZ_06472                         154   1e-37    
ref|XP_011028659.1|  PREDICTED: probable LRR receptor-like serine...    154   1e-37    
ref|XP_003536619.1|  PREDICTED: phytosulfokine receptor 1-like          152   2e-37    
ref|XP_008337901.1|  PREDICTED: receptor-like protein kinase 2          152   3e-37    
emb|CDY17334.1|  BnaA10g09680D                                          152   3e-37    
ref|XP_010514243.1|  PREDICTED: putative leucine-rich repeat rece...    151   6e-37    
ref|XP_002310285.2|  hypothetical protein POPTR_0007s13680g             151   9e-37    Populus trichocarpa [western balsam poplar]
ref|XP_006340694.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-36    
ref|XP_004232455.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-36    
ref|XP_006350423.1|  PREDICTED: LRR receptor-like serine/threonin...    143   3e-36    
ref|XP_009346301.1|  PREDICTED: probable LRR receptor-like serine...    149   4e-36    
ref|XP_006346371.1|  PREDICTED: LRR receptor-like serine/threonin...    149   5e-36    
ref|XP_008453716.1|  PREDICTED: LRR receptor-like serine/threonin...    148   6e-36    
ref|XP_004230743.1|  PREDICTED: probable LRR receptor-like serine...    147   1e-35    
ref|XP_002875304.1|  leucine-rich repeat family protein                 147   1e-35    
ref|XP_010263857.1|  PREDICTED: LRR receptor-like serine/threonin...    147   3e-35    
ref|XP_008796883.1|  PREDICTED: leucine-rich repeat receptor-like...    146   5e-35    
ref|XP_007201068.1|  hypothetical protein PRUPE_ppa007248mg             145   6e-35    
ref|NP_001241130.1|  LRR receptor-like serine/threonine-protein k...    145   7e-35    
ref|XP_010061015.1|  PREDICTED: probable LRR receptor-like serine...    145   8e-35    
ref|XP_007046769.1|  Leucine-rich repeat (LRR) family protein           145   9e-35    
ref|XP_010029720.1|  PREDICTED: probable LRR receptor-like serine...    145   1e-34    
ref|XP_011025898.1|  PREDICTED: probable LRR receptor-like serine...    145   1e-34    
ref|XP_006383144.1|  hypothetical protein POPTR_0005s11980g             144   2e-34    
ref|XP_010506974.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-34    
ref|XP_007202180.1|  hypothetical protein PRUPE_ppa006641mg             142   5e-34    
emb|CDY20758.1|  BnaA02g08980D                                          142   5e-34    
ref|XP_006342229.1|  PREDICTED: probable leucine-rich repeat rece...    142   8e-34    
ref|XP_010674464.1|  PREDICTED: LRR receptor-like serine/threonin...    139   1e-32    
ref|XP_007157953.1|  hypothetical protein PHAVU_002G112100g             138   2e-32    
ref|XP_007156101.1|  hypothetical protein PHAVU_003G258700g             137   3e-32    
ref|XP_002982179.1|  hypothetical protein SELMODRAFT_115747             134   5e-32    
ref|XP_011090416.1|  PREDICTED: LRR receptor-like serine/threonin...    137   6e-32    
dbj|BAK03644.1|  predicted protein                                      136   1e-31    
ref|XP_003536896.1|  PREDICTED: LRR receptor-like serine/threonin...    133   8e-31    
ref|XP_002309797.2|  leucine-rich repeat family protein                 130   9e-31    Populus trichocarpa [western balsam poplar]
gb|KCW60493.1|  hypothetical protein EUGRSUZ_H03228                     130   4e-30    
emb|CDY06571.1|  BnaC02g12950D                                          130   6e-30    
gb|EPS66742.1|  hypothetical protein M569_08034                         130   1e-29    
ref|XP_009800454.1|  PREDICTED: LRR receptor-like serine/threonin...    129   1e-29    
ref|XP_010927511.1|  PREDICTED: probable LRR receptor-like serine...    129   2e-29    
ref|XP_010235773.1|  PREDICTED: probable LRR receptor-like serine...    129   2e-29    
ref|XP_010026278.1|  PREDICTED: probable LRR receptor-like serine...    128   4e-29    
ref|XP_003520222.1|  PREDICTED: leucine-rich repeat receptor-like...    127   1e-28    
ref|XP_003591587.1|  Receptor-like protein kinase                       127   1e-28    
ref|XP_003553442.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-28    
ref|XP_008796766.1|  PREDICTED: LRR receptor-like serine/threonin...    126   1e-28    
gb|KHN36060.1|  Receptor-like protein 12                                126   2e-28    
ref|XP_010933760.1|  PREDICTED: leucine-rich repeat receptor prot...    125   4e-28    
ref|XP_009619476.1|  PREDICTED: LRR receptor-like serine/threonin...    125   5e-28    
ref|XP_007144581.1|  hypothetical protein PHAVU_007G167800g             124   7e-28    
ref|XP_007162374.1|  hypothetical protein PHAVU_001G146600g             124   9e-28    
ref|XP_007226927.1|  hypothetical protein PRUPE_ppa015866mg             117   1e-27    
ref|XP_004496056.1|  PREDICTED: LRR receptor-like serine/threonin...    123   2e-27    
ref|XP_003516553.2|  PREDICTED: LRR receptor-like serine/threonin...    123   2e-27    
ref|XP_001772599.1|  predicted protein                                  122   2e-27    
ref|XP_003520549.1|  PREDICTED: probable LRR receptor-like serine...    122   5e-27    
gb|KCW58984.1|  hypothetical protein EUGRSUZ_H01608                     120   2e-26    
ref|XP_010026277.1|  PREDICTED: DNA-damage-repair/toleration prot...    120   3e-26    
gb|ACR35989.1|  unknown                                                 119   5e-26    Zea mays [maize]
emb|CBI21262.3|  unnamed protein product                                120   5e-26    
ref|XP_002526809.1|  serine-threonine protein kinase, plant-type,...    122   8e-26    Ricinus communis
ref|XP_010260748.1|  PREDICTED: LRR receptor-like serine/threonin...    118   1e-25    
ref|XP_010267182.1|  PREDICTED: probably inactive leucine-rich re...    121   1e-25    
ref|XP_009405862.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-25    
ref|NP_001150051.1|  receptor-like protein kinase precursor             118   2e-25    Zea mays [maize]
ref|XP_010054697.1|  PREDICTED: putative receptor-like protein ki...    120   2e-25    
gb|KCW77199.1|  hypothetical protein EUGRSUZ_D01548                     120   2e-25    
gb|KCW63534.1|  hypothetical protein EUGRSUZ_G01170                     120   3e-25    
gb|EAZ22204.1|  hypothetical protein OsJ_05865                          120   3e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008807273.1|  PREDICTED: LRR receptor-like serine/threonin...    116   4e-25    
emb|CDX75559.1|  BnaA01g01430D                                          120   4e-25    
ref|XP_010068348.1|  PREDICTED: putative receptor-like protein ki...    120   4e-25    
gb|EEC72734.1|  hypothetical protein OsI_06350                          119   4e-25    Oryza sativa Indica Group [Indian rice]
ref|XP_004493629.1|  PREDICTED: LRR receptor-like serine/threonin...    116   4e-25    
emb|CDY36706.1|  BnaC02g31270D                                          119   5e-25    
ref|XP_009793939.1|  PREDICTED: leucine-rich repeat receptor-like...    116   6e-25    
ref|XP_011033036.1|  PREDICTED: leucine-rich repeat receptor-like...    119   7e-25    
ref|XP_009123620.1|  PREDICTED: putative receptor-like protein ki...    119   8e-25    
ref|XP_006585228.1|  PREDICTED: putative receptor-like protein ki...    119   9e-25    
emb|CDP07983.1|  unnamed protein product                                114   1e-24    
gb|KFK30898.1|  hypothetical protein AALP_AA6G040400                    115   1e-24    
ref|XP_010941739.1|  PREDICTED: LRR receptor-like serine/threonin...    115   1e-24    
gb|EMT19068.1|  LRR receptor-like serine/threonine-protein kinase...    115   2e-24    
gb|KHN48112.1|  LRR receptor-like serine/threonine-protein kinase...    118   2e-24    
ref|XP_009396739.1|  PREDICTED: probable LRR receptor-like serine...    114   2e-24    
ref|XP_009404704.1|  PREDICTED: probably inactive leucine-rich re...    114   2e-24    
ref|XP_009146238.1|  PREDICTED: probable LRR receptor-like serine...    117   2e-24    
ref|XP_004298715.1|  PREDICTED: probable LRR receptor-like serine...    117   2e-24    
ref|XP_002448543.1|  hypothetical protein SORBIDRAFT_06g028760          117   2e-24    Sorghum bicolor [broomcorn]
ref|XP_010041038.1|  PREDICTED: putative receptor-like protein ki...    117   2e-24    
ref|XP_010556795.1|  PREDICTED: probably inactive leucine-rich re...    114   2e-24    
ref|XP_003532799.1|  PREDICTED: putative receptor-like protein ki...    117   3e-24    
gb|KCW82356.1|  hypothetical protein EUGRSUZ_C03760                     117   3e-24    
gb|KCW63516.1|  hypothetical protein EUGRSUZ_G011492                    115   3e-24    
gb|KHN48111.1|  LRR receptor-like serine/threonine-protein kinase...    117   3e-24    
ref|XP_010038143.1|  PREDICTED: probable LRR receptor-like serine...    114   3e-24    
ref|XP_006854860.1|  hypothetical protein AMTR_s00182p00028790          117   4e-24    
ref|XP_010064788.1|  PREDICTED: putative receptor-like protein ki...    117   4e-24    
ref|XP_010455961.1|  PREDICTED: probably inactive leucine-rich re...    114   4e-24    
emb|CDP03580.1|  unnamed protein product                                114   4e-24    
gb|KEH19361.1|  LRR receptor-like kinase family protein                 116   4e-24    
emb|CDX69210.1|  BnaC01g02430D                                          116   5e-24    
gb|KCW69037.1|  hypothetical protein EUGRSUZ_F02592                     116   5e-24    
ref|XP_010249537.1|  PREDICTED: probably inactive leucine-rich re...    116   5e-24    
ref|XP_004502093.1|  PREDICTED: probably inactive leucine-rich re...    115   5e-24    
ref|WP_039118712.1|  hypothetical protein                               112   6e-24    
gb|KCW62999.1|  hypothetical protein EUGRSUZ_G00600                     116   6e-24    
ref|XP_003620837.1|  Receptor-like protein kinase                       113   6e-24    
ref|XP_002871261.1|  extra sporogenous cells                            116   6e-24    
ref|XP_010112694.1|  LRR receptor-like serine/threonine-protein k...    113   6e-24    
gb|KCW63514.1|  hypothetical protein EUGRSUZ_G01147                     116   6e-24    
emb|CDP18529.1|  unnamed protein product                                113   7e-24    
ref|XP_010249536.1|  PREDICTED: probably inactive leucine-rich re...    116   7e-24    
emb|CBI19800.3|  unnamed protein product                                115   7e-24    
ref|XP_010423232.1|  PREDICTED: leucine-rich repeat receptor prot...    116   7e-24    
ref|XP_010068334.1|  PREDICTED: putative receptor-like protein ki...    115   8e-24    
gb|KCW82341.1|  hypothetical protein EUGRSUZ_C03742                     115   8e-24    
ref|XP_006296914.1|  hypothetical protein CARUB_v10012906mg             115   8e-24    
ref|XP_002874882.1|  leucine-rich repeat family protein                 112   1e-23    
gb|ABK28618.1|  unknown                                                 112   1e-23    Arabidopsis thaliana [mouse-ear cress]
gb|EEC73695.1|  hypothetical protein OsI_08279                          112   1e-23    Oryza sativa Indica Group [Indian rice]
ref|XP_006654388.1|  PREDICTED: LRR receptor-like serine/threonin...    112   1e-23    
ref|XP_002460722.1|  hypothetical protein SORBIDRAFT_02g033810          115   1e-23    Sorghum bicolor [broomcorn]
ref|XP_004309271.1|  PREDICTED: probable LRR receptor-like serine...    114   2e-23    
ref|XP_010491332.1|  PREDICTED: leucine-rich repeat receptor prot...    115   2e-23    
gb|KGN62469.1|  hypothetical protein Csa_2G354950                       115   2e-23    
ref|XP_010456432.1|  PREDICTED: leucine-rich repeat receptor prot...    115   2e-23    
ref|XP_004143019.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-23    
ref|XP_006406709.1|  hypothetical protein EUTSA_v10022092mg             112   2e-23    
ref|XP_004242322.1|  PREDICTED: LRR receptor-like serine/threonin...    112   2e-23    
ref|XP_010068335.1|  PREDICTED: putative receptor-like protein ki...    114   2e-23    
ref|XP_002532618.1|  serine-threonine protein kinase, plant-type,...    111   2e-23    Ricinus communis
ref|NP_001055516.1|  Os05g0406800                                       111   2e-23    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002978200.1|  hypothetical protein SELMODRAFT_50240              114   2e-23    
ref|XP_008444587.1|  PREDICTED: probable LRR receptor-like serine...    114   2e-23    
gb|KCW44699.1|  hypothetical protein EUGRSUZ_L01766                     114   2e-23    
ref|XP_010648218.1|  PREDICTED: LRR receptor-like serine/threonin...    112   2e-23    
gb|AAV59431.1|  putative leucine-rich repeat family protein             111   2e-23    Oryza sativa Japonica Group [Japonica rice]
ref|NP_195341.2|  putative LRR receptor-like serine/threonine-pro...    114   2e-23    Arabidopsis thaliana [mouse-ear cress]
emb|CAA18124.1|  putative receptor protein kinase                       114   2e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310940.2|  leucine-rich repeat transmembrane protein ki...    114   3e-23    Populus trichocarpa [western balsam poplar]
ref|XP_002966360.1|  hypothetical protein SELMODRAFT_60230              114   3e-23    
ref|XP_009403829.1|  PREDICTED: leucine-rich repeat receptor-like...    111   3e-23    
ref|XP_006345275.1|  PREDICTED: probable LRR receptor-like serine...    110   3e-23    
ref|XP_010068349.1|  PREDICTED: putative receptor-like protein ki...    114   3e-23    
ref|XP_002979740.1|  hypothetical protein SELMODRAFT_444337             111   3e-23    
gb|KCW62330.1|  hypothetical protein EUGRSUZ_H04973                     114   3e-23    
ref|XP_006444181.1|  hypothetical protein CICLE_v10020489mg             110   3e-23    
ref|XP_004290702.1|  PREDICTED: receptor-like protein kinase-like       111   3e-23    
ref|XP_004154011.1|  PREDICTED: LRR receptor-like serine/threonin...    114   4e-23    
ref|XP_004145215.1|  PREDICTED: LRR receptor-like serine/threonin...    114   4e-23    
ref|XP_010064793.1|  PREDICTED: putative receptor-like protein ki...    113   4e-23    
ref|XP_010027375.1|  PREDICTED: putative receptor-like protein ki...    114   4e-23    
ref|XP_004309920.1|  PREDICTED: probable LRR receptor-like serine...    114   4e-23    
ref|XP_009398994.1|  PREDICTED: probable inactive leucine-rich re...    113   4e-23    
ref|XP_010656627.1|  PREDICTED: probable leucine-rich repeat rece...    113   4e-23    
gb|KCW69044.1|  hypothetical protein EUGRSUZ_F02602                     113   4e-23    
ref|XP_010520745.1|  PREDICTED: putative receptor-like protein ki...    113   4e-23    
gb|KCW63536.1|  hypothetical protein EUGRSUZ_G01172                     113   4e-23    
ref|XP_006857015.1|  hypothetical protein AMTR_s00197p00037090          110   4e-23    
ref|XP_010536377.1|  PREDICTED: probable LRR receptor-like serine...    113   4e-23    
gb|KHN28913.1|  LRR receptor-like serine/threonine-protein kinase...    113   5e-23    
ref|XP_006283031.1|  hypothetical protein CARUB_v10004023mg             113   5e-23    
tpg|DAA40884.1|  TPA: putative leucine-rich repeat receptor-like ...    113   5e-23    
gb|KCW63525.1|  hypothetical protein EUGRSUZ_G01159                     112   5e-23    
gb|KHN06759.1|  DNA-damage-repair/toleration protein DRT100             108   5e-23    
ref|NP_192210.1|  leucine-rich repeat family protein                    110   6e-23    
gb|KCW66776.1|  hypothetical protein EUGRSUZ_F00536                     113   6e-23    
ref|NP_001047577.1|  Os02g0647300                                       110   6e-23    
ref|XP_010065839.1|  PREDICTED: putative receptor-like protein ki...    113   6e-23    
ref|XP_010064266.1|  PREDICTED: receptor-like protein 12                113   6e-23    
ref|XP_011073865.1|  PREDICTED: probable leucine-rich repeat rece...    113   6e-23    
ref|XP_010676626.1|  PREDICTED: probable LRR receptor-like serine...    113   6e-23    
ref|XP_004985730.1|  PREDICTED: leucine-rich repeat receptor-like...    113   7e-23    
ref|XP_008234947.1|  PREDICTED: receptor-like protein kinase HSL1       110   7e-23    
ref|XP_002988384.1|  hypothetical protein SELMODRAFT_128057             110   8e-23    
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    112   8e-23    
ref|XP_007050723.1|  Leucine-rich repeat (LRR) family protein           110   8e-23    
ref|XP_008368897.1|  PREDICTED: leucine-rich repeat receptor-like...    110   8e-23    
ref|XP_003532673.2|  PREDICTED: LRR receptor-like serine/threonin...    112   8e-23    
ref|XP_011085465.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    110   8e-23    
ref|XP_006580232.1|  PREDICTED: putative receptor-like protein ki...    112   8e-23    
emb|CBI19443.3|  unnamed protein product                                112   9e-23    
ref|XP_009395787.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-22    
gb|KEH36629.1|  LRR receptor-like kinase                                109   1e-22    
ref|XP_008238681.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-22    
ref|XP_010029708.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-22    
ref|XP_010505639.1|  PREDICTED: probable LRR receptor-like serine...    109   1e-22    
ref|XP_009801818.1|  PREDICTED: LRR receptor-like serine/threonin...    112   1e-22    
gb|KEH19631.1|  LRR receptor-like kinase                                112   1e-22    
ref|XP_007201585.1|  hypothetical protein PRUPE_ppa018962mg             109   1e-22    
ref|XP_006602649.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-22    
gb|KCW56665.1|  hypothetical protein EUGRSUZ_I02367                     112   1e-22    
ref|XP_011019593.1|  PREDICTED: probably inactive leucine-rich re...    112   1e-22    
emb|CBI25249.3|  unnamed protein product                                112   1e-22    
ref|XP_011079773.1|  PREDICTED: probable leucine-rich repeat rece...    109   1e-22    
ref|XP_002963489.1|  hypothetical protein SELMODRAFT_80025              109   1e-22    
ref|XP_006353734.1|  PREDICTED: probably inactive leucine-rich re...    109   1e-22    
gb|EMT26720.1|  Putative LRR receptor-like serine/threonine-prote...    112   1e-22    
gb|KCW82349.1|  hypothetical protein EUGRSUZ_C03754                     112   1e-22    
ref|XP_009595503.1|  PREDICTED: LRR receptor-like serine/threonin...    112   1e-22    
emb|CBI37168.3|  unnamed protein product                                112   1e-22    
ref|XP_003616915.1|  DNA-directed RNA polymerase subunit beta           112   1e-22    
emb|CDP01924.1|  unnamed protein product                                112   1e-22    
ref|XP_002988198.1|  hypothetical protein SELMODRAFT_127639             109   2e-22    
ref|XP_007143904.1|  hypothetical protein PHAVU_007G112100g             111   2e-22    
ref|XP_007210377.1|  hypothetical protein PRUPE_ppa001194mg             111   2e-22    
ref|XP_010430633.1|  PREDICTED: LRR receptor-like serine/threonin...    108   2e-22    
ref|XP_011033649.1|  PREDICTED: probably inactive leucine-rich re...    108   2e-22    
ref|XP_004512590.1|  PREDICTED: leucine-rich repeat receptor-like...    111   2e-22    
gb|KCW63523.1|  hypothetical protein EUGRSUZ_G011582                    108   2e-22    
ref|XP_003568478.1|  PREDICTED: LRR receptor-like serine/threonin...    108   2e-22    
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    112   2e-22    
emb|CBN80251.1|  Putative leucine rich repeat protein                   111   2e-22    
gb|AES99873.2|  LRR receptor-like kinase family protein                 111   2e-22    
ref|XP_004233867.2|  PREDICTED: LRR receptor-like serine/threonin...    111   2e-22    
emb|CAN61202.1|  hypothetical protein VITISV_009745                     111   2e-22    
ref|XP_009417308.1|  PREDICTED: DNA-damage-repair/toleration prot...    108   2e-22    
ref|XP_002867031.1|  hypothetical protein ARALYDRAFT_491015             111   2e-22    
dbj|BAJ87098.1|  predicted protein                                      108   2e-22    
ref|XP_010422507.1|  PREDICTED: LRR receptor-like serine/threonin...    108   2e-22    
tpg|DAA62772.1|  TPA: putative leucine-rich repeat receptor-like ...    111   2e-22    
emb|CDY26403.1|  BnaA02g23670D                                          111   2e-22    
ref|XP_004296066.1|  PREDICTED: receptor-like protein 12-like           111   2e-22    
ref|XP_004301322.1|  PREDICTED: probable leucine-rich repeat rece...    111   2e-22    
gb|KCW80921.1|  hypothetical protein EUGRSUZ_C02281                     111   2e-22    
ref|XP_010050145.1|  PREDICTED: putative receptor-like protein ki...    111   2e-22    
ref|XP_009368631.1|  PREDICTED: LRR receptor-like serine/threonin...    111   2e-22    
gb|KCW56526.1|  hypothetical protein EUGRSUZ_I02251                     110   3e-22    
gb|KEH21504.1|  LRR receptor-like kinase family protein                 110   3e-22    
ref|XP_011000669.1|  PREDICTED: putative leucine-rich repeat rece...    108   3e-22    
gb|KFK30252.1|  hypothetical protein AALP_AA7G237200                    111   3e-22    
ref|NP_001168291.1|  uncharacterized protein LOC100382055               110   3e-22    
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    110   3e-22    
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    110   3e-22    
ref|XP_003524132.2|  PREDICTED: LRR receptor-like serine/threonin...    111   3e-22    
ref|XP_001773336.1|  predicted protein                                  110   3e-22    
gb|KEH23681.1|  LRR receptor-like kinase                                108   4e-22    
ref|XP_003568840.1|  PREDICTED: LRR receptor-like serine/threonin...    110   4e-22    
ref|XP_010069577.1|  PREDICTED: probable LRR receptor-like serine...    110   4e-22    
ref|XP_004495431.1|  PREDICTED: probable leucine-rich repeat rece...    110   4e-22    
gb|KCW57968.1|  hypothetical protein EUGRSUZ_H00705                     110   4e-22    
ref|XP_007152413.1|  hypothetical protein PHAVU_004G128100g             110   4e-22    
ref|XP_002524773.1|  serine-threonine protein kinase, plant-type,...    107   4e-22    
ref|NP_001237639.1|  ERECTA-like kinase                                 110   4e-22    
ref|XP_003563067.1|  PREDICTED: LRR receptor-like serine/threonin...    110   5e-22    
gb|KCW46086.1|  hypothetical protein EUGRSUZ_K00002                     110   5e-22    
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...    110   5e-22    
ref|XP_009111154.1|  PREDICTED: LRR receptor-like serine/threonin...    107   5e-22    
ref|XP_010054700.1|  PREDICTED: putative receptor-like protein ki...    110   5e-22    
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...    110   5e-22    
ref|XP_006358722.1|  PREDICTED: LRR receptor-like serine/threonin...    110   5e-22    
ref|XP_004953285.1|  PREDICTED: leucine-rich repeat receptor-like...    108   5e-22    
ref|XP_006429796.1|  hypothetical protein CICLE_v10013859mg             108   5e-22    
gb|AES75836.2|  LRR receptor-like kinase                                109   6e-22    
ref|XP_008448931.1|  PREDICTED: probable LRR receptor-like serine...    110   6e-22    
ref|XP_009405373.1|  PREDICTED: LRR receptor-like serine/threonin...    110   6e-22    
ref|XP_007155446.1|  hypothetical protein PHAVU_003G202100g             110   6e-22    
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             110   6e-22    
ref|XP_009101649.1|  PREDICTED: LRR receptor-like serine/threonin...    110   6e-22    
ref|XP_006396528.1|  hypothetical protein EUTSA_v10028712mg             107   6e-22    
ref|XP_009762356.1|  PREDICTED: LRR receptor-like serine/threonin...    107   6e-22    
ref|XP_008358557.1|  PREDICTED: LRR receptor-like serine/threonin...    110   7e-22    
ref|XP_003619618.1|  Receptor-like protein kinase                       109   7e-22    
gb|KEH19363.1|  LRR receptor-like kinase family protein                 110   7e-22    
gb|KDP34811.1|  hypothetical protein JCGZ_11173                         110   7e-22    
gb|AAC78595.1|  Hcr2-5B                                                 109   7e-22    
dbj|BAJ92367.1|  predicted protein                                      110   7e-22    
ref|XP_010441796.1|  PREDICTED: putative receptor-like protein ki...    110   7e-22    
gb|KHG23182.1|  hypothetical protein F383_03005                         110   7e-22    
emb|CDX73169.1|  BnaC06g36170D                                          109   7e-22    
gb|EMT15790.1|  Putative LRR receptor-like serine/threonine-prote...    110   7e-22    
ref|XP_010437368.1|  PREDICTED: probable LRR receptor-like serine...    110   8e-22    
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...    109   8e-22    
gb|EPS63845.1|  hypothetical protein M569_10937                         107   8e-22    
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...    109   8e-22    
ref|XP_009590461.1|  PREDICTED: leucine-rich repeat receptor-like...    107   8e-22    
gb|KHN47566.1|  Leucine-rich repeat receptor-like serine/threonin...    109   8e-22    
gb|KDP46931.1|  hypothetical protein JCGZ_08919                         109   8e-22    
ref|XP_008645155.1|  PREDICTED: leucine-rich repeat receptor-like...    109   8e-22    
ref|XP_006428844.1|  hypothetical protein CICLE_v10011222mg             109   9e-22    
ref|XP_007141638.1|  hypothetical protein PHAVU_008G212900g             109   9e-22    
ref|XP_006353439.1|  PREDICTED: probably inactive leucine-rich re...    109   9e-22    
emb|CAN73988.1|  hypothetical protein VITISV_022117                     109   9e-22    
gb|KHN07496.1|  Putative leucine-rich repeat receptor-like protei...    109   9e-22    
gb|KDP46934.1|  hypothetical protein JCGZ_08922                         109   9e-22    
ref|XP_008347354.1|  PREDICTED: probable LRR receptor-like serine...    109   9e-22    
pdb|4MNA|A  Chain A, Crystal Structure Of The Free Fls2 Ectodomains     108   9e-22    
ref|XP_008359405.1|  PREDICTED: probably inactive leucine-rich re...    107   1e-21    
gb|KFK42697.1|  hypothetical protein AALP_AA1G028200                    106   1e-21    
gb|EMS61225.1|  LRR receptor-like serine/threonine-protein kinase...    109   1e-21    
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             109   1e-21    
ref|XP_006428843.1|  hypothetical protein CICLE_v10011222mg             108   1e-21    
ref|XP_006358444.1|  PREDICTED: LRR receptor-like serine/threonin...    106   1e-21    
gb|AER60531.1|  flagellin-sensing 2-like protein                        109   1e-21    
ref|XP_003596118.1|  Receptor protein kinase-like protein               109   1e-21    
ref|XP_010245658.1|  PREDICTED: probable leucine-rich repeat rece...    109   1e-21    
gb|EEC80879.1|  hypothetical protein OsI_23515                          108   1e-21    
ref|XP_002976268.1|  hypothetical protein SELMODRAFT_104958             106   1e-21    
emb|CDX88024.1|  BnaA06g26150D                                          108   1e-21    
gb|AER60532.1|  flagellin-sensing 2-like protein                        109   1e-21    
ref|XP_006290096.1|  hypothetical protein CARUB_v10003741mg             106   1e-21    
ref|XP_008351826.1|  PREDICTED: LRR receptor-like serine/threonin...    106   1e-21    
ref|XP_010279332.1|  PREDICTED: probably inactive leucine-rich re...    106   1e-21    
ref|XP_010277767.1|  PREDICTED: putative receptor-like protein ki...    108   1e-21    
gb|EMT01712.1|  Putative LRR receptor-like serine/threonine-prote...    109   1e-21    
gb|KHN20484.1|  LRR receptor-like serine/threonine-protein kinase...    106   1e-21    
ref|XP_006365571.1|  PREDICTED: LRR receptor-like serine/threonin...    109   1e-21    
ref|XP_010245927.1|  PREDICTED: probable LRR receptor-like serine...    107   1e-21    
ref|XP_010474965.1|  PREDICTED: probable leucine-rich repeat rece...    106   1e-21    
gb|KDP46936.1|  hypothetical protein JCGZ_08924                         108   1e-21    
ref|XP_002982726.1|  hypothetical protein SELMODRAFT_116600             106   1e-21    
gb|AES60036.2|  LRR receptor-like kinase family protein                 108   1e-21    
ref|XP_006293587.1|  hypothetical protein CARUB_v10022534mg             108   1e-21    
ref|WP_039118713.1|  hypothetical protein                               105   1e-21    
ref|XP_010040263.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-21    
emb|CBI29785.3|  unnamed protein product                                108   2e-21    
ref|XP_010099563.1|  LRR receptor-like serine/threonine-protein k...    107   2e-21    
gb|EMT18362.1|  Putative LRR receptor-like serine/threonine-prote...    108   2e-21    
emb|CDY22094.1|  BnaA09g01230D                                          106   2e-21    
ref|XP_002267737.3|  PREDICTED: probably inactive leucine-rich re...    108   2e-21    
ref|XP_009150872.1|  PREDICTED: LRR receptor-like serine/threonin...    108   2e-21    
gb|KCW63531.1|  hypothetical protein EUGRSUZ_G01166                     108   2e-21    
ref|XP_004140933.1|  PREDICTED: LRR receptor-like serine/threonin...    108   2e-21    
emb|CDP08216.1|  unnamed protein product                                108   2e-21    
gb|EPS73732.1|  hypothetical protein M569_01020                         105   2e-21    
gb|KEH41270.1|  LRR receptor-like kinase family protein                 108   2e-21    
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             108   2e-21    
ref|XP_006395138.1|  hypothetical protein EUTSA_v10003549mg             108   2e-21    
ref|XP_004148876.1|  PREDICTED: receptor-like protein 12-like           105   2e-21    
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-21    
ref|XP_010432193.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-21    
ref|XP_004159444.1|  PREDICTED: LRR receptor-like serine/threonin...    108   2e-21    
ref|XP_003589785.1|  Receptor-like protein kinase                       108   2e-21    
ref|XP_010445856.1|  PREDICTED: LRR receptor-like serine/threonin...    108   2e-21    
ref|XP_006651034.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-21    
ref|XP_002985557.1|  hypothetical protein SELMODRAFT_122495             108   2e-21    
ref|XP_008241799.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-21    
ref|XP_009416959.1|  PREDICTED: receptor-like protein kinase HSL1       108   2e-21    
ref|XP_002281133.1|  PREDICTED: probably inactive leucine-rich re...    108   2e-21    
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-21    
gb|EPS69497.1|  hypothetical protein M569_05269                         105   2e-21    
gb|EEE65944.1|  hypothetical protein OsJ_21821                          108   2e-21    
ref|XP_006279730.1|  hypothetical protein CARUB_v10027518mg             108   2e-21    
ref|XP_006305009.1|  hypothetical protein CARUB_v10009374mg             105   2e-21    
ref|XP_001771841.1|  predicted protein                                  108   2e-21    
ref|XP_010446816.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-21    
ref|XP_011000226.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-21    
ref|XP_003612526.1|  Kinase-like protein                                108   2e-21    
gb|KDP21530.1|  hypothetical protein JCGZ_22001                         105   3e-21    
ref|XP_002981260.1|  hypothetical protein SELMODRAFT_233681             105   3e-21    
gb|KHG04654.1|  LRR receptor-like serine/threonine-protein kinase...    107   3e-21    
ref|XP_006480349.1|  PREDICTED: probable LRR receptor-like serine...    108   3e-21    
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    108   3e-21    
gb|KDO48084.1|  hypothetical protein CISIN_1g0097712mg                  105   3e-21    
ref|XP_007204673.1|  hypothetical protein PRUPE_ppa000484mg             108   3e-21    
gb|KCW77196.1|  hypothetical protein EUGRSUZ_D01545                     108   3e-21    
ref|XP_006492908.1|  PREDICTED: leucine-rich repeat receptor-like...    105   3e-21    
ref|XP_009417091.1|  PREDICTED: probable inactive leucine-rich re...    107   3e-21    
ref|XP_006476025.1|  PREDICTED: probably inactive leucine-rich re...    108   3e-21    
gb|KDP40470.1|  hypothetical protein JCGZ_24469                         107   3e-21    
ref|XP_004158927.1|  PREDICTED: LOW QUALITY PROTEIN: protein BRAS...    105   3e-21    
gb|AES95484.2|  LRR receptor-like kinase family protein                 108   3e-21    
ref|XP_006602887.1|  PREDICTED: probable LRR receptor-like serine...    107   3e-21    
ref|XP_002984565.1|  hypothetical protein SELMODRAFT_234577             107   3e-21    
ref|XP_010320167.1|  PREDICTED: probable LRR receptor-like serine...    108   3e-21    
ref|XP_009123618.1|  PREDICTED: putative receptor-like protein ki...    108   3e-21    
gb|KEH15855.1|  LRR receptor-like kinase family protein                 107   3e-21    



>emb|CDP18022.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   406 bits (1044),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 230/387 (59%), Positives = 289/387 (75%), Gaps = 2/387 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             PC   + TL+SD+QVLR+ ++++DPN+V   SFLS+WN D DPCE++G HFLG+LC TP 
Sbjct  26    PCLAVSLTLQSDIQVLRNIREAVDPNTVSSTSFLSTWNFDTDPCESSGPHFLGVLCTTPE  85

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             DNSS RI+VI+LEGDGL+ FLTP IGNLTELTTLNL  N FRGPIP++I  LRKIT+LLL
Sbjct  86    DNSSSRIAVINLEGDGLDCFLTPTIGNLTELTTLNLRNNNFRGPIPNTIAKLRKITKLLL  145

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             S+NFFSGGLP  +  +++LE  D+S NRLSG+IP  I+ALR L  L LS N+ +GK+PD 
Sbjct  146   SQNFFSGGLPEGLSEMKRLEHFDLSQNRLSGTIPPKISALRSLLHLQLSGNQFSGKLPDF  205

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             SGLWQL TL LSSN F+  LP FP  LRTLLL HN+++G++S+I RL +L  LDLSDNR 
Sbjct  206   SGLWQLTTLDLSSNLFYGTLPQFPTSLRTLLLSHNMISGNVSSIGRLPHLKTLDLSDNRL  265

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I   I+T P++  INVSAN F+ IEV   + + S+LQ+LDAH N L+GHLPL++ITY
Sbjct  266   SGKIEPDILTSPKVSSINVSANLFSDIEVVFMN-QPSQLQLLDAHGNHLRGHLPLHLITY  324

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NL+ + LGHN F G IPKEYG      W+ L LEYN+L+GTLP EFM   E+ R SL H
Sbjct  325   QNLRAIYLGHNLFSGWIPKEYG-AKLYSWKTLFLEYNFLQGTLPQEFMNNLERIRGSLAH  383

Query  387   NCLNCPDHLPWCLGGQRPASQCRRSAG  307
             NCL CP ++ +C GGQR  S+C    G
Sbjct  384   NCLRCPKNVSFCHGGQRAPSECTGQKG  410



>gb|AHA51696.1| leucine-rich repeat protein [Petunia x hybrida]
Length=416

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 245/392 (63%), Positives = 294/392 (75%), Gaps = 3/392 (1%)
 Frame = -3

Query  1470  NPCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTP  1291
             NP F+NAKTL SD+QVL + K+SIDP S+   SFLSSWN +LDPCE TGT FLGILC  P
Sbjct  23    NPNFVNAKTLPSDIQVLEAIKNSIDPVSISSDSFLSSWNFNLDPCETTGTSFLGILCTIP  82

Query  1290  SD-NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
              D NS+ RI  IDLEGD LEGFL P IG LTEL +LNL RNKFRGP+P +I NLRK+TRL
Sbjct  83    LDTNSTSRIMEIDLEGDELEGFLNPAIGKLTELVSLNLGRNKFRGPVPAAITNLRKLTRL  142

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              L ENFFSG L   +  LRKLEV+DVS+NRLSGSIP++IT+LR LT+LDLSNNE TGKIP
Sbjct  143   QLYENFFSGSLFNGIGVLRKLEVLDVSNNRLSGSIPSSITSLRSLTQLDLSNNEFTGKIP  202

Query  933   DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDN  754
              L+GLWQL +  +S+NQ +  LP FP+++RTLLL HNLL+GHIS +++LR L+ LDLSDN
Sbjct  203   QLNGLWQLTSFDVSNNQIYGSLPQFPLKIRTLLLSHNLLSGHISPVNKLRRLSILDLSDN  262

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
             RFSG I + +  LP++ ++NVS N FT +EV + + K + L  LD H N L+GHLPLN+I
Sbjct  263   RFSGAINNGLFMLPDISQVNVSVNRFTALEVVEFTDKGTELHSLDVHGNRLRGHLPLNLI  322

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASL  394
             TY NL  +NLGHN F G+IP EY  RL + WRN NLEYNYLEGT+P E     E  R S 
Sbjct  323   TYPNLTEINLGHNLFSGQIPSEYWPRLGTSWRNFNLEYNYLEGTVPRELNRTLEGVRGSF  382

Query  393   DHNCLNCPDHLPWCLGGQRPASQC--RRSAGG  304
              HNCL CP+ L  C GGQRPAS+C  RR  GG
Sbjct  383   AHNCLTCPNGLQLCHGGQRPASECVGRRKGGG  414



>ref|XP_009601505.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=420

 Score =   397 bits (1019),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 233/387 (60%), Positives = 282/387 (73%), Gaps = 1/387 (0%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDN  1282
             F+NAKTL SD+Q L++ K SIDP S+   SFL SW+  LDPCE TG  FLGILC  P DN
Sbjct  30    FVNAKTLPSDIQALQAIKMSIDPVSISSESFLRSWDFALDPCETTGASFLGILCTIPLDN  89

Query  1281  -SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
              S+ RI  IDLEGD LEGFLTP IGNLTEL  LNL +NKFRGP+P++I NLRK+T L L 
Sbjct  90    NSTSRIMEIDLEGDELEGFLTPAIGNLTELVALNLGKNKFRGPVPETITNLRKLTSLQLY  149

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
             ENFFSG L   +  LRKLEV+DVS+NRLSGSIP +IT+LR LT+LDLSNNE TGKIP L+
Sbjct  150   ENFFSGSLINGIGFLRKLEVLDVSNNRLSGSIPISITSLRSLTQLDLSNNEFTGKIPQLN  209

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
             GLWQL++  LS+NQ +  LP FP++++TL LGHNLL+GHIS +++LR L  LDLSDNRFS
Sbjct  210   GLWQLSSFDLSNNQIYGNLPQFPLKIKTLSLGHNLLSGHISPVNKLRRLRILDLSDNRFS  269

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G I   +  LP++   N S N FT +EV + + K ++L  LD H N L+GHLP+N++TY 
Sbjct  270   GAINKEVFMLPDISHANASVNRFTVLEVVEFTDKATQLHTLDVHGNRLRGHLPVNLVTYP  329

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHN  385
             NL  +NLGHN F G+IP EY  RL   WR+L+LEYNYLEG +P E     E  R S  HN
Sbjct  330   NLTEINLGHNLFSGQIPSEYWPRLGFAWRSLDLEYNYLEGPVPRELNRTLEGVRGSFAHN  389

Query  384   CLNCPDHLPWCLGGQRPASQCRRSAGG  304
             CL CP  L  C GGQRPAS+C R  GG
Sbjct  390   CLTCPKGLQLCHGGQRPASECVRRKGG  416



>emb|CDP18018.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   395 bits (1014),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 230/387 (59%), Positives = 290/387 (75%), Gaps = 2/387 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             PC + + TL+SD+QVLR+ ++++DPN++   SFLS+WN D DPCE++G HFLG+LC TP 
Sbjct  26    PCLVVSLTLQSDIQVLRNIREAVDPNTISSTSFLSTWNFDTDPCESSGPHFLGVLCTTPE  85

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             DNSS RI+VI+LEGDGL+GFLTP IGNLTELTTLNL  N FRGPIP++I  LRKIT+LLL
Sbjct  86    DNSSSRIAVINLEGDGLDGFLTPTIGNLTELTTLNLRNNNFRGPIPNTIAKLRKITKLLL  145

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             S+NFFSGGLP  +  + +LE  D+S NRLSG+IP  I+ALR L  L LS N+ +GK+PD 
Sbjct  146   SQNFFSGGLPEGLSEMTRLEHFDLSQNRLSGTIPPKISALRSLLHLRLSGNQFSGKLPDF  205

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             SGLWQL TL LSSN F+  LP FP  LRTLLL HN+++G++S+I RL +L  LDLSDNR 
Sbjct  206   SGLWQLTTLDLSSNLFYGTLPHFPTSLRTLLLSHNMISGNVSSIGRLPHLKTLDLSDNRL  265

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I   I+T P++  INVSAN FT IEV   + + S+LQ+LDAH N L+GHLPL++IT+
Sbjct  266   SGKIEPDILTSPKVSSINVSANLFTDIEVVFMN-QPSQLQLLDAHGNHLRGHLPLHLITF  324

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NL+ + LGHN F G IPKEYG      W+ L LEYN+L+GTLP EFM   E+ R SL H
Sbjct  325   QNLRAIYLGHNLFSGWIPKEYG-AKLYSWKTLFLEYNFLQGTLPQEFMNNLERIRGSLAH  383

Query  387   NCLNCPDHLPWCLGGQRPASQCRRSAG  307
             NCL CP ++ +C GGQR  S+C    G
Sbjct  384   NCLRCPKNVSFCHGGQRAPSECTGQKG  410



>ref|XP_009797681.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana sylvestris]
Length=420

 Score =   387 bits (995),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 234/387 (60%), Positives = 285/387 (74%), Gaps = 1/387 (0%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDN  1282
             F+N KTL SD+Q L++ K SIDP S+   SF+SSW+  LDPCE TGT FLGILC  P DN
Sbjct  30    FVNGKTLTSDIQALQAIKMSIDPISISSESFISSWDFALDPCETTGTSFLGILCTVPLDN  89

Query  1281  -SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
              S+ RI  IDLEGD LEGFLTP IGNLTEL  LNL RNKFRGP+P++I NLRK+T L L 
Sbjct  90    NSTSRIMEIDLEGDELEGFLTPAIGNLTELVALNLGRNKFRGPVPETITNLRKLTSLQLY  149

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
             ENFFSG L   +  LRKLEV+D+S+NRLSGSIP++IT+LR LT+LDLSNNELTGKIP L+
Sbjct  150   ENFFSGSLVNGIGFLRKLEVLDLSNNRLSGSIPSSITSLRSLTQLDLSNNELTGKIPQLN  209

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
             GLWQLN+  LS+NQ +   P FP++++TL LGHNLL+GHIS +++L  L  LDLSDNRFS
Sbjct  210   GLWQLNSFDLSNNQIYGNFPEFPLKIKTLSLGHNLLSGHISPVNKLHRLRILDLSDNRFS  269

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G I   +  LP++  +NVS N FT +EV + + K ++L  LD H+N L+GHLP+N+ITY 
Sbjct  270   GAINKGVFMLPDISHVNVSVNRFTVLEVVEFTDKATQLHTLDVHANRLRGHLPVNLITYP  329

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHN  385
             NL  +NLGHN F G+IP EY  RL   WR+L+LEYNYLEGT+P E     E  R S   N
Sbjct  330   NLTEINLGHNLFSGQIPLEYWPRLGFAWRSLDLEYNYLEGTVPRELNRTLEGVRGSFARN  389

Query  384   CLNCPDHLPWCLGGQRPASQCRRSAGG  304
             CL CP  L  C GGQRPAS+C    GG
Sbjct  390   CLTCPKGLQLCQGGQRPASECVGKKGG  416



>ref|XP_006345540.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Solanum tuberosum]
Length=411

 Score =   385 bits (988),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 230/384 (60%), Positives = 281/384 (73%), Gaps = 4/384 (1%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSD-  1285
             ++NA T +SD+QVL + K SIDP S+ P SFLSSW+ +LDPCE TG  FLGILC  P   
Sbjct  24    YVNATTSQSDIQVLVAIKTSIDPFSITPDSFLSSWDFNLDPCETTGASFLGILCTVPDQV  83

Query  1284  --NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLL  1111
               N++ RI  IDLEGDGLEGFLT  IGNLTEL TLNL RNKFRGP+P+SI NLRK+T L 
Sbjct  84    DTNATSRIMEIDLEGDGLEGFLTSSIGNLTELVTLNLGRNKFRGPVPESITNLRKLTSLQ  143

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD  931
             L ENFFSG L   +  L KLE +DVS+NRLSGSIP++IT+LR LTRLDLSNNE TGK P 
Sbjct  144   LYENFFSGSLVDDIGVLTKLETLDVSNNRLSGSIPSSITSLRSLTRLDLSNNEFTGKFPQ  203

Query  930   LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
             L+GLWQL++  +S+NQ +  LP FP++++TL L HNLL+GHI+ + +LR+L+ LDLSDNR
Sbjct  204   LNGLWQLSSFDISNNQIYGNLPQFPLKIKTLSLSHNLLSGHITPVHKLRHLSTLDLSDNR  263

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             FSG I   I  LPEL  +NVS N FT  EV + S K+S+L  LD H+N L GHLP+N++T
Sbjct  264   FSGGINKGIFMLPELSHVNVSVNRFTVFEVVEFSDKKSQLHTLDVHANRLHGHLPVNLVT  323

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
             Y NL  +NLGHN F G+IP EY SRL   WR+LNLEYN LEG++P E     E  + S +
Sbjct  324   YPNLTEINLGHNLFSGEIPSEYWSRLGFSWRSLNLEYNNLEGSVPRELNRTLEGVQGSFE  383

Query  390   HNCLNCPDHLPWCLGGQRPASQCR  319
             HNCL CP  L  C  GQR AS+C 
Sbjct  384   HNCLICPKGLQLC-HGQRTASECH  406



>ref|XP_011073891.1| PREDICTED: phytosulfokine receptor 2 [Sesamum indicum]
Length=411

 Score =   383 bits (983),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 221/387 (57%), Positives = 287/387 (74%), Gaps = 3/387 (1%)
 Frame = -3

Query  1470  NPCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTP  1291
             NP  +++KTLESD++VLRS + SI+P+++  +SFL SW+ ++DPC+A GTHFLGILC  P
Sbjct  25    NPILVDSKTLESDIEVLRSIRQSINPHTIPSSSFLHSWSFNIDPCDAPGTHFLGILCNIP  84

Query  1290  SDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLL  1111
              +NSS RI+ I+LE DGLEGFL P +GNLTELT LNL +NKF G IPDSI+ + K+TRLL
Sbjct  85    DNNSSSRITAINLEEDGLEGFLPPSLGNLTELTLLNLRKNKFHGKIPDSIVRMTKMTRLL  144

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD  931
             LSEN  SGG+P   R L++LEVID+SHNRLSGSIPA I+ +R L  L LS N+ +G+IPD
Sbjct  145   LSENSLSGGIPHGFRGLKRLEVIDLSHNRLSGSIPAAISNIRSLIHLRLSYNKFSGRIPD  204

Query  930   LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
             L+GLWQLNT+ LSSNQ F  LP  P  L +LLLG NLL+GHIS ++ LR+L  LDL+ NR
Sbjct  205   LTGLWQLNTMDLSSNQLFGNLPEVPNNLVSLLLGGNLLSGHISTLNGLRHLRLLDLTHNR  264

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             FSGPI   I+ LPE+  IN+SAN FTRI+V + S + S+L  ++A +N ++G LP+N+IT
Sbjct  265   FSGPINQAILALPEIRNINISANRFTRIDVMRMSNRPSQLHAIEAQNNQIRGRLPINLIT  324

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslw-rnlnLEYNYLEGTLPSEFMTGGEKARASL  394
             Y NL  VNLGHN F GKIP EYG R+   + R+L L+YN L+G +P+ F+    K   SL
Sbjct  325   YQNLSHVNLGHNLFHGKIPVEYGDRVSKGYWRSLFLDYNMLQGNVPAGFIHSSIK--GSL  382

Query  393   DHNCLNCPDHLPWCLGGQRPASQCRRS  313
              HNCLNC   +P C G QR  ++C R+
Sbjct  383   AHNCLNCRRSIPICPGRQRSPAECVRA  409



>ref|XP_004240268.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Solanum lycopersicum]
Length=411

 Score =   374 bits (959),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 225/384 (59%), Positives = 277/384 (72%), Gaps = 4/384 (1%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSD-  1285
             F+NA T +SD+QVL + K  IDP S+   SFL+SW+ ++DPCE TG  FLGILC  P   
Sbjct  24    FVNATTSQSDIQVLVAIKTLIDPFSITADSFLNSWDFNVDPCETTGASFLGILCTVPDQV  83

Query  1284  --NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLL  1111
               N++ RI  IDLEGDGLEGFLT  IGNLTEL TLNL RNKFRGP+P+SI NLRK+T L 
Sbjct  84    DTNATSRIMEIDLEGDGLEGFLTSSIGNLTELVTLNLGRNKFRGPVPESITNLRKLTSLQ  143

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD  931
             L ENFFSG L   +  L KLE +DVS+NRLSGSIP++I +LR LTRLDLSNNE TGKIP 
Sbjct  144   LYENFFSGSLVDDIGVLSKLENLDVSNNRLSGSIPSSIMSLRSLTRLDLSNNEFTGKIPQ  203

Query  930   LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
             L+GLWQL++  +S+NQ +  LP FP++++T+ L HNLL+GHI+ + +LR+L  LDLSDNR
Sbjct  204   LNGLWQLSSFDISNNQIYGNLPQFPLKIKTISLSHNLLSGHITPVHKLRHLNTLDLSDNR  263

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             FSG I   I  L EL  +NVS N FT  EV + S K+S+L  LD H+N L GHLP+N++T
Sbjct  264   FSGGINKGIFRLTELSHVNVSVNRFTVFEVVEFSDKKSQLHTLDVHANRLHGHLPVNLVT  323

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
             Y NL  +NLGHN F G+IP EY SRLR  WR+LNLEYN LEG++P E     E  + +  
Sbjct  324   YPNLTEINLGHNLFSGEIPSEYWSRLRFSWRSLNLEYNNLEGSVPRELNRTSEGVQGNFG  383

Query  390   HNCLNCPDHLPWCLGGQRPASQCR  319
             HNCL CP  L  C  GQR AS+C 
Sbjct  384   HNCLICPKGLQLC-NGQRTASECH  406



>ref|XP_004309839.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790-like [Fragaria vesca subsp. vesca]
Length=406

 Score =   363 bits (933),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 209/382 (55%), Positives = 266/382 (70%), Gaps = 2/382 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P F ++ TLESD+QVLR  K SIDPN++ P S+LSSW+  LDPCE TG  FLGILC  P 
Sbjct  19    PLFTSSLTLESDIQVLRVVKRSIDPNAIPPNSYLSSWDFKLDPCETTGGQFLGILCSFPL  78

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             D S  RI+ IDL+G G +GFLT  +GNLTELT +NL +N FRGPIP SI NL+K+TRL L
Sbjct  79    DKSPSRITAIDLDGAGYQGFLTSAVGNLTELTFINLRKNNFRGPIPRSISNLKKLTRLSL  138

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             S NFF+G +P  +  L+KLE +D+S N LSG+I  +I  LR LT L LSNN  TG++PDL
Sbjct  139   SNNFFTGTIPLGLNTLKKLESLDISFNELSGTIHPSIGGLRGLTFLSLSNNGFTGRVPDL  198

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             SGLWQL TL LS NQ    LP FPV LRTL+L  NL  GH++ +++L  L  LD+S NR 
Sbjct  199   SGLWQLKTLDLSRNQLHGNLPNFPVSLRTLILSQNLFLGHLTPLNKLSNLRVLDVSGNRL  258

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I     TLP++ ++N+S NHFTR+EV +S  +E  LQVLDA  N L+GHLP+N++T 
Sbjct  259   SGAITREFFTLPKVTQLNLSYNHFTRLEVVRSFGQE-ELQVLDAKGNQLRGHLPVNLVTL  317

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NL T+NL +N+FFGKIP  Y       W  L L++N+L G LP++F    ++ R SL  
Sbjct  318   QNLTTINLSYNQFFGKIPDAYA-SRVGDWSELYLDHNFLLGKLPAQFAQAAQRIRGSLSF  376

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL CPD++P C GGQR   +C
Sbjct  377   NCLRCPDNVPLCEGGQRKVEEC  398



>ref|XP_006443000.1| hypothetical protein CICLE_v10020393mg [Citrus clementina]
 ref|XP_006478774.1| PREDICTED: phytosulfokine receptor 2-like [Citrus sinensis]
 gb|ESR56240.1| hypothetical protein CICLE_v10020393mg [Citrus clementina]
Length=409

 Score =   358 bits (918),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 209/382 (55%), Positives = 277/382 (73%), Gaps = 1/382 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  +++ TL +D+QVLR  K SIDPN++  +SFL SW+  LDPCE++G HFLGILC  PS
Sbjct  22    PTIVHSATLATDIQVLRLLKRSIDPNTIPRSSFLDSWDFKLDPCESSGGHFLGILCSIPS  81

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             DNS+ RI+ I L+  G +GFLTP IGNLTELTTL+L+RN FRGPIPD+I  LRK+T L L
Sbjct  82    DNSTSRITAIYLDSSGYDGFLTPSIGNLTELTTLDLSRNNFRGPIPDTITGLRKLTTLSL  141

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
               NFF+G +P  + RL+KL+ +D+SHN LSG IPA ++ LR LT L LS+N  +GKIP L
Sbjct  142   PGNFFTGNIPVGITRLKKLQTLDLSHNSLSGIIPAQLSGLRSLTALRLSHNAFSGKIPSL  201

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +G WQL+TL L SNQ +  LP FP  LRTL L HNLL+GH+S++  L  L +LDLS NRF
Sbjct  202   TGAWQLHTLDLDSNQLYGNLPKFPTSLRTLSLSHNLLSGHLSSLRNLVNLKSLDLSSNRF  261

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             +G I H ++TLP+++ I+VS N  T IE+T  S  ++ LQ LD   NLL+GHLP+N+++ 
Sbjct  262   TGAISHEVLTLPQVVSIDVSVNRLTAIEMTTLS-GDTHLQELDVQGNLLRGHLPINLVSL  320

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NL ++NL  N+  G IPK YG++L S WR+L L++N+L G LP EF +   + R SL  
Sbjct  321   RNLTSINLARNQLSGHIPKVYGAKLGSSWRSLFLDHNFLWGNLPPEFSSSITRIRGSLAK  380

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL+CP+ +  C GGQRPAS+C
Sbjct  381   NCLSCPETIRLCHGGQRPASEC  402



>gb|KDO46275.1| hypothetical protein CISIN_1g038636mg [Citrus sinensis]
Length=409

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 208/382 (54%), Positives = 276/382 (72%), Gaps = 1/382 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  +++ TL +D QVLR  K SIDPN++  +SFL SW+  LDPCE++G  FLGILC  PS
Sbjct  22    PTIVHSATLATDTQVLRLLKRSIDPNTIPRSSFLDSWDFKLDPCESSGGQFLGILCSIPS  81

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             DNS+ RI+ I L+  G +GFLTP IGNLTELTTL+L+RN FRGPIPD+I +LRK+T L L
Sbjct  82    DNSTSRITAIYLDSSGYDGFLTPSIGNLTELTTLDLSRNNFRGPIPDTITDLRKLTTLYL  141

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
               NFF+G +P  + RL+KL+ +D+SHN LSG IPA ++ LR LT L LS+N  +GKIP L
Sbjct  142   PGNFFTGNIPVGITRLKKLQTLDLSHNSLSGIIPAQLSGLRSLTALRLSHNAFSGKIPSL  201

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +G WQL+TL L SNQ +  LP FP  LRTL L HNLL+GH+S++  L  L +LDLS NRF
Sbjct  202   TGAWQLHTLDLDSNQLYGNLPKFPTSLRTLSLSHNLLSGHLSSLRNLVNLKSLDLSSNRF  261

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             +G I H ++TLP+++ I+VS N  T IE+T  S  ++ LQ LD   NLL+GHLP+N+++ 
Sbjct  262   TGAISHEVLTLPQVVSIDVSVNRLTAIEMTTLS-GDTHLQELDVQGNLLRGHLPINLVSL  320

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NL ++NL  N+  G IPK YG++L S WR+L L++N+L G LP EF +   + R SL  
Sbjct  321   RNLTSINLARNQLSGHIPKVYGAKLGSSWRSLFLDHNFLWGNLPPEFSSSITRIRGSLAK  380

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL+CP+ +  C GGQRPAS+C
Sbjct  381   NCLSCPETIRLCHGGQRPASEC  402



>ref|XP_010554423.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=420

 Score =   352 bits (904),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 197/375 (53%), Positives = 265/375 (71%), Gaps = 1/375 (0%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             TL+SD+QVL S   SIDP+S+ PAS+LS+W+   DPC+A GT FLGI+C  PSDN++ RI
Sbjct  38    TLQSDIQVLESILRSIDPSSISPASYLSTWDFSEDPCDAVGT-FLGIMCSFPSDNTTSRI  96

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             + I+L+  G +GFL+   GNLTELT L+LN+N+FRGPIP+S+ +L K+ RL L+EN+F+G
Sbjct  97    TEIELDDIGYDGFLSASTGNLTELTVLSLNKNRFRGPIPESVFHLTKLVRLSLAENYFTG  156

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLN  907
              +P  +  L+ L +ID+S N L+G+IP  I ALR LT L LS+N LTG+IP L+GLW+L 
Sbjct  157   DIPERITHLKDLTIIDLSKNSLTGAIPVRIPALRSLTTLSLSSNHLTGRIPPLNGLWKLQ  216

Query  906   TLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHR  727
              L L SN  +  LP  P  L+ L +  N L G IS++ RL+ LT++D+SDNRFS  I H 
Sbjct  217   VLDLGSNHLYGTLPQLPTSLKILSVCRNALEGRISSLHRLKQLTSIDVSDNRFSNTIGHE  276

Query  726   IVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVN  547
             I+T PE+  +NVS N FT +EV K + +ESRL++LDA  N LQGHLP+N+ TY NLK VN
Sbjct  277   ILTFPEITHVNVSYNMFTTLEVFKFTGRESRLRILDAEGNHLQGHLPVNLATYENLKEVN  336

Query  546   LGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCPD  367
             L HN F G IPK YG +L + WR+L L+ NYL G +P +F       + SL +NCL CP 
Sbjct  337   LRHNMFSGDIPKVYGKKLENSWRSLYLDNNYLTGDIPEQFHKISRVMKGSLSNNCLECPK  396

Query  366   HLPWCLGGQRPASQC  322
             ++  C GGQ+P +QC
Sbjct  397   NVTVCQGGQKPKAQC  411



>ref|XP_003597526.1| Receptor kinase [Medicago truncatula]
 gb|AES67777.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=412

 Score =   345 bits (885),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 269/379 (71%), Gaps = 0/379 (0%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNS  1279
             +++ T E+D+  L+     IDPNS+ P+S+++SW+  +DPC +TG+ FLGILC  P DNS
Sbjct  28    IHSLTHENDIHSLQEIVHGIDPNSISPSSYINSWDFTVDPCHSTGSQFLGILCDLPLDNS  87

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ IDL+G G EGFLTP IGNLTELT LNLN NKFRGPIP++I NLRK+TRL  S+N
Sbjct  88    SSRVTAIDLDGIGYEGFLTPVIGNLTELTILNLNNNKFRGPIPETIGNLRKLTRLTFSDN  147

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
             FF+GG+P+ +  L++LE +D+S NRLSG+IP+ +T LR LT L LSNN  +G++ +L+GL
Sbjct  148   FFTGGIPQEIIELKRLEYLDLSANRLSGTIPSNMTGLRSLTYLSLSNNNFSGRVQNLTGL  207

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
             W LNTL +S NQFF  LP  PV LR + L HN+ +G I+ +  L ++  LD+SDNR SG 
Sbjct  208   WNLNTLDISYNQFFGNLPNLPVSLRNIYLSHNIFSGDITPLKDLIHVRWLDISDNRLSGV  267

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
             I   I++L  +  +NVS N FT I V     +  RL++L+A +N L+GHLP+N++T+ NL
Sbjct  268   IRRDILSLRFVSHLNVSYNRFTSINVVNGQGQGQRLRLLEAQANNLKGHLPVNLVTFTNL  327

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
               +NL +N+  G IPKEYG +LR+ WR L L++N+L G LP E        + S  +NCL
Sbjct  328   TIINLSNNQLHGPIPKEYGLKLRTTWRRLYLDHNFLTGNLPLELTHKSTNFKGSFANNCL  387

Query  378   NCPDHLPWCLGGQRPASQC  322
             NCP ++  C GGQRPA++C
Sbjct  388   NCPTNVGVCRGGQRPATEC  406



>ref|XP_004486909.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Cicer arietinum]
Length=414

 Score =   342 bits (877),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 193/382 (51%), Positives = 273/382 (71%), Gaps = 0/382 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  +++ T E D+  LR  K +IDPNS+ P+S+++SW+  +DPCE TG+ FLGILC  P 
Sbjct  27    PSQIHSSTFEGDILSLREIKHAIDPNSIPPSSYINSWDFRVDPCEGTGSQFLGILCDLPL  86

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             DNSS R++ IDL+G G EGFLT  IGNLTELT LNLN NKFRGPIP++I  LRK+TRL +
Sbjct  87    DNSSSRVTAIDLDGIGYEGFLTSYIGNLTELTVLNLNNNKFRGPIPETIGKLRKLTRLTI  146

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             SENFF+G +P+ + +L+KL+ +D+S NRLSG+IP  ++ LR LT L +SNN  +G+I +L
Sbjct  147   SENFFTGFIPQGITQLKKLQYLDLSSNRLSGTIPNDMSGLRSLTYLSISNNNFSGRIQNL  206

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLWQLNTL +S NQF+  LP  P+ LR L   HN+L+GHI+ +  L +L  +D+SDN+F
Sbjct  207   TGLWQLNTLDISFNQFYGNLPNLPMSLRNLHFSHNILSGHITPLKDLIHLKWIDISDNKF  266

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I   +++L  ++ +NVS N F  ++V   S +  +L++L+A  N L+G LP+N++++
Sbjct  267   SGVIRRDVLSLKNVVHLNVSFNRFATLDVVDYSGQGQQLKLLEAQGNHLKGRLPVNLVSF  326

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NL  +NL +N F G IPKEYG +LR+ WR L L++N+L G LP EF       R S+ +
Sbjct  327   TNLTILNLSNNEFHGIIPKEYGMKLRTTWRRLYLDHNFLMGNLPLEFSHIATNVRGSVAN  386

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL CP ++  C GGQRPA++C
Sbjct  387   NCLKCPTNVVMCHGGQRPATEC  408



>ref|XP_010672229.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Beta vulgaris subsp. vulgaris]
Length=414

 Score =   340 bits (872),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 194/375 (52%), Positives = 264/375 (70%), Gaps = 1/375 (0%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             TL ++V VLR+ K+ IDPNS+   SF+S+W+  LDPCE+TG HFLGILC  P DNSS RI
Sbjct  31    TLSTEVDVLRALKEGIDPNSIPSNSFISTWDFALDPCESTGAHFLGILCSIPEDNSSSRI  90

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             +++DL+G G +GFLT +IGNLTELT LNL++NKFRGPIPDS+  L K+T L++S+N+F+G
Sbjct  91    TILDLDGVGYDGFLTNDIGNLTELTILNLSKNKFRGPIPDSVTKLNKLTALVMSDNYFTG  150

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLN  907
              LP  +RRL++++ +DVS N+L+G IP  +T  R L  L +++N  +G+IP+L+GLWQL+
Sbjct  151   SLPLGLRRLKRIQELDVSRNKLTGLIPTWLTNFRSLESLRMASNGFSGRIPNLAGLWQLH  210

Query  906   TLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHR  727
             TL LSSNQ F  LP  P  LR L L HN+L+G I +I  L+ L  LDLSDNRFSG I   
Sbjct  211   TLDLSSNQLFGILPQLPTSLRILSLSHNVLSGSIHSIYELQNLRMLDLSDNRFSGRI-RG  269

Query  726   IVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVN  547
             IV+LPE++ +N+S N FT ++V K + + + L+VLD   N L GHLP N+ T   L  + 
Sbjct  270   IVSLPEVISLNLSVNWFTELQVPKFAGESTHLEVLDVQENRLTGHLPANLATMEKLTAIY  329

Query  546   LGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCPD  367
             L HN+  G IP+ +G RL + WR++   +N+L G +P EF     K   SL HNCL CP 
Sbjct  330   LSHNQLSGPIPRSFGVRLGAPWRHVFFNHNFLVGAVPPEFAIQKIKVTGSLAHNCLKCPK  389

Query  366   HLPWCLGGQRPASQC  322
             ++  C GGQR AS+C
Sbjct  390   NVTMCDGGQRLASEC  404



>ref|XP_011037112.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Populus euphratica]
Length=414

 Score =   338 bits (866),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 194/382 (51%), Positives = 272/382 (71%), Gaps = 1/382 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  +++ TL+SD++ LR+   ++DP S++  S+L SW+   DPCEA G  F GI+C  P+
Sbjct  26    PSRVHSVTLKSDIEALRALMQAVDPVSIVRYSYLHSWDFTFDPCEAAGL-FQGIVCTFPT  84

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             D S+ RI  IDL+  G +GFLT  IGNLTELT+L +++N FRGPIP++I NL+K+TRL L
Sbjct  85    DQSANRIMAIDLDPAGYDGFLTASIGNLTELTSLRISKNNFRGPIPETIANLQKLTRLSL  144

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             ++N F+G +P+ +  L+ L+++D+S N LS  IPA IT LR L +L LSNN L+G+IPDL
Sbjct  145   TQNLFTGRIPQGIINLKHLQILDLSQNHLSSKIPADITTLRSLVKLSLSNNALSGRIPDL  204

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             S LWQL+TL LSSN     +P  P+ LR L L HN+L+GHIS +S L++LT LDLSDNRF
Sbjct  205   SALWQLSTLDLSSNNLDGIVPNLPMNLRKLSLSHNVLSGHISPVSVLQHLTILDLSDNRF  264

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I   I+TLP + R+N+S N FT +E      +  +L+VLDAH+N L GHLP++++  
Sbjct  265   SGLIRQEILTLPLVERLNISNNQFTEMEPLPYPREGLQLRVLDAHANRLHGHLPISLVNI  324

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NL +++L HN+F G+IP EYG++L S W++L LE N+L G LP +F+ G    RA+L H
Sbjct  325   ANLSSIDLSHNQFSGRIPLEYGAKLGSSWKSLLLEDNFLIGNLPPQFINGTVAVRANLAH  384

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL CP ++ +C GGQR  S+C
Sbjct  385   NCLRCPPNIRFCRGGQRANSEC  406



>ref|XP_006372857.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|ERP50654.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=414

 Score =   338 bits (866),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 194/382 (51%), Positives = 272/382 (71%), Gaps = 1/382 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  +++ TL+SDV+ L++   ++DP S++  S+L SW+   DPCEA G  F GI+C  P+
Sbjct  26    PSRVHSVTLKSDVEALQALMQAVDPVSIVRYSYLHSWDFAFDPCEAAGL-FQGIVCTFPT  84

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             DNS+ RI  IDL+  G +GFLT  IGNLTELT+L +++N FRGPIP++I NL+K+TRL L
Sbjct  85    DNSANRIMAIDLDPAGYDGFLTASIGNLTELTSLRISKNNFRGPIPETIANLQKLTRLSL  144

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             ++N F+G +P+ +  L+ L+++D+S N LS  IPA IT LR L +L LSNN L+G+IPDL
Sbjct  145   TQNLFTGRIPQGIINLKHLQILDLSQNHLSSKIPADITTLRSLVQLSLSNNALSGRIPDL  204

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             S LWQL+TL LSSN     +P  P+ LR L L HN+L+GH+S +S L++LT LDLSDNRF
Sbjct  205   SALWQLSTLDLSSNNLDGIVPNLPMNLRKLSLSHNVLSGHVSPVSVLQHLTVLDLSDNRF  264

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I   I+TLP + R+N+S N FT +E      +  +L+VLDAH+N L GHLP++++  
Sbjct  265   SGLIRQEILTLPLVERLNISNNQFTEMEPLPYPREGLQLRVLDAHANRLHGHLPISLVNI  324

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NL +++L HN F G+IP EYG++L S W++L LE N+L G LP +F+ G    RA+L H
Sbjct  325   ANLSSIDLSHNHFSGRIPLEYGAKLGSSWKSLLLEDNFLIGNLPPQFINGTVAVRANLAH  384

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL CP ++ +C GGQR  S+C
Sbjct  385   NCLRCPPNIRFCRGGQRANSEC  406



>ref|XP_010526132.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1 
[Tarenaya hassleriana]
Length=420

 Score =   335 bits (858),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 193/377 (51%), Positives = 260/377 (69%), Gaps = 1/377 (0%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSG  1273
             + TL SD+Q L S   SIDP+S+ PAS+LS+W+   DPCE  GT FLGI+C  P DN++ 
Sbjct  35    SATLPSDIQALESILRSIDPSSISPASYLSTWDFSEDPCEGAGT-FLGIICSFPLDNTTS  93

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R++ I+L+  G +GFL+  IGNLTELT L+LN+N+FRGPIP+S+  LRK+ RL L+EN+F
Sbjct  94    RVTEIELDDVGYDGFLSVSIGNLTELTVLSLNKNRFRGPIPESVFTLRKLVRLSLAENYF  153

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
             +G +P  +  L +L+VID+S N L+G++P  I+ALR LT L LS N L G+IP L+GLW+
Sbjct  154   TGDIPERITHLMELKVIDLSKNSLAGAVPLRISALRSLTHLSLSGNYLAGRIPALNGLWK  213

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L  L L +N F+  LP  P  LR L + HN L G IS + RL+ L  LD+SDNRFS  I 
Sbjct  214   LEVLELGNNHFYGALPKLPTSLRVLSISHNGLAGRISPLHRLKQLVRLDVSDNRFSSTIG  273

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKT  553
             H I+T PE+  +NVS N  T +EV   + ++SRL++LDA  N LQG LP+N+ T+ NL+ 
Sbjct  274   HEILTFPEITLVNVSYNMLTSLEVINFTGRQSRLRILDAEGNHLQGRLPINLATFENLRE  333

Query  552   VNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNC  373
             +NL +N F G IPK YG +L S WR+L L++NYL G LP +F       + SL +NCL C
Sbjct  334   INLRNNMFSGGIPKVYGKKLTSPWRSLYLDHNYLTGDLPEQFHKLSRLIKGSLSNNCLEC  393

Query  372   PDHLPWCLGGQRPASQC  322
             P +L  C GGQ+P SQC
Sbjct  394   PKNLTICRGGQKPKSQC  410



>ref|XP_006372855.1| hypothetical protein POPTR_0017s05710g [Populus trichocarpa]
 gb|ERP50652.1| hypothetical protein POPTR_0017s05710g [Populus trichocarpa]
Length=405

 Score =   333 bits (853),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 191/379 (50%), Positives = 267/379 (70%), Gaps = 1/379 (0%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNS  1279
             +++ TL+SDV+ L++   ++DP S++  S+L SW+   DPCEA G  F GILC  P+D S
Sbjct  20    IHSVTLKSDVEALQALMQAVDPVSIVRYSYLHSWDFAFDPCEAAGV-FQGILCTFPTDKS  78

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             + RI  IDL+  G +GFLT  IGNLTELT+L +++N FRGPIP++I NL+K+TRL L +N
Sbjct  79    ANRIMAIDLDPAGYDGFLTASIGNLTELTSLRISKNNFRGPIPETIANLQKLTRLSLPQN  138

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              F+G +P+ +  L+ L+++D+S N LS  IPA IT LR L +L LSNN L+G+IPDLS L
Sbjct  139   LFTGRIPQGIINLKHLQILDLSQNNLSSKIPADITTLRSLVQLSLSNNALSGRIPDLSAL  198

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
             WQL+TL LS N     +P  P+ LR L L HN+L+GHIS +S L++LT LDLSDNR SG 
Sbjct  199   WQLSTLDLSGNNLDGIVPNLPINLRKLSLSHNVLSGHISPVSVLQHLTVLDLSDNRLSGL  258

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
             I   I+TLP + R+N+S N FT +E      +  +L+VLDAH+N L GHLP++++   NL
Sbjct  259   IRQEILTLPLVERLNISHNQFTEMEPMPYPREGLQLRVLDAHANRLHGHLPISLVNIANL  318

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
              +++L HN F G+IP EYG++L S W++L LE N+L G LP +F+ G    RA+  HNCL
Sbjct  319   SSIDLSHNLFSGRIPLEYGAKLGSSWKSLLLEDNFLIGNLPPQFINGTVAVRANFAHNCL  378

Query  378   NCPDHLPWCLGGQRPASQC  322
              CP ++P+C GGQR  ++C
Sbjct  379   RCPPNIPFCRGGQRANTEC  397



>ref|XP_011037111.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Populus euphratica]
Length=447

 Score =   329 bits (843),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 192/382 (50%), Positives = 267/382 (70%), Gaps = 1/382 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  +++ TL+SD++ LR+   ++DP S++  S+L SW+   DPCEA G  F GI+C  P+
Sbjct  59    PTRVHSVTLKSDIEALRALMQAVDPVSIVRYSYLHSWDFTFDPCEAAGL-FQGIVCTFPT  117

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             D S+ RI  IDL+  G +GFLT  IGNLTELT+L +++N FRGPIP++I NL+K+TRL L
Sbjct  118   DQSANRIMAIDLDPAGYDGFLTASIGNLTELTSLRISKNNFRGPIPETIANLQKLTRLSL  177

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             ++N F+G +P+ +  L+ L+++D+S N LS  IPA IT LR L +L LSNN L+G+IPDL
Sbjct  178   TQNLFTGRIPQGIINLKHLQILDLSQNHLSSKIPADITTLRSLGQLSLSNNALSGRIPDL  237

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             S LWQL+TL LSSN     +P  P+ LR L L HN+L+GHIS +S L++L  LDLSDNR 
Sbjct  238   SALWQLSTLDLSSNNLDGIVPNLPMNLRKLSLSHNVLSGHISPVSVLQHLRVLDLSDNRL  297

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I   I TLP +  IN+S N FT +E      +  +L+VLDAH+N L GHLP++++  
Sbjct  298   SGLIRQEIFTLPLVESINISNNQFTEMEPMPYPREGLQLRVLDAHANRLHGHLPISLVNI  357

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NL +++L HN F G+IP EYG++L S W++L LE N+L G LP +F+ G    RA+L H
Sbjct  358   ANLSSIDLSHNLFSGRIPLEYGAKLGSSWKSLLLEDNFLIGNLPPQFINGTVAVRANLAH  417

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL CP ++ +C GGQR  S+C
Sbjct  418   NCLRCPPNILFCRGGQRANSEC  439



>ref|XP_010524152.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1 
[Tarenaya hassleriana]
Length=417

 Score =   327 bits (839),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 189/377 (50%), Positives = 256/377 (68%), Gaps = 1/377 (0%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSG  1273
             + T +SD+ VL S   SIDP+S+ P S+LS+WN   DPCE TGT FLG++C  P DN++ 
Sbjct  32    SATFQSDINVLESIVRSIDPSSISPPSYLSTWNFSEDPCEGTGT-FLGVMCSFPLDNTTS  90

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R++ I+L+  G +GFL+  IGNLTELT L+LN N+FRGPIP+S+ +LRK+ RL LSENFF
Sbjct  91    RVTEIELDDGGYDGFLSASIGNLTELTVLSLNGNRFRGPIPESVFSLRKLVRLSLSENFF  150

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
             +G L   +  L +L+ ID+S N L+G+IP  I++LR LTRL LS N L+G IP L+GLW+
Sbjct  151   TGELSERITHLMELKEIDLSKNSLAGAIPFRISSLRSLTRLSLSGNHLSGTIPALNGLWK  210

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L  L L  N  +  LP  P  L+ L +  N L G IS++ RL+ L  LD+SDNRFSG I 
Sbjct  211   LQVLELGHNHLYGALPKLPTSLQVLSVSQNGLAGRISSLHRLKRLVTLDVSDNRFSGTIG  270

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKT  553
             H ++T  E+  +NVS N FT +EV K + +ESRL++LDA  N LQG LP+N+ TY +L+ 
Sbjct  271   HELLTFREITLLNVSYNMFTSLEVIKFTGRESRLRILDAEENHLQGRLPVNLATYESLRN  330

Query  552   VNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNC  373
             +NL +N F G IPK YG RL + WR L L+ NYL G LP +F+      + SL +NCL C
Sbjct  331   INLRNNMFSGGIPKVYGERLANPWRTLYLDNNYLTGDLPEQFLKFSRLMKGSLSNNCLEC  390

Query  372   PDHLPWCLGGQRPASQC  322
             P ++  C  GQ+P  +C
Sbjct  391   PRNVTVCQRGQKPKIRC  407



>ref|XP_006402682.1| hypothetical protein EUTSA_v10006500mg [Eutrema salsugineum]
 gb|ESQ44135.1| hypothetical protein EUTSA_v10006500mg [Eutrema salsugineum]
Length=417

 Score =   325 bits (834),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 203/383 (53%), Positives = 265/383 (69%), Gaps = 2/383 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILC-MTP  1291
             P  + + TL SD+Q L S   SIDP+S+ P+S+LS+W+   DPCE  GT FLG++C   P
Sbjct  27    PSSVLSATLRSDIQALESIIRSIDPSSISPSSYLSTWDFSEDPCEGAGT-FLGVMCSFDP  85

Query  1290  SDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLL  1111
              +N++ R++ IDL+ DG +GFL+   GNLTELT L+LNRN+FRGPIP+++  LRK+T+L 
Sbjct  86    LENTTSRVTEIDLDDDGYDGFLSDATGNLTELTVLSLNRNRFRGPIPETVFQLRKLTKLS  145

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD  931
             LS NFF+G +   + RL++L+ ID+S N ++G IP  I+ALR LT L LSNN L G+IP 
Sbjct  146   LSGNFFTGDISPGITRLKQLKTIDLSRNSIAGEIPPRISALRSLTHLILSNNHLDGRIPA  205

Query  930   LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
             L+GLW+L  L L +N  F  LP  P  LRTL +  N L G IS + RL+ L +LD+S NR
Sbjct  206   LNGLWKLQVLELGNNHLFGMLPKLPPSLRTLSICFNSLAGRISPLHRLKQLVSLDVSQNR  265

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             FSG I H I+T PE+ RINVS N F  IEV K +  ESRL++LDA  N LQGHLPLN+ T
Sbjct  266   FSGTIGHEILTFPEISRINVSFNQFISIEVIKVTGMESRLRILDAEGNHLQGHLPLNLAT  325

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
             Y NLK +NL  N F G IP+ YG RL + WR+L LE NYL G+LP EF    ++ R SL 
Sbjct  326   YGNLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLTGSLPEEFQRISKQIRGSLS  385

Query  390   HNCLNCPDHLPWCLGGQRPASQC  322
             +NCL CP ++P C G Q+P SQC
Sbjct  386   NNCLQCPKNVPICQGVQKPKSQC  408



>emb|CDY00622.1| BnaC04g23030D [Brassica napus]
Length=417

 Score =   325 bits (832),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 199/382 (52%), Positives = 269/382 (70%), Gaps = 1/382 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L S   SIDP+S+ P+S+LS+W+   DPCE +GT FLG++C  P 
Sbjct  27    PSSVLSATLRSDIQALESIIRSIDPSSISPSSYLSTWDFSEDPCEGSGT-FLGVMCSFPL  85

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R++ IDL+ DG EGFL+ E+GNLTELT L+L+RN+FRGP+P+++  L+K+T+L L
Sbjct  86    ENTTSRVTEIDLDDDGYEGFLSDEVGNLTELTVLSLSRNRFRGPMPETVFQLKKLTKLSL  145

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             SEN F+G +   +  L++L+ ID+S N ++G IP  I++LR LT L LSNN L G+IP L
Sbjct  146   SENLFTGDITPGITWLKELKTIDLSKNSIAGEIPPRISSLRSLTHLILSNNHLDGRIPPL  205

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N     LP  P  LRTL L +N L G IS + RL++L +LD+S NRF
Sbjct  206   NGLWKLQALELGNNHLSGTLPKLPPSLRTLSLCYNSLAGRISPLHRLKHLVSLDVSQNRF  265

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I H+I+T PE+  INVS NHFT IEV + +  ESRL++LDA  N LQGHLPLN+ TY
Sbjct  266   SGTIGHQILTFPEISHINVSFNHFTSIEVVQVTGIESRLRILDAEGNQLQGHLPLNLPTY  325

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NLK +NL  N+F G IP+ YG RL + WR+L LE NYL G LP EF+    + R SL +
Sbjct  326   GNLKDINLRSNKFSGDIPRIYGKRLENSWRSLYLENNYLTGLLPEEFLRLSRQVRGSLSN  385

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL CP ++P C G Q+  SQC
Sbjct  386   NCLQCPKNVPICKGVQKAKSQC  407



>emb|CDX89025.1| BnaA04g01610D [Brassica napus]
Length=415

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 198/383 (52%), Positives = 269/383 (70%), Gaps = 2/383 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L S   SIDP+S+ P+S+LS+W+   DPCE +GT FLG++C  P 
Sbjct  24    PSSVLSATLRSDIQALESIIRSIDPSSISPSSYLSTWDFSDDPCEGSGT-FLGVMCSFPL  82

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R++ IDL+ DG EGFL+ E+GNLTELT L+LN+N+FRGPIP+++  L+K+T+L L
Sbjct  83    ENTTSRVTEIDLDDDGYEGFLSDEVGNLTELTVLSLNKNRFRGPIPETVFQLKKLTKLSL  142

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             SENFF+G +   +  L++L+ ID+S N ++G IP  I++LR LT L LSNN L G+IP L
Sbjct  143   SENFFTGDITPGITWLKELKTIDLSKNSIAGEIPPRISSLRSLTHLILSNNHLDGRIPPL  202

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N     LP  P  LRTL L +N L G IS + RL++L +LD+S NRF
Sbjct  203   NGLWKLQALELGNNHLSGTLPKLPPSLRTLSLCYNSLAGRISPLHRLKHLVSLDVSQNRF  262

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I H+I+T PE+  INVS N F  IEV + +  ESRL++LDA  N LQGHLPLN+ TY
Sbjct  263   SGTISHQILTFPEISHINVSFNQFISIEVVQVTGIESRLRILDAEGNQLQGHLPLNLPTY  322

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslw-rnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
              NLK +NL  N+F+G IP+ YG RL +   R+L LE NYL G LP EF+   ++ R SL 
Sbjct  323   GNLKDINLRSNKFYGDIPRIYGKRLENNSWRSLYLENNYLTGLLPEEFLRLSKQIRGSLS  382

Query  390   HNCLNCPDHLPWCLGGQRPASQC  322
             +NCL+CP H+  C G Q+  SQC
Sbjct  383   NNCLHCPKHVRICKGVQKAKSQC  405



>ref|NP_191510.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 emb|CAB75448.1| putative protein [Arabidopsis thaliana]
 gb|AEE79934.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=419

 Score =   320 bits (821),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 200/388 (52%), Positives = 268/388 (69%), Gaps = 3/388 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L S   S+DP+S+ P+S+LS+W+   DPCE +GT FLG++C  P 
Sbjct  32    PSSVLSATLRSDIQALESIIRSVDPSSISPSSYLSTWDFSEDPCEGSGT-FLGVMCSFPL  90

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R+  IDL+ DG +GFL+ E+GNLTELT L+LN+N+FRGP+P+S+  LRK+T+L L
Sbjct  91    ENTTSRVIEIDLDDDGYDGFLSDEVGNLTELTVLSLNKNRFRGPVPESVFQLRKLTKLSL  150

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             +ENFF+G +P  + RL++L+ ID+S N ++G IP  I+ALR LT L LSNN L G+IP L
Sbjct  151   AENFFTGDIPAEITRLKELKTIDLSKNSIAGEIPPRISALRSLTHLVLSNNHLDGRIPAL  210

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N  +  LP  P  LRTL L  N L G IS + RL+ L +LD+S NRF
Sbjct  211   NGLWKLQVLELGNNHLYGMLPKLPPSLRTLSLCFNSLAGRISPLHRLKQLVSLDVSQNRF  270

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG + H I+T PE+ RINVS N F  IEV K +   SRL++LDA  N LQGHLPLN+ TY
Sbjct  271   SGTVGHEILTFPEIARINVSFNQFISIEVIKVTG--SRLRMLDAEGNHLQGHLPLNLATY  328

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NLK +NL  N F G IP+ YG RL + WR+L LE NYL G LP EF    ++ R +L +
Sbjct  329   ENLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLSGILPEEFQKITKQIRGNLSN  388

Query  387   NCLNCPDHLPWCLGGQRPASQCRRSAGG  304
             NCL CP ++  C G Q+P SQC  +  G
Sbjct  389   NCLQCPKNVQICQGTQKPKSQCTNAMLG  416



>ref|XP_006290416.1| hypothetical protein CARUB_v10019143mg [Capsella rubella]
 gb|EOA23314.1| hypothetical protein CARUB_v10019143mg [Capsella rubella]
Length=420

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 269/388 (69%), Gaps = 3/388 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L +   S+DP+S+ P+S+LS+W+   DPCE +GT FLG++C  P 
Sbjct  33    PSSVLSATLRSDIQALEAIIRSVDPSSISPSSYLSTWDFSEDPCEGSGT-FLGVMCSFPL  91

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             DN++ R++ IDL+ DG +GFL+ E+GNLTELT L+LN+N+FRGP+P+++  LRK+T+L L
Sbjct  92    DNTTSRVTEIDLDDDGYDGFLSDEVGNLTELTVLSLNKNRFRGPVPETVFQLRKLTKLSL  151

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             +ENFF+G +   + RL++L+ ID S N ++G IP  I+ALR LT L LSNN L G+IP L
Sbjct  152   AENFFTGDISPEVTRLKELKTIDFSKNSIAGEIPPRISALRSLTHLILSNNHLDGRIPAL  211

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N  +  LP  P  LRTL L  N L G IS + RL+ L +LD+S NRF
Sbjct  212   NGLWKLQVLELGNNHLYGMLPKLPPSLRTLSLCFNSLAGRISPLHRLKQLVSLDVSQNRF  271

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG + H I+T P++ RINVS N F  IEV K +   SRL++LDA  N LQGHLPLN+ TY
Sbjct  272   SGTVGHEILTFPDISRINVSFNQFISIEVIKVTG--SRLRMLDAEGNHLQGHLPLNLATY  329

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NLK +NL  N F G IP+ YG RL + WR+L LE NYL GTLP EF    ++ R +L +
Sbjct  330   ENLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLSGTLPEEFQKISKQIRGNLSN  389

Query  387   NCLNCPDHLPWCLGGQRPASQCRRSAGG  304
             NCL CP ++P C G Q+P SQC  +  G
Sbjct  390   NCLQCPKNVPICQGPQKPKSQCTNAMLG  417



>ref|XP_010418635.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Camelina sativa]
Length=419

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 270/388 (70%), Gaps = 3/388 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L +   S+DP+S+ P+S+LS+W+   DPCE +GT FLG++C  P 
Sbjct  32    PSSVFSATLRSDIQALEAIIRSVDPSSISPSSYLSTWDFSEDPCEGSGT-FLGVMCSFPL  90

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R++ IDL+ DG +GFL+ EIGNLTELT L+LN+N+FRGP+P+S+  LRK+T+L L
Sbjct  91    ENTTSRVTEIDLDDDGYDGFLSDEIGNLTELTVLSLNKNRFRGPVPESVFQLRKLTKLSL  150

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             +ENFF+G +   + RL++L+ +D+S N ++G IP  I+ALR LT L LSNN L GKIP L
Sbjct  151   AENFFTGDISPEITRLKELKTVDLSTNSIAGEIPPRISALRSLTHLILSNNHLDGKIPAL  210

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N  +  LP  P  LRTL L  N L G IS + RL+ L +LD+S NRF
Sbjct  211   NGLWKLQVLELGNNHLYGMLPKLPPSLRTLSLCFNSLAGRISPLHRLKQLVSLDVSQNRF  270

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG + H I+T P++ RINVS N F  IEV K +   SRL++LDA  N LQGHLPLN+ TY
Sbjct  271   SGTVGHEILTFPDISRINVSFNQFISIEVIKVTG--SRLRMLDADGNHLQGHLPLNLATY  328

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NLK +NL  N F G IP+ YG RL + WR+L LE NYL G+LP EF    ++ R +L +
Sbjct  329   ENLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLSGSLPEEFQKISKQIRGNLSN  388

Query  387   NCLNCPDHLPWCLGGQRPASQCRRSAGG  304
             NCL CP ++P C G Q+P SQC  +  G
Sbjct  389   NCLQCPKNVPICQGPQKPKSQCTNAMLG  416



>ref|XP_010513735.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Camelina sativa]
Length=420

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 197/388 (51%), Positives = 270/388 (70%), Gaps = 3/388 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L +   S+DP+S+ P+S+LS+W+   DPCE +GT FLG++C  P 
Sbjct  33    PSSVFSATLRSDIQALEAIIRSVDPSSISPSSYLSTWDFSEDPCEGSGT-FLGVMCSFPL  91

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R++ IDL+ DG +GFL+ EIGNLTELT L+LN+N+FRGP+P+S+  LRK+T+L L
Sbjct  92    ENTTSRVTEIDLDDDGYDGFLSDEIGNLTELTVLSLNKNRFRGPVPESVFQLRKLTKLSL  151

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             +ENFF+G + + + RL++L+ ID+S N ++G IP  I+ALR LT L LSNN L GKIP L
Sbjct  152   AENFFTGDISQEITRLKELKTIDLSTNSIAGEIPPRISALRSLTHLILSNNHLDGKIPAL  211

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N  +  LP  P  LRTL L  N L G IS + RL+ L +LD+S NRF
Sbjct  212   NGLWKLQVLELGNNHLYGTLPKLPPSLRTLSLCFNSLAGRISPLHRLKQLVSLDVSQNRF  271

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG + H I+T P++ RINVS N F  +EV K +   SRL++LDA  N LQGHLPLN+ +Y
Sbjct  272   SGTVGHEILTFPDISRINVSFNQFISLEVIKVTG--SRLRMLDAEGNHLQGHLPLNLASY  329

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NLK +NL  N F G IP+ YG RL + WR+L LE NYL G+LP EF    ++ R +  +
Sbjct  330   ENLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLSGSLPEEFQKISKQIRGNFSN  389

Query  387   NCLNCPDHLPWCLGGQRPASQCRRSAGG  304
             NCL CP ++P C G Q+P SQC  +  G
Sbjct  390   NCLQCPKNVPICQGPQKPKSQCTNAVLG  417



>ref|XP_002878275.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54534.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=416

 Score =   318 bits (814),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 267/388 (69%), Gaps = 3/388 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L S   S+DP+S+ P+S+LS+W+   DPCE  GT FLG++C  P 
Sbjct  29    PSSVLSATLRSDIQALESIIRSVDPSSISPSSYLSTWDFSEDPCEGAGT-FLGVMCSFPL  87

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R+  IDL+ DG +GFL+ E+GNLTELT L+LN+N+FRGP+P+++  LRK+T+L L
Sbjct  88    ENTTSRVIEIDLDDDGYDGFLSDEVGNLTELTVLSLNKNRFRGPVPETVFQLRKLTKLSL  147

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             +ENFF+G +   + RL++L+ ID+S N ++G IP  I+ALR LT L LSNN L G+IP L
Sbjct  148   AENFFTGDISAEITRLKELKTIDLSKNSIAGEIPPRISALRSLTHLILSNNHLDGRIPAL  207

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N  +  LP  P  LRTL L  N L G IS + RL+ L +LD+S NRF
Sbjct  208   NGLWKLQVLELGNNHLYGMLPKLPPSLRTLSLCFNSLGGRISPLHRLKQLVSLDVSQNRF  267

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG + H I+T PE+ RINVS N F  IEV K +   SRL++LDA  N LQGHLPLN+ TY
Sbjct  268   SGTVGHEILTFPEISRINVSFNQFISIEVIKVTG--SRLRMLDAEGNHLQGHLPLNLATY  325

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NLK +NL  N F G IP+ YG RL + WR+L LE NYL GTLP EF    ++ R +L +
Sbjct  326   ENLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLSGTLPEEFQKISKQIRGNLSN  385

Query  387   NCLNCPDHLPWCLGGQRPASQCRRSAGG  304
             NCL CP ++  C G Q+P SQC  +  G
Sbjct  386   NCLQCPKNVQICQGTQKPKSQCTNAMLG  413



>gb|KFK35171.1| hypothetical protein AALP_AA5G249000 [Arabis alpina]
Length=417

 Score =   317 bits (812),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 197/382 (52%), Positives = 259/382 (68%), Gaps = 1/382 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L +   SIDP+S+ P+S+LS+W+   DPCE  GT FLG++C    
Sbjct  28    PSSVLSATLRSDIQALEAIIRSIDPSSISPSSYLSTWDFSEDPCEGAGT-FLGVMCSFTL  86

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R++ IDL+ DG +GFL+  +GNLTELT L++NRN+FRGPIP+++  LRK+T+L L
Sbjct  87    ENTTSRVTEIDLDDDGYDGFLSDAVGNLTELTVLSINRNRFRGPIPETVFQLRKLTKLSL  146

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             S NFF+G +   + +L+ L+ ID+S N ++G IP  I+ALR LT L LSNN L G+IP L
Sbjct  147   SGNFFTGDISEGITQLKDLKTIDLSKNSIAGEIPPRISALRSLTHLILSNNHLDGRIPAL  206

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N  F  LP  P  LRTL +  N LTG IS + RL+ L  LD+S NRF
Sbjct  207   NGLWKLQVLELGNNHLFGALPKLPPSLRTLSICFNSLTGRISPLHRLKQLLTLDVSQNRF  266

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I H I+T P +  INVS N F  IEV + +  ES L+VLDA  N LQG LPLN+ TY
Sbjct  267   SGTIGHEILTFPYISHINVSFNQFISIEVVQVTGMESHLRVLDAEGNHLQGRLPLNLATY  326

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NLK +NL  N F G IPK YG RL + WR+L LE NYL G LP EF    ++ R SL +
Sbjct  327   ANLKYINLRSNMFSGDIPKIYGKRLENSWRSLYLENNYLSGALPEEFQKISKQIRGSLSN  386

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL CP ++P C G Q+P SQC
Sbjct  387   NCLQCPKNVPICQGVQKPKSQC  408



>emb|CDX98379.1| BnaC06g17400D [Brassica napus]
Length=408

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 196/382 (51%), Positives = 262/382 (69%), Gaps = 1/382 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L S   SIDP+S+ P+S+LS+W+   DPCE +GT FLG++C    
Sbjct  18    PSSVLSATLRSDIQALESIIRSIDPSSISPSSYLSTWDFSEDPCEGSGT-FLGVMCSFTL  76

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R++ IDL+ DG +GFL+  IGNLTELT L+L+ N+FRGPIP+++  LRK+T+L L
Sbjct  77    ENTTSRVTEIDLDDDGYDGFLSEAIGNLTELTVLSLDNNRFRGPIPETVFQLRKLTKLSL  136

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             S NFF+G +   + +L++L+ ID+S N ++G IP  I+ LR LT L LSNN + G+IP L
Sbjct  137   SGNFFTGDITPGITKLKELKTIDLSKNSIAGEIPPRISGLRSLTHLILSNNHIDGRIPAL  196

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N  F  LP  P  LRTL L +N L G IS + RL++L +LDLS NRF
Sbjct  197   NGLWKLQVLELGNNHLFGMLPKLPTSLRTLSLCYNSLAGRISPLHRLKHLVSLDLSQNRF  256

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I H I+T PE+ RINVS N F  IEV +    E+ L++LDA  N LQG LPLN+ TY
Sbjct  257   SGTIGHEILTFPEISRINVSFNQFISIEVIQVIGMETHLRILDAEGNHLQGPLPLNLATY  316

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NLK +NL  N F G IP+ YG RL + WR+L LE NYL GTLP EF    ++ R SL +
Sbjct  317   GNLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLTGTLPVEFQRISKQIRGSLSN  376

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL CP ++  C G Q+P SQC
Sbjct  377   NCLQCPKNVTICQGVQKPKSQC  398



>ref|XP_009104211.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Brassica rapa]
 emb|CDX67800.1| BnaA07g18400D [Brassica napus]
Length=408

 Score =   315 bits (806),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 196/382 (51%), Positives = 262/382 (69%), Gaps = 1/382 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L S   SIDP+S+ P+S+LS+W+   DPCE +GT FLG++C    
Sbjct  18    PSSVLSATLRSDIQALESIIRSIDPSSISPSSYLSTWDFSEDPCEGSGT-FLGVMCSFTL  76

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R++ IDL+ DG +GFL+  IGNLTELT L+LN N+FRGPIP+++  LRK+T+L L
Sbjct  77    ENTTSRVTEIDLDDDGYDGFLSEAIGNLTELTVLSLNNNRFRGPIPETVFQLRKLTKLSL  136

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             S NFF+G +   + +L++L+ ID+S N ++G IP  I+ LR LT L LSNN + G+IP L
Sbjct  137   SGNFFTGDITPGITKLKELKTIDLSKNSIAGEIPPRISGLRSLTHLILSNNHIDGRIPAL  196

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N  F  LP  P  LRTL L +N L G IS + RL++L +LD+S NRF
Sbjct  197   NGLWKLQVLELGNNHLFGMLPKLPTSLRTLSLCYNSLAGRISPLHRLKHLVSLDVSQNRF  256

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I H I+T PE+ RINVS N F  IEV +    E+ L++LDA  N LQG LPLN+ TY
Sbjct  257   SGTIGHEILTFPEISRINVSFNQFISIEVIQVIGMETHLRILDAEGNHLQGPLPLNLATY  316

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              NLK +NL  N F G IP+ YG RL + WR+L LE NYL GTLP EF    ++ R SL +
Sbjct  317   GNLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLTGTLPVEFQRISKQIRGSLSN  376

Query  387   NCLNCPDHLPWCLGGQRPASQC  322
             NCL CP ++  C G Q+P SQC
Sbjct  377   NCLQCPKNVTICQGVQKPKSQC  398



>ref|XP_009138910.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Brassica rapa]
Length=423

 Score =   315 bits (806),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 197/383 (51%), Positives = 267/383 (70%), Gaps = 2/383 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L S   SIDP+S+ P+S+LS+W+   DPCE +GT FLG+ C  P 
Sbjct  32    PSSVLSATLRSDIQALESIIRSIDPSSISPSSYLSTWDFSEDPCEGSGT-FLGVTCSFPL  90

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R++ IDL+ DG EGFL+ E+GNLTELT L+LN+N+FRGPIP+++  L+K+T+L L
Sbjct  91    ENTTNRVTEIDLDDDGYEGFLSDEVGNLTELTVLSLNKNRFRGPIPETVFQLKKLTKLSL  150

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             SENFF+G +   +  L++L+ ID+S N ++G IP  I++LR LT L LSNN L G+IP L
Sbjct  151   SENFFTGDITPGITWLKELKTIDLSKNSIAGEIPPRISSLRSLTHLILSNNHLDGRIPPL  210

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLW+L  L L +N     LP  P  LRTL L +N L G IS + RL++L +LD+S NRF
Sbjct  211   NGLWKLQALELGNNHLSGTLPKLPPSLRTLSLCYNSLAGRISPLHRLKHLVSLDVSQNRF  270

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I H+I+T PE+  INVS N F  IEV + +  ESRL++LDA  N LQGHLPLN+ TY
Sbjct  271   SGTISHQILTFPEISHINVSFNQFISIEVVQVTGIESRLRILDAEGNQLQGHLPLNLPTY  330

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslw-rnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
              NLK +NL  N+F G IP+ YG RL +   R+L LE NYL G LP EF+   ++ R SL 
Sbjct  331   GNLKDINLRSNKFSGDIPRIYGKRLENNSWRSLYLENNYLTGLLPEEFLRLSKQIRGSLS  390

Query  390   HNCLNCPDHLPWCLGGQRPASQC  322
             +NCL+CP ++  C G Q+  SQC
Sbjct  391   NNCLHCPKNVRICKGVQKAKSQC  413



>ref|XP_006858894.1| hypothetical protein AMTR_s00066p00204410 [Amborella trichopoda]
 gb|ERN20361.1| hypothetical protein AMTR_s00066p00204410 [Amborella trichopoda]
Length=388

 Score =   302 bits (773),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 187/385 (49%), Positives = 252/385 (65%), Gaps = 1/385 (0%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P F   KTL+SD++ LRS K+ IDP S+ P +FL +W+  +DPCE TG+HF+GILC  PS
Sbjct  2     PNFALPKTLDSDIEALRSLKNGIDPYSIPPTTFLDTWDFSVDPCENTGSHFVGILCDIPS  61

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
              N+S RI  +DL   G +GFL+P IG+LTELT L+L++N+FRGP+P+S   L KIT L L
Sbjct  62    GNTSQRIVALDLNSMGYDGFLSPSIGSLTELTFLDLSKNRFRGPLPESFTRLTKITTLSL  121

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             SEN F+G +P  +  LR L+ +D+S N   G++P T   LR+LT +D+S N     +PDL
Sbjct  122   SENIFTGYIPSEITNLRWLQYLDLSKNNFIGTLPPTFVDLRQLTHVDVSYNLFFSNLPDL  181

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
               LWQL +LAL  N F  GLP  P  LRTL L +NLL+G +    RL +L ALDLS+N+F
Sbjct  182   DALWQLTSLALDHNHFEGGLPRLPSNLRTLSLNNNLLSGRLPPTMRLPHLEALDLSNNQF  241

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             +G I   ++ LP + RIN+S N FT IEV  ++   + L+ LDA  N +Q HLPL + T 
Sbjct  242   TGTIGWGLLLLPSIRRINLSFNLFTSIEVFNATNMTTTLEELDASHNRIQMHLPLGLATI  301

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMT-GGEKARASLD  391
              ++ +++L  N F G+IP EYG+R  + WR L L  NYLEG++PSEF     EK   SL 
Sbjct  302   ESMLSIHLEGNSFVGRIPPEYGARAMNSWRQLFLNDNYLEGSVPSEFKNLQREKLNGSLA  361

Query  390   HNCLNCPDHLPWCLGGQRPASQCRR  316
              NCL C +    C G QRP+S+C R
Sbjct  362   SNCLVCRNGHYLCEGRQRPSSECHR  386



>ref|XP_010418636.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Camelina sativa]
Length=335

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 174/334 (52%), Positives = 232/334 (69%), Gaps = 2/334 (1%)
 Frame = -3

Query  1305  LCMTPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRK  1126
             +C  P +N++ R++ IDL+ DG +GFL+ EIGNLTELT L+LN+N+FRGP+P+S+  LRK
Sbjct  1     MCSFPLENTTSRVTEIDLDDDGYDGFLSDEIGNLTELTVLSLNKNRFRGPVPESVFQLRK  60

Query  1125  ITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELT  946
             +T+L L+ENFF+G +   + RL++L+ +D+S N ++G IP  I+ALR LT L LSNN L 
Sbjct  61    LTKLSLAENFFTGDISPEITRLKELKTVDLSTNSIAGEIPPRISALRSLTHLILSNNHLD  120

Query  945   GKIPDLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALD  766
             GKIP L+GLW+L  L L +N  +  LP  P  LRTL L  N L G IS + RL+ L +LD
Sbjct  121   GKIPALNGLWKLQVLELGNNHLYGMLPKLPPSLRTLSLCFNSLAGRISPLHRLKQLVSLD  180

Query  765   LSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLP  586
             +S NRFSG + H I+T P++ RINVS N F  IEV K +   SRL++LDA  N LQGHLP
Sbjct  181   VSQNRFSGTVGHEILTFPDISRINVSFNQFISIEVIKVTG--SRLRMLDADGNHLQGHLP  238

Query  585   LNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKA  406
             LN+ TY NLK +NL  N F G IP+ YG RL + WR+L LE NYL G+LP EF    ++ 
Sbjct  239   LNLATYENLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLSGSLPEEFQKISKQI  298

Query  405   RASLDHNCLNCPDHLPWCLGGQRPASQCRRSAGG  304
             R +L +NCL CP ++P C G Q+P SQC  +  G
Sbjct  299   RGNLSNNCLQCPKNVPICQGPQKPKSQCTNAMLG  332



>gb|KHN33303.1| LRR receptor-like serine/threonine-protein kinase FLS2 [Glycine 
soja]
Length=271

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 188/273 (69%), Gaps = 6/273 (2%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P   N+ TL+ D   L   K +IDPNSV P+S+L+SW+  +DPCE TG+ FLGILC  P 
Sbjct  2     PSQTNSSTLQDDTLALLEIKRAIDPNSVTPSSYLNSWDFTVDPCEITGSQFLGILCNLPL  61

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             DNSS R++ +DL+G G EGFLTP IGNLTELT LNLN NKFRGPIP++I  LRK+TRL +
Sbjct  62    DNSSSRVTEVDLDGIGREGFLTPAIGNLTELTVLNLNNNKFRGPIPETIAKLRKLTRLTM  121

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             S NFF+G +P+ + +L+ L+ IDVS NRLSG IP +IT LR LT L LSNN   G+IP+L
Sbjct  122   SLNFFTGAIPQGITQLKNLQYIDVSGNRLSGLIPTSITGLRSLTYLSLSNNGFAGRIPNL  181

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             +GLWQLNTL LS NQF+  LP  PV LR +   HN+          L +L  L +SDNR 
Sbjct  182   TGLWQLNTLDLSVNQFYGDLPNLPVSLRNMYFHHNIPK------GLLIHLKWLVVSDNRL  235

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSS  649
             SG I   +++L  ++ +NVS N FT +EV   S
Sbjct  236   SGAISGDVLSLRNVVHLNVSFNRFTVLEVIDYS  268



>gb|EPS68803.1| hypothetical protein M569_05977, partial [Genlisea aurea]
Length=281

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 183/255 (72%), Gaps = 2/255 (1%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             +DLEGDGLEGF++P IGNLTELT LNL  NKFRGPIPDSI  L  +TRL LS+NF SG +
Sbjct  1     VDLEGDGLEGFISPMIGNLTELTQLNLRNNKFRGPIPDSISRLTNLTRLCLSQNFLSGSV  60

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNT  904
             P+ +R L +LE +D+S NRL+GSI   I+ LR L  L+L  NE  G+IP  L+GLW+L T
Sbjct  61    PKGLRALLRLEDVDLSENRLTGSIIPGISDLRRLKHLNLMKNEFFGRIPVTLTGLWRLET  120

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             L LS NQ    LP FP  LR+L L HN L+GHIS +  L++   +DLS+NR SG I   I
Sbjct  121   LNLSRNQLSGKLPGFPNGLRSLSLSHNFLSGHISPVENLKHAQRVDLSNNRLSGIIFQGI  180

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKE-SRLQVLDAHSNLLQGHLPLNIITYLNLKTVN  547
             +TLPEL  I++S N FT IEV K   +E S+L+ +D  +N++ GHLP N++TY NL+ ++
Sbjct  181   LTLPELTSIDLSTNRFTAIEVAKIPDEESSQLRAIDVQNNMITGHLPRNLVTYRNLRRLD  240

Query  546   LGHNRFFGKIPKEYG  502
             LGHN F G+IP+EYG
Sbjct  241   LGHNMFSGEIPEEYG  255



>ref|XP_007033918.1| Leucine-rich repeat (LRR) family protein, putative [Theobroma 
cacao]
 gb|EOY04844.1| Leucine-rich repeat (LRR) family protein, putative [Theobroma 
cacao]
Length=277

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 164/248 (66%), Gaps = 0/248 (0%)
 Frame = -3

Query  1065  RLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSN  886
             +LR++E ID+S N LSG IP  ++ALR    L LSNN  +G+IP+++GLWQL TL L SN
Sbjct  23    QLREIETIDLSKNLLSGQIPDRLSALRRSAVLRLSNNGFSGRIPNINGLWQLQTLELDSN  82

Query  885   QFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPEL  706
              FF  LP  P R RTL L H+LL+GHI+++  L  L ++D+SDNRFSG I   ++ LP L
Sbjct  83    MFFGNLPMLPKRFRTLTLCHSLLSGHITSLGTLEQLRSVDVSDNRFSGSISKGVLALPPL  142

Query  705   MRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFF  526
               INVS N  T  EV  +    S LQVLDA  N LQGHLPLN++TY +L  +NL HNRF 
Sbjct  143   NHINVSFNQLTVTEVDNTYEIGSPLQVLDAQENHLQGHLPLNMVTYESLAVINLAHNRFP  202

Query  525   GKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCPDHLPWCLG  346
               IP EYG RL + WR L L+ N L G LP +F +G  + + SL +NCL  P ++P C  
Sbjct  203   SGIPMEYGDRLGNPWRALFLDQNLLSGRLPLQFDSGAARIKGSLANNCLRYPVNIPLCCR  262

Query  345   GQRPASQC  322
             GQRPAS C
Sbjct  263   GQRPASGC  270



>ref|XP_010244255.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nelumbo nucifera]
Length=396

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 143/390 (37%), Positives = 214/390 (55%), Gaps = 32/390 (8%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSD  1285
             L A TL SD   L++FK++I P ++ P S L+SWN  +DPC      +   GI C   SD
Sbjct  25    LRALTLPSDTSALKAFKNAIKPATISPWSCLASWNFSIDPCSLPRRSYFICGITCN--SD  82

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             N+  R++ + L+  G  G L+P++  LT+L  L+++ N F GPIP S+ +L K+  L LS
Sbjct  83    NT--RVTALVLDPAGYSGTLSPQLSTLTQLIHLDISDNSFYGPIPSSLSSLTKLQTLSLS  140

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG  P  + RL  L  +D+SHN L+ ++P T+++L  +  +DLS N+LTG +P L 
Sbjct  141   SNSFSGPFPPSLTRLTSLNSLDISHNALARTLPQTMSSLSNVRTIDLSFNKLTGSLPKLP  200

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LA+ +N F +G                  +   S+      L  ++L  N FS
Sbjct  201   P--NLVELAIRAN-FLSG------------------SLLQSSFQGSSQLEVVELGANMFS  239

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G +      LP L ++++S N FTR+E+ K S K+S L  +D   N L+G+LP+N  ++ 
Sbjct  240   GVLNSWFFLLPSLQQVDLSNNSFTRLEIWKPSNKDSNLVAVDLGFNSLEGYLPVNFASFP  299

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMT--GGEKARASLD  391
              L +++L HNRF G IP EYG   +   R L L+ N+L G +P  F +  GG     S  
Sbjct  300   LLSSLSLRHNRFRGPIPLEYG--KKLSLRRLFLDGNFLNGKVPDRFFSGAGGSTLSGSFG  357

Query  390   HNCL-NCPDHLPWCLGGQRPASQCRRSAGG  304
              NCL +CP+    CL  Q+  S CR++ GG
Sbjct  358   DNCLESCPNSSQLCLPLQKSPSMCRQAYGG  387



>emb|CDO97212.1| unnamed protein product [Coffea canephora]
Length=389

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 138/383 (36%), Positives = 205/383 (54%), Gaps = 32/383 (8%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHF-LGILCMTPSDNSSGR  1270
             T  SDV  L++FK +I P+S+ P S L SWN   DPC     +F  G+LC      S  R
Sbjct  33    TFSSDVTALKAFKAAIKPSSIKPYSCLGSWNFSNDPCSIPRAYFSCGLLC------SGNR  86

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             ++ + L+     G LTP I  LT+L TL+L+ NKF GPIP  + +L  +  L+L  N FS
Sbjct  87    VTQLTLDPADYAGTLTPLISKLTQLVTLDLSTNKFSGPIPP-LYSLANLQTLVLRFNSFS  145

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQL  910
             G +P  +  L+ LE +D+SHN LSGS+P + +++  L RLDLS N+LTG +P L     L
Sbjct  146   GTVPPSLTALKSLETVDLSHNYLSGSLPNSWSSIGSLRRLDLSYNKLTGSLPKLPP--NL  203

Query  909   NTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILH  730
               LA+ +N     L                   + ++   L  L  ++LS N F+G +  
Sbjct  204   IELAIKANYLSGPL-------------------YRTSFQGLTQLEVVELSGNSFAGTLEA  244

Query  729   RIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTV  550
                 LP L +++++ N FTR+++ K +   S L  +D   N +QG+L +N   Y  L ++
Sbjct  245   WFFLLPALQQVDLANNSFTRVDIWKPTNGNSDLVAVDLGFNRIQGYLSVNFAAYPLLSSL  304

Query  549   NLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLN-C  373
             +L +NRF G IP EY    R   + L L+ N+L G+ P+ F + G     SL  NCL  C
Sbjct  305   SLRYNRFRGPIPWEYS--KRESLKRLFLDGNFLNGSPPAGFFSAGTSVSGSLGDNCLQKC  362

Query  372   PDHLPWCLGGQRPASQCRRSAGG  304
             P     CL  Q+P++ C+ + GG
Sbjct  363   PVSSQLCLKSQKPSAICQHAYGG  385



>ref|XP_011030411.1| PREDICTED: polygalacturonase inhibitor 1-like [Populus euphratica]
Length=387

 Score =   192 bits (489),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 139/386 (36%), Positives = 201/386 (52%), Gaps = 30/386 (8%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHFL-GILCMTPSDNS  1279
             A T   D+  L++FK S+ P+S+ P S L+SW+   DPC     THF+ GI C       
Sbjct  25    ALTSPQDISALKAFKASVKPSSIQPWSCLASWDFTTDPCAFPRRTHFICGITC----SPD  80

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G LTP I  LT LT L+L  N F GPIP SI +L  +  L LS N
Sbjct  81    STRVTQLTLDPAGYSGQLTPLISLLTSLTILDLVDNNFYGPIPSSISSLINLQTLTLSSN  140

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L+ LE +D SHN LSG +P T+ ++  L RLDLS N+LTG +P L   
Sbjct  141   SFSGAVPNSITNLKSLESLDFSHNYLSGYLPKTMNSMSSLRRLDLSYNKLTGPLPKLP--  198

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
             + L  LAL +N                       +   S+   L  +  ++LS+N F+G 
Sbjct  199   YNLLELALKANS-------------------LSGSLSKSSFDGLARIEVVELSENLFTGT  239

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
             +      LP L +++++ N  TR+E++K S   S L  +D   N ++G+ PL+   Y  L
Sbjct  240   LEPWFFLLPALQQVDLANNSLTRVEISKPSNASSDLVAVDLGFNKIEGNAPLHFADYPLL  299

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
              +++L +NR  G IP EY    +   R L L+ N+L G  P  F         SL  NCL
Sbjct  300   ASLSLRYNRLRGTIPLEYS--RKRSLRRLFLDGNFLIGKPPPAFFAADTSVSGSLGDNCL  357

Query  378   N-CPDHLPWCLGGQRPASQCRRSAGG  304
               CP     C+  Q+P+S C+++ GG
Sbjct  358   QACPGSFQLCMPSQKPSSVCKQAYGG  383



>ref|XP_007042511.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao]
 gb|EOX98342.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao]
Length=382

 Score =   192 bits (487),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 140/386 (36%), Positives = 203/386 (53%), Gaps = 28/386 (7%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHFLGILCMTPSDNS  1279
              A T   D+  L++FK SI P+S+   S L+SW+   DPC     THF+  L  +P    
Sbjct  19    QALTSPQDISALKAFKASIKPSSIPSWSCLASWDFTTDPCAIPRRTHFICGLTCSPD---  75

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ I L+  G  G L P +  LT+LTTL+L+ N F GPIP SI +LR +  L L  N
Sbjct  76    SARVTQITLDPAGYSGQLNPLVSQLTQLTTLDLSDNNFFGPIPSSITSLRSLQSLTLRSN  135

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  ++ LE +D+SHN LSG +P T+ +L  L R+DLS N+ TG +P L   
Sbjct  136   SFSGSIPDSVATIKSLEYLDLSHNSLSGPLPKTLNSLSSLRRVDLSYNKFTGFLPKLP--  193

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
             + L  LAL  N + +G                      S    L  L  ++LS+N F+G 
Sbjct  194   YNLLELALRGN-YLSGY------------------ISKSTFDGLTQLEVVELSENSFTGT  234

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
             +      LP L +++++ N FTRIE++K     S L  ++   N ++G++P N   Y  L
Sbjct  235   LQSWFFLLPSLQQVDLANNSFTRIEISKPPGGNSDLVAVNLGFNKIEGNVPANFSDYPLL  294

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
              +++L +NR  G IP EY    +   R L L+ N+L G  PSEF  G      SL  NCL
Sbjct  295   SSLSLRYNRLRGAIPLEYS--KKKSLRRLFLDGNFLIGKPPSEFFAGDTSVSGSLGDNCL  352

Query  378   N-CPDHLPWCLGGQRPASQCRRSAGG  304
               CP     C+  Q+  S C+++ GG
Sbjct  353   QGCPGSSQLCIPSQKSYSVCKQAYGG  378



>ref|XP_002285338.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g20940 [Vitis vinifera]
Length=389

 Score =   192 bits (488),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 142/387 (37%), Positives = 203/387 (52%), Gaps = 32/387 (8%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCMTPSDN  1282
             +A TL SDV  L+SFK SI P+SV P S L+SWN   DPC     THF  GI C      
Sbjct  28    HALTLPSDVSALQSFKASIKPSSVSPWSCLASWNFSTDPCSVPRRTHFTCGISC----SA  83

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
              S R+  I L+  G  G L+P I  LT+LT L+L+ N   G +P ++ +L  +  L L  
Sbjct  84    DSTRVISITLDPAGYAGALSPAIAKLTQLTVLDLSDNSLSGYVPSALSSLSNLQILTLRS  143

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FSG LP+ +  ++ LE +D+SHN LSGS+P T+ +L  L RLDLS N +TG +P L  
Sbjct  144   NSFSGPLPQAITAIKSLESLDISHNFLSGSLPKTMVSLSSLRRLDLSFNRITGTLPKLPS  203

Query  921   LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG  742
                L+ LAL SN     L                     S+   L  L  ++LS N F+G
Sbjct  204   --SLSELALRSNSLSGYL-------------------LKSSFDGLTRLEVVELSANAFTG  242

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
             PI      LP L ++N++ N FT + + K +  +  L  +D   N ++G++P N   +  
Sbjct  243   PIQSWFFLLPSLQQVNLANNSFTGLAILKPTASD--LVAVDLGFNQIKGYVPTNFSAFPL  300

Query  561   LKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
             L +++L +N+  G IP +Y    +   + L L+ N+L G  P  F +G      SL  NC
Sbjct  301   LSSLSLRYNQLRGPIPLDYS--KKETLKRLFLDGNFLNGKAPVGFFSGWSGVSGSLGDNC  358

Query  381   L-NCPDHLPWCLGGQRPASQCRRSAGG  304
             L +CP     CL  Q+P S C+++ GG
Sbjct  359   LQSCPTSSQLCLPSQKPNSICKQAYGG  385



>emb|CBI40273.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   192 bits (487),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 142/387 (37%), Positives = 203/387 (52%), Gaps = 32/387 (8%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCMTPSDN  1282
             +A TL SDV  L+SFK SI P+SV P S L+SWN   DPC     THF  GI C      
Sbjct  17    HALTLPSDVSALQSFKASIKPSSVSPWSCLASWNFSTDPCSVPRRTHFTCGISC----SA  72

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
              S R+  I L+  G  G L+P I  LT+LT L+L+ N   G +P ++ +L  +  L L  
Sbjct  73    DSTRVISITLDPAGYAGALSPAIAKLTQLTVLDLSDNSLSGYVPSALSSLSNLQILTLRS  132

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FSG LP+ +  ++ LE +D+SHN LSGS+P T+ +L  L RLDLS N +TG +P L  
Sbjct  133   NSFSGPLPQAITAIKSLESLDISHNFLSGSLPKTMVSLSSLRRLDLSFNRITGTLPKLPS  192

Query  921   LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG  742
                L+ LAL SN     L                     S+   L  L  ++LS N F+G
Sbjct  193   --SLSELALRSNSLSGYL-------------------LKSSFDGLTRLEVVELSANAFTG  231

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
             PI      LP L ++N++ N FT + + K +  +  L  +D   N ++G++P N   +  
Sbjct  232   PIQSWFFLLPSLQQVNLANNSFTGLAILKPTASD--LVAVDLGFNQIKGYVPTNFSAFPL  289

Query  561   LKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
             L +++L +N+  G IP +Y    +   + L L+ N+L G  P  F +G      SL  NC
Sbjct  290   LSSLSLRYNQLRGPIPLDYS--KKETLKRLFLDGNFLNGKAPVGFFSGWSGVSGSLGDNC  347

Query  381   L-NCPDHLPWCLGGQRPASQCRRSAGG  304
             L +CP     CL  Q+P S C+++ GG
Sbjct  348   LQSCPTSSQLCLPSQKPNSICKQAYGG  374



>gb|ABK24515.1| unknown [Picea sitchensis]
Length=428

 Score =   191 bits (486),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 141/393 (36%), Positives = 206/393 (52%), Gaps = 23/393 (6%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHF-LGILCMTPSDNS  1279
             A+T+  DV+ L++ KDS+D NS+   S L SWN  +DPC+ A G  F  G+ C       
Sbjct  37    ARTVAGDVEALKAIKDSVDANSIKAGSCLGSWNFSVDPCDYAFGELFTCGLRC------D  90

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
               R++ + L+  G  G L P I  L+ L  L+L  N F GPIP +I NL  + RLL+S N
Sbjct  91    GERVTEVTLDDSGYNGTLPPAIAQLSALQILDLTNNAFHGPIPHTIGNLTDLVRLLVSHN  150

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L  L+ + +  N L G IPAT   L  L RL+L+ N L+ + P LS L
Sbjct  151   SFSGNIPASLSSLSNLQQLSLDDNSLEGPIPATFNNLTSLVRLELNGNNLSDRFPMLSAL  210

Query  918   WQLNTLALSSNQF----FAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
              +LN L +S NQ      A +PP  V+L     G +        ++ +  L  LDLS N+
Sbjct  211   GKLNFLDVSDNQLSGPILAVVPPSLVQLSLRNNGLSGELRL--NLAGMSMLQVLDLSHNK  268

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
              SGP+   +   P L ++ +S N FT ++V  S   +S+L  +D   N + G LP+ + T
Sbjct  269   LSGPLPSGLFDHPALEQLTLSYNRFTSLQVPGSYGTDSQLIAVDLSYNRIHGPLPVFMAT  328

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMT-GGE  412
               +L  ++L +N F G IP +Y  R+ +            L  N+L G +P+ FM    +
Sbjct  329   MPSLSALSLQYNYFTGIIPLQYAKRVSASLAGKEPLVRLFLAGNFLFGEIPTPFMNLSTQ  388

Query  411   KARASLDHNC-LNCPDHLPWCLGG-QRPASQCR  319
             +   S   NC L+CP  L +C GG Q+ AS CR
Sbjct  389   EVNVSFGDNCLLDCPKSLFFCQGGDQKAASTCR  421



>ref|XP_002965556.1| hypothetical protein SELMODRAFT_84581 [Selaginella moellendorffii]
 gb|EFJ32976.1| hypothetical protein SELMODRAFT_84581 [Selaginella moellendorffii]
Length=409

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 145/390 (37%), Positives = 215/390 (55%), Gaps = 15/390 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATGT-HFL-GILCMTPSDN  1282
             A TL SD+Q L+  K ++DP+S+   + L SW+    DPC++  T HF+ GI C +  D 
Sbjct  19    ASTLSSDLQALKDVKAAVDPSSIHSTTCLGSWDFAAADPCDSRSTSHFVCGIGC-SSDDP  77

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
              S R+  + L+G G  G L+P +G+LT L  L+ + N F G IP S+  L  + +L LS 
Sbjct  78    LSRRVISLILDGSGYNGTLSPSLGSLTALQVLDFSGNSFHGTIPASLGQLTSLIKLDLSR  137

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N F+G +P  + +L  L  + V++N L G IP++I  L  + RL L NN+L GKIP L G
Sbjct  138   NSFTGAIPDTISQLSNLSYLSVANNHLEGPIPSSIANLSTIERLFLHNNQLAGKIPSLDG  197

Query  921   LWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRF  748
             L +L+    S+N+  + LP   PV L  L L  N L G     +++L+ L  LDLS N+F
Sbjct  198   LQRLSYFDASNNR-LSELPLKLPVSLLQLSLRSNQLGGSFPQNLAQLQGLEVLDLSYNQF  256

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             +G +   +  LP L ++ VS N    + V + S  ES L  +D   N L+G LP+ +   
Sbjct  257   AGHLDSSLFELPSLQQLTVSHNQIASLGVPRLSNVESELVAVDISYNQLEGALPVFLANI  316

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMTGGEKA  406
               L  ++L +N F G IP E+ S+  S  + +       L+ NYL G +P  F+    + 
Sbjct  317   SRLSALSLRYNNFSGTIPYEFASKASSASKEVQPLMRLFLDGNYLIGEVPQPFLEVPGRF  376

Query  405   RASLDHNCL-NCPDHLPWCL-GGQRPASQC  322
              AS  +NCL  CP+   +C  GGQRP S+C
Sbjct  377   SASFIYNCLAKCPESFAFCQGGGQRPKSEC  406



>gb|EPS62359.1| hypothetical protein M569_12432, partial [Genlisea aurea]
Length=351

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 138/380 (36%), Positives = 196/380 (52%), Gaps = 33/380 (9%)
 Frame = -3

Query  1434  DVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNSSGRISV  1261
             DV  LR+FK ++ P SV  AS L++W+   DPC A    +   GI C      S GR+  
Sbjct  1     DVSGLRAFKSALKPGSVPLASCLATWDFSGDPCAAPRITSFTCGITC------SDGRVVQ  54

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             + L+  G  G L+P I  LT L  L+L  N F GPIP+SI +L  +  L+LS N FSG +
Sbjct  55    LTLDSQGYSGELSPAISELTHLEALDLGENDFHGPIPESISSLSNLRTLILSRNSFSGAI  114

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTL  901
                +  +R LE +D+S N L+G IP  + +L  LTRLDLS N L+G +P+L     LN L
Sbjct  115   SPSIAAIRSLETLDLSRNSLAGRIPPELKSLSGLTRLDLSYNNLSGPLPELPK--NLNEL  172

Query  900   ALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIV  721
             AL +N     L                     S+   L  L  L+LS+N F+G +   I 
Sbjct  173   ALKANSLSGPLSE-------------------SSFHELSQLMVLELSENSFTGVLGSWIF  213

Query  720   TLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLG  541
              LP L +I++++N FT ++V   +    +L  +D   N ++G L  N   +  L++++L 
Sbjct  214   RLPSLQQIDLASNSFTAVDV--GAEPNGQLVAVDLSRNKIEGFLTENFARFTTLRSLSLS  271

Query  540   HNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL-NCPDH  364
              N+F G IP EYG R     + L L+ NYL G+ P  F +G      SL  NCL  CP  
Sbjct  272   CNQFRGPIPSEYG-RKGLGLQRLYLDGNYLNGSPPVAFFSGDGTLSGSLGDNCLRRCPTS  330

Query  363   LPWCLGGQRPASQCRRSAGG  304
                CL  Q+P   C+ + GG
Sbjct  331   SELCLKSQKPVKICQLAYGG  350



>ref|XP_008373089.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=415

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 139/388 (36%), Positives = 202/388 (52%), Gaps = 32/388 (8%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCMTPSD  1285
             + A T  SD+  L++FK ++ P+S+ P S L+SW+   DPC     THF  G+ C     
Sbjct  50    IQALTSPSDISALKAFKSAVKPSSIPPWSCLASWDFTTDPCAVPRRTHFTCGVTC----S  105

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
               S R++ I L+     G LTP I  LT LTTL+L  N F G IP SI +L  +  L L 
Sbjct  106   PDSTRVTQITLDPAAYSGTLTPLISQLTNLTTLDLADNSFSGAIPSSISSLSNLQTLTLQ  165

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG LP  +  L+ LE +D+SHN LSG +P T+ +L  L RLDLS N+L G IP L 
Sbjct  166   SNSFSGSLPPAISNLKSLESLDISHNLLSGFLPNTLNSLPNLRRLDLSFNKLAGTIPKLP  225

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LAL  N     +P                    S  + L  L  ++LS+N F+
Sbjct  226   P--NLLELALKHNSLSGSIPE-------------------SVFAGLTQLEVIELSENSFA  264

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G +       P L +++++ N  T +E+  +   E  L  LD   N ++G++P+N  +Y 
Sbjct  265   GTLQSWFFLQPSLQQVDLANNSLTGVEIPPNGGGE--LVALDLGFNRIEGYVPVNFGSYP  322

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHN  385
              L +++L +NR  G+IP EYG   +   + L L+ N+L G  P+  +TGG     SL  N
Sbjct  323   VLSSLSLRYNRLRGRIPVEYG--RKKSLKRLYLDGNFLIGQPPAGLVTGGNGVSGSLGDN  380

Query  384   CLN-CPDHLPWCLGGQRPASQCRRSAGG  304
             CL  CP     C+  Q+P + C+++ GG
Sbjct  381   CLQACPASSNLCMPSQKPNAICKQAYGG  408



>ref|XP_002983042.1| hypothetical protein SELMODRAFT_117682 [Selaginella moellendorffii]
 gb|EFJ15851.1| hypothetical protein SELMODRAFT_117682 [Selaginella moellendorffii]
Length=409

 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 142/389 (37%), Positives = 211/389 (54%), Gaps = 13/389 (3%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATGT-HFLGILCMTPSDNS  1279
             A TL SD+Q L+  K ++DP+S+   + L SW+    DPC++  T HF+  +  +  D  
Sbjct  19    ASTLSSDLQALKDVKAAVDPSSIHSTTCLGSWDFAAADPCDSRSTSHFVCGIGCSSDDPL  78

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R+  + L+G G  G L+P +G+LT L  L+ + N F G IP S+  L  + +L LS N
Sbjct  79    SRRVISLILDGSGYNGTLSPSLGSLTALQVLDFSGNSFHGTIPASLGQLTSLIKLDLSRN  138

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              F+G +P  + +L  L  + V++N L G IP++I  L  + RL L NN+L GKIP L GL
Sbjct  139   SFTGAIPDTISQLSNLSYLSVANNHLEGPIPSSIANLSTIERLFLHNNQLAGKIPSLDGL  198

Query  918   WQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFS  745
              +L+    S+N+  + LP   PV L  L L  N L G     + +L+ L  LDLS N+F 
Sbjct  199   QRLSYFDASNNR-LSELPLKLPVSLLQLSLRSNQLGGSFPQNLVQLQGLEVLDLSYNQFV  257

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G +   +  LP L ++ VS N  + + V + S  ES L  +D   N L+G LP+ +    
Sbjct  258   GHLDSSLFELPSLQQLTVSHNQISSLGVPRLSNVESELVAVDISYNQLEGALPVFLANIS  317

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMTGGEKAR  403
              L  ++L +N F G IP E+ S+  S    +       L+ NYL G +P  F+    +  
Sbjct  318   RLSALSLRYNNFSGTIPYEFASKASSASNEVQPLMRLFLDGNYLIGEVPQPFLEVPGRFS  377

Query  402   ASLDHNCL-NCPDHLPWCL-GGQRPASQC  322
             AS  +NCL  CP+   +C  GGQRP S+C
Sbjct  378   ASFIYNCLAKCPESFAFCQGGGQRPKSEC  406



>ref|XP_002298744.2| hypothetical protein POPTR_0001s30880g [Populus trichocarpa]
 gb|EEE83549.2| hypothetical protein POPTR_0001s30880g [Populus trichocarpa]
Length=378

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 138/378 (37%), Positives = 196/378 (52%), Gaps = 30/378 (8%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHFL-GILCMTPSDNS  1279
             A T   D+  L++FK S+ P+S+ P S L+SW+   DPC     THF+ GI C       
Sbjct  25    ALTSPQDISALKAFKASVKPSSIQPWSCLASWDFTTDPCAFPRRTHFICGITC----SPD  80

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G LTP I  LT LT L+L  N F GPIP SI +L  +  L LS N
Sbjct  81    STRVTQLTLDPAGYSGQLTPLISLLTSLTILDLVDNNFYGPIPSSISSLINLQTLTLSSN  140

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L+ LE +D SHN LSG +P T+ ++  L RLDLS N+LTG +P L   
Sbjct  141   SFSGAVPNSITNLKSLESLDFSHNYLSGYLPKTMNSMSSLRRLDLSYNKLTGPLPKLP--  198

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
             + L  LAL +N                       +   S+  RL  L  ++LS+N F+G 
Sbjct  199   YNLLELALKANS-------------------LSGSLSKSSFDRLTGLEVVELSENSFTGT  239

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
             +      LP L +++++ N  TR+E++K S   S L  +D   N ++G+ PL+   Y  L
Sbjct  240   LEPWFFLLPALQQVDLANNSLTRVEISKPSDANSDLVAVDLGFNKIEGNAPLHFADYPLL  299

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
              +++L +NR  G IP EY    +   R L L+ N+L G  P  F         SL  NCL
Sbjct  300   SSLSLRYNRLRGTIPLEYS--RKKSLRRLFLDGNFLIGKPPPAFFAADTSVSGSLGDNCL  357

Query  378   N-CPDHLPWCLGGQRPAS  328
               CP     C+  Q+P+S
Sbjct  358   QACPGSFQLCMPTQKPSS  375



>ref|XP_006855205.1| hypothetical protein AMTR_s00051p00180000 [Amborella trichopoda]
 gb|ERN16672.1| hypothetical protein AMTR_s00051p00180000 [Amborella trichopoda]
Length=384

 Score =   186 bits (471),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 139/383 (36%), Positives = 204/383 (53%), Gaps = 30/383 (8%)
 Frame = -3

Query  1449  KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLD-LDPCEATG-THFL-GILCMTPSDNS  1279
             KTL+SD++ L +FK +ID  S+   S L+SW+   +DPC+    THF+ GI C   + +S
Sbjct  22    KTLDSDIRALVAFKAAIDSASIPSWSCLASWDFSSVDPCDTPRRTHFICGITCDNSTTSS  81

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             + R++ + L+  G  G +TP + +LT LT L+L+ N FRGPIP S+ +L  +T L LS N
Sbjct  82    AARVTALALDSAGYAGPITPRLADLTALTLLDLSSNSFRGPIPPSLASLPSLTTLALSTN  141

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
               SG LP  +  L  L+ +D+S N+  G IP  +  +  L  LDLS N L+G +PDL   
Sbjct  142   SLSGPLPPSLPNLTSLQSLDLSQNQFRGRIPIALHLMSSLNHLDLSFNALSGALPDLPS-  200

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
               L  LA+  N     L                        S L +L  L+LSDN+ +G 
Sbjct  201   -NLVVLAVKGNLLTGAL-------------------FRRVFSSLEHLAVLELSDNQLNGK  240

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
             +   +  LP L +IN+S N  + +EV KSST    L  +D   N LQG LP N      L
Sbjct  241   LGGWLFALPALQQINLSNNKLSALEVWKSST----LVAVDLSYNRLQGLLPTNFSLLPLL  296

Query  558   KTVNLGHNRFFGKIPKEYGsrlrs-lwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
               ++L HN+F+G +P+EYG  +     R + L+ N+L+G +P  F         S+  NC
Sbjct  297   AALSLRHNQFWGPLPREYGQMVAEGRVRRMYLDSNFLQGNVPPAFFKFSGTLTGSVGDNC  356

Query  381   L-NCPDHLPWCLGGQRPASQCRR  316
             L NCP  L +C+  Q+ A+  R+
Sbjct  357   LRNCPPTLSFCMPPQKSAASYRQ  379



>ref|XP_007143042.1| hypothetical protein PHAVU_007G038700g [Phaseolus vulgaris]
 gb|ESW15036.1| hypothetical protein PHAVU_007G038700g [Phaseolus vulgaris]
Length=399

 Score =   186 bits (471),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 141/395 (36%), Positives = 203/395 (51%), Gaps = 36/395 (9%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHFL-GILCMTPS  1288
              + A T   DV  L++FKDSI P+S+  +S L+SWN   DPC     T F+ G  C    
Sbjct  24    LVQALTSPLDVAALKAFKDSIKPSSIASSSCLASWNFTTDPCSLPRRTSFICGFTCTA--  81

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
                S RIS I L+  G  G LTP I  L++LTTL+L+ N F G IP SI +L  +  L L
Sbjct  82    --DSRRISQITLDPAGYSGTLTPLISRLSQLTTLDLSDNSFFGSIPSSISSLYNLQTLTL  139

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
               NFFSG +P  +  L+ L+ +D+SHN L G +  ++ +L +L RLDLS N+LTG IP L
Sbjct  140   RSNFFSGPIPPSITTLKSLQSLDLSHNSLYGYLLNSMNSLTKLRRLDLSFNKLTGSIPKL  199

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
                  L  LA+ +N  +  L                      +   +  L  ++LSDN+ 
Sbjct  200   PP--NLLELAIKANYLYGPL-------------------QKQSFEGMNQLEVVELSDNKL  238

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKE------SRLQVLDAHSNLLQGHLP  586
             SG +   + +LP L ++N+S N FT ++++ S   +      S L  LD   N ++G+ P
Sbjct  239   SGTVESWLFSLPSLQQVNLSNNTFTAVQISGSRAADGGTGSRSNLVALDLGFNRIRGYAP  298

Query  585   LNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKA  406
              N+ ++  L ++++ HN   G IP EYG       R L L+ N+L G  P+  +  G   
Sbjct  299   ANLASFPALSSLSIRHNALRGAIPLEYG--HIKSLRRLFLDGNFLSGNPPAGLVAAGTTV  356

Query  405   RASLDHNCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
               SL  NCL  CP   P C   Q+  S C+R  GG
Sbjct  357   SGSLGDNCLQACPRSSPLCSPPQKAISVCKRGYGG  391



>ref|XP_002977299.1| hypothetical protein SELMODRAFT_443476 [Selaginella moellendorffii]
 gb|EFJ21303.1| hypothetical protein SELMODRAFT_443476 [Selaginella moellendorffii]
Length=428

 Score =   186 bits (473),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 138/398 (35%), Positives = 213/398 (54%), Gaps = 23/398 (6%)
 Frame = -3

Query  1449  KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSG-  1273
              T   D++ L+  K +IDP ++ P+S L+SW+   DPC +  T F   +C     N +  
Sbjct  28    STAAVDIEALKELKAAIDPATIAPSSCLASWDFSHDPCASISTSFF--VCGFRCSNGAHP  85

Query  1272  -RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
              RI+ I L+  G  G L+P +GNL+ L  L+++ N F G IP+S+ NLR + +L LS+N 
Sbjct  86    MRITEITLDNVGYAGSLSPYLGNLSSLQVLDVSGNAFHGSIPESLSNLRSLLKLELSQNS  145

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW  916
              SG +P+ + RL KLE + ++ N + G +PA++  L  L RL +SNN L+G IP ++ + 
Sbjct  146   ISGWIPQSLGRLDKLEYLSLASNAIEGPLPASLNRLHSLERLAVSNNRLSGPIPLMTAMS  205

Query  915   QLNTLALSSNQFFA-GLPPFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFSG  742
              L     S+N+F        P+ L  + L +N L G +  ++++L  L  LDLS N   G
Sbjct  206   SLLYFDGSTNRFSGWAQSELPLSLMVISLRNNQLQGRLPESLTKLEQLEVLDLSHNDLRG  265

Query  741   PILHRIVTLPELMRINVSANHFTRIEVT------KSSTKESRLQVLDAHSNLLQGHLPLN  580
             P+   + TLP L ++N++ N F  +  T      + +   S+L  +D   N  QG LP+ 
Sbjct  266   PVPASLFTLPSLQQLNLAYNQFVSVLATPGLAEWEQAADSSQLIEIDLSFNQFQGRLPVF  325

Query  579   IITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnl------nLEYNYLEGTLPSEFMT-  421
              +    L  ++LGHN+F G IP EY  +   +           LE N+L G LPS F++ 
Sbjct  326   FVQMKRLTALSLGHNQFSGLIPIEYALKAVRMLIGAEPLMRLYLESNFLAGELPSPFLSI  385

Query  420   -GGEKARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
               GE    S   NCL  CP  L +C GG QR  ++C +
Sbjct  386   VPGE-VSGSFVGNCLQRCPAELFFCQGGQQRSPAECSK  422



>ref|XP_002971932.1| hypothetical protein SELMODRAFT_412673 [Selaginella moellendorffii]
 gb|EFJ26849.1| hypothetical protein SELMODRAFT_412673 [Selaginella moellendorffii]
Length=428

 Score =   184 bits (468),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 138/398 (35%), Positives = 212/398 (53%), Gaps = 23/398 (6%)
 Frame = -3

Query  1449  KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSG-  1273
              T   D++ L+  K +IDP ++ P+S L+SW+   DPC +  T F   +C     N +  
Sbjct  28    STAAVDIEALKELKAAIDPATIAPSSCLASWDFSHDPCASISTSFF--VCGFRCSNGAHP  85

Query  1272  -RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
              RI+ I L+  G  G L+P +GNL+ L  L+++ N F G IP+S+ NLR + +L LS+N 
Sbjct  86    MRITEITLDNVGYAGSLSPYLGNLSSLQVLDVSGNAFHGSIPESLSNLRSLLKLELSQNS  145

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW  916
              SG +P+ + RL KLE + ++ N + G +PA++  L  L RL +SNN L+G IP ++ + 
Sbjct  146   ISGWIPQSLGRLDKLEYLSLASNAIEGLLPASLNRLHSLERLAVSNNRLSGPIPLMTAMS  205

Query  915   QLNTLALSSNQFFA-GLPPFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFSG  742
              L     S+N+F        P+ L  + L +N L G +  ++++L  L  LDLS N   G
Sbjct  206   SLLYFDGSTNRFSGWAQSELPLSLMVISLRNNQLQGRLPGSLTKLEQLEVLDLSHNDLRG  265

Query  741   PILHRIVTLPELMRINVSANHFTRIEVT------KSSTKESRLQVLDAHSNLLQGHLPLN  580
             P+   + TLP L ++N++ N F  +  T      +     S+L  +D   N  QG LP+ 
Sbjct  266   PVPASLFTLPSLQQLNLAYNQFVSVLATPGLAEWEQVADSSQLIEIDLSFNKFQGRLPVF  325

Query  579   IITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnl------nLEYNYLEGTLPSEFMT-  421
              +    L  ++LGHN+F G IP EY  +   +           LE N+L G LPS F++ 
Sbjct  326   FVQMKRLTALSLGHNQFSGLIPIEYALKAVRMLIGAEPLMRLYLESNFLAGELPSPFLSI  385

Query  420   -GGEKARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
               GE    S   NCL  CP  L +C GG QR  ++C +
Sbjct  386   VPGE-VSGSFVGNCLQRCPAELFFCQGGQQRSPAECSK  422



>ref|XP_006829151.1| hypothetical protein AMTR_s00001p00269630 [Amborella trichopoda]
 gb|ERM96567.1| hypothetical protein AMTR_s00001p00269630 [Amborella trichopoda]
Length=404

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 137/386 (35%), Positives = 198/386 (51%), Gaps = 18/386 (5%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT-GTHF-LGILCMTPSDNSSG  1273
             TL+ DVQ L   +D ++  S+ P S L+SW+  LDPC++  G  F  G  C        G
Sbjct  20    TLDGDVQGLMQLRDGVESASITPGSCLASWDFTLDPCDSLFGERFTCGFRC------EQG  73

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R++ I L+G G  G L P +G+L  L TL+L+ N   GP+P S+  L  + RL+LS N F
Sbjct  74    RVTEITLDGAGYSGSLAPGVGSLLALKTLDLSNNALSGPLPSSLSKLTSLQRLVLSRNAF  133

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
             SG +P  +  L  LE + + +NR  G I  ++TA   L RL+L NN L+G +PD+S L  
Sbjct  134   SGQIPPAISSLASLEELYLDNNRFQGLISPSLTAFHGLRRLELQNNALSGVLPDMSALPN  193

Query  912   LNTLALSSNQF---FAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG  742
             L  L  S NQ     AGLPP  V L                +  L++L  +DLS N+ SG
Sbjct  194   LYFLDASDNQISGGIAGLPPSLVELSMRNNKLEGDLP--ENLGDLKWLQVMDLSHNQLSG  251

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
              +   +   P L ++ +S N F++++V  +    S L  +D   N +QG LP+ +     
Sbjct  252   ALPSVLFEHPSLQQLTLSHNAFSQLQVPSNFGASSELIAVDLGYNKIQGLLPVFVTMMPK  311

Query  561   LKTVNLGHNRFFGKIPKEYGsrlrsl--wrnlnLEYNYLEGTLPSEFMT-GGEKARASLD  391
             L  ++L  N F G +P EY  +  ++     L L  NYL G +PS FM    +    SL 
Sbjct  312   LSALSLESNCFTGLVPAEYAVKAAAVPGVVRLLLSGNYLYGPIPSSFMILKPDSVTVSLV  371

Query  390   HNC-LNCPDHLPWCLGG-QRPASQCR  319
              NC + CP    +C GG Q+  S CR
Sbjct  372   DNCFMRCPASFFFCQGGAQKTLSACR  397



>ref|XP_010270975.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=393

 Score =   182 bits (461),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 135/388 (35%), Positives = 199/388 (51%), Gaps = 30/388 (8%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT--GTHFLGILCMTPSD  1285
             + A TL SD   L++FK++I P ++ P S L+SWN   DPC          GI C    +
Sbjct  24    VQALTLPSDTSALKAFKEAIKPTTIPPWSCLASWNFSCDPCSLPRRSDFICGITC----N  79

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             + S R++ + L+  G  G L+P +  LT+LT L+L+ N F GPIP S+ +L  +  L L 
Sbjct  80    SDSTRVTALVLDPAGYSGTLSPLLSKLTQLTHLDLSDNSFYGPIPSSLSSLTNLQTLSLR  139

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG     + +L  L  +D+SHN L+GS+P T+++L  L  +DLS N+LTG +P L 
Sbjct  140   SNSFSGSFSPSLTQLPSLSFLDISHNALTGSLPQTMSSLSSLRTIDLSFNKLTGSLPKLP  199

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LA+ +N     L                     S+      L  ++LS N F+
Sbjct  200   S--NLLELAIKANSLTGPL-------------------LQSSFQGSPRLEVVELSGNMFN  238

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G I      LP L ++++S N FT +E++K S     L  +D   N ++G+LP+N  +Y 
Sbjct  239   GVIKGWFFQLPSLQQVDLSNNSFTGLEISKPSDANGNLVAVDLGFNSIEGYLPVNFASYP  298

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHN  385
              L +++L +NRF G IP EY        R L L+ N+L G  P  F + G     S   N
Sbjct  299   LLSSLSLRYNRFRGPIPMEYS--NNLSLRRLFLDGNFLNGKAPLGFFSDGSSVSGSFGDN  356

Query  384   CL-NCPDHLPWCLGGQRPASQCRRSAGG  304
             CL +CP+    CL  Q+P S CR +  G
Sbjct  357   CLQSCPNSSRLCLPSQKPNSICRHAYDG  384



>ref|XP_011001048.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1 
[Populus euphratica]
Length=385

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 134/384 (35%), Positives = 196/384 (51%), Gaps = 32/384 (8%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCMTPSDNSSG  1273
             TL  D+  L++FK S+ P+S+ P S L+SW+   DPC +   T F  GI C       S 
Sbjct  27    TLPQDISALKAFKASVKPSSIQPWSCLASWDFIADPCASPRRTRFTCGITC----SPDST  82

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R++ + L+  G  G LTP I  LT L  L+L  N F GPIP SI +L  +  L L  N F
Sbjct  83    RVTQLTLDSAGYSGRLTPLISQLTSLIILDLADNSFFGPIPSSISSLINLQTLTLRSNSF  142

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
             SG +P  +  L+ LE +D+SHN LSG +P T+ ++  L RLDLS N+LTG +P L   + 
Sbjct  143   SGSVPDSITNLKSLESLDLSHNSLSGYLPKTMNSMSSLRRLDLSYNKLTGSLPKLP--YN  200

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L  LAL +N     L                     S+   L  L  ++LS+N  +G + 
Sbjct  201   LLELALKANYLSGSL-------------------SKSSFDSLSQLEVVELSENSLTGTLG  241

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKT  553
                  LP L +++++ N  TR+E+ K +  E  L  +D   N ++G+ PL+   Y  L +
Sbjct  242   SWFFLLPGLQQVDLANNSLTRLEIPKPANSE--LVAVDLGFNKIEGNAPLHFADYPLLSS  299

Query  552   VNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLN-  376
             ++L +N   G IP EY    +   R L L+ N+L G  P  F         S+  NCL  
Sbjct  300   LSLRYNSLRGTIPLEYS--RKKSLRRLFLDGNFLIGKPPPAFFAADTSVSGSIGDNCLQA  357

Query  375   CPDHLPWCLGGQRPASQCRRSAGG  304
             CP     C+  Q+P+S C+++ GG
Sbjct  358   CPGSSQLCMPLQKPSSICKQAYGG  381



>ref|XP_009335003.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=412

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 136/388 (35%), Positives = 200/388 (52%), Gaps = 32/388 (8%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHF-LGILCMTPSD  1285
             + A T  SD+  L++FK ++ P+S+ P S L+SW+   DPC      HF  G+ C     
Sbjct  47    IQALTSPSDISALKAFKSAVKPSSIPPWSCLASWDFTTDPCAIPRRPHFTCGVTC----S  102

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
               S R++ I L+     G L+P I  LT LTTL+L  N F G IP SI +L  +  L L 
Sbjct  103   PDSTRVTQITLDPAAYSGTLSPLISQLTNLTTLDLADNSFSGAIPSSISSLSNLQTLTLQ  162

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG LP  +  L+ LE +D+SHN LSG +P T+ +L  L RL  S N+L G IP L 
Sbjct  163   SNSFSGSLPPALSNLKSLESLDISHNLLSGFLPNTLNSLPNLRRLAPSVNKLAGTIPKLP  222

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LAL  N     +P                    SA + L  L  ++LS+N FS
Sbjct  223   P--NLLELALKHNSLSGSIPE-------------------SAFAGLTQLEVIELSENSFS  261

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G +      LP L +++++ N  T +E+  +   +  L  LD   N ++G++P+N  +Y 
Sbjct  262   GTLQSWFFLLPSLQQVDLANNSLTGVEIPPNGGGD--LVALDLGFNRIEGYVPVNFGSYP  319

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHN  385
              L +++L +NR  G+IP EYG   +   + L L+ N+L G  P+  +TGG     SL  N
Sbjct  320   MLSSLSLRYNRLRGRIPVEYG--RKKSLKRLYLDGNFLIGQPPAGLVTGGNGVSGSLGDN  377

Query  384   CLN-CPDHLPWCLGGQRPASQCRRSAGG  304
             CL  CP     C+  Q+P + C+++  G
Sbjct  378   CLQACPASSNLCIPPQKPNAICKQAYAG  405



>ref|XP_006487018.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130-like [Citrus sinensis]
Length=388

 Score =   177 bits (448),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 137/386 (35%), Positives = 202/386 (52%), Gaps = 31/386 (8%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCE-ATGTHF-LGILCMTPSDN  1282
             A T   D+  L++FK SI P+S+ P S L+SW+    DPC     THF  G+LC     +
Sbjct  25    ALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLC----SS  80

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
              S R++ + L+  G  G LTP I  LT+LT L+L+ N F GPIP SI +L  +  L L  
Sbjct  81    DSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQLLTLRS  140

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FS  +P  + +L+ L+ +D+S+N LSGS+P     +  L RLDLS N+LTG +P L  
Sbjct  141   NSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPP  200

Query  921   LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG  742
                L+ LAL +N   +G+                     ++   L  L  ++LS+N F+G
Sbjct  201   --NLSELALKNN-VLSGV------------------ITKNSFDGLTQLEVIELSENSFTG  239

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
              +      LP L ++N+S N  TR+E++K     S L  +D   N +QG+LP+N   Y  
Sbjct  240   TLEAWFFLLPALQQVNLSNNTLTRVEISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPM  299

Query  561   LKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
             L ++++ +NR  G IP E+    +   + L L+ N+L G  P  F TG      SL  NC
Sbjct  300   LSSLSMRYNRLRGGIPLEFS--HKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNC  357

Query  381   LN-CPDHLPWCLGGQRPASQCRRSAG  307
             L  CP     C   Q+  S C+++ G
Sbjct  358   LQGCPVSSQLCSPSQKSYSVCKQAYG  383



>ref|XP_002280730.1| PREDICTED: receptor-like protein kinase 5 [Vitis vinifera]
 emb|CBI19793.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   177 bits (448),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 138/393 (35%), Positives = 201/393 (51%), Gaps = 15/393 (4%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDN  1282
             +++T   D+Q+L+ FK+ ++P S+ P S LSSW+  +DPC+   +     G  C      
Sbjct  29    DSRTHSGDIQILKDFKNGLNPGSITPGSCLSSWDFSVDPCDYLFSDRFTCGFRCDRLVAG  88

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
             +S R++ I L+  G  G L+    NL  L  L+L+ N F G IPDS  NL ++ RL LS 
Sbjct  89    AS-RVTEITLDQAGYTGTLSSSTWNLPFLQFLDLSDNSFSGSIPDSFSNLTRLRRLTLSR  147

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FSG +P  +  L  LE + + +N L G IPA+I  L  L +L+L  N L+G  PDL  
Sbjct  148   NSFSGEIPNSLGSLPNLEELYLDNNHLQGPIPASINGLISLKKLELQENALSGAFPDLGS  207

Query  921   LWQLNTLALSSNQFFAGL-PPFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRF  748
             L  L  L  S NQ    +    P  L  L + +N L G++   +  L+YL  +DLSDN+ 
Sbjct  208   LKNLYFLDASDNQICGQITTALPASLLELSIRNNNLEGNLPHRLGSLKYLQVMDLSDNKL  267

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG I   +   P L ++ +S N+F+ ++V  +  + S+L  LD   N L G LP  I + 
Sbjct  268   SGVISWIVFDHPSLQQLTLSHNNFSLLQVPSNMGEGSKLIALDLSYNQLGGLLPAFIASM  327

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY-------NYLEGTLPSEFM-TGGE  412
              NL  V+L HN+F G IP +Y  +           +       NYL G +P   M     
Sbjct  328   PNLSAVSLEHNKFTGMIPSQYALKTVVGGGGGTASFERLLLGGNYLFGPIPGPLMFLKPG  387

Query  411   KARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
              A  SL  NCL  CP+   +C GG Q+    C+
Sbjct  388   YANVSLVDNCLYRCPNSFFFCQGGTQKSLVDCK  420



>ref|XP_010547451.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Tarenaya hassleriana]
Length=417

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 144/398 (36%), Positives = 207/398 (52%), Gaps = 18/398 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT-GTHF-LGILCMTPSDNS  1279
             +KT  +DV+ L+ FK+S+D +S  P S LSSW+  +DPC++  G  F  G  C   + + 
Sbjct  19    SKTFWADVEALKEFKNSVDADSASPGSCLSSWDFSVDPCDSLFGERFTCGFRCDAVA-SG  77

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             SGR++ + L+  G  G L+    NL  L TL+L  N F G +PDS+ NL ++TRL+LS N
Sbjct  78    SGRVTELSLDQAGYSGSLSSVSFNLPYLQTLDLTGNYFSGQLPDSLSNLTQLTRLVLSRN  137

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  +  LE + V +NRL G +PA+   L  L RL++  N L+G+ PDL  L
Sbjct  138   SFSGSIPGSIGSISGLEELLVDNNRLEGPVPASFNGLSVLKRLEIQFNNLSGEFPDLGLL  197

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTA---LDLSDNRF  748
               L  L  S N  F+GL P  +    + +         +    LR LT+   LDLS NR 
Sbjct  198   KNLYYLDASDNS-FSGLIPSSLPESLVQVSLRNSFIEGTIPESLRQLTSLQVLDLSHNRL  256

Query  747   SGPILHRIVTLPELMRINVSANHFTRIE--VTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
             SG I   I TL  L ++ +S+N FT ++      S   S L  +D  SN +QG LPL + 
Sbjct  257   SGSIPSFIFTLSSLQQLTLSSNRFTSVQSPYYSPSGLPSELIAVDLSSNDIQGTLPLFMG  316

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFMT-GG  415
                 L  ++L +N+F G IP +Y  +  S   +L          N+L G +P   M    
Sbjct  317   LLPKLSALSLENNKFSGMIPTQYVWKTVSPGSDLAAFERLLLGGNFLFGAIPGPLMELKP  376

Query  414   EKARASLDHNCLN-CPDHLPWCLG-GQRPASQCRRSAG  307
               A   L  NCL  CP    +C G  QRP ++CR+  G
Sbjct  377   GSANVQLAGNCLFWCPSTFFFCQGRDQRPLAECRKFGG  414



>ref|XP_002313141.2| hypothetical protein POPTR_0009s10000g [Populus trichocarpa]
 gb|EEE87096.2| hypothetical protein POPTR_0009s10000g [Populus trichocarpa]
Length=382

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 132/384 (34%), Positives = 194/384 (51%), Gaps = 32/384 (8%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCMTPSDNSSG  1273
             TL  D+  L++FK S+ P+S+ P S L+SW+   DPC     T F  GI C       S 
Sbjct  24    TLPQDISALKAFKASVKPSSIQPWSCLASWDFIADPCAVPRRTRFTCGITC----SPDST  79

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R++ + L+  G  G LTP    LT L  L+L  N F GPIP SI +L  +  L L  N F
Sbjct  80    RVTQLTLDSAGYSGRLTPLTSQLTSLIILDLADNNFFGPIPSSISSLINLQTLTLRSNSF  139

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
             SG +P  +  L+ LE +D+SHN LSG +P T+ ++  L RLDLS N+LTG +P L   + 
Sbjct  140   SGSVPDSITNLKSLESLDLSHNSLSGYLPKTMNSMSSLRRLDLSYNKLTGSLPKLP--YN  197

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L  LAL +N                       +   S+   L  L  ++LS+N  +G + 
Sbjct  198   LLELALKANS-------------------LSGSLSKSSFDSLTQLEVVELSENSLTGTLE  238

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKT  553
                  LP L +++++ N  TR+E+ K +   S L  +D   N ++G+ PL+   Y  L +
Sbjct  239   SWFFLLPALQQVDLANNSLTRLEIPKPA--NSDLVAVDLGFNKIEGNAPLHFADYPLLSS  296

Query  552   VNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLN-  376
             ++L +N   G IP EY    +   R L L+ N+L G  P  F         S+  NCL  
Sbjct  297   LSLRYNSLRGTIPLEYS--RKKSLRRLFLDGNFLIGKPPPAFFAADRSVSGSIGDNCLQA  354

Query  375   CPDHLPWCLGGQRPASQCRRSAGG  304
             CP     C+  Q+P+S C+++ GG
Sbjct  355   CPGSSQLCMPSQKPSSICKQAYGG  378



>ref|XP_004496960.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like [Cicer arietinum]
Length=388

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 132/381 (35%), Positives = 193/381 (51%), Gaps = 31/381 (8%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THFL-GILCMTPSDNSSG  1273
             T  SD++ L++FK SI P+S+ P S L+SWN  +DPC     T+F+ G  C   S N   
Sbjct  28    TSSSDIEALKAFKASIKPSSITPYSCLASWNFTIDPCSVPHRTYFICGFTCTLDSKN---  84

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
              I+ I L+  G  G LTP I  LT+L TL+L+ N F G IP S+ +L  +  L L  N F
Sbjct  85    -INQITLDPAGYSGTLTPLISQLTQLVTLDLSDNNFFGSIPFSLSSLSNLKTLTLRSNSF  143

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
             SG +P  +  L+ LE ID SHN L+GS+P ++ +L  L R+DLS N+  G IP L     
Sbjct  144   SGSIPSSITTLKSLESIDFSHNSLTGSLPNSLNSLSSLRRIDLSFNKFIGSIPILPP--N  201

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L  LA+ +N     L                     +     + L  ++LS+N  +G I 
Sbjct  202   LIELAIKANSLSGSLQK-------------------TTFLGSKQLEVVELSENVLNGMIE  242

Query  732   HRIVTLPELMRINVSANHFTRIEVTK-SSTKESRLQVLDAHSNLLQGHLPLNIITYLNLK  556
                + LP L ++N+  N FT I++++      + L  L+   N +QG+ P+N+  Y  L 
Sbjct  243   DWFLLLPSLQQVNLENNSFTGIQISRPVKDGGNNLVALNIGFNKIQGYAPVNLAAYPMLS  302

Query  555   TVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL-  379
              +++ HN   G IP EYG       + L L+ N+  G  P+  ++ G     SL  NCL 
Sbjct  303   FLSMSHNSLRGTIPLEYG--KIKSIKKLFLDGNFFVGKPPTGLLSAGGGVSGSLGDNCLE  360

Query  378   NCPDHLPWCLGGQRPASQCRR  316
              CP     C   Q+P S C+R
Sbjct  361   GCPTSSQLCKPAQKPISVCKR  381



>gb|KDO59800.1| hypothetical protein CISIN_1g016534mg [Citrus sinensis]
Length=388

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 136/386 (35%), Positives = 201/386 (52%), Gaps = 31/386 (8%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCE-ATGTHF-LGILCMTPSDN  1282
             A T   D+  L++FK SI P+S+ P S L+SW+    DPC     THF  G+LC     +
Sbjct  25    ALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLC----SS  80

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
              S R++ + L+  G  G LTP I  LT+LT L+L+ N F GPIP SI +L  +  L L  
Sbjct  81    DSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRS  140

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FS  +P  + +L+ L+ +D+S+N LSGS+P     +  L RLDLS N+LTG +P L  
Sbjct  141   NSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPP  200

Query  921   LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG  742
                L+ LAL +N   +G+                     ++   L  L  ++LS+N F+G
Sbjct  201   --NLSELALKNN-VLSGV------------------ITKNSFDGLTQLEVIELSENSFTG  239

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
              +      LP L ++N+S N  TR+ ++K     S L  +D   N +QG+LP+N   Y  
Sbjct  240   TLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPM  299

Query  561   LKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
             L ++++ +NR  G IP E+    +   + L L+ N+L G  P  F TG      SL  NC
Sbjct  300   LSSLSMRYNRLRGGIPLEFS--HKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNC  357

Query  381   LN-CPDHLPWCLGGQRPASQCRRSAG  307
             L  CP     C   Q+  S C+++ G
Sbjct  358   LQGCPVSSQLCSPSQKSYSVCKQAYG  383



>ref|XP_002273008.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
 emb|CAN73589.1| hypothetical protein VITISV_026204 [Vitis vinifera]
Length=422

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 139/393 (35%), Positives = 204/393 (52%), Gaps = 14/393 (4%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT-GTHF-LGILCMTPSDN  1282
             ++KT   D++VL+  +  +DP SV+P S LSSW+  +DPC++  G  F  G  C      
Sbjct  25    DSKTYWGDIEVLKELRKGLDPGSVIPGSCLSSWDFSVDPCDSVFGERFTCGFRCDVVVSG  84

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
             SS R++ I L+  G  G L+    NL  L TL+L+ N F G +  S+ NL ++ RL LS 
Sbjct  85    SS-RVTEISLDQAGYAGSLSSASWNLPYLETLDLSDNFFSGSVSASLSNLTRLRRLGLSR  143

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FSG +P  +  +  LE + +  N   G++PA+   L  L RL+L  N+L+G+ PDL  
Sbjct  144   NSFSGEIPTSIGFMHSLEELYLDSNGFEGAVPASFNGLVNLKRLELQGNKLSGEFPDLGS  203

Query  921   LWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRF  748
             L  L+ L  S N     +P  FP  L  + + +N L G+I  AI  L +L  LDLS NR 
Sbjct  204   LKNLDFLDASGNVISGNVPDTFPTSLVEISMRNNSLEGNIPRAIKNLSFLQVLDLSHNRL  263

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             +G +   +   P L ++ +S NHF  IEV  +   +S+L  LD   N L+G LP  +   
Sbjct  264   NGSVPFFVFDHPTLQQVTLSNNHFNSIEVPTNPATQSQLIALDLSYNDLRGLLPSFLALM  323

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnl------nLEYNYLEGTLPSEFMT-GGEK  409
               L  ++L +N+F G IP +Y  +       +       L  NYL G +PS  M    + 
Sbjct  324   TKLSALSLENNKFTGMIPTQYALKAVVPDAGVSPFERLMLGGNYLFGPIPSPLMELRPDG  383

Query  408   ARASLDHNCL-NCPDHLPWCLGG-QRPASQCRR  316
             A   L  NCL  CP    +C GG Q+   +C+R
Sbjct  384   ATVRLVDNCLYRCPAMFSFCQGGEQKSLMECKR  416



>gb|EYU37641.1| hypothetical protein MIMGU_mgv1a019103mg, partial [Erythranthe 
guttata]
Length=364

 Score =   173 bits (439),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 196/390 (50%), Gaps = 39/390 (10%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCMTPSDNSSG  1273
             T  +D+  LR+FK ++ P S+   S L++WN   DPC     THF  G+ C      S  
Sbjct  1     TFPADIAALRAFKSAVKPASIPATSCLATWNFSADPCAVPRITHFTCGVTC------SGD  54

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R+  + L+  G  G LTP I                          L ++  L + +N F
Sbjct  55    RVVQLTLDSQGYAGKLTPLIS------------------------KLTQLINLDIGDNSF  90

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
              G +P  +  L  L+ + +  N  SG++P +I +L+ L  LDLS N L+G +P+L+ L  
Sbjct  91    YGAIPSSISSLPNLKNLILRVNSFSGALPPSIASLKSLQTLDLSRNSLSGSLPNLNSLAG  150

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI--SAISRLRYLTALDLSDNRFSGP  739
             L  L LS N+    LP  P  +  L L  N L+G +  S+   L  L  ++LS+N F+G 
Sbjct  151   LTRLDLSYNKLTGSLPKLPPNMNELALKANSLSGPLTQSSFDGLTRLMVVELSENSFTGT  210

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTK----SSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             +   +  LP L +++++ N FT + V+K     +   + L  +D   N ++G LP+N   
Sbjct  211   VEPWLFLLPSLQQVDLAKNAFTGVSVSKPAPSPANPNTELVAVDLSYNKIEGLLPVNFAE  270

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
             Y  L+++ L +N+F G IP +Y S+  S  + L L+ NYL G+ PS F +G      SL 
Sbjct  271   YSMLRSLALSYNKFRGPIPWQYMSKKGSSLQRLYLDGNYLNGSPPSGFFSGEGPISGSLG  330

Query  390   HNCL-NCPDHLPWCLGGQRPASQCRRSAGG  304
              NCL +CP     CL  Q+P S C+++ GG
Sbjct  331   DNCLQSCPVSSELCLKSQKPVSICQQAYGG  360



>ref|XP_001781475.1| predicted protein [Physcomitrella patens]
 gb|EDQ53750.1| predicted protein [Physcomitrella patens]
Length=435

 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 140/393 (36%), Positives = 208/393 (53%), Gaps = 15/393 (4%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGT-HF-LGILCMTPSD  1285
             + A T   D++VL+  K +++ +S++ AS + SW+   DPCEA  + HF  GI C  P  
Sbjct  36    VQAITHPGDIEVLKEVKMALNASSIMNASCMGSWDFAFDPCEARASAHFTCGIDCSLPVS  95

Query  1284  NSSGRISVIDLE-GDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
               S RI  I LE G G  G L+P +GNLT L  L ++ N   GPIPD++ N  ++ +L L
Sbjct  96    GVS-RIIGIRLETGAGYTGLLSPAVGNLTALQRLIVSGNNLHGPIPDTLGNCMELFQLDL  154

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             S+N FSG LP  +  L  L    V++N L G IP +   ++ LT + L NN L G IP L
Sbjct  155   SKNAFSGQLPASLGLLSTLSFFSVANNYLEGPIPDSFNQMKNLTYMYLDNNRLMGSIPSL  214

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHIS-AISRLRYLTALDLSDNR  751
             +G+  L+ L  S+N     LP  P +L  L L  N LTG +  ++  L +L  LD+ +N+
Sbjct  215   AGMSTLSFLDASNNNLTGSLPSVPPQLSLLSLRKNQLTGPLPLSLKNLTFLQVLDVRENK  274

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKE-SRLQVLDAHSNLLQGHLPLNII  574
              +G +   + ++P L ++N+S N FT +E    ST E S L  +D   N + G LP  + 
Sbjct  275   LNGSVFSFLFSMPNLQQMNLSYNQFTDVEPYNMSTGEKSELLSMDLSFNEIGGTLPEFLA  334

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlr------slwrnlnLEYNYLEGTLPSEFMT-GG  415
                 L  + L  N F G IP  Y  ++            L ++ NYL G++PS  +    
Sbjct  335   EMQKLMVLALRSNLFTGSIPYSYALKVADPPNGTVRLGQLYMDDNYLTGSIPSPLLNLTL  394

Query  414   EKARASLDHNCL-NCPDHLPWCLGG-QRPASQC  322
                RA+   NCL +CPD L +C G  Q+  ++C
Sbjct  395   PDFRANFVRNCLESCPDTLSFCQGATQKTPAEC  427



>ref|XP_006422949.1| hypothetical protein CICLE_v10030023mg, partial [Citrus clementina]
 gb|ESR36189.1| hypothetical protein CICLE_v10030023mg, partial [Citrus clementina]
Length=365

 Score =   172 bits (437),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 135/386 (35%), Positives = 201/386 (52%), Gaps = 31/386 (8%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCE-ATGTHF-LGILCMTPSDN  1282
             A T   D+  L++FK SI P+S+ P S L+SW+    DPC     THF  G+LC     +
Sbjct  2     ALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLC----SS  57

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
              S R++ + L+  G  G LTP I  LT+LT L+L+ N F GPIP SI +L  +  L L  
Sbjct  58    DSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRS  117

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FS  +P  + +L+ L+ +D+S+N LSGS+P     +  L RLDLS N+LTG +P L  
Sbjct  118   NSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPP  177

Query  921   LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG  742
                L+ LAL +N   +G+                     ++   L  L  ++LS+N F+G
Sbjct  178   --NLSELALKNN-VLSGV------------------ITKNSFDGLTQLEVIELSENSFTG  216

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
              +      LP L ++N+S N  TR+ ++K     S L  +D   N +QG+LP+N   Y  
Sbjct  217   TLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPM  276

Query  561   LKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
             L ++++ +NR  G IP E+    +   + L L+ N+L G  P  F +G      SL  NC
Sbjct  277   LSSLSMRYNRLRGGIPLEFS--HKKSLKRLFLDGNFLIGKAPIGFFSGDVPVAGSLGDNC  334

Query  381   LN-CPDHLPWCLGGQRPASQCRRSAG  307
             L  CP     C   Q+  S C+++ G
Sbjct  335   LQGCPVSSQLCSPSQKSYSVCKQAYG  360



>ref|XP_010531560.1| PREDICTED: polygalacturonase inhibitor 1, partial [Tarenaya hassleriana]
Length=371

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/390 (34%), Positives = 196/390 (50%), Gaps = 33/390 (8%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATG-THF-LGILCMTPSD  1285
             +A T  SDV  L++FK  ++P S+ P S L++W+    DPC +   THF  G+ C     
Sbjct  5     DALTSASDVAALKAFKAGVNPRSIPPWSCLATWDFAAADPCASPRRTHFTCGVTC----S  60

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
               S R++ + L+  G  G +TP +  LT L TL+L  N F G IP SI +L  +  L L 
Sbjct  61    PDSTRVTQLTLDPAGYSGRVTPLVSGLTHLLTLDLAENSFFGQIPPSISSLVNLQFLNLR  120

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N  SG LP  + RL  LE ID+SHN L+GS+P ++ ++  L RLDLS N+LTG IP L 
Sbjct  121   SNSLSGSLPESITRLNSLESIDISHNSLTGSLPKSMGSMPNLRRLDLSYNKLTGSIPKLP  180

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LAL +N     +P                     + +    L  +++++N F+
Sbjct  181   K--NLIELALKANSLSGSVP-------------------KDSFTDSTQLEVVEIAENSFT  219

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESR--LQVLDAHSNLLQGHLPLNIIT  571
             G +      LP + + +++ N  T +EV+  S   S   L  ++   N ++GH P N   
Sbjct  220   GVLGAWFFLLPSIQQADLANNSLTGVEVSPPSPAGSSGDLVAVELGFNAIEGHAPANFAA  279

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
             Y  L +++L HNR  G IP EYG       R L L+ N+L G  P+ F+        S  
Sbjct  280   YPRLSSLSLRHNRLRGGIPAEYG--QSKTLRRLYLDGNFLTGKPPAGFIRPDSPVYGSFG  337

Query  390   HNCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
              NCL  CP +   C   Q+P S C+++ GG
Sbjct  338   DNCLQGCPGNSKMCAPSQKPFSICKQAYGG  367



>ref|XP_011045158.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=431

 Score =   171 bits (433),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 141/398 (35%), Positives = 210/398 (53%), Gaps = 22/398 (6%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSD  1285
             ++++T   D++VL+  K  + P S+ P S LSSW+  +DPC+   +     G  C     
Sbjct  26    VDSRTHPGDIRVLKDLKHGLHPESIAPGSCLSSWDFSVDPCDHIFSDRFTCGFRC---DR  82

Query  1284  NSSG--RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLL  1111
              +SG  R++ I L+  G  G L+    NL  L TL+++ N F G IPDS+ NL ++ RL 
Sbjct  83    FASGFFRVTEITLDPVGYSGLLSSTTWNLPYLQTLDVSDNSFYGSIPDSLSNLTRLRRLS  142

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD  931
             LS N  SG +P  +  L  LE + + +N L GSIP+   +L  L RL++  N L+G+ PD
Sbjct  143   LSMNLLSGKMPVSLVSLAHLEELYLDNNSLHGSIPSNFNSLVSLKRLEIQENILSGEFPD  202

Query  930   LSGLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISA-ISRLRYLTALDLSD  757
             L  L  LN L  S NQ    +P   PV L  L + +N L G +   +  L +L  LDLS 
Sbjct  203   LGALKDLNYLDASDNQISGEVPSTLPVSLVELSMRNNNLRGKLPVNVGDLEFLQVLDLSH  262

Query  756   NRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             N+ SGPI   +   P L ++ +S N+FT ++V  +    S+L  LD+  N L+G LP  +
Sbjct  263   NKLSGPISSVLFDHPSLQQLTLSHNNFTFLQVPGTVGLTSKLIALDSSYNDLRGILPGFL  322

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFMTGG  415
              +   L +++L +N+F G IP +Y  ++     N +         NYL G +PS  M  G
Sbjct  323   CSMPKLSSLSLENNKFTGMIPSQYALKVAVPRSNSSSLERLLLGGNYLFGPIPSALM--G  380

Query  414   EK---ARASLDHNCL-NCPDHLPWCLGG-QRPASQCRR  316
              K   A  SL  NCL  CPD   +C GG Q+    C++
Sbjct  381   LKPGSANVSLVDNCLYRCPDTFFFCQGGNQKSLVDCKK  418



>gb|KDP38584.1| hypothetical protein JCGZ_04509 [Jatropha curcas]
Length=417

 Score =   171 bits (433),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 136/393 (35%), Positives = 213/393 (54%), Gaps = 14/393 (4%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSD  1285
             ++++T   D++VL+  K+ +DP+S+ PAS LSSW+  LDPC+   +     G  C   + 
Sbjct  22    VHSRTYLGDIRVLKDLKNGLDPSSISPASCLSSWDFSLDPCDHIFSDKFTCGFRCDRVA-  80

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             + S R++ I L+  G  G L+    NL  L TL+++ N F G +P+S+ NL ++ RL LS
Sbjct  81    SGSFRVTEITLDPVGYSGSLSSTTWNLRFLQTLDISDNSFFGSVPESLANLTRLRRLSLS  140

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
             +N  SG LP  +  L  LE + + +N L+GS+P++ ++L  L RL++  N ++G+ P+L 
Sbjct  141   KNSLSGELPFSLGSLSHLEELYLDNNNLNGSLPSSFSSLVSLKRLEIQQNNISGEFPNLH  200

Query  924   GLWQLNTLALSSNQFFAGLPPF-PVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNR  751
              L +L  +  S NQF   LP   P+ L  L + +N L G+I   +  L YL  LDLS N+
Sbjct  201   SLKRLYFVDASDNQFSGQLPSTSPMSLVELSMRNNNLKGNIPHNLGDLEYLQVLDLSHNQ  260

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
              SGP+L  I     L ++ +S N+F  ++V ++    S+L  LD   N L G LP  + +
Sbjct  261   LSGPVLSLIFNHRSLQQLTLSHNNFRVLQVPRTKGFTSKLIALDLSHNNLGGLLPAFLGS  320

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFMT-GGE  412
                L  +NL  N+F G IP +Y  +      + +         NYL G +P   M+    
Sbjct  321   MPKLSALNLEQNKFTGMIPTQYALKAAVQKAHTSSFERLLLAGNYLFGPIPGPLMSLKPG  380

Query  411   KARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                 SL  NCL  CPD+L +C GG Q+    C+
Sbjct  381   SVDLSLVDNCLYRCPDNLFFCQGGDQKSLVDCK  413



>ref|XP_011088215.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Sesamum indicum]
Length=388

 Score =   170 bits (431),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 140/392 (36%), Positives = 197/392 (50%), Gaps = 38/392 (10%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCMTPSD  1285
             + + T  +DV  LR+FK ++ P S+ P S L++WN   DPC     THF  G+ C     
Sbjct  24    VRSATFPADVAALRAFKSAVKPASIAPTSCLATWNFSADPCAVPRITHFTCGVTC-----  78

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
              S  R+  + L+  G  G LT  I  LT+L TL+L  N F GPIP SI +L  +  L+L 
Sbjct  79    -SGERVVQLTLDSQGYSGALTTFISKLTQLITLDLGDNNFYGPIPSSISSLPNLRNLILR  137

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG LP                         +I  L  L  LDLS N L+G +P+L+
Sbjct  138   VNSFSGPLP------------------------PSIATLASLETLDLSRNSLSGTLPNLN  173

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI--SAISRLRYLTALDLSDNR  751
              L  L  L LS N+    LP  P  L  L L  N L+G +  S+   L  L  ++LS+N 
Sbjct  174   SLTGLTRLDLSYNKLTGSLPRLPPNLNELALKANSLSGPLTKSSFGGLTRLMVVELSENS  233

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTK--SSTKESRLQVLDAHSNLLQGHLPLNI  577
             F+G +      LP L ++N++ N  T + V K  ++T    L  +D   N ++G LP N 
Sbjct  234   FTGSLESWFFLLPSLQQVNLAKNSLTSVAVAKPPANTNAGELVAVDLSYNKMEGFLPANF  293

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARAS  397
               Y  L+++ L +NRF G IP +Y  +  S  R L L+ NYL  + P+ F +G      S
Sbjct  294   AKYPMLRSLALSYNRFRGPIPWQYS-KKGSSLRRLYLDGNYLNRSPPAGFFSGEGPVSGS  352

Query  396   LDHNCL-NCPDHLPWCLGGQRPASQCRRSAGG  304
             L  NCL +CP     CL  Q+PAS C+++ GG
Sbjct  353   LGDNCLESCPSSSELCLKPQKPASICQQAYGG  384



>gb|KDP47139.1| hypothetical protein JCGZ_22135 [Jatropha curcas]
Length=389

 Score =   170 bits (430),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 136/391 (35%), Positives = 203/391 (52%), Gaps = 30/391 (8%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHF-LGILCMT  1294
             P  +++ T   D+  L++FK SI PNS+ P S L+SW+   DPC     THF  G+ C  
Sbjct  20    PFLVSSLTSPQDISALKAFKASIKPNSIPPWSCLASWDFTTDPCAFPRRTHFTCGVTC--  77

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
                + S R++ + L+  G  G LTP I  LT L  L+L+ N F GPIP SI +L  +  L
Sbjct  78    --SSDSTRVTQLTLDPVGYSGQLTPLISQLTNLVILDLSDNNFFGPIPSSISSLSNLQTL  135

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              L  N FSG +P  + +L+ L+ +D+SHN LSG +P  +  +  LTRLDLS N+LT  +P
Sbjct  136   TLRSNLFSGSVPDSVTKLKSLQSLDLSHNSLSGYLPNGMNLMSSLTRLDLSYNKLTASLP  195

Query  933   DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDN  754
              L     L  LA+  N                       +   S+   L  L  ++LS+N
Sbjct  196   KLPP--NLLELAIKGNS-------------------LSGSLSKSSFDGLTQLAVVELSEN  234

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
              FSG +    + LP L +++++ N  TR+E++K+    S L  +D   N ++G+ P+N +
Sbjct  235   SFSGTLESWFLQLPALQQVDLANNSLTRVEISKALNGYSNLVAVDLGFNKIEGNPPVNFV  294

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASL  394
             ++ +L +++L +NR  G IP EY        R L L+ N+L G  PS    G      SL
Sbjct  295   SFPHLSSLSLRYNRLRGAIPLEYS--RMKSLRRLFLDGNFLIGKPPSGLFGGEGPVAGSL  352

Query  393   DHNCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
               NCL  CP     C   Q+P S C+++ GG
Sbjct  353   GDNCLQGCPGSSQLCTPSQKPNSICKQAYGG  383



>gb|KFK40008.1| hypothetical protein AALP_AA3G318100 [Arabis alpina]
Length=383

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 136/389 (35%), Positives = 201/389 (52%), Gaps = 32/389 (8%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEA-TGTHF-LGILCMTPSD  1285
             +A T +SD+  L++FK +I PNS+   S L+SW+    DPC +   THF  GI C     
Sbjct  18    DALTSQSDISALKAFKAAIKPNSIPQWSCLASWDFTTSDPCTSPRRTHFTCGITC----S  73

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             + S R++ + L+  G  G LTP I +LT+L TL+L  N F G IP S+ +L  +  L+L 
Sbjct  74    SDSTRVTQLTLDPAGYSGHLTPLISSLTQLLTLDLADNNFSGQIPSSLSSLLNLKTLILR  133

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG +P  +  L  LE +D+SHN L+GS+P TI +L  L +LDLS N+LTG IP L 
Sbjct  134   SNLFSGSIPDSLTHLNSLESLDISHNFLTGSLPKTINSLSNLRQLDLSYNKLTGTIPKLP  193

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L TLAL SN         P+                 + +    L  ++L++N F+
Sbjct  194   S--NLLTLALKSNTLSG-----PITK--------------DSFTESTQLEIVELAENSFT  232

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSS-TKESRLQVLDAHSNLLQGHLPLNIITY  568
             G +      L  + +I+++ N  T +EV       ES L  ++   N + G+ P +   Y
Sbjct  233   GTLGAWFFLLQSIQQIDIANNTLTGLEVLPPKLAGESDLVAVELGFNRIVGYAPASFAAY  292

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
               L +++L +N   G IP EY        R L L+ NYL G  P+ F+    +   SL +
Sbjct  293   TRLSSLSLRYNMLHGVIPVEY--ERSKTLRRLFLDGNYLTGKAPARFVREDAEVMGSLGN  350

Query  387   NCL-NCPDHLPWCLGGQRPASQCRRSAGG  304
             NCL  CP  +  C   Q+P S C+++ GG
Sbjct  351   NCLRGCPGKVKMCAPSQKPFSICKQAYGG  379



>ref|XP_008454983.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Cucumis melo]
Length=398

 Score =   169 bits (428),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 135/381 (35%), Positives = 202/381 (53%), Gaps = 31/381 (8%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHF-LGILCMTPSDNSSGRIS  1264
             SDV  L++FK +I P+S+ P S L+SWN   DPC     T F  G+LC    ++++ R++
Sbjct  35    SDVSALKAFKSAIKPSSIPPWSCLASWNFSADPCALPRRTSFSCGLLC----NSAATRVT  90

Query  1263  VIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
              + L+  G  G L+P I  LT LT L+L+ N F G IP +I +L  +  L L  N FSG 
Sbjct  91    QLTLDPAGYSGTLSPLISKLTYLTVLDLSDNSFSGFIPSAISSLSNLQILTLRSNSFSGS  150

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNT  904
             +P  +  L+ LE +D SHN L+G++P ++  L  L RLDLS N+LTG +P L     L  
Sbjct  151   VPASISNLKSLESLDFSHNSLAGNLPKSLHFLSLLRRLDLSFNQLTGSLPKLPP--NLLE  208

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             LAL  N     L                     S+ S    L  ++LS+N  +G +    
Sbjct  209   LALKRNSLSGYL-------------------DKSSFSDSNQLEVIELSENFLAGTLPPWF  249

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
               LP L +IN++ N FT IE++ ++T  + L  +D   N ++G++P+N  TY  L +++L
Sbjct  250   FLLPSLQQINLANNSFTHIEISPATTGGADLVAVDLGFNRIEGNVPVNFATYPALSSLSL  309

Query  543   GHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEK-ARASLDHNCLN-CP  370
              +NR  G IP E+    +   + L L+ N+L G  P+ F +GGE     SL  NCL  CP
Sbjct  310   RYNRLRGAIPLEFS--KKKTMKRLYLDGNFLTGKPPAAFFSGGEDPVSGSLGDNCLQGCP  367

Query  369   DHLPWCLGGQRPASQCRRSAG  307
                  C   Q+P + C+ + G
Sbjct  368   QSSQLCAPSQKPNAVCKEAYG  388



>gb|KDO71082.1| hypothetical protein CISIN_1g036985mg [Citrus sinensis]
Length=424

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 140/398 (35%), Positives = 211/398 (53%), Gaps = 22/398 (6%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSDNS  1279
             +KT   D+QV++  K+S+DPNSV P S LSSW+  +DPC++  +     G  C   S ++
Sbjct  24    SKTYWGDIQVMKELKNSLDPNSVSPGSCLSSWDFSVDPCDSLFSEKFTCGFRCDV-SVSA  82

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
               R++ ++L+  G  G L+    NL  L TL+L+ N F G IP+S+ NL ++ RL LS N
Sbjct  83    LSRVTELNLDQAGYSGSLSTTSWNLPYLETLDLSNNFFSGSIPESLSNLTRLIRLGLSRN  142

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L  LE + + +N L G+IPA+   L  L RL++ +N+LTG+ P+L  L
Sbjct  143   SFSGEIPASIGSLSSLEELYLDYNNLEGTIPASFNGLSSLKRLEIQSNKLTGEFPELGSL  202

Query  918   WQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFS  745
               L  L  S N     LP   P  L  + + +N L G +  ++  L YL  +DLS N+ S
Sbjct  203   KNLYFLDASDNAISGKLPAILPTSLVQISMRNNNLQGTVPESLKLLSYLQVVDLSHNKLS  262

Query  744   GPILHRIVTLPELMRINVSANHFTRIE----VTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             G +   + + P L ++ +S N FT I+       ++   S+L  +D  +N LQG LPL +
Sbjct  263   GSVPSFVFSHPSLQQLTLSFNQFTSIQQPAPTNDNNIFSSQLIAVDISNNELQGMLPLFM  322

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlr------slwrnlnLEYNYLEGTLPS---EFM  424
                  L  ++L +N+F G IP EY  R+       + ++ L L  NYL G +P    E  
Sbjct  323   ALMPKLSALSLENNKFTGMIPTEYAIRVAVPGPGIAPFQRLLLGGNYLFGAIPRSLLELQ  382

Query  423   TGGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCRR  316
              G    R  L  NCL  CP    +C G  Q+   +C R
Sbjct  383   PGSANVR--LADNCLYRCPFSFFFCQGARQKSLVECNR  418



>ref|XP_002306903.2| hypothetical protein POPTR_0005s25580g [Populus trichocarpa]
 gb|EEE93899.2| hypothetical protein POPTR_0005s25580g [Populus trichocarpa]
Length=411

 Score =   169 bits (427),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 140/397 (35%), Positives = 209/397 (53%), Gaps = 18/397 (5%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPS  1288
              L++ T   D++VL+  K  + P S+ P S LSSW+  +DPC+   +     G  C   +
Sbjct  11    LLHSLTHPGDIRVLKDLKHGLHPESIAPGSCLSSWDFSVDPCDHIFSDRFTCGFRCDWFA  70

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
              +   R++ I L+  G  G L+    NL  L TL+++ N F G IPDS+ NL ++ RL L
Sbjct  71    SDFF-RVTEITLDPVGYSGLLSSTTWNLPYLQTLDVSDNSFYGSIPDSLSNLTRLRRLSL  129

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             S N  SG +P  +  L  LE + + +N L GSIP+  ++L  L RL++  N L+G+ PDL
Sbjct  130   SINLLSGKMPVSLVSLDHLEELYLDNNSLHGSIPSNFSSLVSLKRLEIQENNLSGEFPDL  189

Query  927   SGLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHIS-AISRLRYLTALDLSDN  754
               L  LN L  S NQ    +P   PV L  L + +N L G +  ++  L +L  LDLS N
Sbjct  190   GALKDLNYLDASDNQISGEVPSTLPVSLVELSMRNNNLRGKLPVSVGDLEFLQVLDLSHN  249

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
             + SGPI   +   P L ++ +S N+FT ++V  +    S L  LD+  N L+G LP  + 
Sbjct  250   KLSGPISSVLFDHPSLQQLTLSHNNFTFLQVPGTVGLTSNLIALDSSYNDLRGILPGFLC  309

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFMTGGE  412
             +   L +++L +N+F G IP +Y  ++     N +         NYL G +PS  M  G 
Sbjct  310   SMPKLSSLSLENNKFTGMIPSQYALKVAVPRSNSSSLERLLLGGNYLFGPIPSALM--GL  367

Query  411   K---ARASLDHNCL-NCPDHLPWCLGG-QRPASQCRR  316
             K   A  SL  NCL  CPD   +C GG Q+    C++
Sbjct  368   KPGSANVSLVDNCLYRCPDTFFFCQGGNQKSLVDCKK  404



>ref|XP_006425561.1| hypothetical protein CICLE_v10025688mg [Citrus clementina]
 gb|ESR38801.1| hypothetical protein CICLE_v10025688mg [Citrus clementina]
Length=424

 Score =   168 bits (426),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 139/398 (35%), Positives = 208/398 (52%), Gaps = 22/398 (6%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSDNS  1279
             +KT   D+QV++  K+S+DPNSV P S LSSW+  +DPC++  +     G  C   S + 
Sbjct  24    SKTYWGDIQVMKELKNSLDPNSVSPGSCLSSWDFSVDPCDSLFSEKFTCGFRCDV-SVSE  82

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
               R++ + L+  G  G L+    NL  L T +L+ N F G IP+S+ NL ++ RL LS N
Sbjct  83    LSRVTELSLDQAGYSGSLSTTSWNLPYLETADLSNNFFSGSIPESLSNLTRLIRLGLSRN  142

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L  LE + + +N L G+IPA+   L  L RL++ +N+LTG+ P+L  L
Sbjct  143   SFSGEIPTSIGSLSSLEELYLDYNNLEGTIPASFNGLSSLKRLEIQSNKLTGEFPELGSL  202

Query  918   WQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFS  745
               L  L  S N     LP   P  L  + + +N L G +  ++  L YL  +DLS N+ S
Sbjct  203   KNLYFLDASDNAISGKLPAILPTSLVQISMRNNNLQGTVPESLKLLSYLQVVDLSHNKLS  262

Query  744   GPILHRIVTLPELMRINVSANHFTRIE----VTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             G +   + + P L ++ +S N FT I+       ++   S+L  +D  +N LQG LPL +
Sbjct  263   GSVPSFVFSHPSLQQLTLSFNQFTSIQQPAPTNDNNIFSSQLIAVDISNNELQGMLPLFM  322

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlr------slwrnlnLEYNYLEGTLPS---EFM  424
                  L  ++L +N+F G IP EY  R+       + ++ L L  NYL G +P    E  
Sbjct  323   ALMPKLSALSLENNKFTGMIPTEYAIRVAVPGPGIAPFQRLLLGGNYLFGAIPRSLLELQ  382

Query  423   TGGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCRR  316
              G    R  L  NCL  CP    +C G  Q+   +C R
Sbjct  383   PGSANVR--LADNCLYRCPFSFFFCQGARQKSLVECNR  418



>ref|XP_009378217.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Pyrus x bretschneideri]
Length=429

 Score =   168 bits (426),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 140/401 (35%), Positives = 211/401 (53%), Gaps = 17/401 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT  +D++ L+ FK+S++P+SV P S +SSW+  LDPC+   +     G  C  P DNS
Sbjct  29    SKTFWADIEALKEFKNSLNPDSVSPGSCVSSWDFTLDPCDNLFSDRFTCGFRC-EPVDNS  87

Query  1278  SG--RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             S   R++ + L+     G L+    N   L TL+L+ N F G IPDS+ NL +++RL LS
Sbjct  88    SSASRLTELTLDQAAYSGSLSSLSWNFQYLQTLDLSNNFFSGSIPDSLSNLTRLSRLGLS  147

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG +P  +  L  L+ + + +NRL G+IP ++  L +L RL+L  N L G+ P+L 
Sbjct  148   GNSFSGAIPDSIGSLSNLQELFLDNNRLDGAIPPSLNGLAQLKRLELQGNRLGGEFPELG  207

Query  924   GLWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNR  751
              L  L  L +S+N    G+P  FP  L  + + +N L G I   I +L +L  LDLS N+
Sbjct  208   SLQNLYYLDVSNNGISGGVPINFPPSLLQISMRNNSLEGSIPENIKQLGFLQVLDLSHNQ  267

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIE--VTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
               G +   +   P L ++ +S N FT ++  V+ S    S L  LD  +N L+G LP  +
Sbjct  268   LGGAVPAHLFNHPSLQQLTLSFNQFTSVQSPVSLSPGTHSELIALDLSNNDLRGMLPPYM  327

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlr------slwrnlnLEYNYLEGTLPSEFM-TG  418
                  L  + L +N+F G IP +Y  ++       S +  L L  NYL G +P   +   
Sbjct  328   AAMPKLSALTLENNKFTGMIPTQYAFKVAVPGPGVSAFERLLLGGNYLFGPIPGPLLRLK  387

Query  417   GEKARASLDHNCL-NCPDHLPWCLGGQRPASQCRRSAGGIM  298
                A   L  NCL  CP    +C GG + +    RS G ++
Sbjct  388   PGSANVGLGDNCLYRCPRVFFFCQGGDQKSFHACRSFGPMI  428



>ref|XP_002885955.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62214.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   167 bits (424),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 134/386 (35%), Positives = 198/386 (51%), Gaps = 32/386 (8%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATG-THF-LGILCMTPSDNSS  1276
             T  SDV  L++FK ++ PNS+ P S L+SW+  + DPC +   THF  GI C     + S
Sbjct  26    TSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRTHFTCGITC----SSDS  81

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
              R++ + L+  G  G LTP I  LTEL TL+L  N F G IP SI +L  +  L+L  N 
Sbjct  82    TRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSISSLHSLKTLILRSNS  141

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW  916
              SG LP  + RL  LE ID+SHN L+GS+P T+ +L  L +LDLS N+LTG IP L    
Sbjct  142   LSGSLPDSVTRLNSLESIDISHNSLTGSLPKTMNSLSNLRQLDLSYNKLTGAIPKLP--R  199

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPI  736
              L  LAL +N         P+                 + +    L  ++L++N F+G +
Sbjct  200   NLIDLALKANTLSG-----PISK--------------DSFTESTQLEIVELAENSFTGTL  240

Query  735   LHRIVTLPELMRINVSANHFTRIEVTKSS-TKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
                   L  + +++++ N  T IEV       E+ L  ++   N ++G+ P +  TY  L
Sbjct  241   GAWFFLLESIQQVDLANNTLTGIEVLPPKLAGENNLVAVELGFNQIRGNAPASFATYPRL  300

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
              ++++ +N   G IP EY        R L L+ N+L G  P+ F+    +   SL +NCL
Sbjct  301   SSLSMRYNMLHGVIPSEY--ERSKTLRRLYLDGNFLTGKPPARFVKPDAEVMGSLGNNCL  358

Query  378   -NCPDHLPWCLGGQRPASQCRRSAGG  304
               CP     C   Q+P   C+++ GG
Sbjct  359   RGCPGKAKMCAPSQKPFYICKQAYGG  384



>ref|XP_004136962.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Cucumis sativus]
 ref|XP_004173871.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Cucumis sativus]
 gb|KGN43897.1| hypothetical protein Csa_7G072840 [Cucumis sativus]
Length=390

 Score =   167 bits (423),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 133/381 (35%), Positives = 200/381 (52%), Gaps = 31/381 (8%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSDNSSGRIS  1264
             SDV  L++FK +I P+S+ P S L+SWN   DPC      F   G+LC    ++++ R++
Sbjct  27    SDVFALKAFKSAIKPSSIPPWSCLASWNFSTDPCALPRRTFFSCGLLC----NSAATRVT  82

Query  1263  VIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
              + L+  G  G L+P I  LT LT L+L+ N F G IP +I +L  +  L L  N FSG 
Sbjct  83    QLTLDPAGYSGTLSPLISKLTYLTVLDLSDNSFSGFIPSAISSLSNLQILTLRSNSFSGS  142

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNT  904
             +P  +  L+ LE +D SHN L+G++P ++  L  L RLDLS N+LTG +P L     L  
Sbjct  143   IPPSISNLKSLESLDFSHNSLTGNLPKSLHFLSLLRRLDLSFNQLTGSLPKLPP--NLLE  200

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             LAL  N     L                     S+ S    L  ++LS+N  +G +    
Sbjct  201   LALKRNSLSGYL-------------------DKSSFSDSTQLEVIELSENYLAGTLPSWF  241

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
               LP L +IN++ N  T IE++ ++   S L  +D   N ++G++P+N +TY  L +++L
Sbjct  242   FLLPSLQQINLANNSLTHIEISPATAGGSDLVAIDLGFNRIEGNVPVNFVTYPALSSLSL  301

Query  543   GHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEK-ARASLDHNCLN-CP  370
              +NR  G IP E+    +   + L L+ N+L G  P+ F +GGE     SL  NCL  CP
Sbjct  302   RYNRLRGVIPLEFS--KKKTMKRLYLDGNFLTGKPPAAFFSGGEDPVFGSLGDNCLQGCP  359

Query  369   DHLPWCLGGQRPASQCRRSAG  307
                  C   Q+P + C+ + G
Sbjct  360   QSSQLCAPSQKPNAVCKEAYG  380



>ref|XP_010473835.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Camelina sativa]
Length=242

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 146/200 (73%), Gaps = 1/200 (1%)
 Frame = -3

Query  1467  PCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             P  + + TL SD+Q L +   S+DP+S+ P+S+LS+W+   DPCE +GT FLG++C  P 
Sbjct  32    PSSVFSATLRSDIQALEAIIRSVDPSSISPSSYLSTWDFSEDPCEGSGT-FLGVMCSFPL  90

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
             +N++ R++ IDL+ DG +GFL+ EIGNLTELT L+LN+N+FRGP+P+S+  LRK+T+L L
Sbjct  91    ENTTSRVTEIDLDDDGYDGFLSDEIGNLTELTVLSLNKNRFRGPVPESVFQLRKLTKLSL  150

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             +ENFF+G +   + RL++L+ +D+S N ++G IP  I+ALR LT L LSNN L GKIP L
Sbjct  151   AENFFTGDISPEITRLKELKTVDLSTNSIAGEIPPRISALRSLTHLILSNNHLDGKIPAL  210

Query  927   SGLWQLNTLALSSNQFFAGL  868
             +GLW+L  L   + +F   L
Sbjct  211   NGLWKLQDLWEKTGEFMEKL  230


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (53%), Gaps = 1/99 (1%)
 Frame = -3

Query  798  ISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLD  619
            I  L  LT L L+ NRF GP+   +  L +L +++++ N FT  +++   T+   L+ +D
Sbjct  115  IGNLTELTVLSLNKNRFRGPVPESVFQLRKLTKLSLAENFFTG-DISPEITRLKELKTVD  173

Query  618  AHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYG  502
              +N + G +P  I    +L  + L +N   GKIP   G
Sbjct  174  LSTNSIAGEIPPRISALRSLTHLILSNNHLDGKIPALNG  212



>ref|XP_009338658.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Pyrus x bretschneideri]
Length=429

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 139/395 (35%), Positives = 208/395 (53%), Gaps = 18/395 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT  +D++ L+ FK+S++P+SV P S +SSW+  LDPC+   +     G  C  P DNS
Sbjct  29    SKTFWADIEALKEFKNSLNPDSVSPGSCVSSWDFTLDPCDNLFSDRFTCGFRC-EPVDNS  87

Query  1278  SG--RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             S   R++ + L+     G L+    N   L TL+L+ N F G IPDS+ NL +++R  LS
Sbjct  88    SSASRLTELTLDQAAYSGSLSSLSWNFQYLQTLDLSNNFFSGSIPDSLSNLTRLSRFGLS  147

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG +P  +  L  L+ + + +NRL G+IP ++  L +L RL+L  N L G+ P+L 
Sbjct  148   GNSFSGAIPDSIGSLSNLQELFLDNNRLDGAIPPSLNGLAQLKRLELQGNRLGGEFPELG  207

Query  924   GLWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNR  751
              L  L  L +S+N    G+P  FP  L  + + +N L G I   I +L +L  LDLS N+
Sbjct  208   SLQNLYYLDVSNNGISGGIPINFPPSLLQISMRNNSLEGSIPENIKQLGFLQVLDLSHNQ  267

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIE--VTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
               G +   +   P L ++ +S N FT ++  V+ S    S L  LD  +N L+G LP  +
Sbjct  268   LGGAVPAHLFNHPSLQQLTLSFNQFTSVQSPVSLSPGTHSELIALDLSNNDLRGMLPPYM  327

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlr------slwrnlnLEYNYLEGTLPSEFMT-G  418
                  L  + L +N+F G IP +Y  ++       S +  L L  NYL G +P   +   
Sbjct  328   AAMPKLSALTLENNKFTGMIPTQYAFKVAVPGPGVSAFERLLLGGNYLFGPIPGPLLRLK  387

Query  417   GEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                A   L  NCL  CP    +C GG Q+   +CR
Sbjct  388   PGSANVGLGDNCLYRCPRVFFFCQGGDQKSFHECR  422



>ref|NP_001241201.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040-like precursor [Glycine max]
 gb|ACM89596.1| leucine-rich repeat disease resistance protein [Glycine max]
Length=397

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 134/398 (34%), Positives = 199/398 (50%), Gaps = 39/398 (10%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHFL-GILCMTPS  1288
              + A+T  SD+  L++FK SI P+S+ P S L+SWN   DPC     T F+ G+ C    
Sbjct  23    LVQAQTSPSDIAALKAFKASIKPSSITPWSCLASWNFTTDPCSLPRRTSFICGLTC----  78

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
                S RI+ I L+  G  G LTP I  LT+LTTL+L  N F GPIP SI  L  +  L L
Sbjct  79    TQDSTRINQITLDPAGYSGTLTPLISQLTQLTTLDLADNNFFGPIPSSISLLSNLQTLTL  138

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
               N FSG +P  +  L+ L  +D++HN LSG +P ++ +L  L RLDLS N+LTG IP L
Sbjct  139   RSNSFSGTIPPSITTLKSLLSLDLAHNSLSGYLPNSMNSLTTLRRLDLSFNKLTGSIPKL  198

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
                  L  LA+ +N     L                      +   +  L  ++LS+N  
Sbjct  199   PS--NLLELAIKANSLSGPL-------------------QKQSFEGMNQLEVVELSENAL  237

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTK---------SSTKESRLQVLDAHSNLLQG  595
             +G +      LP L +++++ N FT +++++         SS+  S L  L+   N ++G
Sbjct  238   TGTVESWFFLLPSLQQVDLANNTFTGVQISRPLAARGGSSSSSGNSNLVALNLGFNRIRG  297

Query  594   HLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGG  415
             + P N+  Y  L  +++ +N   G IP EYG       + L L+ N+  G  P+  +  G
Sbjct  298   YAPANLGAYPALSFLSIRYNALRGAIPLEYG--QIKSMKRLFLDGNFFVGKPPAGLVAAG  355

Query  414   EKARASLDHNCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
                  SL  NCL  CP     C   Q+P+S C+++  G
Sbjct  356   TAVSGSLGDNCLQACPGSSQLCSPAQKPSSVCKQAYRG  393



>ref|NP_179134.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 gb|AAD26901.1| putative leucine-rich repeat disease resistance protein [Arabidopsis 
thaliana]
 gb|AAK92771.1| putative leucine-rich repeat disease resistance protein [Arabidopsis 
thaliana]
 gb|AAM14102.1| putative leucine-rich repeat disease resistance protein [Arabidopsis 
thaliana]
 gb|AEC06387.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=382

 Score =   166 bits (421),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 198/386 (51%), Gaps = 32/386 (8%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATG-THF-LGILCMTPSDNSS  1276
             T  SDV  L++FK ++ PNS+ P S L+SW+  + DPC +   THF  GI C     + S
Sbjct  20    TSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRTHFTCGITC----SSDS  75

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
              R++ + L+  G  G LTP I  LTEL TL+L  N F G IP SI +L  +  L+L  N 
Sbjct  76    TRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSISSLTSLKTLILRSNS  135

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW  916
             FSG LP  + RL  LE ID+SHN L+G +P T+ +L  L +LDLS N+LTG IP L    
Sbjct  136   FSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSYNKLTGAIPKLPK--  193

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPI  736
              L  LAL +N         P+                 + +    L  +++++N F+G +
Sbjct  194   NLIDLALKANTLSG-----PISK--------------DSFTESTQLEIVEIAENSFTGTL  234

Query  735   LHRIVTLPELMRINVSANHFTRIEVTKSS-TKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
                   L  + +++++ N  T IEV   +   E+ L  ++   N ++G+ P +   Y  L
Sbjct  235   GAWFFLLESIQQVDLANNTLTGIEVLPPNLAGENNLVAVELGFNQIRGNAPASFAAYPRL  294

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
              ++++ +N   G IP EY        R L L+ N+L G  P+ F+    +   SL +NCL
Sbjct  295   SSLSMRYNVLHGVIPSEY--ERSKTLRRLYLDGNFLTGKPPARFVRTDAEVMGSLGNNCL  352

Query  378   N-CPDHLPWCLGGQRPASQCRRSAGG  304
               CP     C   Q+P   C+++ GG
Sbjct  353   QGCPGKAKMCAPSQKPFYICKQAYGG  378



>gb|AAM63268.1| putative leucine-rich repeat disease resistance protein [Arabidopsis 
thaliana]
Length=384

 Score =   166 bits (421),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 133/386 (34%), Positives = 198/386 (51%), Gaps = 32/386 (8%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATG-THF-LGILCMTPSDNSS  1276
             T  SDV  L++FK ++ PNS+ P S L+SW+  + DPC +   THF  GI C     + S
Sbjct  22    TSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRTHFTCGITC----SSDS  77

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
              R++ + L+  G  G LTP I  LTEL TL+L  N F G IP SI +L  +  L+L  N 
Sbjct  78    TRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSISSLTSLKTLILRSNS  137

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW  916
             FSG LP  + RL  LE ID+SHN L+G +P T+ +L  L +LDLS N+LTG IP L    
Sbjct  138   FSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSYNKLTGAIPKLPK--  195

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPI  736
              L  LAL +N         P+                 + +    L  ++L++N F+G +
Sbjct  196   NLIDLALKANTLSG-----PISK--------------DSFTESTQLEIVELAENSFTGTL  236

Query  735   LHRIVTLPELMRINVSANHFTRIEVTKSS-TKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
                   L  + +++++ N  T IEV   +   E+ L  ++   N ++G+ P +   Y  L
Sbjct  237   GAWFFLLESIQQVDLANNTLTGIEVLPPNLAGENNLVAVELGFNQIRGNAPASFAAYPRL  296

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
              ++++ +N   G IP EY        R L L+ N+L G  P+ F+    +   SL +NCL
Sbjct  297   SSLSMRYNVLHGVIPSEY--ERSKTLRRLYLDGNFLTGKPPARFVRTDAEVMGSLGNNCL  354

Query  378   N-CPDHLPWCLGGQRPASQCRRSAGG  304
               CP     C   Q+P   C+++ GG
Sbjct  355   QGCPGKAKVCAPSQKPFYICKQAYGG  380



>ref|XP_006466890.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Citrus sinensis]
Length=424

 Score =   167 bits (422),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 138/398 (35%), Positives = 208/398 (52%), Gaps = 22/398 (6%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSDNS  1279
             +KT   D+QV++  K+S+DPNSV P S +SSW+  +DPC++  +     G  C   S + 
Sbjct  24    SKTYWGDIQVMKELKNSLDPNSVNPGSCVSSWDFSVDPCDSLFSEKFTCGFRCDV-SVSE  82

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
               R++ + L+  G  G L+    NL  L T +L+ N F G IP+S+ NL ++ RL LS N
Sbjct  83    LSRVTELSLDQAGYSGSLSTTSWNLPYLETADLSNNFFSGSIPESLSNLTRLIRLGLSRN  142

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L  LE + + +N L G+IPA+   L  L RL++ +N+LTG+ P+L  L
Sbjct  143   SFSGEIPTSIGSLSSLEELYLDYNNLEGTIPASFNGLSSLKRLEIQSNKLTGEFPELGSL  202

Query  918   WQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFS  745
               L  L  S N     LP   P  L  + + +N L G +  ++  L YL  +DLS N+ S
Sbjct  203   KNLYFLDASDNAISGKLPAILPTSLVQISMRNNNLQGTVPESLKLLSYLQVVDLSHNKLS  262

Query  744   GPILHRIVTLPELMRINVSANHFTRIE----VTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             G +   + + P L ++ +S N FT I+       ++   S+L  +D  +N LQG LPL +
Sbjct  263   GSVPSFVFSHPSLQQLTLSFNQFTSIQQPAPTNDNNIFSSQLIAVDISNNELQGMLPLFM  322

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlr------slwrnlnLEYNYLEGTLPS---EFM  424
                  L  ++L +N+F G IP EY  R+       + ++ L L  NYL G +P    E  
Sbjct  323   ALMPKLSALSLENNKFTGMIPTEYAIRVAVPGPGIAPFQRLLLGGNYLFGAIPRSLLELQ  382

Query  423   TGGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCRR  316
              G    R  L  NCL  CP    +C G  Q+   +C R
Sbjct  383   PGSANVR--LADNCLYRCPFSFFFCQGARQKSLVECNR  418



>ref|XP_002510474.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF52661.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=422

 Score =   166 bits (419),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 136/401 (34%), Positives = 208/401 (52%), Gaps = 19/401 (5%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSD  1285
             ++++T   DV+ L+  K+ +DPNS++PAS LSSW+  LDPC+   +     G  C   + 
Sbjct  25    VDSRTYPGDVRALKDLKNGLDPNSIVPASCLSSWDFSLDPCDHIFSNKFTCGFRCDRVT-  83

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             + S R++ I L+  G  G L+    +L  L TL+++ N F G IP+S+  L ++ RL LS
Sbjct  84    SGSFRVTEITLDPVGYSGSLS-STWDLPYLQTLDISDNSFSGSIPESLAKLIRLRRLSLS  142

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
             +N  SG +P  +  L  LE + + +N L G +P++ ++L  L RL++  N ++G+ PDL 
Sbjct  143   KNSLSGEIPVSLGTLSHLEELYLDNNNLQGPLPSSFSSLVSLKRLEIQENNISGEFPDLG  202

Query  924   GLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISAI-SRLRYLTALDLSDNR  751
              L  L  L  S+NQ    +P   P+ L  L + +N L G++  I   L YL   DLS N 
Sbjct  203   SLKDLYFLDASNNQLSGPVPSTLPMHLVELSMRNNNLQGNLPDILEDLEYLEVFDLSHNL  262

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
              SGP+L  +   P L ++ +S N+F  ++V  +    S+L  +D   N LQG LP     
Sbjct  263   LSGPVLSVLFDHPSLQQLTLSYNNFAHLQVPGTRGSTSKLIAVDLSYNNLQGLLPAFFGL  322

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFMTGGEK  409
                L  + L HN+F G IP +Y  +      + +         NYL G +P   M  G K
Sbjct  323   MPKLSALTLEHNKFTGMIPTQYALKAAVTKGHTSSFERLLLGGNYLFGPIPGPLM--GLK  380

Query  408   ---ARASLDHNCL-NCPDHLPWCLGG-QRPASQCRRSAGGI  301
                A  S+  NCL  CPD L +C GG Q+    C+     I
Sbjct  381   PGSANVSIVDNCLYRCPDTLFFCQGGDQKSLVDCKSFGPAI  421



>gb|KFK28302.1| hypothetical protein AALP_AA8G499000 [Arabis alpina]
Length=419

 Score =   165 bits (418),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 134/397 (34%), Positives = 208/397 (52%), Gaps = 22/397 (6%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSDNS  1279
             +KT  +DV  L+ FK SID  S+ P S +SSW+  LDPC+++ +     G  C T   + 
Sbjct  21    SKTFSADVAALQDFKKSIDAKSITPGSCISSWDFSLDPCDSSFSDKFTCGFRCDT-VISG  79

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             SGR++ I L+  G  G L+    NL  L TL+L+ N F GP+PDS  NL ++TRL +S N
Sbjct  80    SGRVTEISLDHPGYSGSLSSISFNLPYLQTLDLSGNYFSGPLPDSFSNLTRLTRLTVSGN  139

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  +  LE + + +NRL GS+PA++  +  L +L++  N ++G+ PDL+ L
Sbjct  140   SFSGSIPDSIGSMPALEELQLDNNRLDGSVPASLNGIYNLKKLEIQLNNISGEFPDLNKL  199

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTAL---DLSDNRF  748
               LN L +S N+  +GL P  +    + +         +     ++L +L   DLS+N+ 
Sbjct  200   INLNYLDVSDNR-ISGLVPSSLPESIVQISMRNNLIEGTIPQSFKFLNSLEVVDLSNNKL  258

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSS--TKESRLQVLDAHSNLLQGHLPLNII  574
             SG I   I     L ++ +S N FT ++    S     S L  +D  +N +QG LPL + 
Sbjct  259   SGSIPSFIFNHQTLQQLTLSFNGFTSLDSPYYSPLGLPSELISVDLSNNQIQGVLPLFMG  318

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEFMTGGE  412
                 L  ++L +NRF+G IP +Y  ++ S   +           N+L G +P   M  G 
Sbjct  319   LLPKLSALSLENNRFYGMIPTQYVWKIVSPGSDFAGFQRLLLGGNFLFGVVPGPLM--GL  376

Query  411   K---ARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
             K   A   L  NC + CP    +C G  QR  ++CR+
Sbjct  377   KPGSANLQLAGNCFSWCPATFFFCQGQEQRSVTECRK  413



>ref|XP_006299807.1| hypothetical protein CARUB_v10016003mg [Capsella rubella]
 gb|EOA32705.1| hypothetical protein CARUB_v10016003mg [Capsella rubella]
Length=384

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 131/383 (34%), Positives = 193/383 (50%), Gaps = 32/383 (8%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEA-TGTHF-LGILCMTPSDNSSGRI  1267
             SDV  L++FK ++ PNS+ P S L+SW+  + DPC +   THF  GI C     + S R+
Sbjct  25    SDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRTHFTCGITC----SSDSTRV  80

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
               + L+  G  G LTP I  LTEL TL+L  N F G IP SI +L  +  L+L  N FSG
Sbjct  81    IQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGVIPSSISSLVSLKTLILRSNSFSG  140

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLN  907
              +P  + +L  LE ID+S N L+GS+P T+ +L  L +LDLS N+LTG IP L     L 
Sbjct  141   SIPDSVTKLNSLESIDISRNSLTGSLPKTMNSLLNLRQLDLSYNKLTGAIPKLP--RNLI  198

Query  906   TLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHR  727
              LAL +N         P+                 + +    L  ++L++N F+G +   
Sbjct  199   DLALKANTLSG-----PISK--------------DSFTESTQLEIIELAENSFTGTLGSW  239

Query  726   IVTLPELMRINVSANHFTRIEVTKSS-TKESRLQVLDAHSNLLQGHLPLNIITYLNLKTV  550
                L  + +++++ N  T IEV       E+ L  ++   N ++G  P +   Y  L ++
Sbjct  240   FFLLESVQQVDLANNSLTAIEVIPPKLAGENNLVAVELGFNQIKGTAPASFAAYPRLSSL  299

Query  549   NLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLN-C  373
             ++ +N   G IP EY        R L L+ N+L G  P+ F+        SL +NCL  C
Sbjct  300   SMRYNMLHGGIPSEY--ERSKSLRRLYLDGNFLTGKAPARFVRSDADVMGSLGNNCLQGC  357

Query  372   PDHLPWCLGGQRPASQCRRSAGG  304
             P     C   Q+P   C+R+ GG
Sbjct  358   PGKAKMCAPSQKPFYICKRAYGG  380



>ref|XP_006409562.1| hypothetical protein EUTSA_v10022724mg [Eutrema salsugineum]
 gb|ESQ51015.1| hypothetical protein EUTSA_v10022724mg [Eutrema salsugineum]
Length=383

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 134/389 (34%), Positives = 201/389 (52%), Gaps = 32/389 (8%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNL-DLDPCEATG-THF-LGILCMTPSD  1285
             +A T ++DV  L +FK ++ PNS+ P S L+SW+    DPC +   THF  GI C     
Sbjct  18    DALTSQADVSALIAFKAAVKPNSIPPWSCLASWDFASSDPCASPRRTHFTCGITC----S  73

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             + S R++ + L+  G  G LTP I  LT+L TL+L  NKF G IP S+ +L  +  L+L 
Sbjct  74    SESTRVTQLTLDPAGYSGRLTPLISGLTQLLTLDLADNKFYGLIPSSLSSLLSLKTLILR  133

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG LP  + RL  +E ID+S N L+GS+P ++ +L  L +LDLS N+LTG IP L 
Sbjct  134   SNSFSGSLPESVTRLNSVESIDISRNSLTGSLPKSMNSLSSLRQLDLSYNKLTGSIPKLP  193

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LAL SN         P+                 + +    L  ++L++N F+
Sbjct  194   --RSLIDLALKSNSLSG-----PISK--------------ESFTDSTQLEIVELAENSFT  232

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTK-ESRLQVLDAHSNLLQGHLPLNIITY  568
             G +      L  + +++++ N  T IEV       ES L  ++   N + G+ P +   Y
Sbjct  233   GTLGAWFFLLQSIQQVDLANNSLTSIEVLPPKVAGESDLVAVELGFNRITGYAPASFAAY  292

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
              +L +++L +N   G IP EY        R L L+ N+L G  P+ F+    +   SL +
Sbjct  293   PSLSSLSLRYNMLHGVIPSEY--ERSKTLRRLFLDGNFLTGKPPARFVRPESEVMGSLGN  350

Query  387   NCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
             NCL  CP  +  C   Q+P S C+++ GG
Sbjct  351   NCLQGCPGKVKMCAPSQKPFSICKQAYGG  379



>gb|KEH44118.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=387

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 135/385 (35%), Positives = 195/385 (51%), Gaps = 31/385 (8%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPC-EATGTHFL-GILCMTPSDNSSG  1273
             T  SD++ L++FK SI P+S+ P S ++SWN  +DPC     T+FL G  C T     S 
Sbjct  28    TSPSDIEALKAFKASIKPSSITPWSCVASWNFTIDPCSHPRRTYFLCGFTCTT----DST  83

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
              I+ I L+     G LTP I  LT+L TL+L+ N F G IP SI +L  +  L L  N F
Sbjct  84    HINQITLDPASYSGSLTPLISKLTQLITLDLSDNNFFGSIPSSISSLSNLKTLTLRSNSF  143

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
             SG +P  +  L+ LE +D+SHN L+GS+P ++ +L  L R+DLS N+L G IP L     
Sbjct  144   SGPIPPSIISLKSLESLDLSHNSLTGSLPNSLNSLINLHRIDLSFNKLAGSIPKLPP--N  201

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L  LA+ +N     L                     +       L  ++LS+N  +G I 
Sbjct  202   LLELAIKANSLSGPL-------------------QKTTFEGSNQLEVVELSENALTGTIE  242

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTK-ESRLQVLDAHSNLLQGHLPLNIITYLNLK  556
                + L  L ++N++ N FT I+++K +   ES L  L+   N +QG+ P N+  Y  L 
Sbjct  243   TWFLLLSSLQQVNLANNSFTGIQISKPARGVESNLVALNLGFNRIQGYAPANLAAYPLLS  302

Query  555   TVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLN  376
              +++ HN   G IP EYG       + L L+ N+ +G  P   +  G     SL  NCL 
Sbjct  303   FLSIRHNSLRGNIPLEYG--QIKSMKRLFLDGNFFDGKPPPALLAAGATVSGSLGDNCLQ  360

Query  375   -CPDHLPWCLGGQRPASQCRRSAGG  304
              CP     C   Q+P+S C+R   G
Sbjct  361   VCPVSSQMCAPAQKPSSVCKRGYRG  385



>ref|XP_010107876.1| hypothetical protein L484_027463 [Morus notabilis]
 gb|EXC17276.1| hypothetical protein L484_027463 [Morus notabilis]
Length=394

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 133/388 (34%), Positives = 196/388 (51%), Gaps = 29/388 (7%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATG-THFLGILCMTPSD  1285
             ++A T  SD+  L++FK +++P+S+   S L+SW+    DPC +   THF   L  +P  
Sbjct  27    VSALTSPSDISALKAFKSAVNPSSIPSWSCLASWDFAAADPCASPRRTHFTCALTCSPD-  85

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
               S  I+ I L+  G  G LTP +  L++LT L+L  N F G IP SI +L  +  L L 
Sbjct  86    --STHITQITLDPVGYSGSLTPLVSLLSQLTALDLADNNFSGQIPSSISSLLNLRTLTLR  143

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG LP  + +L+ L+ +D+S N LSG +P  I ++  L RLDLS N+L G IP L 
Sbjct  144   SNKFSGSLPSSITKLKFLDSLDISRNSLSGFLPKRIDSMTGLRRLDLSFNKLAGSIPKLP  203

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LA+  N                       +   S+   L  L  ++LS+N  +
Sbjct  204   P--NLFELAMKGNS-------------------LSGSISKSSFGELTQLEVVELSENSLT  242

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G +      LP L +++++ N  TRIE++      S L  +D   N + G+ P     Y 
Sbjct  243   GTLESWFFLLPSLQQVDLANNSLTRIEISSPPGSASDLVAVDLGFNRIGGYAPAKFADYP  302

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHN  385
              L +++L +NR  GKIP EYG   +   R L L+ N+L G  P+ F  G      SL  N
Sbjct  303   LLSSLSLRYNRLRGKIPLEYG--QKKSLRRLYLDGNFLIGQPPAGFFGGKSGVSGSLGDN  360

Query  384   CL-NCPDHLPWCLGGQRPASQCRRSAGG  304
             CL  CP     CL  Q+P+  C+++ GG
Sbjct  361   CLWGCPVSSQLCLPSQKPSGICKQAYGG  388



>ref|XP_002982589.1| hypothetical protein SELMODRAFT_234053 [Selaginella moellendorffii]
 gb|EFJ16342.1| hypothetical protein SELMODRAFT_234053 [Selaginella moellendorffii]
Length=413

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 144/406 (35%), Positives = 211/406 (52%), Gaps = 33/406 (8%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THFL-GILC------M  1297
             AKT   D+Q L+  K SIDP+++  +S L SW+   DPC+AT  T F+ GI C       
Sbjct  11    AKTAAVDIQALQQIKSSIDPSTLHSSSCLGSWDFSHDPCDATSSTSFVCGIRCDEELQEE  70

Query  1296  TPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITR  1117
               S     R++ I L+G G  GFL+P +GNL+ L  L+++ N   G +P S+  L ++ R
Sbjct  71    GASTRPPRRVTSIVLDGYGYRGFLSPFVGNLSALQALDVSGNALSGALPASLGKLARLRR  130

Query  1116  LLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI  937
             L +S N FSGG+P  +  LR LE + ++ N LSG+IPA+++ L  L RLDL +N L+G++
Sbjct  131   LDVSGNAFSGGIPESLGELRSLEHLGLARNALSGTIPASLSRLSSLRRLDLYSNLLSGEL  190

Query  936   P-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISA-----ISRLRYLT  775
             P  +  +  L  L  SSN+      PFP RL   L+  +L    +S      +  +  L 
Sbjct  191   PIAMPAMSSLLYLDASSNRITG---PFPGRLPPSLVRLSLRDNRLSGQLPSNLGDMAALE  247

Query  774   ALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKE-----SRLQVLDAHS  610
              LD+S N   G +   I   P L ++NV+ N F  I+    +        S++  LDA  
Sbjct  248   VLDVSRNALWGALPDSIFLHPSLQQVNVAGNAFQWIQTPGLAAMPLVVLGSKMVALDASH  307

Query  609   NLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLE  448
             N L+G LP  +     L +++L  N   G IP +Y  +       +       L+ N L 
Sbjct  308   NRLRGPLPPFLAELPRLSSLSLTGNMLGGTIPLQYAIKAVESAVGIQPLRRLFLDGNLLV  367

Query  447   GTLPSEFMTGGEKA---RASLDHNCL-NCPDHLPWCLGGQRPASQC  322
             G LP  F+T    A    AS  +NCL +CP  LP+C G QRPA+QC
Sbjct  368   GALPFPFLTWSPSATLISASFANNCLHSCPPSLPFC-GAQRPATQC  412



>ref|NP_201434.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 dbj|BAB10712.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL38825.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51280.1| unknown protein [Arabidopsis thaliana]
 gb|AED98200.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=418

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 139/398 (35%), Positives = 202/398 (51%), Gaps = 24/398 (6%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT   DV  L+ FK+S+D  S+ P S LSSW+  +DPC+   + T   G  C +     
Sbjct  20    SKTFWGDVAALKDFKNSVDAKSMSPGSCLSSWDFSVDPCDNIFSDTFTCGFRCDSVV-TG  78

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             SGR++ + L+  G  G L+    NL  L TL+L+ N F GP+PDS+ NL ++TRL +S N
Sbjct  79    SGRVTELSLDQAGYSGSLSSVSFNLPYLQTLDLSGNYFSGPLPDSLSNLTRLTRLTVSGN  138

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  +  LE + +  NRL GSIPA+   L  L RL++  N ++G+ PDLS L
Sbjct  139   SFSGSIPDSVGSMTVLEELVLDSNRLYGSIPASFNGLSSLKRLEIQLNNISGEFPDLSSL  198

Query  918   WQLNTLALSSNQFFAGLPPF-PVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFS  745
               L  L  S N+    +P F P  +  + + +NL  G I  +   L  L  +DLS N+ S
Sbjct  199   KNLYYLDASDNRISGRIPSFLPESIVQISMRNNLFQGTIPESFKLLNSLEVIDLSHNKLS  258

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSS--TKESRLQVLDAHSNLLQGHLPLNIIT  571
             G I   I T   L ++ +S N FT +E    S     S L  +D  +N + G LPL +  
Sbjct  259   GSIPSFIFTHQSLQQLTLSFNGFTSLESPYYSPLGLPSELISVDLSNNQILGALPLFMGL  318

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY----------NYLEGTLPSEFMT  421
                L  ++L +N+FFG IP +Y         +   E+          N+L G +P   M 
Sbjct  319   SPKLSALSLENNKFFGMIPTQY----VWKTVSPGSEFAGFQRLLLGGNFLFGVVPGPLMA  374

Query  420   -GGEKARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
                  A   L  NC + CP  L +C G  QR   +CR+
Sbjct  375   LKPGSANVQLAGNCFSWCPATLFFCQGQEQRSPKECRK  412



>ref|XP_002518690.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43615.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=386

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 134/389 (34%), Positives = 201/389 (52%), Gaps = 31/389 (8%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCE-ATGTHF-LGILCMTP  1291
             F+   T   D+  L++FK SI P+S+   S L+SW+  L DPC     +HF  G+ C   
Sbjct  18    FILGVTSPQDISALKAFKSSIKPSSIPSWSCLASWDFTLADPCLLPRRSHFTCGVTC---  74

Query  1290  SDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLL  1111
               + + R++ + L+  G  G LTP I  LT LT L+L+ N F G +P SI +L  +  L 
Sbjct  75    -SSDATRVTQLTLDPVGYSGQLTPLISQLTNLTILDLSDNNFFGSVPSSISSLINLQTLT  133

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD  931
             L  N FSG LP  +  L+ L  +D+SHN L G +P ++ ++  L RLDLS N+LTG +P 
Sbjct  134   LRFNSFSGSLPISITNLKSLRSLDLSHNSLFGYLPKSMNSMSSLRRLDLSYNKLTGSLPK  193

Query  930   LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
             L   + L  LAL +N     L                     ++   L  L  ++LS+N 
Sbjct  194   LP--YNLLELALKNNSLSGSLSK-------------------ASFDGLTQLEVIELSENS  232

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             F+G +      LP L +++++ N  TR E++K     S L  +D   N ++G++PLN   
Sbjct  233   FNGVLESWFFLLPALQQVDLANNDLTRAEISKPVNGNSDLVAVDLGFNKIEGNVPLNFAD  292

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
             Y  L +++L +NR  G IP E+    +   + L L+ N+L G  PSEF  GG     SL 
Sbjct  293   YPLLSSLSLRYNRLRGTIPLEFS--QKKSLKRLFLDGNFLIGKPPSEFFAGGVPVTGSLG  350

Query  390   HNCLN-CPDHLPWCLGGQRPASQCRRSAG  307
              NCL  CP     C   Q+P+S C+++ G
Sbjct  351   DNCLQGCPGSSQLCTPSQKPSSVCKQAYG  379



>ref|XP_002981118.1| hypothetical protein SELMODRAFT_114038 [Selaginella moellendorffii]
 gb|EFJ17819.1| hypothetical protein SELMODRAFT_114038 [Selaginella moellendorffii]
Length=424

 Score =   163 bits (412),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 142/403 (35%), Positives = 208/403 (52%), Gaps = 27/403 (7%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THFL-GILC------M  1297
             AKT   D+Q L+  K SIDP+++  +S L SW+   DPC+AT  T F+ GI C       
Sbjct  22    AKTAAVDIQALQQIKSSIDPSTLHSSSCLGSWDFSHDPCDATSSTSFVCGIRCDEELQEE  81

Query  1296  TPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITR  1117
               S     R++ I L+G G  GFL+P +GNL+ L  L+++ N   G +P S+  L ++ R
Sbjct  82    GASTRPPRRVTSIVLDGYGYRGFLSPFVGNLSALQALDVSGNALSGALPASLGKLARLRR  141

Query  1116  LLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI  937
             L +S N FSGG+P  +  LR LE + ++ N LSG+IPA+++ L  L RLDL +N L+G++
Sbjct  142   LDVSGNAFSGGIPESLGELRSLEHLGLARNALSGTIPASLSRLSSLRRLDLYSNLLSGEL  201

Query  936   P-DLSGLWQLNTLALSSNQFFAGLPPF--PVrlrtlllghnlltgHISAISRLRYLTALD  766
             P  +  +  L  L  SSN+     P    P  +R  L  + L     S +  +  L  LD
Sbjct  202   PIAMPAMSSLLYLDASSNRITGSFPGRLPPSLVRLSLRDNRLSGQLPSNLGDMAALEVLD  261

Query  765   LSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKE-----SRLQVLDAHSNLL  601
             +S N   G +   I   P L ++NV+ N F  I+    +        S++  LDA  N L
Sbjct  262   VSRNGLWGALPDSIFLHPSLQQVNVAGNAFQWIQTPGLAAMPLVVLGSKMVALDASHNRL  321

Query  600   QGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTL  439
             +G LP  +     L +++L  N   G IP +Y  +       +       L+ N L G L
Sbjct  322   RGPLPPFLAELPRLSSLSLTGNMLGGTIPLQYAIKAVESAVGIQPLRRLFLDGNLLVGAL  381

Query  438   PSEFMTGGEKA---RASLDHNCL-NCPDHLPWCLGGQRPASQC  322
             P  F+T    A    AS  +NCL +CP  LP+C G QRPA+QC
Sbjct  382   PFPFLTWSPSATLISASFANNCLHSCPPSLPFC-GAQRPATQC  423



>ref|XP_007017684.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14909.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=400

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 132/394 (34%), Positives = 189/394 (48%), Gaps = 44/394 (11%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGT-HF-LGILCMTPSDN  1282
             N++T  +D+QVL+  K  +D  S+ P S LS W+  LDPC+   T HF  G+ C      
Sbjct  29    NSRTYPADIQVLKDLKHGVDHRSIAPGSCLSFWDFSLDPCDNIFTEHFTCGLRC---DRI  85

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
              SG    +D+  +                         F G IPDS+ NL ++ RL LS 
Sbjct  86    VSGYARTLDVSDN------------------------SFSGSIPDSLSNLTRLRRLGLSR  121

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N  SG +P  +  L  LE + +  N L G IP++   L  L RL++  N+++G+ PDL  
Sbjct  122   NSLSGEIPVILGSLSHLEELYLDSNHLHGPIPSSFNNLTSLRRLEIQQNDISGEFPDLGS  181

Query  921   LWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRF  748
             L  L  L  S N    G+P   P  L  L + +N L G+I   I  +R+L  LDLS N  
Sbjct  182   LKNLYFLDASDNNISGGVPATLPTSLVELSIRNNKLGGNIPDNIENMRFLQVLDLSHNIL  241

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG IL  +   P L ++ +S N+F+ +EV       S+L  LD   N L+G LP  + + 
Sbjct  242   SGSILSVLFDHPSLEQLTLSYNNFSYLEVPGDKGLNSKLIALDLSYNKLRGFLPAFMASM  301

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFMTGGEK-  409
               L  ++L HN+F G IP +Y  +      N +         NYL G +P   +  G K 
Sbjct  302   AKLAALSLEHNKFTGMIPAQYALKAAVPRTNTSSFERLLLGGNYLFGPIPGPLL--GLKP  359

Query  408   --ARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
               A+ SL  NCL  CPD   +C GG Q+    C+
Sbjct  360   GSAQVSLADNCLYRCPDAFFFCQGGDQKSLVDCK  393



>emb|CDP01941.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 138/404 (34%), Positives = 206/404 (51%), Gaps = 25/404 (6%)
 Frame = -3

Query  1461  FLNA--KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT-GTHF-LGILC--  1300
             FL+A  KT   DV VL+  KDS+DP SV P S LSSW+  +DPC+   G  F  G+ C  
Sbjct  22    FLHAHSKTYWKDVSVLKQLKDSVDPKSVTPGSCLSSWDFGVDPCDNLFGDRFTCGLRCDV  81

Query  1299  MTPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKIT  1120
             + PS +   R++ + L+  G  G L      L  L  L+L+ N F G IPDS   L ++ 
Sbjct  82    VLPSGS---RVTELALDQAGYSGSLASVSWELPYLQKLDLSGNHFTGGIPDSFSYLTRLQ  138

Query  1119  RLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGK  940
             +L LS N FSG +P  +  L  LE + + +N L G+IP+++  L  L RL++  N+  G 
Sbjct  139   QLGLSGNSFSGSVPDSLGALSSLEEMYLDNNNLEGTIPSSLNGLSNLKRLEIQGNKFAGP  198

Query  939   IPDLSGLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISA-ISRLRYLTALD  766
              P+L  L  L  L  S+N     LP  FP  L  L + +N + G + A +S L YL  LD
Sbjct  199   FPELGQLGNLYFLDASNNAISGELPATFPASLVELSMRNNSIEGSLPASLSNLPYLQVLD  258

Query  765   LSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLP  586
             LS N+ SG +   + T P L ++ +S N    +E   +S   S +  +D  +N ++G LP
Sbjct  259   LSHNKLSGSVPASLFTHPSLEQLTLSYNQLGWVEAPANSGLNSEVIAIDLSNNEIRGFLP  318

Query  585   LNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY-------NYLEGTLPSEF  427
               +     L  + L +N+  G IP +Y  ++         ++       NYL G +P +F
Sbjct  319   GFLGMMPKLSALTLENNKLTGMIPTQYALKVLLPQGQGVSQFERLLLGGNYLFGPIPGQF  378

Query  426   MTGGEKARA---SLDHNCL-NCPDHLPWCLGG-QRPASQCRRSA  310
             +  G K  +   +L  NCL  CP  L +C GG Q+   +C+  A
Sbjct  379   L--GLKPGSVTINLGDNCLYRCPLRLFFCDGGEQKSLMECKAFA  420



>ref|XP_004512092.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Cicer arietinum]
Length=422

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 137/393 (35%), Positives = 209/393 (53%), Gaps = 18/393 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSDNS  1279
             +KT   D++VL+  K  ++P+SV P S +S+W+ + DPC+   +     G  C       
Sbjct  26    SKTHWGDIKVLKELKQKLNPDSVYPGSCVSTWDFNHDPCDNLFSEKFTCGFRCDVVVSKL  85

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G L+    NL  L TL+ + N F G  P+S+ NL +++RL LS N
Sbjct  86    S-RLTELSLDQAGYSGSLSTITFNLPYLETLDFSNNFFTGNFPESLSNLTRLSRLSLSTN  144

Query  1098  FFSGGLP-RYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
              F+G +P  +   L  L+ + + +N L G+IP++   L+ LTRL+L NN+  G +PDL  
Sbjct  145   SFTGEIPFSFGTSLSNLQELYLDNNNLQGTIPSSFNNLQRLTRLELQNNKFYGNVPDLGY  204

Query  921   LWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHISAIS--RLRYLTALDLSDNR  751
             L  L  + LS+N  F+G+P   PV L  + + +N L G +S+ S   L YL  +DLS N+
Sbjct  205   LKNLYYMDLSNNG-FSGVPFSLPVSLVQISIRNNNLNGSLSSESFKNLMYLQVVDLSSNK  263

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKE-SRLQVLDAHSNLLQGHLPLNII  574
              SG        LP L ++ +S N F+ IEV    T+  S L  +D  +N LQG LPL + 
Sbjct  264   ISGNAPSIFFELPSLQQLTLSYNEFSSIEVPSYGTESLSELIAVDLSNNKLQGVLPLFLA  323

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMT-GG  415
                 L +++L +NRF G IP ++  +       +       L  NYL G +P   +    
Sbjct  324   MMPKLSSLSLENNRFTGLIPVQFALKTVYPEIGIAPFGRLLLGGNYLFGGIPRPLLVLKQ  383

Query  414   EKARASLDHNCL-NCPDHLPWCLGG-QRPASQC  322
             + A  SL  NCL  CP    +C GG Q+ +SQC
Sbjct  384   DYANVSLVDNCLYRCPHRFFFCQGGQQKSSSQC  416



>ref|XP_010271508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nelumbo nucifera]
Length=423

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 136/393 (35%), Positives = 193/393 (49%), Gaps = 14/393 (4%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT-GTHF-LGILCMTPSD  1285
             ++++T   D++ L+  K  +D  SV P S LSSW+  +DPC+   G  F  G  C     
Sbjct  25    VDSRTYWEDIESLKELKKGVDARSVTPGSCLSSWDFSVDPCDNIFGERFTCGFRCDVVVS  84

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
               S R++ I L+  G  G L     NL  L  L+L  N F G IP S  NL ++ RL LS
Sbjct  85    GLS-RVTEISLDRAGYSGSLYSSTWNLPYLENLDLADNFFSGSIPSSFSNLTRLRRLALS  143

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N  SG +P  +  L  LE + + +N L G IPA+   L  L RL+L  N  +G+ PDLS
Sbjct  144   RNSLSGEIPTSIGSLSYLEELYLDNNHLQGPIPASFNGLVRLERLELQGNHFSGEFPDLS  203

Query  924   GLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISAISR-LRYLTALDLSDNR  751
              L  L  +  S N  +  +P  FP  L  +L+ +N L G++    R LR+L  +DLS+NR
Sbjct  204   SLNSLYFIDASDNGIYGRVPVNFPGSLVEILMRNNKLQGNLPENFRDLRFLQVIDLSNNR  263

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
              SG I   +   P L ++ +S N F+ I+V  +    S L  LD   N LQG LP+ +  
Sbjct  264   LSGSIPSALFDHPSLQQLTLSHNQFSSIQVPWTMGTRSELIALDISYNELQGLLPVFMAM  323

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEFMT-GGE  412
                L  ++L +N+F G IP +Y  +        +         NYL G +P   M     
Sbjct  324   MPRLSALSLEYNKFTGMIPSQYALKAVVHVAGTSPFVRLLLGGNYLFGPIPGPLMALKPG  383

Query  411   KARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
              A  SL  NCL  CP    +C GG Q+    C+
Sbjct  384   SATVSLVDNCLYRCPSTFFFCQGGEQKSVMACK  416



>ref|XP_008241777.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=427

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 133/393 (34%), Positives = 203/393 (52%), Gaps = 18/393 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT   D++ L+  K+++DP SV P S +SSW+  LDPC+   +     G  C    D++
Sbjct  31    SKTFWGDIEALKELKNALDPTSVSPGSCISSWDFKLDPCDNLFSDRFTCGFRCDL-VDSA  89

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             + R++ + L+  G  G L+    NL  L TL+L+ N F G IPDS+ NL ++TRL LS N
Sbjct  90    TSRVTELSLDQAGYSGSLSSISWNLPYLQTLDLSNNFFSGSIPDSLSNLTRLTRLGLSGN  149

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L  LE + +  N L G+IP ++  L  L RL+L  N+L+G+ P+L  L
Sbjct  150   SFSGSIPASIGSLSNLEELYLDSNSLHGAIPPSLNRLASLKRLELQGNQLSGEFPELGSL  209

Query  918   WQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHISA-ISRLRYLTALDLSDNRFS  745
               L  L  S+N     +P   P  L  + + +N L G +   I  L +L  LDLS N+  
Sbjct  210   QNLFYLDASNNAISGQIPLTLPSSLLQISMRNNSLQGTVPENIKHLGFLQVLDLSHNQLG  269

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G +   +   P L ++ +S N F+ ++   S   +S +  LD  +N L+G LP  +    
Sbjct  270   GFVPSYLFEHPSLQQLTLSFNQFSSVQPPISLGTQSEMIALDVSNNQLKGPLPSFLPMMP  329

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFMTGGEK--  409
              L  + L +N+F G IP +Y  ++      ++         NYL G +PS  +  G K  
Sbjct  330   KLSALTLENNKFMGMIPTQYAFKVAVPGSGVSAFERLLLGGNYLFGPIPSPLL--GLKPG  387

Query  408   -ARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
              A   L  NCL  CP    +C GG Q+  S+CR
Sbjct  388   SANVGLADNCLYRCPRVFFFCQGGDQKSLSECR  420



>ref|XP_004289102.1| PREDICTED: receptor-like protein kinase BRI1-like 3-like [Fragaria 
vesca subsp. vesca]
Length=415

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 134/392 (34%), Positives = 205/392 (52%), Gaps = 16/392 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT   D QVL+  K+++DPNSV   S +SSW+  LDPC++  +     G  C    D+ 
Sbjct  19    SKTFWGDTQVLKQLKNTLDPNSVAQGSCISSWDFKLDPCDSLFSDKFTCGFRCDLIDDSG  78

Query  1278  SGRISVIDL-EGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
               R++ I L +       L+    NL  L TL+L+ N F GP+P+S+ NL ++ RL+LS 
Sbjct  79    VSRVTEIGLDQAGYSGSSLSSLTWNLPYLETLDLSGNFFSGPLPESLSNLTRLRRLILSG  138

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FSG +P     L  LE + + +N+L GSIP +   L  L RL++  N L+G++P+LS 
Sbjct  139   NSFSGHIPTSFGSLSNLEELFLDNNKLQGSIPPSFNNLVSLNRLEVQANTLSGELPNLSS  198

Query  921   LWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRF  748
             L  L  L  S+N     +P   P  L  + + +N L G +   I +L  L  LDLS N+ 
Sbjct  199   LTSLYYLDASNNAITGQVPATLPSSLIQISMRNNSLVGTVPETIQQLGSLQVLDLSHNQL  258

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
                I   + + P L ++ +S NHFT ++   S+  +S+L  +D  +N LQG LP  +   
Sbjct  259   GDSIPAHLFSHPSLQQLTLSFNHFTSLQT--STGVQSQLIAVDLSNNNLQGFLPFFMALM  316

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEFMTGGE-K  409
               L  ++L +N+F G IP +Y  ++      ++         NYL G LP   ++     
Sbjct  317   PKLSALSLENNKFTGMIPTQYAFKVAVPGTGVSPFVRLLLGGNYLFGPLPGPLLSMKPGS  376

Query  408   ARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
             A   L +NCL  CP    +C GG Q+  S+CR
Sbjct  377   ANVGLGNNCLYRCPRVFFFCQGGDQKSLSECR  408



>ref|XP_009605875.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana tomentosiformis]
Length=426

 Score =   161 bits (408),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 141/402 (35%), Positives = 213/402 (53%), Gaps = 20/402 (5%)
 Frame = -3

Query  1473  MNPCFLNA--KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE--ATGTHFLGI  1306
             ++  FL+A   T   D++VL+  K+S+DPNSV P S L SW+  +DPC+  +T     G+
Sbjct  21    LHALFLHAHSTTHWQDIEVLKQLKNSVDPNSVTPGSCLISWDFSVDPCDNLSTEKFTCGL  80

Query  1305  LCMTPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRK  1126
              C     + S R++ + L+  G  G L+    NL  L TL+L  N F G +PDS+ NL +
Sbjct  81    RCDIVVSSVS-RVTELALDQWGYSGSLSSVSWNLPYLQTLDLTNNFFTGSVPDSLSNLTR  139

Query  1125  ITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELT  946
             + RL LS N FSG +P  +  L  LE + + +N L G+IP+T   L+ L RL+   N+LT
Sbjct  140   VQRLTLSRNSFSGSIPSSLGSLSHLEQLYLDNNFLEGTIPSTFNGLKNLKRLEFQANKLT  199

Query  945   GKIPDLSGLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISA-ISRLRYLTA  772
             G+ PDL  L  L  L  S N F   LP  FP  L  L + +N L  +I A ++ L +L  
Sbjct  200   GEFPDLGQLNNLFFLDGSDNAFSGQLPATFPASLVELAMRNNSLEVNIPASLAGLNFLQV  259

Query  771   LDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGH  592
             +DLS N+ SG +   + T P L ++ +S N +  ++   +  + S+L  +D  +N ++G 
Sbjct  260   IDLSHNKLSGSVPANLFTHPSLEQLTLSYNQYGSVQQPGNFLQNSQLIAVDLSNNEIRGL  319

Query  591   LPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPS-  433
             LP  +     L +++L +N+  G IP +Y  ++       S +  L L  NYL G +P  
Sbjct  320   LPGFLGLMPRLSSLSLENNKLSGMIPVQYALKMVLPGQGVSQFERLLLGGNYLFGPIPGP  379

Query  432   --EFMTGGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
               E   G    R  L  NCL  CP  L  C GG Q+  S+C+
Sbjct  380   MLELKPGSVTLR--LGDNCLYRCPLRLFLCEGGEQKSLSECQ  419



>ref|XP_009606818.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Nicotiana tomentosiformis]
Length=383

 Score =   159 bits (403),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 134/392 (34%), Positives = 204/392 (52%), Gaps = 34/392 (9%)
 Frame = -3

Query  1464  CFLNAKTL--ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCM  1297
             C  + ++L   SD+  L++FK +I P+S+   S L SWN   DPC     THF  G+ C 
Sbjct  17    CLSSVQSLPPSSDIIALQAFKAAIKPSSIPSYSCLGSWNFSSDPCSVPRVTHFTCGLSC-  75

Query  1296  TPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITR  1117
                 +S  R++ + L+  G  G LTP I  LT+L TL+L  N F GPIP S+ +L  +  
Sbjct  76    ----SSGNRVTELTLDPAGYSGTLTPLISKLTQLVTLDLQNNNFYGPIPASLSSLPNLRN  131

Query  1116  LLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI  937
             L+L  N FSG +P  +  L+ L  +D+SHN +SG +P ++  L  L RLDLS N+LTG +
Sbjct  132   LVLRLNSFSGSVPPSLTSLKSLLSLDLSHNSISG-LPNSMNQLTSLRRLDLSYNKLTGSL  190

Query  936   PDLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
             P L     L  LA  +N                       +    +   L+ L  ++LS+
Sbjct  191   PKLPP--NLIELAAKANS-------------------LSGSLLKLSFDGLKQLEVVELSE  229

Query  756   NRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             N  SG I      LP L +++++ N FTR+E++++    S L  +D   N ++G+LP+N 
Sbjct  230   NLLSGTIEAWFFQLPSLQQVDMANNGFTRVEISRTGNLNSDLVAVDLGFNKIEGYLPVNF  289

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARAS  397
               +  L +++L +NRF G IP +Y    +   + L L+ N+L G+ P+ F         S
Sbjct  290   AFFPRLSSLSLSYNRFRGPIPWQYS--KKVTLKRLYLDGNFLNGSPPAGFFGRQTGVTGS  347

Query  396   LDHNCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
             L  NCL  CP     CL  Q+P S C+++ GG
Sbjct  348   LGDNCLQKCPTSSQLCLKSQKPTSICQQAYGG  379



>gb|ACN78489.1| putative disease resistance protein [Arachis hypogaea]
Length=391

 Score =   159 bits (403),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 130/382 (34%), Positives = 198/382 (52%), Gaps = 32/382 (8%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCMTPSDNSSG  1273
             T  SD++ L++FK SI P+S+ P S ++SWN   DPC     THF  G+ C   +DN+  
Sbjct  29    TSSSDIEALKAFKASIKPSSITPWSCIASWNFTTDPCSVPRRTHFTCGLTCT--ADNT--  84

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             RI+ I L+  G  G LTP +  LT L TL+L+ N F G IP S+ +L K+  L L  N F
Sbjct  85    RINQITLDPAGYTGTLTPLVSQLTSLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSF  144

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
             SG +P  +  L+ L+ +D+S N LSG +P ++ +L  L R+DLS N+LTG +P L     
Sbjct  145   SGSIPPSITTLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRMDLSFNKLTGGLPKLPP--N  202

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L  LA+ +N     L                     +    L  L  ++LSDN   G I 
Sbjct  203   LLDLAIKANSLSGVLQK-------------------TTFEGLNQLEVVELSDNALQGIIE  243

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSST--KESRLQVLDAHSNLLQGHLPLNIITYLNL  559
               +  LP L +++++ N F+ +E+++       + L  ++   N +QG+ P N+  Y +L
Sbjct  244   TWLFLLPSLQQLDLANNSFSGVEISRPVVGGGGNSLVAVNLGFNKIQGYAPANLGAYPSL  303

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
               ++L +N   G IP EYG       + L L+ N+L G  P+  +  G +   SL  NCL
Sbjct  304   SFLSLRYNALRGAIPLEYG--KSKSMKRLFLDGNFLMGKPPAGLVAAGAEVSGSLGDNCL  361

Query  378   -NCPDHLPWCLGGQRPASQCRR  316
               CP     C   Q+P+S C++
Sbjct  362   EGCPAMSQLCTPKQKPSSVCKQ  383



>ref|XP_009770154.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Nicotiana sylvestris]
Length=383

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 133/392 (34%), Positives = 203/392 (52%), Gaps = 34/392 (9%)
 Frame = -3

Query  1464  CFLNAKTL--ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCM  1297
             C  + ++L   SD+  L++FK +I P+S+   S L SWN   DPC     THF  G+ C 
Sbjct  17    CLSSVQSLPPSSDIIALQAFKAAIKPSSIPSYSCLGSWNFTSDPCSVPRVTHFTCGLSC-  75

Query  1296  TPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITR  1117
                 +S  R++ + L+  G  G LTP I  LT+L TL+L  N F GPIP S+ +L  +  
Sbjct  76    ----SSGNRVTELTLDPAGYSGTLTPLISKLTQLVTLDLQNNNFYGPIPASLSSLPNLKN  131

Query  1116  LLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI  937
             L+L  N FSG +P  +  L+ L  +D+SHN +SG +P ++  L  L R+DLS N+LTG +
Sbjct  132   LVLRLNSFSGSVPPSLTSLKSLLSLDLSHNSISG-LPNSMNQLTSLRRMDLSYNKLTGSL  190

Query  936   PDLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
             P L     L  LA  +N                       +    +   L  L  ++LS+
Sbjct  191   PKLPP--NLIELAAKANS-------------------LSGSLLKLSFDGLNQLEVVELSE  229

Query  756   NRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             N  SG I      LP L +++++ N FTR+E++++    S L  +D   N ++G+LP+N 
Sbjct  230   NSLSGTIEAWFFQLPSLQQVDMANNGFTRVEISRTGNFNSDLIAVDLSFNKIEGYLPVNF  289

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARAS  397
               +  L +++L +NRF G IP +Y    +   + L L+ N+L G+ P+ F         S
Sbjct  290   AVFPRLSSLSLSYNRFRGPIPWQYS--KKVTLKRLYLDGNFLNGSPPAGFFGRQTGVTGS  347

Query  396   LDHNCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
             L  NCL  CP     CL  Q+P S C+++ GG
Sbjct  348   LGDNCLQKCPTSSQLCLKSQKPTSICQQAYGG  379



>ref|XP_004304038.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Fragaria vesca subsp. vesca]
Length=388

 Score =   159 bits (402),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 133/387 (34%), Positives = 199/387 (51%), Gaps = 27/387 (7%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNS  1279
             + A T  SD+  L++FK SI P+S+   S L+SW+   DPC  T  H +   C       
Sbjct  20    VQALTSPSDISALKAFKASIKPSSIPSWSCLASWDFTSDPC--TLPHRIHFTCGVTCSPD  77

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ I L+  G  G LTP+I  LT L+TL+L+ N F GPIP SI +L  +  L L  N
Sbjct  78    STRVTQITLDPAGYSGTLTPQISQLTHLSTLDLSENSFFGPIPSSISSLSYLQILTLRSN  137

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG L   + +L+ LE +D+SHN L+G +P ++ +L  L RLDLS N++TG +P L   
Sbjct  138   SFSGSLTPSITKLKSLESLDISHNFLTGFLPNSMASLSNLRRLDLSFNKITGSLPRLPP-  196

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
              +L  LAL SN     L                     S+   L  L  ++LS N FSG 
Sbjct  197   -KLLELALKSNSLSGPL-------------------SKSSFDGLSQLEVVELSQNSFSGT  236

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTK-SSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
             +      +P L +++++ N  T +++ +  S +   L  +D   N ++G+ P N   +  
Sbjct  237   LQSWFFLIPSLQQVDLANNSLTGVDIARPGSGRGGELVAVDLSFNRIEGYAPANFAAFPR  296

Query  561   LKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
             L ++++ +NR  GKIP EYG       + L L+ N+L G  P   +TG      SL  NC
Sbjct  297   LSSLSVRYNRLRGKIPVEYG--KNKSLKRLYLDGNFLNGQPPPALLTGSSGISGSLGDNC  354

Query  381   LN-CPDHLPWCLGGQRPASQCRRSAGG  304
             L  CP     CL  Q+  + C+++ GG
Sbjct  355   LQGCPSSAKLCLPSQKSNAICKQAYGG  381



>ref|XP_010691707.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Beta vulgaris subsp. vulgaris]
Length=399

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 142/393 (36%), Positives = 211/393 (54%), Gaps = 30/393 (8%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPC-EATGTHFLGILCMTPSD  1285
             F  + T  +D+  L+S K  I P+S+ P+S +S+W+   DPC     THF+  L  +P  
Sbjct  28    FSISTTATADIAALKSLKTFIKPSSIPPSSCISTWDFSSDPCLTPKRTHFICGLTCSPD-  86

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
               S R+  I L+  G  G LTP I  LT+L  L+L +N F G IP S+ +L  +  L LS
Sbjct  87    --STRVISITLDSVGYSGSLTPYISQLTQLVLLDLGQNSFHGTIPSSLSSLSLLQSLSLS  144

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N F+G LP  +  L+ L+ +D+S+N LSGSIP T+ +L  LTRLDLS N+ +G +P   
Sbjct  145   YNSFTGPLPSSIGNLKSLQDLDLSNNLLSGSIPNTLFSLSHLTRLDLSFNKFSGTLPT-K  203

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L+ LA+ +N     +                     ++ + L  L  ++LS N F+
Sbjct  204   LPPNLHELAIKANSLSGTI-------------------TKTSFTELTQLETVELSGNSFT  244

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G +   +  LP L +IN+S N FT +E+ +   K S L  +D   N ++G+LP+N+  Y 
Sbjct  245   GVLQSWLFQLPALQQINLSNNSFTGVEIWRVGKKLSSLVAVDLGFNKIEGYLPVNLSEYP  304

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTG-GEKAR--ASL  394
              L +++L +NR  G IP +Y    +S  + L L+ NYL GT P+ F TG GE++    S 
Sbjct  305   VLASLSLRYNRLRGPIPLQYS--KKSNLKRLFLDGNYLSGTPPAGFFTGVGEESPVIGSF  362

Query  393   DHNC-LNCPDHLPWCLGGQRPASQCRRSAGGIM  298
               NC L CP     CL  Q+P S C++  GG M
Sbjct  363   GDNCLLRCPPKSELCLPLQKPMSVCKKVYGGKM  395



>ref|XP_010467293.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=387

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 134/389 (34%), Positives = 199/389 (51%), Gaps = 32/389 (8%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATG-THF-LGILCMTPSD  1285
             +A T  SDV  L++FK ++ PNS+ P S L+SW+  + DPC +   THF  GI C     
Sbjct  22    DALTSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRTHFTCGITC----S  77

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             + S R++ + L+  G  G LTP I  LTEL TL+L  N F G IP SI +L  +  L+L 
Sbjct  78    SDSTRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSISSLLSLKTLVLR  137

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG +P  + RL  LE ID+SHN L+GS+P T+ +L  L +LDLS N+LTG IP L 
Sbjct  138   SNSFSGSIPDSVTRLNSLESIDISHNSLTGSLPKTMNSLSNLRQLDLSYNKLTGAIPKLP  197

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LAL +N         P+                 + +    L  ++L++N F+
Sbjct  198   K--NLIDLALKANTLSG-----PISK--------------ESFTESTQLEIVELAENSFT  236

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSS-TKESRLQVLDAHSNLLQGHLPLNIITY  568
             G +      L  + +++++ N  T IEV       E+ L  ++   N ++G  P +   Y
Sbjct  237   GTLGAWFFLLESVQQVDLANNTLTGIEVLPPKLAGENNLVAVELGYNQIRGTAPASFAAY  296

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
               L ++++ +N   G IP EY        R L L+ N+L G  P+ F+    +   SL +
Sbjct  297   PRLSSLSMRYNMLHGGIPSEY--ERSKTLRRLYLDGNFLTGKAPARFVRSDAEVMGSLGN  354

Query  387   NCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
             NCL  CP     C   Q+P   C+++ GG
Sbjct  355   NCLQGCPGKAKMCAPSQKPFYICKQAYGG  383



>ref|XP_010488953.1| PREDICTED: polygalacturonase inhibitor 1-like [Camelina sativa]
Length=389

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 135/389 (35%), Positives = 199/389 (51%), Gaps = 32/389 (8%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATG-THF-LGILCMTPSD  1285
             +A T  SDV  L++FK ++ PNS+ P S L+SW+  + DPC +   THF  GI C     
Sbjct  24    DALTSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRTHFTCGITC----S  79

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             + S R++ + L+  G  G LTP I  LTEL TL+L  N F G IP SI +L  +  L+L 
Sbjct  80    SDSTRVTQLTLDPAGYTGRLTPLIFGLTELLTLDLAENNFYGLIPSSISSLLSLKTLVLR  139

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG +P  + RL  LE ID+SHN L+GS+P T+ +L  L +LDLS N+LTG IP L 
Sbjct  140   SNSFSGSIPDSVTRLNSLESIDISHNSLTGSLPKTMNSLSNLRQLDLSYNKLTGAIPKLP  199

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LAL +N         P+                 + +    L  ++L+DN F+
Sbjct  200   K--NLIDLALKANTLSG-----PISK--------------ESFTESTQLEIVELADNLFT  238

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSS-TKESRLQVLDAHSNLLQGHLPLNIITY  568
             G +      L  + +++++ N  T IEV       E+ L  ++   N ++G  P +   Y
Sbjct  239   GTLGAWFFLLESVQQVDLANNTLTGIEVLPPKFAGENNLVAVELGYNQIRGTAPASFAAY  298

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
               L ++++ +N   G IP EY        R L L+ N+L G  P+ F+    +   SL +
Sbjct  299   PRLSSLSMRYNMLHGGIPSEY--ERSKTLRRLYLDGNFLTGKAPARFVRSDAEVMGSLGN  356

Query  387   NCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
             NCL  CP     C   Q+P   C+++ GG
Sbjct  357   NCLQGCPGKAKMCAPSQKPFYICKQAYGG  385



>ref|XP_006401440.1| hypothetical protein EUTSA_v10013640mg [Eutrema salsugineum]
 gb|ESQ42893.1| hypothetical protein EUTSA_v10013640mg [Eutrema salsugineum]
Length=424

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 133/394 (34%), Positives = 202/394 (51%), Gaps = 16/394 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT  +DV  L+ FK+S+D  S+ P S LSSW+  +DPC+     T   G  C +   + 
Sbjct  26    SKTFWADVAALKDFKNSVDAKSMSPGSCLSSWDFSVDPCDGLFGETFTCGFRCDSVV-SG  84

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             SGR++ + L+  G  G L+    N   L TL+L+ N F GP+PDS+ NL ++T L +S N
Sbjct  85    SGRVTELSLDKAGYSGSLSSVSFNFPYLQTLDLSGNYFSGPLPDSLSNLTRLTSLSVSGN  144

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  +  LE + + +NRL GS+PA+   L  L RL++  N ++G++PDLS L
Sbjct  145   SFSGSIPDSLGSMSGLEELLLDNNRLDGSVPASFNGLTSLKRLEIQLNNISGELPDLSSL  204

Query  918   WQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFS  745
               L  +  S N+    +P   P  +  + + +N + G I  +   L+ L  LDLS N+ S
Sbjct  205   KNLYYIDASDNRISGRVPSSLPGSVLQISMRNNKIQGTIPESFKLLKSLEVLDLSHNKLS  264

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSS--TKESRLQVLDAHSNLLQGHLPLNIIT  571
             G I   I T   L ++ +S N FT ++    S     S L  +D  +N +QG LPL +  
Sbjct  265   GSIPSFIFTHQTLQQLTLSFNGFTSLDSPYYSPLGLPSELISVDLSNNQVQGALPLFMGL  324

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEFMT-GGE  412
                L  ++L +N F G IP +Y  +  S   +           N+L G +P   MT    
Sbjct  325   LPKLSALSLENNSFSGMIPTQYVWKTVSPRSDFAGFQRLLLGGNFLFGVVPGPLMTLKPG  384

Query  411   KARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
              A   L  NC + CP    +C G  QR   +CR+
Sbjct  385   SANVQLAGNCFSWCPATFFFCQGQEQRSTEECRK  418



>emb|CDY45666.1| BnaC09g32080D [Brassica napus]
Length=419

 Score =   158 bits (399),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 131/395 (33%), Positives = 200/395 (51%), Gaps = 18/395 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA-TGTHF-LGILCMTPSDNS  1279
             +KT  +DV  L+ FK+S+D  S+ P S LSSW+  +DPC+  +G  F  G  C T   + 
Sbjct  21    SKTFWADVAALKEFKNSVDAKSITPGSCLSSWDFSVDPCDGLSGETFTCGFRCDTVV-SG  79

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             SGR++ + L+  G  G L+    N   L +L+L+ N F GP+PD + NL ++T L LS N
Sbjct  80    SGRVTDLSLDHAGYSGSLSSVSFNFPYLQSLDLSGNYFFGPLPDCLSNLTRLTSLYLSGN  139

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  +  LE + + ++RLSGS+PA+   L  L RL++  N ++G+ PDLS L
Sbjct  140   SFSGSVPDSLGSMPALEELLLDNSRLSGSVPASFNNLSSLKRLEIQLNNISGEFPDLSSL  199

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTAL---DLSDNRF  748
               LN L  S N+  +G  P  +    + +         +     R LT+L   DLS N+ 
Sbjct  200   KNLNYLDASDNR-ISGRVPLSLPGSVVQISMRNNLMEGTIPESFRNLTSLEVVDLSHNKL  258

Query  747   SGPILHRIVTLPELMRINVSANHFTRIE--VTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
             SG +   I T   L ++ +S N FT ++      S   S L  +D  +N ++G LPL + 
Sbjct  259   SGSVPSFIFTHQTLQQLTLSFNGFTSLDSPYYSPSGLPSELISVDLSNNQIRGSLPLFMG  318

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEFMT-GG  415
                 L  ++L +N F G IP +Y  +  S   +           N+L G +P   M    
Sbjct  319   LLPKLSALSLENNSFSGMIPTQYVWKTVSPGSDFAAFQRLLLGGNFLFGVVPGPLMALKP  378

Query  414   EKARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
               A   L  NC + CP    +C G  QR  ++CR+
Sbjct  379   GSANVQLAGNCFSWCPATFFFCQGQEQRSLTECRK  413



>ref|XP_009798456.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nicotiana sylvestris]
Length=426

 Score =   158 bits (399),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 137/398 (34%), Positives = 208/398 (52%), Gaps = 20/398 (5%)
 Frame = -3

Query  1461  FLNA--KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE--ATGTHFLGILCMT  1294
             FL+A   T   D++VL+  K+S+DPNS+ P S L SW+  +DPC+  +T     G+ C  
Sbjct  25    FLHAHSTTHWQDIEVLKQLKNSVDPNSMTPGSCLISWDFSVDPCDNLSTEKFTCGLRCDI  84

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
                + S R++ + L+  G  G L+    NL  L TL+L  N F G +PDS  NL ++ RL
Sbjct  85    VVSSVS-RVTEVALDQWGYSGSLSSVSWNLPYLQTLDLTNNFFTGSVPDSFSNLTRVQRL  143

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              LS N  SG +P  +  L  LE + + +N L G+IP+T   L+ L RL+   N+LTG+ P
Sbjct  144   TLSRNSLSGSIPSSLGSLSNLEELYLDNNFLEGTIPSTFNGLKNLKRLEFQANKLTGEFP  203

Query  933   DLSGLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISA-ISRLRYLTALDLS  760
             DL  L  L  L  S N F   LP  FP  L  L   +N + G+I A ++ L +L  LDLS
Sbjct  204   DLGQLNNLFFLDGSDNAFSGQLPATFPASLVELATRNNSIEGNIPASLAGLNFLQVLDLS  263

Query  759   DNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLN  580
              N+ SG +   + T P L ++ +S N +  ++   +  + S+L  +D  +N ++G LP  
Sbjct  264   HNKLSGSVPASLFTHPSLEQLTLSYNQYGSVQQPGNFLENSQLIAVDLSNNEIRGLLPGF  323

Query  579   IITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPS---EF  427
             +     L +++L +N+  G IP +Y  ++    + ++         NYL G +P    E 
Sbjct  324   LGLMPRLSSLSLENNKLSGMIPVQYALKMVVPGQGVSQFERLLLGGNYLFGPIPGPMLEL  383

Query  426   MTGGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
               G    R  L  NCL  CP  L  C GG Q+  S+C+
Sbjct  384   KPGSVTVR--LGGNCLYRCPLRLFLCEGGEQKSLSECQ  419



>ref|XP_010518138.1| PREDICTED: polygalacturonase inhibitor 1-like [Camelina sativa]
Length=387

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 134/389 (34%), Positives = 198/389 (51%), Gaps = 32/389 (8%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATG-THF-LGILCMTPSD  1285
             +A T  SDV  L++FK ++ PNS+ P S L+SW+    DPC +   THF  GI C     
Sbjct  22    DALTSPSDVSALKAFKATVKPNSIPPWSCLASWDFTASDPCASPRRTHFTCGITC----S  77

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             + S R++ + L+  G  G LTP I  LTEL TL+L  N F G IP SI +L  +  L+L 
Sbjct  78    SDSTRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSISSLLSLKTLVLR  137

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG +P  + RL  LE ID+SHN L+GS+P T+ +L  L +LDLS N+LTG IP L 
Sbjct  138   SNSFSGSIPDSVTRLNSLESIDISHNSLTGSLPKTMNSLSNLRQLDLSYNKLTGAIPKLP  197

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LAL +N         P+                 + +    L  ++L++N F+
Sbjct  198   K--NLIDLALKANTLSG-----PISK--------------ESFTESTQLEIVELAENSFT  236

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSS-TKESRLQVLDAHSNLLQGHLPLNIITY  568
             G +      L  + +++++ N  T IEV       E+ L  ++   N ++G  P +   Y
Sbjct  237   GTLGAWFFLLESVQQVDLANNTLTGIEVLPPKLAGENNLVAVELGYNQIRGTAPASFAAY  296

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
               L ++++ +N   G IP EY        R L L+ N+L G  P+ F+    +   SL +
Sbjct  297   PRLSSLSMRYNMLHGGIPSEY--ERSKTLRRLYLDGNFLTGKAPARFVRSDGEVMGSLGN  354

Query  387   NCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
             NCL  CP     C   Q+P   C+++ GG
Sbjct  355   NCLQGCPGKAKMCAPSQKPFYICKQAYGG  383



>gb|EYU31152.1| hypothetical protein MIMGU_mgv1a007121mg [Erythranthe guttata]
Length=418

 Score =   157 bits (396),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 128/396 (32%), Positives = 198/396 (50%), Gaps = 21/396 (5%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDN  1282
             N+ T   DVQVL+  K +I  +S+ P+S + SW+  LDPC+   +     G  C    ++
Sbjct  20    NSATHWGDVQVLKQLKGTITQSSIPPSSCIDSWDFSLDPCDNLFSPKFTCGFRCDVVLNS  79

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
             S  R++ + L+  G  G LT    +L  L  L+ + N F G IPDS+  L ++ RL LS 
Sbjct  80    S--RVTELALDSAGYSGSLTSVSWSLPYLQNLDFSNNNFFGSIPDSLSRLTRLKRLGLSH  137

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FSG +P  +  L  +E I +  N L+G IP+T   L  L RL+L  N++ G +PDLS 
Sbjct  138   NSFSGSIPASLGSLAAVEEIYLDGNTLTGEIPSTFNRLANLKRLELQGNKIGGALPDLSR  197

Query  921   LWQLNTLALSSNQFFAGLPPF--PVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             L  LN L  S N     LPPF  P  +   +  + +     +++  L  L  +DLS N+ 
Sbjct  198   LGSLNFLDASDNAISGELPPFLPPYLIVLSMRNNQIEGNIPASVLGLSSLQVIDLSHNKL  257

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             +G +   +   P L ++ +S N F  +++  ++   S+L  +D  +N ++G LP  +   
Sbjct  258   AGSVPAGLFAHPSLEQLTLSYNQFGSVQIPGNAGLTSQLISVDLSNNEIRGFLPGFMGLM  317

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLE--------YNYLEGTLPSEFMTGGE  412
               L  ++L +N+F G IP +Y  ++        +          NYL G +P  FM  G 
Sbjct  318   PRLSALSLENNKFSGWIPVQYVLKVVVPGPGQEIAPLERLLLGGNYLFGPIPGRFM--GL  375

Query  411   KA---RASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
             KA      L  NCL  CP  L +C GG Q+   +CR
Sbjct  376   KAGTVTVMLGDNCLYRCPVRLFFCGGGVQKSLMECR  411



>gb|ACN78482.1| putative disease resistance protein [Arachis hypogaea]
Length=391

 Score =   156 bits (394),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 130/382 (34%), Positives = 197/382 (52%), Gaps = 32/382 (8%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA-TGTHF-LGILCMTPSDNSSG  1273
             T  SD++ L++FK SI  +S+ P S ++SWN   DPC     THF  G+ C   +DN+  
Sbjct  29    TSSSDIEALKAFKASIKSSSITPWSCIASWNFTTDPCSVPRRTHFTCGLTCT--ADNT--  84

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             RI+ I L+  G  G LTP +  LT L TL+L+ N F G IP S+ +L K+  L L  N F
Sbjct  85    RINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSF  144

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
             SG +P  +  L+ L+ +D+S N LSG +P ++ +L  L RLDLS N+LTG +P L     
Sbjct  145   SGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPP--N  202

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L  LA+ +N     L                     +    L  L  ++LSDN   G I 
Sbjct  203   LLDLAIKANSLSGVLQK-------------------TTFEGLNQLEVVELSDNALQGIIE  243

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSST--KESRLQVLDAHSNLLQGHLPLNIITYLNL  559
               +  LP L +++++ N F+ +E+++       + L  ++   N +QG+ P N+  Y +L
Sbjct  244   TWLFLLPSLQQLDLANNSFSGVEISRPVVGGGGNSLVAVNLGFNKIQGYAPANLGAYPSL  303

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
               ++L +N   G IP EYG       + L L+ N+L G  P+  +  G +   SL  NCL
Sbjct  304   SFLSLRYNALRGAIPLEYG--KSKSMKRLFLDGNFLMGRPPAGLVAAGAEVSGSLGDNCL  361

Query  378   -NCPDHLPWCLGGQRPASQCRR  316
               CP     C   Q+P+S C++
Sbjct  362   EGCPAMSQLCTPKQKPSSVCKQ  383



>ref|XP_002966122.1| hypothetical protein SELMODRAFT_85778 [Selaginella moellendorffii]
 gb|EFJ32149.1| hypothetical protein SELMODRAFT_85778 [Selaginella moellendorffii]
Length=396

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 124/398 (31%), Positives = 197/398 (49%), Gaps = 46/398 (12%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLP-ASFLSSWNLDLDPCEATGTH-FLGILCMTPSDNS  1279
             A+T   DV VL++ K ++   + LP +S ++SW+   DPC++  +  F+       ++  
Sbjct  24    AETHPGDVTVLKNIKAAV--AAFLPQSSCVASWDFSRDPCDSYASEKFVCGFSCDAANPR  81

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S RI+ ++L+  G                        + G IP S+ NL  +  L +S+N
Sbjct  82    SKRIARLELDASG------------------------YSGAIPRSLGNLESLVVLDISQN  117

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD--LS  925
              F+G +P  + RLR L+ +D+S N+LSG++P ++  L +L  L ++NN+L+G +P    S
Sbjct  118   SFTGSIPSEIARLRNLQKLDLSGNKLSGALPQSMAQLNKLEYLSVANNKLSGTLPVSLFS  177

Query  924   GLWQLNTLALSSNQFFAGLP-------PFPVrlrtlllghnlltgHISAISRLRYLTALD  766
              +  L  L L +NQF   LP       P  +   +L      LT     ++R + L  LD
Sbjct  178   SMKDLQRLYLQNNQFAGALPTLLFSKLPKSLYQLSLRSNAASLTLDSPDVTRFQDLEVLD  237

Query  765   LSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKS-STKESRLQVLDAHSNLLQGHL  589
             LS N+  GP+   I  LP L ++N+S N  T I  T       S+L   DA  N ++G L
Sbjct  238   LSSNKVRGPLPSTIFLLPSLQQLNLSHNQLTSISSTDHLDFSNSQLVAFDASHNNIRGSL  297

Query  588   PLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEF  427
             P+ +     L +++L  N F  +IP EY  ++ +            L+ NYL+G +PS F
Sbjct  298   PVALSRLNRLSSLSLSSNHFTSRIPDEYAKKVAADGSTALPLARLFLDGNYLQGEVPSLF  357

Query  426   MTG-GEKARASLDHNCL-NCPDHLPWCLGGQRPASQCR  319
             +        AS  +NCL  CP  L +C G QRP S+CR
Sbjct  358   LKPLPNLISASFTYNCLKKCPASLSFCSGSQRPDSECR  395



>ref|XP_003519880.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=426

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 131/402 (33%), Positives = 197/402 (49%), Gaps = 21/402 (5%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPS  1288
             F +A T  SD Q L+  K+++DP+S+ P S L SW+  LDPC+   +     G  C    
Sbjct  20    FESATTHWSDKQALKDLKNNLDPSSITPGSCLYSWDFSLDPCDNLFSDNFTCGFRCDAVV  79

Query  1287  DNSSGRISVIDLEGDGLEG-FLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLL  1111
               ++ R++ + L+  G  G  +     NL  L +L+L+ N F GPIPDS+ NL ++TRL 
Sbjct  80    SGAT-RVTELALDPAGYTGPLVINHHNNLPFLQSLDLSNNYFSGPIPDSLSNLTRLTRLG  138

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD  931
             LS+N FSG +P  +  L  L+ + + +N L+G++P +   L  L RL+L +N L G +PD
Sbjct  139   LSKNSFSGPIPSSLGSLINLQELYLDNNNLNGTLPVSFDGLTNLKRLELQSNSLNGVLPD  198

Query  930   LSGLWQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLS  760
             L+ L  L  L LS N    G P   P  +   ++            A+    YL  LDLS
Sbjct  199   LTSLKNLYFLDLSFNSLTGGFPSNLPDSLVQISIRNNSLNGAFESDALKSFSYLQVLDLS  258

Query  759   DNRFSGPILHRIVTLPELMRINVSANHFTRIE-----VTKSSTKESRLQVLDAHSNLLQG  595
              NR +G +   +  LP L ++ +S N F+ I+             S L  +D  +N L G
Sbjct  259   SNRLNGSLPLSLFELPSLQQLTLSFNGFSGIKPPSFAFDGGVAVPSELIAVDLSNNELGG  318

Query  594   HLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPS  433
              LP+       L +++L +N+F G IP +Y  +          +  L L  NYL G +PS
Sbjct  319   FLPMFFSLMPKLSSLSLENNKFVGMIPTQYALKTVFPEPGVEPFERLLLGGNYLFGGIPS  378

Query  432   EFMT-GGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCRR  316
               M      A   L  NC   CP    +C GG Q+   +C+R
Sbjct  379   ALMALEPGSANVRLVDNCFYRCPLSFFFCQGGEQKSYEECKR  420



>ref|XP_010113398.1| Receptor-like protein 12 [Morus notabilis]
 gb|EXC35405.1| Receptor-like protein 12 [Morus notabilis]
Length=426

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 135/397 (34%), Positives = 201/397 (51%), Gaps = 22/397 (6%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT   D+QVL+ FK+ +DP+SV P S +SSW+  LDPC+   +     G  C +  ++ 
Sbjct  26    SKTNWGDIQVLKEFKNELDPDSVSPGSCVSSWDFKLDPCDNLFSDKFTCGFRCDSVDESG  85

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             + R++ + L+  G  G L     NL  L TL+L+ N F GPIPDS+ NL ++ RL LS N
Sbjct  86    ASRLTELALDQAGYSGSLASLSFNLPYLETLDLSNNFFSGPIPDSLSNLTRLRRLALSGN  145

Query  1098  FFSGGLPR-YMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
              FSG +P   ++ L  LE + + +NRL G IP ++  L  L RL+L +N  +G+ PDL  
Sbjct  146   SFSGQIPATAIKALSSLEELFLDNNRLEGEIPGSLRGLSSLKRLELQSNSFSGEFPDLGS  205

Query  921   LWQLNTLALSSNQFFAG-----LPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
             L  L  L  +SN F +G     LPP  V +                I RL +L  +DLS 
Sbjct  206   LQNLYFLD-ASNNFISGEIPENLPPSLVEISLRNNSVGGKIP--EGIKRLSFLQVMDLSH  262

Query  756   NRFSGPILHRIVTLPELMRINVSANHFTRIE--VTKSSTKESRLQVLDAHSNLLQGHLPL  583
             NR    +   + T   L ++++S+N F+ +     +    ES+L  LD   N + G LP 
Sbjct  263   NRLGDSVPSFLFTHQSLQQLSLSSNRFSSVHPPYFRGVVVESQLIALDLKDNEIGGFLPS  322

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPSEFMT  421
                    L  ++L +N+F G IP +Y  +        S +  L L  NYL G +P   + 
Sbjct  323   FFALMPKLSALSLENNKFTGMIPTQYAVKTVFPSWGVSPFSRLLLGRNYLLGPIPGPLLQ  382

Query  420   -GGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                  A   L  NCL  CP+   +C GG Q+  S+C+
Sbjct  383   LKPGSAHVELTGNCLFRCPEIFFFCQGGEQKSLSECK  419



>ref|XP_008346303.1| PREDICTED: receptor-like protein 12 [Malus domestica]
Length=429

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 132/394 (34%), Positives = 207/394 (53%), Gaps = 16/394 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILC-MTPSDN  1282
             +KT  +D++ L+ FK+S++P+SV P S ++SW+  LDPC+   +     G  C +  + +
Sbjct  29    SKTFWADIEALKEFKNSLNPDSVTPGSCVNSWDFTLDPCDNLFSDRFTCGFRCDLLDNSS  88

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
             S+ R++ + L+  G  G L+        L TL+L+ N F G IPDS+ NL +++RL LS 
Sbjct  89    SASRLTELTLDQAGYSGSLSSLSWXFPYLQTLDLSDNFFSGSIPDSLSNLTRLSRLGLSG  148

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FSG +P  +  L  LE + + +NRL G+IP ++  L +L RL+L  N L G+ P+L  
Sbjct  149   NSFSGSIPXSIGLLSNLEELFLDNNRLDGAIPQSLHGLAQLKRLELQGNLLGGEFPELGS  208

Query  921   LWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRF  748
             L  L  L +S+N    G+P  FP  L  + + +N L G I   I +L +L  LDLS N+ 
Sbjct  209   LQNLYYLDVSNNAISGGVPINFPPSLLQISMRNNSLEGSIPENIKQLGFLQVLDLSHNQL  268

Query  747   SGPILHRIVTLPELMRINVSANHFTRIE--VTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
              G +   +     L ++ +S N FT ++  V+ S +  S L  LD  +N L+G LP  + 
Sbjct  269   GGAVPAHLFNHLSLQQLTLSFNQFTSVQSPVSLSPSTHSELIALDLSNNDLRGMLPPFMA  328

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFM-TGG  415
                 L  + L +N+F G IP +Y  ++      ++         NYL G +P   +    
Sbjct  329   AMPKLSALTLENNKFTGMIPTQYAFKVAVPGSGVSAFERLLLSGNYLFGPIPGPLLRLKP  388

Query  414   EKARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
               A   L  NCL  CP    +C GG Q+   +CR
Sbjct  389   GSANVGLGDNCLYRCPRVFFFCQGGDQKSFHECR  422



>ref|XP_008236364.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Prunus mume]
Length=395

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 143/402 (36%), Positives = 204/402 (51%), Gaps = 45/402 (11%)
 Frame = -3

Query  1467  PCFL--------------NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-  1333
             PCFL               A T  SD+  L++FK SI  +S+ P S L+SW+   DPC  
Sbjct  10    PCFLLPLISLLSNHITPAQALTAPSDISALKAFKASIKASSIPPWSCLASWDFTTDPCAL  69

Query  1332  ATGTHFLGILCMTPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPI  1153
                THF   L  +P    S R++ I L+     G LTP I  LT+L+TL+L+ N F GPI
Sbjct  70    PRRTHFTCGLTCSPD---STRVTQITLDPAAYSGTLTPLISQLTQLSTLDLSENSFSGPI  126

Query  1152  PDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTR  973
             P SI +L K+  L L  N FSG LP  +  L+ LE +D+SHN LSG +P  + +L  L R
Sbjct  127   PSSISSLSKLQSLTLRSNSFSGSLPPSITTLKSLESLDISHNFLSGFLPNAMNSLPNLRR  186

Query  972   LDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAIS  793
             LDLS N+L G +P L     L  LAL  N     +P                    SA +
Sbjct  187   LDLSFNKLAGSLPKLPP--NLLELALKRNSLSGSVPK-------------------SAFT  225

Query  792   RLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTK-SSTKESRLQVLDA  616
              L  L  ++LS+N FSG +      LP L +++++ N  T +E+ K +      L  +D 
Sbjct  226   GLTQLEVVELSENSFSGTLQSWFFLLPSLQQVDLANNSLTGVEIPKPAGNGGGELVAVDL  285

Query  615   HSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLP  436
               N ++G+ P+N   Y  L +++L +NR  G+IP EYG   +   + L L+ N+L G  P
Sbjct  286   GFNRIEGYPPVNFAGYPVLSSLSLRYNRLRGRIPLEYG--RKKSLKRLYLDGNFLIGQPP  343

Query  435   SEFMTGGEKARASLDHNCLN-CPDHLPWCLGGQRPASQCRRS  313
             +  +T G     SL  NCL  CP     CL  Q+P + C+++
Sbjct  344   AGLVTNG--VSGSLGDNCLQACPASSNLCLPSQKPNAICKQA  383



>ref|XP_010550441.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
Length=417

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 137/398 (34%), Positives = 202/398 (51%), Gaps = 14/398 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT-GTHFLGILCMTPSDNSS  1276
             +KT  +DV+ L+ FK+S+  +SV P S LSSW+  LDPC++  G  F          + S
Sbjct  19    SKTFWADVEALKEFKNSVHADSVSPGSCLSSWDFSLDPCDSLFGERFTCGFRCDLVISGS  78

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
              R++ + L+  G  G L+    NL  L TL+L  N F G +PDS+ +L ++TRL LS N 
Sbjct  79    ARVTELSLDQAGYSGSLSSVSFNLPYLQTLDLTGNYFTGQLPDSLSHLTRLTRLALSRNS  138

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW  916
             FSG +P  +  +  LE + + +NRL G +PA    +  L RL++  N L+G+ PDL  L 
Sbjct  139   FSGSVPGSIGSITGLEEVLLDNNRLEGPVPANFNGISGLKRLEMQFNNLSGEFPDLGSLK  198

Query  915   QLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFSG  742
              L+ L  S N+    +P   P  L  + + +N + G I  +++ L  L  LDLS NR SG
Sbjct  199   NLSYLDASDNRISGRVPSSLPESLVQISMRNNFIGGTIPESLNLLNSLQVLDLSHNRLSG  258

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTK--ESRLQVLDAHSNLLQGHLPLNIITY  568
              I   I T   L ++ +S N FT ++    S     S+L  +D  +N +QG LPL +   
Sbjct  259   SIPSFIFTHSSLQQLTLSFNRFTSVQSPWYSPSGLPSQLIAVDLSNNEIQGILPLFMSLL  318

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMT-GGEK  409
               L  ++L +N+  G IP +Y  +  S            L  N+L G +P   M      
Sbjct  319   PKLSALSLENNKISGMIPTQYVWKTVSPGSYFAPFERLLLGGNFLFGAIPGPLMELKPGS  378

Query  408   ARASLDHNCLN-CPDHLPWCLG-GQRPASQCRRSAGGI  301
             A   L  NC   CP  L +C G  QRP  +CR+  G I
Sbjct  379   ANVQLAGNCFFWCPTTLFFCQGRDQRPFMECRKFRGVI  416



>ref|XP_010679829.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Beta vulgaris subsp. vulgaris]
Length=432

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 132/400 (33%), Positives = 196/400 (49%), Gaps = 15/400 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT  +D+ VL+  K SI  NS+ P S +SSW+   DPC++  +     G  C   + ++
Sbjct  30    SKTYYTDITVLKLLKQSISTNSLTPGSCISSWDFSYDPCDSLFSDKFTCGFTCDRVNSSN  89

Query  1278  SGRISVIDLEGDGLEGFLTP-EIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
               R++ + L+       L+     NL  L +L+L  N F G IPDS+ NL ++TRL+LS 
Sbjct  90    ITRVTELGLDQASYSASLSSIPWNNLQFLRSLDLTGNAFHGNIPDSLSNLTRLTRLVLSR  149

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N  SG +P  + +L  LE I + +N L G IP +   LR L R++L  N+L+G+ PDLS 
Sbjct  150   NSLSGSIPNSLSQLGALEEIYLDYNSLVGPIPGSFRGLRGLKRVELQGNQLSGEFPDLSR  209

Query  921   LWQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
             L QL  L  S N     +P   P  +   ++             +  L +L  LDLS N+
Sbjct  210   LTQLEFLDTSENLITGRVPTNLPSSLTEISMRKNLLSGDLPGEILRNLPFLQVLDLSFNQ  269

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
              SG I     T   L ++++S N  T IEV      +S L  +D  +N L G LP  +  
Sbjct  270   LSGLISASFFTHSVLQQVSLSNNKLTSIEVPSGLGADSGLIAIDLSNNELSGLLPGFMGL  329

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslw------rnlnLEYNYLEGTLPSEFMT-GGE  412
                L  + L +N+F G IP  Y  ++            L L  NYL G +P   M     
Sbjct  330   MPKLSALTLENNKFMGLIPTTYALKMVWAEPGVVPFERLLLGGNYLFGPIPDPLMKLEPG  389

Query  411   KARASLDHNC-LNCPDHLPWCLGG-QRPASQCRRSAGGIM  298
               R +L  NC L CP+ + +C GG Q+   +CR S G ++
Sbjct  390   STRINLVDNCLLVCPNTVFFCQGGDQKSVVECRTSLGPVI  429



>ref|XP_002533302.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF29079.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=429

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 133/402 (33%), Positives = 204/402 (51%), Gaps = 25/402 (6%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSD  1285
             + AKT   DV+VL+  K+ I+ +SV P S LSSW+  +DPC++  +     G  C     
Sbjct  24    VEAKTHWQDVEVLKQLKNGIEASSVSPGSCLSSWDFSVDPCDSLFSEKFTCGFRCDLLVS  83

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
               S R++ + L+  G  G L+    NL  L TL+L+ N F G IP+S  NL ++TRL LS
Sbjct  84    GMS-RVTEVSLDQAGYSGSLSSISWNLPYLQTLDLSSNNFYGQIPESFSNLTRLTRLGLS  142

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N+FS  +P  +  L KLE + + +N L G+IPA+I  L  L RL++ +N+L G+ P+L 
Sbjct  143   RNWFSNNIPTSIGSLTKLEELYLDNNILQGTIPASINGLISLKRLEIQSNKLYGEFPELG  202

Query  924   GLWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNR  751
              L  L  L  S N     +P   P  L  + + +N L G I  +   L +L  LDLS N+
Sbjct  203   SLKNLYFLDASDNAISGKVPYSLPSSLVQISMRNNTLQGTIPESFKNLVFLQVLDLSHNK  262

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTK-----ESRLQVLDAHSNLLQGHLP  586
              SG +   + T P L ++ +S N+FT ++     +      +S L  +D  +N LQG LP
Sbjct  263   LSGLVPSLLFTHPSLQQLTLSFNYFTSVQSPSPFSLPSSPIQSELIAMDLSNNQLQGFLP  322

Query  585   LNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLE--------YNYLEGTLPSE  430
               +     L  ++L +N+F G IP ++  +  +                 NYL G +P +
Sbjct  323   SFLPLMPKLSALSLENNKFTGMIPTQFAIKAAASLIGSGFSPFARLLLGGNYLFGPIPVQ  382

Query  429   FMT---GGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
              +    G    R  L+ NCL  CP    +C GG Q+   +C+
Sbjct  383   LIKLQPGSVDVR--LNDNCLYRCPTSFFFCQGGVQKSLMECK  422



>gb|AFK43023.1| unknown [Medicago truncatula]
Length=414

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 133/392 (34%), Positives = 211/392 (54%), Gaps = 18/392 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSDNS  1279
             +KT   D + L+  K +I+ NS+ P S +SSW+   DPC+   +     G  C T   N 
Sbjct  20    SKTHWLDTKSLKQLKQNINRNSITPGSCISSWDFTFDPCDNLFSEKFTCGFRCDTIISNL  79

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G L+  I N   L TL+++ N F G IP+S+ +L +++RL+LS N
Sbjct  80    S-RVTELTLDQAGYSGSLS--IDNFPYLNTLDVSNNYFTGNIPESLSSLTRLSRLILSSN  136

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              F+G +P  +  L  LE + + +N L G++P++   L+ LTRLDL  N+L+GKIP+L  L
Sbjct  137   SFTGEIPSSIGSLTNLEELYLDNNNLQGTVPSSFNYLKSLTRLDLQQNKLSGKIPNLGSL  196

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAIS--RLRYLTALDLSDNRFS  745
               L  + LS+N F      FP  L  + + +N L+G +++ S   L YL  +D S N+ +
Sbjct  197   ENLYYMDLSNNGFSGDPFGFPASLVQISMRNNNLSGSLASESFKNLNYLQVVDFSSNKIN  256

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTK--ESRLQVLDAHSNLLQGHLPLNIIT  571
             G +      LP L ++ +S N F+ IE     T+  +S L  +D  +N L+G LP  + T
Sbjct  257   GYVPSIFFQLPSLQQLTLSFNEFSSIEAPSYGTESSQSELIAVDLSNNQLEGFLPAFLAT  316

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPSEFMT-GGE  412
                L +++L +NRF G IP ++  +        + +  L L  NYL G +P   +    +
Sbjct  317   MPKLSSLSLENNRFTGLIPVQFALKTVFPEIGMAPFGRLLLGGNYLLGGIPRPLLVLKQD  376

Query  411   KARASLDHNCL-NCPDHLPWCLGG-QRPASQC  322
              A  SL  NCL  CP    +C GG Q+ + +C
Sbjct  377   SANVSLVDNCLFRCPHVFFFCQGGAQKSSFEC  408



>ref|XP_003612103.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula]
 gb|AES95061.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=414

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 133/392 (34%), Positives = 211/392 (54%), Gaps = 18/392 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSDNS  1279
             +KT   D + L+  K +I+ NS+ P S +SSW+   DPC+   +     G  C T   N 
Sbjct  20    SKTHWLDTKSLKQLKQNINRNSITPGSCISSWDFTFDPCDNLFSEKFTCGFRCDTIISNL  79

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G L+  I N   L TL+++ N F G IP+S+ +L +++RL+LS N
Sbjct  80    S-RVTELTLDQAGYSGSLS--IDNFPYLNTLDVSNNYFTGNIPESLSSLTRLSRLILSSN  136

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              F+G +P  +  L  LE + + +N L G++P++   L+ LTRLDL  N+L+GKIP+L  L
Sbjct  137   SFTGEIPSSIGSLTNLEELYLDNNNLQGTVPSSFNYLKSLTRLDLQQNKLSGKIPNLGSL  196

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAIS--RLRYLTALDLSDNRFS  745
               L  + LS+N F      FP  L  + + +N L+G +++ S   L YL  +D S N+ +
Sbjct  197   ENLYYMDLSNNGFSGDPFGFPASLVQISMRNNNLSGSLASESFKNLNYLQVVDFSSNKIN  256

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTK--ESRLQVLDAHSNLLQGHLPLNIIT  571
             G +      LP L ++ +S N F+ IE     T+  +S L  +D  +N L+G LP  + T
Sbjct  257   GYVPSIFFQLPSLQQLTLSFNEFSSIEAPSYGTESSQSELIAVDLSNNQLEGFLPAFLAT  316

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPSEFMT-GGE  412
                L +++L +NRF G IP ++  +        + +  L L  NYL G +P   +    +
Sbjct  317   MPKLSSLSLENNRFTGLIPVQFALKTVFPEIGMAPFGRLLLGGNYLLGGIPRPLLVLKQD  376

Query  411   KARASLDHNCL-NCPDHLPWCLGG-QRPASQC  322
              A  SL  NCL  CP    +C GG Q+ + +C
Sbjct  377   SANVSLVDNCLFRCPHVFFFCQGGTQKSSFEC  408



>ref|XP_006291196.1| hypothetical protein CARUB_v10017324mg [Capsella rubella]
 gb|EOA24094.1| hypothetical protein CARUB_v10017324mg [Capsella rubella]
Length=422

 Score =   154 bits (389),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 136/398 (34%), Positives = 204/398 (51%), Gaps = 29/398 (7%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT   DV  L+ FK+S+D  S+ P S LSSW+  +DPC+   + T   G+ C+      
Sbjct  29    SKTYWGDVAALKDFKNSVDAKSMSPGSCLSSWDFSVDPCDNVFSDTFTCGLRCV------  82

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             SGR++ +  +  G  G L+    NL  L TL+L  N F G +PDS+ NL ++TRL +S N
Sbjct  83    SGRVTELSFDQAGYSGSLSSFSFNLPYLQTLDLTGNYFSGQLPDSLSNLTRLTRLAVSGN  142

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  +  LE + + +NRL+GS+PA+   L  L RL++  N ++G+ PDLS L
Sbjct  143   SFSGSIPNSLGSMSLLEELLLDNNRLNGSVPASFNGLSSLKRLEIQVNNISGEFPDLSSL  202

Query  918   WQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHISAISRL-RYLTALDLSDNRFS  745
               L  L  S N+    +P   P  L  + + +NLL G I    +L   L  +DL+ N+ S
Sbjct  203   KNLYYLDASDNRISGRIPTSLPDSLVQISMRNNLLHGTIPQSFKLYNSLQVIDLTHNKLS  262

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSS--TKESRLQVLDAHSNLLQGHLPLNIIT  571
             G I   I T   L ++ +S N FT +E    S  +  S L  +D  +N +QG LPL +  
Sbjct  263   GSIPSFIFTHQSLQQLALSFNGFTSLESPYYSPLSLNSELISIDLSNNRIQGVLPLFLGL  322

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY----------NYLEGTLPSEFMT  421
                L  ++L +N FFG IP +Y         +   E+          N+L G +P   + 
Sbjct  323   SPKLSALSLENNNFFGMIPTQY----VWKTVSPGSEFSGFQRLLLGGNFLFGVVPGPLLA  378

Query  420   -GGEKARASLDHNCLN-CPDHLPWCLG-GQRPASQCRR  316
                  A   L  NC + CP  L +C G  QR  ++CR+
Sbjct  379   LKPGSANVQLAGNCFSWCPATLFFCQGEEQRSPTECRK  416



>ref|XP_009123233.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
Length=388

 Score =   153 bits (387),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 136/391 (35%), Positives = 197/391 (50%), Gaps = 34/391 (9%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATG-THF-LGILCMTPSD  1285
             +A T  SDV  L++FK S+ PNS+   S L+SW+    DPC     THF  GI C     
Sbjct  21    DALTSPSDVSALKAFKASVKPNSIPQWSCLASWDFTASDPCATPRRTHFTCGITC----S  76

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             + S R++ + L+  G  G LTP I  LT+L TL+L  N F G IP SI +L  +  L L 
Sbjct  77    SDSTRVTQLTLDPVGYTGRLTPLISGLTQLLTLDLADNNFYGSIPSSISSLVSLQTLTLR  136

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG LP  + RL   E ID+S N L+GS+P ++++L  L +LDLS N+LTG IP L 
Sbjct  137   SNSFSGSLPESVTRLNSAESIDISRNSLTGSLPKSLSSLSNLRQLDLSYNKLTGSIPKLP  196

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 L  LAL +N         P+                 + +    L  ++L++N F+
Sbjct  197   --QSLIDLALKANSLSG-----PISK--------------ESFTESTQLEVVELAENSFT  235

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVT---KSSTKESRLQVLDAHSNLLQGHLPLNII  574
             G +      L  + +++++ N  T IEV    K  + ES L  ++   N + G+ P +  
Sbjct  236   GTLGAWFFNLQSIQQVDLANNSITGIEVIPPPKKLSGESDLVAVELGFNRISGNAPASFA  295

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASL  394
              Y  L +++L +N   G IP EY        R L L+ NYL G  P+ F+    +   SL
Sbjct  296   AYPRLTSLSLRYNMLHGAIPAEY--ERSKTLRRLFLDGNYLTGKAPARFVKPETEVMGSL  353

Query  393   DHNCL-NCPDHLPWCLGGQRPASQCRRSAGG  304
              +NCL  CP     C   Q+P S C+++ GG
Sbjct  354   GNNCLRGCPGKAKMCAPSQKPFSICKQAYGG  384



>ref|XP_009120067.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Brassica 
rapa]
Length=418

 Score =   154 bits (388),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 136/394 (35%), Positives = 205/394 (52%), Gaps = 16/394 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA-TGTHF-LGILCMTPSDNS  1279
             +KT  +DV  L+ FK+S+D  S+ P S LSSW+  +DPC+  +G  F  G  C T   + 
Sbjct  20    SKTFWADVAALKEFKNSVDAKSITPGSCLSSWDFSVDPCDGLSGETFTCGFRCDTVV-SG  78

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             SGR++ + L+  G  G L+    N   L +L+L+ N F GP+PDS+ NL ++T L LS N
Sbjct  79    SGRVTDLSLDHPGYSGSLSSLSFNFPYLQSLDLSGNYFSGPLPDSLSNLTRLTSLYLSGN  138

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  +  LE + + +NRLSGS+PA+   L  L RL++  N ++G+ PDLS L
Sbjct  139   SFSGSVPDSLGSMPALEELLLDNNRLSGSVPASFNNLSSLKRLEIQLNNISGEFPDLSSL  198

Query  918   WQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHISAISR-LRYLTALDLSDNRFS  745
               LN L  S N+    +P   P  +  + + +NL+ G I    R L  L  +DLS N+ S
Sbjct  199   KNLNYLDASDNRISGRVPSSLPGSVVQISMRNNLMEGTIPESFRDLTSLEVVDLSHNKLS  258

Query  744   GPILHRIVTLPELMRINVSANHFTRIE--VTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             G +   I T   L ++ +S N FT ++      S   S L  +D  +N ++G LPL +  
Sbjct  259   GSVPSFIFTHQTLQQLTLSFNGFTSLDSPYYSPSGLPSELISVDLSNNQIRGSLPLFMGL  318

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEFMT-GGE  412
                L  ++L +N F G IP +Y  +  S   +           N+L G +P   M     
Sbjct  319   LPKLSALSLENNSFSGMIPTQYVWKTVSPGSDFAAFQRLLLGGNFLFGVVPGPLMALKPG  378

Query  411   KARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
              A   L  NC + CP    +C G  QR  ++CR+
Sbjct  379   SANVQLAGNCFSWCPATFFFCQGQEQRSLTECRK  412



>ref|XP_004146484.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Cucumis sativus]
 ref|XP_004170071.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Cucumis sativus]
 gb|KGN53272.1| hypothetical protein Csa_4G043880 [Cucumis sativus]
Length=417

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 130/399 (33%), Positives = 193/399 (48%), Gaps = 13/399 (3%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSD  1285
             + +KT   D QVL+  K+++DP S+   S + SW+  LDPC++  +     G  C     
Sbjct  19    VQSKTYWEDTQVLKQLKNALDPTSISSGSCVDSWDFSLDPCDSLFSQKFTCGFRCDAVVS  78

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
               S R++ ++L+  G  G L+    NL  L TL+L+ N F G IPDS  NL ++  L LS
Sbjct  79    GVS-RVTELNLDQAGYSGSLSSVFWNLPFLQTLDLSNNFFSGSIPDSFSNLTRLRSLSLS  137

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG +P  +  L  LE + ++ N  +GS+PA+   L  L RL+L +N  TG  PDL 
Sbjct  138   TNMFSGEVPPSIGSLSALEELYLNGNGFNGSVPASFVGLVSLQRLELQSNGFTGVFPDLG  197

Query  924   GLWQLNTLALSSNQFFAGLPPF--PVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
              L  L  L  S N F   LP    P  ++  +  ++      S+I  L  L  +DLS NR
Sbjct  198   VLKNLYYLDGSDNGFSGELPAVLPPSLVQLSMRNNSFEGVVPSSIRDLVNLQVVDLSHNR  257

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             FSG +   +   P L ++ +S N F+ +E   S    S L  +D   N + G LP  +  
Sbjct  258   FSGSVPAVLFEHPSLEQLTLSFNQFSAMETPVSDGIRSGLIAVDLSDNEITGFLPPFLAL  317

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEF-MTGGE  412
                L  ++L +N F G IP  Y  +  +    ++         NYL G +P        +
Sbjct  318   MPKLSALSLENNNFTGMIPILYAFKTTAPEPGISPFVRLLLGGNYLSGPIPEPLRRMKAD  377

Query  411   KARASLDHNCLN-CPDHLPWCLGGQRPASQCRRSAGGIM  298
              A   L  NCL  CP    +C GG++ +    RSAG I+
Sbjct  378   SATVRLAGNCLFWCPTLFFFCQGGEQKSPVECRSAGPII  416



>gb|KDP46684.1| hypothetical protein JCGZ_06472 [Jatropha curcas]
Length=422

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 132/388 (34%), Positives = 201/388 (52%), Gaps = 18/388 (5%)
 Frame = -3

Query  1434  DVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSDNSSGRISV  1261
             D+QVL+ FK+S++  S+ P S LSSW+  +DPC+   +     G  C      +S R++ 
Sbjct  30    DLQVLKDFKNSLESVSLTPGSCLSSWDFSVDPCDNLFSERFTCGFRCDLVVSGAS-RVTE  88

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             + L+  G  G L+    NL  L  L+L+ N F G IP+S  NL ++TRL LS N+FSG  
Sbjct  89    LSLDSAGYSGSLSSISWNLPFLQILDLSGNNFYGKIPESFSNLTRLTRLGLSRNWFSGQT  148

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGK-IPDLSGLWQLNT  904
             P  +  L  LE + + +N L G+IPA+  +L  L RL++ +N+L     P+LS L  L+ 
Sbjct  149   PTSIGSLTNLEELYLDNNILEGTIPASFNSLISLKRLEVQSNKLNCMPFPELSSLKNLSF  208

Query  903   LALSSNQFFAGLPP--FPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFSGPIL  733
             L +S N FF+G  P  FP  L  + + +N L G+I  +   L YL  LD+S N+ S  + 
Sbjct  209   LDVSDN-FFSGKIPSSFPSSLVEISMRNNSLEGNIPESFKNLGYLQVLDMSHNKLSDSVP  267

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKT  553
               +   P L ++ +S N+FT ++   SST +S L  +D  +N LQG LP  +     L  
Sbjct  268   SFLFNHPSLQQLTLSYNNFTSVQSPSSSTIQSELIAVDLSNNQLQGFLPSFLALMPKLSA  327

Query  552   VNLGHNRFFGKIPKEYGsrlrslwrnlnLEY-------NYLEGTLPSEFMT-GGEKARAS  397
             ++L +N+  G IP ++  +           +       NYL G +P   M      A   
Sbjct  328   LSLENNKLTGMIPTQFAIKTAVPGGAGFSPFERLLLGGNYLFGPIPVALMELKPGSADVR  387

Query  396   LDHNC-LNCPDHLPWCLGG-QRPASQCR  319
             L+ NC L CP    +C GG Q+    C+
Sbjct  388   LNGNCLLWCPVTFFFCQGGDQKSRMDCK  415



>ref|XP_011028659.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Populus euphratica]
Length=426

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 127/397 (32%), Positives = 197/397 (50%), Gaps = 18/397 (5%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSD  1285
             + +KT   D++VL+ FK ++DPNSV P S LS+W+  +DPC+   +     G  C     
Sbjct  24    VESKTYWGDIEVLKEFKTAVDPNSVSPGSCLSAWDFTVDPCDNLFSERFACGFRCDIVVS  83

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
              SS R++ + L+  G  G L+    NL  L TL+L+ N F G IP S+ NL ++ RL LS
Sbjct  84    GSS-RVTELSLDQAGYSGTLSSITWNLPYLQTLDLSNNYFYGQIPKSLSNLTQLRRLGLS  142

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N F G +P  +  L  LE + + +N L G+IPA+   L  L RL + +N+L G+ P+L 
Sbjct  143   RNLFYGEIPTSIGSLSSLEELYLDNNNLQGNIPASFNGLASLKRLQIQSNKLIGEFPELG  202

Query  924   GLWQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDN  754
              L  L     S N     +P   P  +   ++            +   L +L  LDLS N
Sbjct  203   PLKNLKYFDASDNAISGDVPLALPASLVQLSMRNNGLRGKLDPQSFRSLAFLQVLDLSHN  262

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIE---VTKSSTKESRLQVLDAHSNLLQGHLPL  583
               S  +   + T P L ++ +S N FT ++   +  ++T +S L  +D  +N L+G LP 
Sbjct  263   NLSDSVPLPLFTHPSLQQLTISFNFFTSVQSPPLPLTTTLQSALVAIDLSNNELRGSLPS  322

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMT  421
              + +   L  ++L +N+F G IP ++  +  S    L+      L  NYL G +P   M 
Sbjct  323   FMASMPKLSALSLENNKFSGMIPTQFAMKTVSPGSELSPFDRLFLGGNYLYGPIPGPLME  382

Query  420   GGEK-ARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                  A   L+ NCL  CP    +C GG Q+   +C+
Sbjct  383   LQPGFADVRLNDNCLYRCPVSFFFCRGGDQKSQVECK  419



>ref|XP_003536619.1| PREDICTED: phytosulfokine receptor 1-like [Glycine max]
Length=393

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 130/394 (33%), Positives = 196/394 (50%), Gaps = 35/394 (9%)
 Frame = -3

Query  1461  FLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHFL-GILCMTPS  1288
              + A T  SD+  L++FK SI P+S+   S L+SWN   DPC     T F+ G+ C    
Sbjct  23    LVQALTSPSDIAALKAFKASIKPSSITQWSCLASWNFTTDPCSLPRRTSFICGLTC----  78

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
                S RI+ I L+  G  G LTP I  LT+LTTL+L  N   GPIP SI +L  +  L L
Sbjct  79    TQDSTRINQITLDPAGYSGTLTPLISQLTQLTTLDLAENNLFGPIPSSISSLSNLQTLTL  138

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
               N FSG +P  +   + L+ +D++HN LSG +P ++ +L  L RLDLS N LTG IP L
Sbjct  139   RSNSFSGTIPSSITTFKSLQSLDLAHNSLSGYLPNSMNSLTTLRRLDLSFNRLTGSIPKL  198

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
                  L  LA+ +N     L                      +   ++ L  ++LS+N  
Sbjct  199   PP--NLLELAIKANSLSGSLQK-------------------QSFEGMKQLEVVELSENAL  237

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVT-----KSSTKESRLQVLDAHSNLLQGHLPL  583
             +G +      LP L +++++ N FT ++++     +  +  S L  L+   N ++G+ P 
Sbjct  238   TGTVESWFFLLPSLQQVDLANNTFTGVQISRPLEAREGSSNSNLVALNLGFNRIRGYAPA  297

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKAR  403
             N+  Y  L  +++ +N   G IP EYG       + L L+ N+  G  P+  M  G    
Sbjct  298   NLGAYPALSFLSIRYNALRGAIPLEYG--QIKSMKRLFLDGNFFVGKPPAGLMEAGTAVS  355

Query  402   ASLDHNCLN-CPDHLPWCLGGQRPASQCRRSAGG  304
              SL  NCL+ CP     C   Q+P+S C+++  G
Sbjct  356   GSLGDNCLHACPGSSQLCSPAQKPSSVCKQAYRG  389



>ref|XP_008337901.1| PREDICTED: receptor-like protein kinase 2 [Malus domestica]
Length=426

 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 137/395 (35%), Positives = 209/395 (53%), Gaps = 18/395 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILC-MTPSDN  1282
             +KT  +D++ L+ FK+S+DP SV P S +SSW+ +LDPC+   +     G  C    S +
Sbjct  29    SKTFWADIEALKEFKNSLDPGSVRPGSCVSSWDFNLDPCDNLFSDRFTCGFRCDKVDSSS  88

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
             S  R++ + L+  G  G L+    N   L TL+L+ N F G IP+S+ NL  + RL LS 
Sbjct  89    SVSRLTELTLDQAGYSGSLSSLSWNFPYLQTLDLSNNFFSGSIPESLSNLTGLIRLGLSG  148

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FSG +P  +  L  L  + + +NRL+G+IP+++  L  L RL+L  N L+G+ P+L  
Sbjct  149   NSFSGAIPDSIGSLSNLVELFLDNNRLNGAIPSSLNGLAGLQRLELQGNLLSGEFPELGS  208

Query  921   LWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRF  748
             L  L+ L  S+N    G+P  FP  L  + + +N L G+I   I +L +L  LDLS N+ 
Sbjct  209   LQNLSYLDASNNAISGGVPLNFPTSLLQISMRNNSLVGNIPENIKQLGFLQVLDLSHNQL  268

Query  747   SGPILHRIVTLPELMRINVSANHFTRIE--VTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
              G +   +     L ++ +S N FT ++  V+ S   +S L  LD  +N L G LPL + 
Sbjct  269   GGAVPAHLFNHLSLQQLTLSFNQFTSVKPPVSPSPGAQSALIALDLSNNELSGMLPLFMA  328

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFMTGGE  412
                 L  + L +N+F G IP +Y  ++      ++         NYL G +P   + G E
Sbjct  329   AMRKLSALTLENNKFTGMIPTQYALKVAVPGSGVSKLERLLLGGNYLSGPIPRPLL-GLE  387

Query  411   KARAS--LDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                A+  L +NCL  CP     C GG Q+   +CR
Sbjct  388   PGSANVVLGNNCLYRCPRIYHVCKGGXQKSYHKCR  422



>emb|CDY17334.1| BnaA10g09680D [Brassica napus]
Length=418

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 134/394 (34%), Positives = 203/394 (52%), Gaps = 16/394 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE--ATGTHFLGILCMTPSDNS  1279
             +KT  +DV  L+ FK+S+D  S+ P S LSSW+  +DPC+  +  T   G  C T   + 
Sbjct  20    SKTFWADVAALKEFKNSVDAKSITPGSCLSSWDFSVDPCDNLSGETFTCGFRCDTVV-SG  78

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             SGR++ + L+  G  G L+    N   L +L+L+ N F GP+PDS+ NL ++T L LS N
Sbjct  79    SGRVTDLSLDHPGYSGSLSSLSFNFPYLQSLDLSGNYFSGPLPDSLSNLTRLTSLYLSGN  138

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  +  LE + + +NRLSGS+PA+   L  L RL++  N ++G+ PDLS L
Sbjct  139   SFSGSVPDSLGSMPALEELLLDNNRLSGSVPASFNNLSSLKRLEIQLNNISGEFPDLSSL  198

Query  918   WQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFS  745
               LN L  S N+    +P   P  +  + + +NL+ G I  +   L  L  +DLS N  S
Sbjct  199   KNLNYLDASDNRISGRVPSSLPGSVVQISMRNNLMEGTIPESFRNLTSLEVVDLSHNNLS  258

Query  744   GPILHRIVTLPELMRINVSANHFTRIE--VTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             G +   I T   L ++ +S N FT ++      S   S L  +D  +N ++G LPL +  
Sbjct  259   GSVPSFIFTHQTLQQLTLSFNGFTSLDSPYYSPSGLPSELISVDLSNNQIRGSLPLFMGL  318

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEFMT-GGE  412
                L  ++L +N F G IP +Y  +  S   +           N+L G +P   M     
Sbjct  319   LPKLSALSLENNSFSGMIPTQYVWKTVSPGSDFAAFQRLLLGGNFLFGVVPGPLMALKPG  378

Query  411   KARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
              A   L  NC + CP    +C G  QR  ++CR+
Sbjct  379   SANVQLAGNCFSWCPATFFFCQGQEQRSLTECRK  412



>ref|XP_010514243.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 [Camelina sativa]
Length=423

 Score =   151 bits (382),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 135/400 (34%), Positives = 203/400 (51%), Gaps = 29/400 (7%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSD  1285
             + +KT   DV+ L+  K S+D  S+ P S LS+W+  LDPC+   + T   G+ C+    
Sbjct  28    VESKTFWGDVKALKDLKSSVDAKSMSPGSCLSTWDFSLDPCDNVFSDTFTCGLRCV----  83

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
               SGR++ +  +  G  G L+    NL  L TL+L  N F GP+PDS+ NL ++T L LS
Sbjct  84    --SGRVTELSFDQAGYSGSLSSFSFNLPYLHTLDLTGNYFSGPLPDSLSNLTRLTGLALS  141

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG +P  +  +  L  + + +NRLSGS+PA+   L  L RL++  N ++G+ PDLS
Sbjct  142   GNSFSGSIPDSLGSMSLLVDLLLDNNRLSGSVPASFNGLSSLKRLEIQVNNISGEFPDLS  201

Query  924   GLWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHISAISRL-RYLTALDLSDNR  751
              L  L  L  S N+    +P   P  L  + + +NL+ G I    +L   L  +DL+ N+
Sbjct  202   SLKNLYYLDASDNRISGRIPSSLPESLVQISMRNNLIRGTIPQSFKLYSSLQVIDLAHNK  261

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSS--TKESRLQVLDAHSNLLQGHLPLNI  577
              SG I   I T   L ++ +S N FT ++    S  +  S L  +D  +N +QG LPL +
Sbjct  262   LSGSIPSFIFTHQSLQQLTLSFNGFTSLDSPYYSPMSLPSELISIDLSNNRIQGVLPLFL  321

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY----------NYLEGTLPSEF  427
                  L  ++L +N FFG IP +Y         +   E+          N+L G +P   
Sbjct  322   GLSPKLSALSLENNNFFGMIPTQY----VLKTVSSGSEFARFQRLLLGGNFLFGVVPGPL  377

Query  426   MT-GGEKARASLDHNCLN-CPDHLPWCLG-GQRPASQCRR  316
             M      A   L  NC + CP  L +C G  QR  ++CR+
Sbjct  378   MALKPGSANLQLTGNCFSWCPATLFFCQGEEQRSPNECRK  417



>ref|XP_002310285.2| hypothetical protein POPTR_0007s13680g [Populus trichocarpa]
 gb|EEE90735.2| hypothetical protein POPTR_0007s13680g [Populus trichocarpa]
Length=432

 Score =   151 bits (381),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 126/395 (32%), Positives = 197/395 (50%), Gaps = 18/395 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT   D++VL+  K ++D NSV P S LSSW+  +DPC++  + +   G  C      S
Sbjct  26    SKTFWGDIEVLKEVKSAVDRNSVNPGSCLSSWDFTVDPCDSLFSESFTCGFRCDIVVSES  85

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G L     NL  L TL+L+ N F G IP+S+ NL +++RL LS N
Sbjct  86    S-RVTELSLDQAGYSGSLASISWNLPYLQTLDLSNNFFYGQIPESVSNLTQLSRLGLSRN  144

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSGG+P  +  L +LE + + +N L G IPA+   L  L RL++  N+L G+ P+L  L
Sbjct  145   MFSGGIPTSIGSLSRLEELYLDNNNLQGIIPASFNGLVSLKRLEIQANKLAGEFPELGSL  204

Query  918   WQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
               L+ L  S N     +P   P  +   ++     L      +   L  L  LDLS N  
Sbjct  205   ENLSFLDASENAISGNVPLTLPASLVQISMRNNSLLGKLDPRSFKNLALLQVLDLSHNNL  264

Query  747   SGPILHRIVTLPELMRINVSANHFTRIE---VTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             S  +   + T P + ++ +S N FT ++      ++  +S +  +D  +N L+G LP  +
Sbjct  265   SDSVPLPLFTHPSIQQLTLSFNSFTSVQSPPFPSTTVLKSEVIAIDLSNNELRGFLPYFM  324

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMTGG  415
                  L  ++L +N+F G IP ++  +       L+      L  NYL G +P   M   
Sbjct  325   ALMPKLSALSLENNKFSGMIPTQFAIKTVLPGSGLSPFGRLLLGGNYLYGPIPGPLMELQ  384

Query  414   EK-ARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                A   L+ NCL  CP    +C GG Q+   +C+
Sbjct  385   PGFADVRLNDNCLYRCPVSFFFCQGGDQKSHMECK  419



>ref|XP_006340694.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Solanum tuberosum]
Length=420

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 132/398 (33%), Positives = 206/398 (52%), Gaps = 20/398 (5%)
 Frame = -3

Query  1461  FLNA--KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMT  1294
             FL+A   T   D++VL+  K+S+DPNSV P S L+SW+  +DPC+  G      G+ C  
Sbjct  19    FLHAHSTTHWQDIEVLKQLKNSVDPNSVSPGSCLNSWDFSVDPCDNLGGEKFTCGLRCDL  78

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
                + S R++ + L+     G LT    NL  L  L++  N F G +P+S+ NL ++ R+
Sbjct  79    VVSSVS-RVTELALDQWNYSGSLTSVSWNLPYLQNLDITNNAFSGLVPESLSNLTRVQRV  137

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              LS N  SG +P  +  L  LE + + +N L G IP +   L+ L RL+   N++TG+ P
Sbjct  138   GLSGNSLSGSIPSSLGSLSNLEELYLDNNFLEGEIPQSFNGLKNLKRLEFQGNQITGEFP  197

Query  933   DLSGLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISA-ISRLRYLTALDLS  760
             +L  L  LN +  S N     LP  +P  L  L + +N + G+I A +  L ++  +DLS
Sbjct  198   ELDQLINLNFIDASDNAISGELPASYPASLIELAMRNNSIEGNIPASLIGLNFVQVIDLS  257

Query  759   DNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLN  580
              N+ SG +   + T P L ++ +S N F  ++    S + S+L   D  +N ++G LP  
Sbjct  258   HNKLSGSVPASVFTHPSLEQLTLSYNQFGSVQEPGISFQNSQLIAADLSNNEIRGLLPGF  317

Query  579   IITYLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPS---EF  427
             +     L +++L +N+  G IP +Y  ++       S +  L L  NYL G +PS   + 
Sbjct  318   LGLMPRLSSLSLENNKLSGMIPTQYALKMVFPGEGVSQFERLLLGGNYLFGPIPSPLLDL  377

Query  426   MTGGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
               G    R  L  NCL  CP  L  C GG Q+  S+C+
Sbjct  378   KAGSFTVR--LGDNCLYRCPLRLFLCEGGEQKSLSECQ  413



>ref|XP_004232455.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Solanum lycopersicum]
Length=415

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 128/397 (32%), Positives = 203/397 (51%), Gaps = 18/397 (5%)
 Frame = -3

Query  1461  FLNA--KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPS  1288
             FL+A   T   D++VL+  K+S+DPNS+ P S L+SW+  +DPC+  G       C    
Sbjct  14    FLHAHSTTHWQDIEVLKQLKNSVDPNSMSPGSCLNSWDFSVDPCDNLGGE--KFTCGFRC  71

Query  1287  D---NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITR  1117
             D   +S  R++ + L+     G LT    NL  L  L+++ N F G +PDS+ NL ++ R
Sbjct  72    DLVVSSVSRVTELALDQWNYSGSLTSVSWNLPYLQNLDISNNAFSGSLPDSLSNLTRVQR  131

Query  1116  LLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI  937
             + LS N  SG +P  +  L  LE + + +N L G IP +   L+ L RL+   N++TG+ 
Sbjct  132   VGLSGNSLSGSIPTSLGSLSNLEELYLDNNFLEGEIPQSFNGLKNLKRLEFQGNQITGEF  191

Query  936   PDLSGLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISA-ISRLRYLTALDL  763
             P+L+ L  LN +  S N     LP  +P  L  L + +N + G+I A +  L  +  +DL
Sbjct  192   PELNQLINLNFIDASDNAISGELPASYPASLMELAMRNNSIEGNIPASLIGLNLIQVIDL  251

Query  762   SDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPL  583
             S N+ SG +   + T P L ++ +S N F  ++    S + S+L   D  +N ++G LP 
Sbjct  252   SHNKLSGSVPASLFTHPSLEQLTLSYNQFGSVQEPGISFQNSQLIAADLSNNEIRGLLPG  311

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMT  421
              +     L +++L +N+  G IP +Y  ++      ++      L  NYL G +P   + 
Sbjct  312   FLGLMPTLSSLSLENNKLSGMIPTQYALKMVFPGEGVSPFERLLLGGNYLFGPIPGPLLD  371

Query  420   -GGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                   R  L  NCL  CP  L  C GG Q+  S+C+
Sbjct  372   LKAGSVRVRLGDNCLYRCPLRLFLCEGGEQKSLSECQ  408



>ref|XP_006350423.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Solanum tuberosum]
Length=194

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -3

Query  1257  DLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLP  1078
             +LEGD LEGFLT  IGNLTEL +LNL RNKFRGP+P+SI  LRK+T L LSENFFS  L 
Sbjct  69    NLEGDRLEGFLTSSIGNLTELVSLNLGRNKFRGPVPESITYLRKLTSLQLSENFFSSSLV  128

Query  1077  RYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLA  898
               +  L KLE++DV++N+LSGSIP++ T+LR LTRLDLSNNELTGKIP L+GLW+L++  
Sbjct  129   NDIGVLTKLEILDVANNKLSGSIPSSTTSLRSLTRLDLSNNELTGKIPQLNGLWKLHSFD  188

Query  897   LSSNQF  880
             +S+NQ 
Sbjct  189   ISNNQI  194


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 54/101 (53%), Gaps = 1/101 (1%)
 Frame = -3

Query  804  SAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQV  625
            S+I  L  L +L+L  N+F GP+   I  L +L  + +S N F+   V       ++L++
Sbjct  81   SSIGNLTELVSLNLGRNKFRGPVPESITYLRKLTSLQLSENFFSSSLVNDIGVL-TKLEI  139

Query  624  LDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYG  502
            LD  +N L G +P +  +  +L  ++L +N   GKIP+  G
Sbjct  140  LDVANNKLSGSIPSSTTSLRSLTRLDLSNNELTGKIPQLNG  180



>ref|XP_009346301.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=426

 Score =   149 bits (377),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 135/396 (34%), Positives = 206/396 (52%), Gaps = 20/396 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILC-MTPSDN  1282
             +KT  +D++ L+ FK+S+DP SV P S +SSW+ +LDPC+   +     G  C    S +
Sbjct  29    SKTFWADIEALKEFKNSLDPGSVRPGSCVSSWDFNLDPCDNLFSDRFTCGFRCDKVDSSS  88

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
             S  R++ + L+  G  G L+    N   L TL+L+ N F G IP+S+ NL  + RL LS 
Sbjct  89    SVSRLTELTLDQAGYSGSLSSLSWNFPYLQTLDLSNNFFSGSIPESLSNLTGLIRLGLSG  148

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FSG +P  +  L  L  + + +NRL G+ P+++  L  L RL+L  N L+G+ P+L  
Sbjct  149   NSFSGAIPDSIGSLSNLVELFLDNNRLEGATPSSLNGLAGLQRLELQGNLLSGEFPELGS  208

Query  921   LWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRF  748
             L  L+ L  S+N    G+P  FP  L  + + +N L G+I   I +L +L  LDLS N+ 
Sbjct  209   LQNLSYLDASNNAISGGVPLNFPTSLLQISMRNNSLVGNIPENIKQLGFLQVLDLSHNQL  268

Query  747   SGPILHRIVTLPELMRINVSANHFTRIE--VTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
              G +   +     L ++ +S N F  ++  V+ S   +S L  LD  +N L G LPL + 
Sbjct  269   GGAVPGHLFNHLSLQQLTLSFNQFMSVKPPVSPSPGAQSALIALDLSNNELSGMLPLFMA  328

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFMTGGE  412
                 L  + L +N+F G+IP +Y  ++      ++         NYL G +P   +  G 
Sbjct  329   AMRKLSALTLENNKFTGRIPTQYALKVAVPGSGVSKLERLLLGGNYLSGPIPRPLL--GL  386

Query  411   K---ARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
             K   A   L +NCL  CP     C GG Q+   +CR
Sbjct  387   KPGSANVVLGNNCLYRCPRIYHVCKGGDQKSYHKCR  422



>ref|XP_006346371.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Solanum tuberosum]
Length=414

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 128/382 (34%), Positives = 195/382 (51%), Gaps = 32/382 (8%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCMTPSDNSSGRI  1267
              SD+  L++FK +I P+S+   S L +WN   DPC     THF  G+ C     +S  R+
Sbjct  58    SSDIIALQAFKAAIKPSSIPSYSCLGTWNFTTDPCSVPRVTHFTCGLSC-----SSGNRV  112

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             + + L+  G  G L+P I  LT+L TL+L  N F GPIP S+ +L  +  L+L  N FSG
Sbjct  113   TELTLDPAGYTGTLSPLISKLTQLVTLDLQNNNFYGPIPSSLSSLPNLKNLVLRLNSFSG  172

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLN  907
              +P  +  L+ L  +D+SHN +SG +P ++  L  L RLDLS N+LTG +P L     L 
Sbjct  173   SVPPSLTSLKSLLSLDISHNLISG-LPNSMNELTSLRRLDLSYNKLTGSLPKLPP--NLL  229

Query  906   TLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHR  727
              LA  +N                       +   S+   L  L  ++LS+N   G I   
Sbjct  230   ELAAKANS-------------------LSGSLLKSSFYGLNQLEVVELSENSLFGTIETW  270

Query  726   IVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVN  547
                LP L +I+++ N FT +++ K     S L  +D   N ++G+LP+N   +  L +++
Sbjct  271   FFQLPSLQQIDMANNSFTLVKIPKVVDLNSDLVAVDLGFNKIEGYLPVNFAIFPRLSSLS  330

Query  546   LGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLN-CP  370
             L +N+F G IP +Y    ++  + L L+ N+L G+ P+ F         SL  NCL  CP
Sbjct  331   LRYNKFRGPIPLQYS--KKATLKRLYLDGNFLNGSPPAGFFGRETSVTGSLGDNCLQKCP  388

Query  369   DHLPWCLGGQRPASQCRRSAGG  304
                  CL  Q+  S C+++ GG
Sbjct  389   ISSQLCLKSQKSTSICQQAYGG  410



>ref|XP_008453716.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Cucumis melo]
Length=418

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 134/399 (34%), Positives = 194/399 (49%), Gaps = 13/399 (3%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT-GTHF-LGILCMTPSD  1285
             + +KT   D QVL+  K+++DP S+   S + SW+  LDPC+   G  F  G  C     
Sbjct  20    VQSKTHWEDTQVLKQLKNALDPTSISSGSCVDSWDFSLDPCDNLFGEKFTCGFRCDAVVS  79

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
               S R++ ++L+  G  G L+    NL  L TL+L+ N F G +PD+  NL ++  L LS
Sbjct  80    GVS-RVTELNLDQAGYSGSLSSVFWNLPFLQTLDLSNNFFSGSVPDTFSNLTRLRSLSLS  138

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N FSG +P  +  L  LE + ++ N  +GS+PA+   L  L RL+L +N  TG  PDL 
Sbjct  139   ANMFSGEVPPSIGSLSALEELYLNGNGFNGSVPASFVGLVSLQRLELQSNGFTGVFPDLG  198

Query  924   GLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNR  751
              L  L  L  S N F   LP   P  L  L + +N   G + S I  L  L  +DLS NR
Sbjct  199   VLKNLYYLDGSDNGFSGELPAVLPTSLVQLSMRNNSFEGVVPSGIRDLVNLQVVDLSHNR  258

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             FSG +   +   P L ++ +S N F+ +E   S    S L  +D   N + G LP  +  
Sbjct  259   FSGSVPAVLFEHPSLEQLTLSFNQFSAVETPDSDGVHSGLIAVDLSDNEITGFLPPFLAL  318

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEF-MTGGE  412
                L  ++L +N F G IP  Y  +  +    ++         NYL G +P        +
Sbjct  319   MPKLSALSLENNNFTGMIPILYAFKTAAPEPGISPFVRLLLGGNYLFGPIPEPLRRMKPD  378

Query  411   KARASLDHNCLN-CPDHLPWCLGGQRPASQCRRSAGGIM  298
              A   L  NCL  CP    +C GG++ +    RSAG I+
Sbjct  379   TATVRLAGNCLFWCPTLFFFCQGGEQKSLVECRSAGPII  417



>ref|XP_004230743.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Solanum lycopersicum]
Length=382

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 128/382 (34%), Positives = 194/382 (51%), Gaps = 32/382 (8%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THF-LGILCMTPSDNSSGRI  1267
              +D+  LR+FK +I P+S+   S L SWN   DPC     THF  G+ C     +S  R+
Sbjct  26    STDILALRAFKAAIKPSSIPSYSCLGSWNFTTDPCSVPRVTHFTCGLSC-----SSGNRV  80

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             + + L+  G  G L+P +  LT+L TL+L  N F GPIP S+ +L  +  L+L  N FSG
Sbjct  81    TELTLDPAGYTGTLSPLVSKLTQLVTLDLQNNNFYGPIPSSLSSLPNLKNLVLRLNSFSG  140

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLN  907
              +P  +  L+ L  +D+SHN +SG +P ++  L  L RLDLS N+LTG +P L     L 
Sbjct  141   SVPPSLTSLKSLLSLDLSHNLISG-LPNSMNELTSLRRLDLSYNKLTGSLPKLPP--NLL  197

Query  906   TLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHR  727
              LA  +N     L                     S+   L  L  ++LS+N   G I   
Sbjct  198   ELAAKANSLSGPL-------------------LKSSFYGLNQLEVVELSENSLFGTIETW  238

Query  726   IVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVN  547
                LP L +I+++ N FT ++++      S L  +D   N ++G+LP+N   +  L ++ 
Sbjct  239   FFQLPSLQQIDMANNSFTLVKISNVVNLNSDLVAVDLGFNKIEGYLPVNFAIFPRLSSLT  298

Query  546   LGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLN-CP  370
             L +N+F G IP +Y    ++  + L L+ N+L G+ P+ F         SL  NCL  CP
Sbjct  299   LRYNKFRGPIPLQYS--KKATLKRLYLDGNFLNGSPPAGFFGRETSVTGSLGDNCLQKCP  356

Query  369   DHLPWCLGGQRPASQCRRSAGG  304
                  CL  Q+  S C+++ GG
Sbjct  357   ISSQLCLKSQKSTSICQQAYGG  378



>ref|XP_002875304.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51563.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 132/398 (33%), Positives = 200/398 (50%), Gaps = 29/398 (7%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT   DV  L+  K+S+D  S+ P S LS+W+  +DPC++  + T   G+ C+      
Sbjct  19    SKTYWGDVTALKELKNSVDAKSMRPGSCLSTWDFSVDPCDSVFSDTFTCGLRCV------  72

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             SGR++ +  +  G  G L+    NL  L TL+L+ N F GP+PDS+ NL  +TRL LS N
Sbjct  73    SGRVTELSFDQAGYSGSLSSFSFNLPYLHTLDLSGNYFSGPLPDSLSNLTHLTRLALSAN  132

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L  LE + +  NRL GS+P +   L  L RL++  N ++G+ PDL+ L
Sbjct  133   SFSGSIPDSLGSLSLLEELLLDGNRLDGSVPVSFNGLSNLKRLEIQVNNISGEFPDLNSL  192

Query  918   WQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFS  745
               L  L  S N+    +P   P  L  + + +NL+ G I  +      L  +DL+ N+ S
Sbjct  193   KNLYFLDASDNRISGRIPSSLPESLVQISMRNNLIHGTIPQSFKLFNSLQVIDLTHNKLS  252

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSS--TKESRLQVLDAHSNLLQGHLPLNIIT  571
             G I   I T   L ++ +S N FT ++    S  +  S L  +D  +N +QG LPL +  
Sbjct  253   GSIPSFIFTHQSLQQLTLSFNGFTSLDSPYYSPLSLPSELISIDLSNNRIQGVLPLFLGL  312

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY----------NYLEGTLPSEFMT  421
                L  ++L +N FFG IP +Y         +   E+          N+L G +P   M 
Sbjct  313   LPKLSALSLENNNFFGMIPTQY----VWKTVSSGSEFAGFQRLLLGGNFLFGVVPGPLMA  368

Query  420   -GGEKARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
                      L  NC + CP  L +C G  QR  ++CR+
Sbjct  369   LKPGSTNLQLAGNCFSWCPATLFFCQGQEQRSPTECRK  406



>ref|XP_010263857.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Nelumbo nucifera]
Length=423

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 128/398 (32%), Positives = 192/398 (48%), Gaps = 13/398 (3%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSDN  1282
             +++T   D + L+  K +ID  SV P S LSSW+  +DPC+   +     G  C      
Sbjct  26    DSRTYWRDAESLKELKRAIDFGSVTPGSCLSSWDFSVDPCDNIFSERFTCGFRCDRVVAG  85

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
              S R++ I L+  G  G L+    NL  L  L++  N   G IP+S+ NL ++ RL LS 
Sbjct  86    RS-RVTEISLDRAGYTGSLSSSAWNLPYLEILDVADNSLSGSIPNSLSNLTRLRRLALSR  144

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N FSG +P  +  L  LE + + +NRL G IP +   L  L RL+L  N L+G+ P L  
Sbjct  145   NSFSGEIPTSIGSLSSLEELYLDNNRLQGPIPPSFNGLVSLKRLELQGNNLSGEFPSLGS  204

Query  921   LWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISA-ISRLRYLTALDLSDNRF  748
             L  L  L  S N+    +P   P  L  L + +N L G   A I  L +L  +D ++NR 
Sbjct  205   LENLYFLDASDNKISGRVPTNIPGSLVELSMRNNYLEGPFPANIRDLGFLQVIDFTNNRI  264

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG +   +   P L ++ +S N F+ ++V  +    S L  +D   N L+G LP  +   
Sbjct  265   SGAVPSTLFDHPSLQQLTLSHNKFSSLQVPWNLGIRSELIAVDLSYNELEGLLPAFMAMM  324

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEFMT-GGEK  409
               L  ++L HN+F G IP +Y  R        +         NYL G +P   M      
Sbjct  325   PKLSALSLEHNKFTGMIPSQYALRAVVPIAGASQLVRLLLGGNYLFGPIPGPLMALKPGS  384

Query  408   ARASLDHNCL-NCPDHLPWCLGGQRPASQCRRSAGGIM  298
             A  +L  NCL +CP    +C GG++ +    +S G ++
Sbjct  385   ATVNLVDNCLFSCPPTFFFCQGGEQKSLIVCKSFGPMI  422



>ref|XP_008796883.1| PREDICTED: leucine-rich repeat receptor-like kinase protein THICK 
TASSEL DWARF1 [Phoenix dactylifera]
Length=426

 Score =   146 bits (368),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 134/403 (33%), Positives = 191/403 (47%), Gaps = 18/403 (4%)
 Frame = -3

Query  1473  MNPCFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATGT--HFLGIL  1303
             + P  + +KT   D + L++ K  +DP S+   S LS+W+    DPC+A  +     G+ 
Sbjct  19    VTPLTVTSKTFPGDTEALKAVKQGVDPRSIPSGSCLSTWDFAAADPCDAAFSPRFTCGLR  78

Query  1302  CMTPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKI  1123
             C T       R++ + L+  G  G +TP + +L  L +L L  N   G +P         
Sbjct  79    CDTSDAAGFLRVTELALDPAGYSGSITPSVWSLPFLESLELADNSLAGAVPLPPPAGLPP  138

Query  1122  T--RLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNEL  949
                RL LS N FSG +P +      LE + + +N LSG IP  +  L  L RL+L  N L
Sbjct  139   RLRRLSLSRNAFSGEIPGF-SAAPALEELYLDNNLLSGPIPPGLATLPALRRLELQTNNL  197

Query  948   TGKIPDLSGLWQLNTLALSSNQFFAGLP--PFPVrlrtlllghnlltgHI--SAISRLRY  781
             TG+IPDL  L  L  L  S+N    G P   FP  +  + L  N L G I  +A++ L  
Sbjct  198   TGEIPDLGPLQNLTFLDASNNALSGGFPSGKFPASVVEISLRSNRLEGEIPGAAVAALPA  257

Query  780   LTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLL  601
             L  +DLS N  SG +       P L ++ ++ N F  I+        SRL  LD   N L
Sbjct  258   LQVMDLSHNGLSGAVPGAAFEHPSLEQLTLAYNRFESIKRPGDGGLVSRLIALDLGHNRL  317

Query  600   QGHLPLNIITYLNLKTVNLGHNRFFGKIPKEY-----GsrlrslwrnlnLEYNYLEGTLP  436
              G LP  + +   L  ++L  NRF G IP +Y     G+     +  L L  NYL G +P
Sbjct  318   GGFLPAFLGSMPRLSALSLEDNRFTGMIPAQYAVRVVGAWGAVPFARLILSGNYLSGPVP  377

Query  435   SEFMTGGE-KARASLDHNCL-NCPDHLPWCLGG-QRPASQCRR  316
             S  +   E  A  +L  NCL  CP    +C GG Q+P++ CR 
Sbjct  378   SPLVGLKEGSAMVNLADNCLFRCPPEFFFCDGGRQKPSTTCRE  420



>ref|XP_007201068.1| hypothetical protein PRUPE_ppa007248mg [Prunus persica]
 gb|EMJ02267.1| hypothetical protein PRUPE_ppa007248mg [Prunus persica]
Length=376

 Score =   145 bits (365),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 135/387 (35%), Positives = 192/387 (50%), Gaps = 50/387 (13%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHFLGILCMTPSDNS  1279
              A T  SD+  L++FK SI  +S+ P S L+SW+   DPC     THF   L  +P    
Sbjct  28    QALTAPSDISALKAFKASIKASSIPPWSCLASWDFTTDPCALPRRTHFTCGLTCSPD---  84

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ I L+     G LTP I  LT+L+TL+L+ N F GPIP SI +L K+  L L  N
Sbjct  85    STRVTQITLDPAAYSGTLTPLISQLTQLSTLDLSENSFSGPIPSSISSLSKLQSLTLRSN  144

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG LP  +  L+ LE +D+SHN LSG +P  + +L  L RLDLS N+L G +P L   
Sbjct  145   SFSGSLPPSITNLKSLESLDISHNFLSGFLPNAMNSLPNLRRLDLSFNKLAGSLPKLPP-  203

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
               L  LAL  N                                          +N FSG 
Sbjct  204   -NLLELALKRNSLSG--------------------------------------ENSFSGT  224

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTK-SSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
             +      LP L +++++ N  T +E+ K +      L  +D   N ++G+ P+N   Y  
Sbjct  225   LQSWFFLLPSLQQVDLANNSLTGVEIPKPAGNGGGELVAVDLGFNRIEGYPPVNFAGYPV  284

Query  561   LKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
             L +++L +NR  G+IP EYG   +   + L L+ N+L G  P+  +TGG     SL  NC
Sbjct  285   LSSLSLRYNRLRGRIPLEYG--RKKSLKRLYLDGNFLIGQPPAGLVTGG--VSGSLGDNC  340

Query  381   LN-CPDHLPWCLGGQRPASQCRRSAGG  304
             L  CP     CL  Q+P + C+++ GG
Sbjct  341   LQACPASSNLCLPSQKPNAICKQAYGG  367



>ref|NP_001241130.1| LRR receptor-like serine/threonine-protein kinase GSO1-like precursor 
[Glycine max]
 gb|ACM89586.1| leucine-rich repeat family protein [Glycine max]
 gb|KHN41926.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Glycine soja]
Length=422

 Score =   145 bits (366),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 138/395 (35%), Positives = 203/395 (51%), Gaps = 18/395 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT-GTHF-LGILCMTPSDNS  1279
             +KT   D +VL+  K  +DP SV P S +SSW+  +DPC+   G  F  G  C       
Sbjct  24    SKTHVGDAEVLKELKQGLDPASVKPGSCVSSWDFTVDPCDNLFGEKFTCGFRCDVVVSGL  83

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G L+    NL  L TL+L+ N F G IP S  NL +++RL LS N
Sbjct  84    S-RVTELTLDQAGYSGSLSSFTWNLPYLQTLDLSNNYFSGQIPYSFSNLTRLSRLSLSFN  142

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L  L+ + + +N L G+IP +   L  L RL+L +N+L   +P+L  L
Sbjct  143   SFSGEIPSSLGTLSDLQELYLDNNNLRGAIPESFNHLANLKRLELQSNKLNTHLPNLESL  202

Query  918   WQLNTLALSSNQFFAGL--PPFPVrlrtlllghnlltgHI--SAISRLRYLTALDLSDNR  751
               L  L LS N F AG      PV L  + + +N L+G +   +   LR L  +D S N+
Sbjct  203   RNLKFLYLSDN-FIAGALSASLPVSLVQISIRNNNLSGVLLGESFKSLRRLQVVDFSSNQ  261

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVT-KSSTKESRLQVLDAHSNLLQGHLPLNII  574
              SG +      LP L ++ +S N FT +E   K    +S L  +D  +N L+G LP  + 
Sbjct  262   LSGSVPSVFFELPSLQQLTLSFNKFTNLEAPFKGVESQSGLIAVDLSNNRLRGFLPSFMA  321

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPSEFMT-GG  415
                 L +++L +N F G+IP ++G +        S +  L L  NYL G +P   +    
Sbjct  322   VMPKLSSLSLENNEFTGRIPTQFGVKTVFPEKGVSSFGRLLLGGNYLLGGIPRPLLALKR  381

Query  414   EKARASLDHNCL-NCPDHLPWCLGGQRPA-SQCRR  316
             + A  SL  NCL  CP    +C GGQ+ + +QC R
Sbjct  382   DSANVSLVGNCLYRCPHSFFFCQGGQQKSLAQCNR  416



>ref|XP_010061015.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Eucalyptus grandis]
 gb|KCW67912.1| hypothetical protein EUGRSUZ_F01616 [Eucalyptus grandis]
Length=430

 Score =   145 bits (366),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 138/398 (35%), Positives = 199/398 (50%), Gaps = 19/398 (5%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSD  1285
             ++++T   DV+VL++FK +IDP SV P S +SSW+  +DPC+   +     G+ C     
Sbjct  27    VDSRTHPGDVRVLQAFKAAIDPKSVSPGSCVSSWDFSVDPCDRVFSDRFTCGLRCDLTVS  86

Query  1284  NSSGRISVIDLEGDGLEGFLT--PEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLL  1111
             NSS R++ I L+  G  G L+  P  G +  L TL+++ N F G +P S+  L  + RL 
Sbjct  87    NSS-RVTEIALDSAGYSGSLSSVPWDGGVPYLETLDVSYNAFAGSLPGSLARLTSLRRLR  145

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-P  934
             LS N  SG LP  +  L  LE + +  N   G IP++   L  L RL+L  N L+G++  
Sbjct  146   LSRNSLSGQLPASLGSLAALEELSLDGNNFRGGIPSSFNRLASLKRLELQGNNLSGELLS  205

Query  933   DLSGLWQLNTLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISAI--SRLRYLTALDL  763
             DL  L  L+ L  S N+F  G+P   P  L  L L +N L G +  I     R L  LDL
Sbjct  206   DLGSLESLHFLDASDNRFSGGVPAALPASLVELSLRNNRLRGDLPEIVGGAARLLQVLDL  265

Query  762   SDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPL  583
             S N  +G +   +   P L ++ +S N+FT +    S+   SRL  +D   N L+G LP 
Sbjct  266   SRNELTGAVPAALFEHPSLGQLTLSHNNFTSLHAPPSAGANSRLVAVDLSYNNLRGLLPG  325

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY-------NYLEGTLPSEFM  424
              +     L  ++L HN F G IP +Y  R+R                 NYL G +P   +
Sbjct  326   FMAAMPRLSALSLEHNMFTGMIPSQYALRVREAAAGGTTAIGRLLLGGNYLFGPIPGPLV  385

Query  423   T-GGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                   A  SL  NCL  CPD   +C GG Q+  + C+
Sbjct  386   GLRPGSANVSLVDNCLYRCPDEFFFCRGGDQKSPADCK  423



>ref|XP_007046769.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao]
 gb|EOX90926.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao]
Length=422

 Score =   145 bits (366),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 130/393 (33%), Positives = 200/393 (51%), Gaps = 16/393 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILC-MTPSDN  1282
             +KT   D+Q L   K+ +D NSV P S LSSW+   DPC++  +     G  C +T S  
Sbjct  26    SKTYWGDIQALEQLKNGVDRNSVNPGSCLSSWDFTADPCDSLFSERFTCGFRCDLTVSGL  85

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
             S  R++ + L+  G  G L+    NL  L  L+L+ N F G IP S+ NL ++TRL LS 
Sbjct  86    S--RVTEVSLDSAGYAGSLSSASWNLPYLQILDLSNNFFSGWIPGSLSNLTRLTRLGLSR  143

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N  SG +P  +  L  LE + + +N L G IP T   L  L RL++  N L+G++P+L  
Sbjct  144   NTLSGEIPASIGALSSLEELYLDNNNLQGPIPTTFNGLVSLKRLEIQTNNLSGELPELGS  203

Query  921   LWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRF  748
             L  L  L  S+N     LP  FP  L  + + +N + G I  ++  L +L  LDLS N  
Sbjct  204   LKNLYFLDASNNAISGYLPTTFPPSLVQISMRNNKIEGTIPQSLKYLSFLQVLDLSHNEL  263

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             +  + + +     L ++ ++ N FT ++   +   +S L  +D  +N LQG LP  +   
Sbjct  264   TDSVPYFVFNHQSLQQLTLAFNSFTSVQSPPTLGTQSELIAVDLSNNGLQGWLPPFLPLL  323

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPSEFMT-GGEK  409
               L  ++L +N+F G IP +Y  +        + +  L L  NYL G +P   ++   + 
Sbjct  324   PKLSALSLENNKFSGMIPAQYALKTILPGSGIAPFARLLLGGNYLFGPIPGPLLSLKPDT  383

Query  408   ARASLDHNCL-NCPDHLPWCLGG-QRPASQCRR  316
             A  SL  NCL  CP    +C G  Q+ + +C+R
Sbjct  384   ANVSLADNCLIRCPLRFFFCQGADQKSSMECKR  416



>ref|XP_010029720.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Eucalyptus grandis]
 gb|KCW56675.1| hypothetical protein EUGRSUZ_I02375 [Eucalyptus grandis]
Length=438

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 129/411 (31%), Positives = 194/411 (47%), Gaps = 26/411 (6%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL--DPCEA--TGTHFLGILCMTPS  1288
             +A T   DV+VL+  K+++DP+SV P S ++SW+     DPC+A  +     G  C    
Sbjct  28    SAGTYWGDVEVLKQLKNALDPSSVSPGSCVASWDFAAAADPCDALFSDKFTCGFRCDATD  87

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
              + + R++ + L+  G  G L     +L  L TL+L+ N F GPIP S+ NL +++RL L
Sbjct  88    GSGASRLTELALDQAGYSGPLAAVSWDLPYLQTLDLSGNYFAGPIPASLSNLTQLSRLGL  147

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
             S N  SG +P  +  L  L  + +  N L GSIP+++  L  LTRL++ +N+L+G++P  
Sbjct  148   SRNSLSGPIPDSVSSLSSLGELYLDGNALEGSIPSSLGNLTNLTRLEVQSNKLSGELPAA  207

Query  927   SGLWQLNTLALSSNQFFAG-----LPPFPVrlrtlllghnlltgHISAISRLRYLTALDL  763
                        +S+   +G     LPP  V+L                      L  LDL
Sbjct  208   LSSLGSLLYLDASDNAISGELPRALPPSLVQLTMRNNALEGQLAP-ETFQLASSLQVLDL  266

Query  762   SDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPL  583
             S NR +GP+   + T P L ++ +S+N F  I+   S   ES L  +D   N + G LP 
Sbjct  267   SGNRIAGPVPSALFTHPSLQQLTLSSNGFDSIQSPASLFPESELIAVDLSDNRIMGLLPA  326

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY-------NYLEGTL-----  439
              +     L  + L +N F G IP EY  R  +                NYL G +     
Sbjct  327   FLAGMPRLSALALENNEFSGMIPTEYALRAAAQPAQGAARLERLMLGGNYLMGPIPGPLL  386

Query  438   --PSEFMTGGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCRRSAGGIM  298
                     G E+ R SL  NCL  CP    +C GG QR A++C+   G ++
Sbjct  387   GLGQGGGGGEEEVRVSLAGNCLYRCPARFFFCQGGDQRSAAECKSFFGPVI  437



>ref|XP_011025898.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Populus euphratica]
Length=432

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 124/395 (31%), Positives = 195/395 (49%), Gaps = 18/395 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT   D++VL+  K+++D NSV P S LSSW+  +DPC+   + +   G  C      S
Sbjct  26    SKTFWGDIEVLKEVKNAVDRNSVNPGSCLSSWDFTVDPCDNLFSESFTCGFRCDIVVSES  85

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G+L     NL  L TL+L+ N F G IP+S+ NL +++RL LS N
Sbjct  86    S-RVTELSLDQAGYSGWLASISWNLPYLQTLDLSNNFFYGQIPESVSNLTQLSRLGLSRN  144

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L +LE + + +N L G IPA+   L  L RL++  N+L G+ P+L  L
Sbjct  145   MFSGEIPTSIGSLSRLEELYLDNNNLQGIIPASFNGLVSLRRLEIQANKLGGEFPELGSL  204

Query  918   WQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
               L+ L  S N     +P   P  +   ++            +   L  L  LDLS N  
Sbjct  205   KNLSFLDASDNAISGNVPLTLPASLVQISMRNNSLQGKLDPRSFKNLALLQVLDLSHNNL  264

Query  747   SGPILHRIVTLPELMRINVSANHFTRIE---VTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             S  +   +   P + ++ +S N FT ++      ++  +S    +D  +N L+G LP  +
Sbjct  265   SDSVPLPLFAHPSIQQLTLSFNSFTSVQSPPFPSTTVLKSEAIAIDLSNNELRGFLPYFM  324

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPSEFMTGG  415
                  L  ++L +N+F G IP ++  +        S +  L L  NYL G +P   M   
Sbjct  325   GLMPKLSALSLENNKFSGMIPTQFAVKTFLPGSGMSPFARLLLGGNYLYGPIPGPLMELQ  384

Query  414   EK-ARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                A   L+ NCL  CP    +C GG Q+   +C+
Sbjct  385   PGFADVRLNDNCLYRCPVSFFFCQGGDQKSHMECK  419



>ref|XP_006383144.1| hypothetical protein POPTR_0005s11980g [Populus trichocarpa]
 gb|ERP60941.1| hypothetical protein POPTR_0005s11980g [Populus trichocarpa]
Length=426

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 123/397 (31%), Positives = 195/397 (49%), Gaps = 18/397 (5%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFL--GILCMTPSD  1285
             + +KT   D++VL+  K +++PNSV P S LS+W+  +DPC+   +     G  C     
Sbjct  24    VESKTYWGDLEVLKEVKTAVNPNSVSPGSCLSAWDFTVDPCDHLFSEKFTCGFRCDIVVS  83

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
              SS R++ + L+  G  G L+    NL  L TL+L+ N F G IP+S+ NL ++ RL LS
Sbjct  84    GSS-RVTELSLDQAGYSGTLSSITWNLPYLQTLDLSNNYFYGQIPESLSNLTQLRRLGLS  142

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N   G +P  +  L  LE + + +N L G+IPA+   L  L RL++ +N+L G+ P+L 
Sbjct  143   RNLLYGEIPTSIGSLSSLEELYLDNNNLQGNIPASFNGLASLKRLEIQSNKLIGEFPELG  202

Query  924   GLWQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDN  754
              L  L     S N     +P   P  +   ++            +   L +L  LDLS N
Sbjct  203   PLKNLKYFDASDNAISGDVPLALPASLVQLSMRNNGLRGKLDPQSFRSLAFLQVLDLSHN  262

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIE---VTKSSTKESRLQVLDAHSNLLQGHLPL  583
               S  +   + T P L ++ +S N FT ++      ++T +S L  +D  +N L+G LP 
Sbjct  263   NLSDSVPLPLFTHPSLQQLTLSFNFFTSVQSPPFPLTTTLQSALVAIDLSNNELRGVLPS  322

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMT  421
              + +   L  ++L +N+F G IP ++  +       L+      L  NYL G +P   M 
Sbjct  323   FMASMPKLSALSLENNKFSGMIPTQFAIKTVLPGSELSPFDRLFLGGNYLYGPIPGPLME  382

Query  420   GGEK-ARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                  A   L+ NCL  CP    +C GG Q+   +C+
Sbjct  383   LQPGFADVRLNDNCLYRCPVSFFFCRGGDQKSQIECK  419



>ref|XP_010506974.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Camelina sativa]
Length=395

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 117/326 (36%), Positives = 175/326 (54%), Gaps = 12/326 (4%)
 Frame = -3

Query  1464  CFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTP  1291
             C   +KT   DV+ L+  K S+D  S+ P S LS+W+  LDPC+   + T   G+ C+  
Sbjct  24    CLTESKTFWGDVKALKDLKSSVDAKSMSPGSCLSTWDFSLDPCDNVFSDTFTCGLRCV--  81

Query  1290  SDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLL  1111
                 SGR++ +  +  G  G L+    NL  L TL+L  N F GP+PDS+ NL ++TRL 
Sbjct  82    ----SGRVTELSFDQAGYSGSLSSFSFNLPYLHTLDLTGNYFSGPLPDSLSNLARLTRLA  137

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD  931
             LS N FSG +P  +  +  L  + + +NRL GS+PA+   L  L RL++  N ++G+ PD
Sbjct  138   LSGNSFSGSIPDSLGSMPLLVDLLLDNNRLDGSVPASFNGLSSLKRLEIQVNNISGEFPD  197

Query  930   LSGLWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHISAISRL-RYLTALDLSD  757
             LS L  L  L  S N+    +P   P  L  + + +NL+ G I    +L   L  +DL+ 
Sbjct  198   LSSLKNLYYLDASDNRISGRIPSSLPESLVQISMRNNLIRGTIPQSFKLYSSLQVIDLAH  257

Query  756   NRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSS--TKESRLQVLDAHSNLLQGHLPL  583
             N+ SG I   I T   L ++ +S N FT ++    S  +  S L  +D  +N +QG LPL
Sbjct  258   NKLSGSIPSFIFTHQSLQQLTLSFNGFTSLDSPYYSPLSLPSELISIDLSNNRIQGVLPL  317

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEY  505
              +     L  ++L +N FFG IP +Y
Sbjct  318   FLGLSPKLSALSLENNNFFGMIPTQY  343



>ref|XP_007202180.1| hypothetical protein PRUPE_ppa006641mg [Prunus persica]
 gb|EMJ03379.1| hypothetical protein PRUPE_ppa006641mg [Prunus persica]
Length=402

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 129/392 (33%), Positives = 192/392 (49%), Gaps = 41/392 (10%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSG  1273
             +KT   D++ L+  K+++DP SV P S +SSW+  LDPC+               +  S 
Sbjct  31    SKTFWGDIEALKELKNALDPTSVSPGSCISSWDFKLDPCD---------------NLFSD  75

Query  1272  RISV-IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             R +    L+  G  G L+    NL  L TL+L+ N F G IPDS+ NL ++TRL LS N 
Sbjct  76    RFTCGFSLDQAGYSGSLSSISWNLPYLQTLDLSNNFFSGSIPDSLSNLTRLTRLGLSGNS  135

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW  916
             FSG +P  +  L  LE + +  N L G+IP ++  L  L RL+L  N+L+G++P+L  L 
Sbjct  136   FSGSIPASIGSLSNLEELYLDSNSLHGAIPPSLNRLASLKRLELQGNQLSGELPELGSLQ  195

Query  915   QLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFSG  742
              L  L  S+N     +P   P  L  + + +N L G +   I  L +L  LDLS N+  G
Sbjct  196   NLFYLDASNNVISGQIPLTLPSSLLQISMRNNSLQGTVPENIKHLGFLQVLDLSHNQLGG  255

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
              +   +   P L ++ +S N F+  E+            LD  +N L+G LP  +     
Sbjct  256   SVPSYLFEHPSLQQLTLSFNQFSSSEMI----------ALDLSNNQLKGLLPSFLPMMPK  305

Query  561   LKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL------EYNYLEGTLPSEFMTGGEK---  409
             L  + L +N+F G IP +Y  ++      ++         NYL G +P   +  G K   
Sbjct  306   LSALTLENNKFMGMIPTQYAFKVAVPGSGVSAFERLLLGGNYLFGPIPGPLL--GLKPGS  363

Query  408   ARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
             A   L  NCL  CP    +C GG Q+  S+CR
Sbjct  364   ANVGLADNCLYRCPRVFFFCQGGDQKSLSECR  395



>emb|CDY20758.1| BnaA02g08980D [Brassica napus]
Length=414

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 134/390 (34%), Positives = 205/390 (53%), Gaps = 12/390 (3%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE--ATGTHFLGILCMTPSDNS  1279
             +KT   DV  L+ FK+S+D  S+ P S LSSW+  +DPC+  ++ T   G  C T    S
Sbjct  20    SKTYWGDVAALKEFKNSVDAKSMTPGSCLSSWDFSVDPCDNLSSETFTCGFRCDTIVSGS  79

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G L+    N   L TL L+ N F GP+P+S+ NL ++T L LS N
Sbjct  80    S-RVTELILDQAGYSGSLSSLSFNFPYLQTLKLSDNYFSGPLPNSLFNLTRLTSLFLSGN  138

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  +  LE + + +N L+GS+P +   L  L RL+L  N+++G++PDL+ L
Sbjct  139   SFSGPIPASLGSMPVLEELLLDNNNLNGSVPTSFNRLSRLKRLELQQNKISGELPDLTSL  198

Query  918   WQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFS  745
               LN L +S N+F   +P   P  L  + + +NL  G I  +   L  L  +DLS N+ S
Sbjct  199   KNLNYLDVSDNRFSGPVPSSLPGSLVQISMRNNLFKGTIPESFRNLTSLEVIDLSQNKLS  258

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTK--ESRLQVLDAHSNLLQGHLPLNIIT  571
             G I   I T   L ++ +S N FT ++  + S     S L  +D  +N ++G LPL +  
Sbjct  259   GSIPSFIFTHQTLQQLTLSFNGFTSLDSPRYSPSGLPSELISVDLSNNKIRGPLPLFMGL  318

Query  570   YLNLKTVNLGHNRFFGKIPKEY--GsrlrslwrnlnLEYNYLEGTLPSEFMT-GGEKARA  400
                L  ++L +N FFG +P +Y   +   + ++ L L  N+L G +P   M         
Sbjct  319   LPKLSALSLENNSFFGMVPTQYVWKTVSPAGFQRLLLGGNFLFGVVPGPLMALKPGSVNV  378

Query  399   SLDHNCLN-CPDHLPWCLG-GQRPASQCRR  316
              L  NC   CP    +C G  QR   +CR+
Sbjct  379   QLAGNCFTWCPGTFFFCRGREQRSLMECRK  408



>ref|XP_006342229.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Solanum tuberosum]
Length=416

 Score =   142 bits (358),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 125/397 (31%), Positives = 198/397 (50%), Gaps = 24/397 (6%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSD---N  1282
              KT   D+Q L++ K+ I+P S+ P S L+SWN  +DPC+   T      C    D   +
Sbjct  20    CKTHPIDIQGLQNLKNGINPKSIKPGSCLNSWNFTIDPCDHIFTD--RFTCGFRCDLIVS  77

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
                R++ I L+  G  G L P   NL  L  L+++ N   G IP+S  NL ++ RL LS+
Sbjct  78    GFYRVTEISLDQAGYSGSL-PNSFNLPHLEILDMSYNSLSGSIPNSFSNLTRLRRLSLSK  136

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N F+G +   +  L +L+ + + +N+ +GSIP +   L  L R +L  N ++G++P+L+ 
Sbjct  137   NSFTGPVTSSIGSLSRLQELFLDNNKFTGSIPESFNGLINLNRFELQQNNISGELPNLNQ  196

Query  921   LWQLNTLALSSNQ----FFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDN  754
             L  L  L LS+N+    FF    P  +   ++   +      ++    L++L  LDLS N
Sbjct  197   LGNLIFLDLSNNRLAGNFFTTNLPDSMIELSIRNNYLHGEFPLN-FEELKFLQVLDLSHN  255

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
              FSG I   +     L ++ +S N+FT ++V +     S+L  +D   N L G LP  + 
Sbjct  256   LFSGMIPAVLFHHSSLQQLTLSYNNFTFLQVPEDLVLRSKLIAIDLSYNNLHGLLPAFMA  315

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY------NYLEGTLPSEFMTGGE  412
             +   L  +NL HN+F G IP ++  ++ +   +           NYL G +P   M  G 
Sbjct  316   SMPELSALNLEHNKFTGVIPIQFAVKVVAPRNHTASFERLLLGGNYLFGPIPGPLM--GL  373

Query  411   K---ARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
             K      SL  NCL  CPD +  C GG Q+    C++
Sbjct  374   KPGSGNISLVDNCLYMCPDSVYICHGGYQKSLLDCKK  410



>ref|XP_010674464.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Beta vulgaris subsp. vulgaris]
Length=416

 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 130/383 (34%), Positives = 189/383 (49%), Gaps = 12/383 (3%)
 Frame = -3

Query  1434  DVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNSSGRISV  1261
             DV+ L++ K SI+  S+   S LSSW+  +DPC+   +     GI C   S     R++ 
Sbjct  28    DVEALKNLKRSIERKSITMGSCLSSWDFSVDPCDHIFSARFTCGIRC-DFSLAGLSRVTE  86

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             I L+  G  G LT     L  L TL+L+ N   G +P+S+ NL ++ +L LS N FS  +
Sbjct  87    IALDSAGYSGELTNITWLLPYLHTLDLSGNSLSGSLPESLSNLIRLRQLSLSRNSFSLSI  146

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTL  901
             P  +  L  LE + +  N+LSGSIP ++  L  L    +  N+L+G+ P L  L  LN+L
Sbjct  147   PTSIGSLPYLEELYLDDNKLSGSIPPSLNKLSHLKNFAIQQNQLSGEFPFLGSLSNLNSL  206

Query  900   ALSSNQFFA-GLPP--FPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFSGPIL  733
               S+N   + G  P   P+ L +  + +N L G +      +RYL  LDLS N   G I 
Sbjct  207   DASNNNISSIGTNPLSLPISLISFSMRNNSLKGEMPRQFLHMRYLEVLDLSYNELVGAIT  266

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQV-LDAHSNLLQGHLPLNIITYLNLK  556
               I   P L +++ S N F+ +     + +  R  V +D   N + G LP  +    NL 
Sbjct  267   GEIFEHPSLQQLSFSHNQFSAVISPSGNVRRGRKMVAVDLSYNKINGLLPKFLAELPNLS  326

Query  555   TVNLGHNRFFGKIPKEYG-srlrslwrnlnLEYNYLEGTLPSEFM-TGGEKARASLDHNC  382
              ++L HNRF G IP  Y      +  + L L  NYL G +P          A+ SL  NC
Sbjct  327   ALSLEHNRFTGMIPSGYAFKVRTASLQRLLLGGNYLFGPIPDPLKRVEPGSAKVSLVDNC  386

Query  381   L-NCPDHLPWCLGG-QRPASQCR  319
             L  CPD   +C GG Q+   QC+
Sbjct  387   LYTCPDTFFFCQGGEQKSLIQCK  409



>ref|XP_007157953.1| hypothetical protein PHAVU_002G112100g [Phaseolus vulgaris]
 gb|ESW29947.1| hypothetical protein PHAVU_002G112100g [Phaseolus vulgaris]
Length=417

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 133/394 (34%), Positives = 191/394 (48%), Gaps = 20/394 (5%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNS  1279
             +KT   D +VL+  K  ++  SV+P S +SSW+  LDPC+         G  C       
Sbjct  23    SKTHWGDAEVLKELKQGLEQASVIPGSCVSSWDFTLDPCDNLFADKFTCGFRCDVVVSGL  82

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G LT    NL  L TL+L++N F   IPDS  NL ++ RL LS N
Sbjct  83    S-RVTELALDQAGYVGSLT-FTWNLPFLQTLDLSKNNFSAQIPDSFSNLTRLRRLSLSSN  140

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L  LE + +  N L G+IP        L RL+L +N L   +P+    
Sbjct  141   SFSGEIPPSLGTLPSLEELYLDSNNLRGTIPQ---GFHNLKRLELQSNNLNTHLPNFDTF  197

Query  918   WQLNTLALSSNQFFAGL-PPFPVrlrtlllghnlltgHISAIS--RLRYLTALDLSDNRF  748
               L  L  S N     L    PV L  + + +N L G +S+ S   L+ L  +D S NR 
Sbjct  198   TNLKYLDFSDNSIAGELSASLPVSLVQISIRNNNLNGVLSSESFRNLKRLQVVDFSSNRM  257

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEV-TKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             SG I      LP L ++ +S N FT++E   K     SRL  +D  +N L+G LP  +  
Sbjct  258   SGLIPSVFFELPSLQQLTLSFNEFTKVEAPYKGVESRSRLIAVDLSNNRLEGFLPSFMAM  317

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMT-GGE  412
                L +++L +N F G+I  +   +  S    +       L  NYL G +P   +T   +
Sbjct  318   MPKLSSLSLENNEFTGRIATQLAEKTVSPKTGVTPLERLLLRGNYLVGGIPRPLLTLKRD  377

Query  411   KARASLDHNCL-NCPDHLPWCLGGQRPA-SQCRR  316
              A  SL  NCL  CP    +C GGQ+ + +QC R
Sbjct  378   SANVSLVDNCLYRCPHTFFFCQGGQQKSLAQCNR  411



>ref|XP_007156101.1| hypothetical protein PHAVU_003G258700g [Phaseolus vulgaris]
 gb|ESW28095.1| hypothetical protein PHAVU_003G258700g [Phaseolus vulgaris]
Length=391

 Score =   137 bits (345),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 115/357 (32%), Positives = 177/357 (50%), Gaps = 14/357 (4%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDN  1282
             ++ T   D Q+L+  K++++  SV P S + SW+   DPC+   +     G  C      
Sbjct  21    DSATHWDDTQLLKELKNNLNAASVTPGSCIYSWDFSFDPCDNLFSDKFTCGFRCDAVVSG  80

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
             +S R++ + L+  G  G L P   NL  L TL+++ N F G IP+S  NL ++TRL LS+
Sbjct  81    TS-RLTELTLDPAGYTGTL-PAAWNLPYLQTLDVSNNFFSGQIPESFSNLTRLTRLGLSK  138

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N  +G +P  +  L  L+ + + +N L G IP T  AL  L RL++ +N+L G +P LS 
Sbjct  139   NSLTGTIPSSLSSLSNLQELYLDNNNLQGPIPVTFNALTNLQRLEMQSNKLNGVVPSLSS  198

Query  921   LWQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
             L  L  L LS N F  G P   P  +   ++            ++  L  L  +DLS N 
Sbjct  199   LKSLYYLDLSFNFFGGGFPSALPESLIQISMRNNSLSGALEPESLRSLNSLQVVDLSGNG  258

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTK-ESRLQVLDAHSNLLQGHLPLNII  574
             FSG +   +  LP L ++ +S N F+++EV   S +  S +  +D   N L G LPL   
Sbjct  259   FSGAVPFALFELPSLQQVTLSFNKFSQVEVPSYSLEMRSGVIAVDLSDNELGGFLPLFPA  318

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln------LEYNYLEGTLPSEFMT  421
                 L +++L +N+F G IP +Y  +       +       L  NYL G +PS  M 
Sbjct  319   LMPRLSSLSLENNKFVGMIPTQYALKTVFPEAGMAPFQRLLLGGNYLFGAIPSALMA  375



>ref|XP_002982179.1| hypothetical protein SELMODRAFT_115747, partial [Selaginella 
moellendorffii]
 gb|EFJ16847.1| hypothetical protein SELMODRAFT_115747, partial [Selaginella 
moellendorffii]
Length=299

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 105/299 (35%), Positives = 154/299 (52%), Gaps = 17/299 (6%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATI-TA  991
             F G IP  I  LR + +L LS N  SG LP+ M +L KLE + V++N+LSG++P ++ ++
Sbjct  1     FPGSIPSEIARLRNLQKLDLSGNKLSGALPQSMAQLNKLEYLSVANNKLSGTLPVSLFSS  60

Query  990   LRELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQF-----FAGLPPFPVrlrtlllg  829
             +++L RL L NN+  G +P  LS    L     S N F     F+ LP   +   +L   
Sbjct  61    MKDLQRLYLQNNQFAGALPTSLSNTVNLRYFDASHNGFTDSLLFSKLPK-SLYQLSLRSN  119

Query  828   hnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKS-  652
                LT     ++R + L  LDLS N+  GP+   I  LP L ++N+S N  T I  T   
Sbjct  120   AASLTLDSPDVTRFQDLEVLDLSSNKVRGPLPSTIFLLPSLQQLNLSHNQLTSISSTDHL  179

Query  651   STKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnl  472
                 S+L   DA  N ++G LP+ +     L +++L  N F  +IP EY  ++ +     
Sbjct  180   DFSNSQLVAFDASHNNIRGSLPVALSRLNRLSSLSLSSNHFTSRIPDEYAKKVAADGSTA  239

Query  471   n------LEYNYLEGTLPSEFMTG-GEKARASLDHNCL-NCPDHLPWCLGGQRPASQCR  319
                    L+ NYL+G +PS F+        AS  +NCL  CP  L +C G QRP S+CR
Sbjct  240   LPLARLFLDGNYLQGEVPSLFLKPLPNLISASFTYNCLKKCPASLSFCSGSQRPDSECR  298



>ref|XP_011090416.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Sesamum indicum]
Length=423

 Score =   137 bits (344),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 127/399 (32%), Positives = 197/399 (49%), Gaps = 29/399 (7%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDN  1282
             ++ T   DVQVL+  K +I P++V P+S + SW+ +LDPC+   T     G+ C     N
Sbjct  27    DSATHWQDVQVLKQLKSTITPSTVPPSSCIDSWDFNLDPCDHLFTDKFTCGLRCDV-VLN  85

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
             SS R++ + L+  G  G L+     L  L  L+ + N F G IP+S   L ++ RL LS 
Sbjct  86    SSSRVTELTLDPAGYSGSLSAVSWTLPYLQNLDFSNNNFSGSIPESFSLLTRLQRLGLSR  145

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N  + G       L  LE + + +N LSG+IP +   L+ L RL++  N+++G  P+LS 
Sbjct  146   NSLTLG------SLAGLEEMYLDNNMLSGAIPLSFNGLKNLKRLEIQGNKISGAFPELSQ  199

Query  921   LWQLNTLALSSNQFFAGLPPF--PVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             L  LN L  S N     LPP   P  +   +  + +      +++ L  +  LDLS N  
Sbjct  200   LGSLNFLDASDNAISGELPPGLPPSLIELAMRSNQIEGNIPGSVANLVSMQVLDLSHNNL  259

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SG +   + T P L ++ +S N F  ++V  +S   S+L  +D  +N ++G LP  +   
Sbjct  260   SGSVPAGLFTHPSLEQLTLSYNQFGSVQVPGNSGWTSQLISVDLSNNEIRGFLPGFMGLM  319

Query  567   LNLKTVNLGHNRFFGKIPKEY-----------GsrlrslwrnlnLEYNYLEGTLPSEFM-  424
               L  ++L +N+F G IP +Y           G    + +  L L  NYL G +P  F+ 
Sbjct  320   PRLSALSLENNKFSGMIPTQYVLKVLSPGTGTGEGGLAQFERLLLGGNYLLGPVPGAFLD  379

Query  423   --TGGEKARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
                G    R  L  NCL  CP  L +C GG Q+   +C+
Sbjct  380   LKAGSVTVR--LGDNCLYRCPVTLFFCEGGVQKSLMECK  416



>dbj|BAK03644.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=445

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 172/386 (45%), Gaps = 23/386 (6%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             T   D   L S K ++D  ++   S L+SW+   DPC A      G+ C TP ++S  R+
Sbjct  50    TFPGDTAALASLKSAVDAATIPSYSCLASWDFARDPCTA---FTCGVHCYTPPNSSHQRV  106

Query  1266  SVIDLEGDGLEGFL-TPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             + + L+  G  G L  P   +L  L TL+L  N+F G +P  +     +  L+LS N FS
Sbjct  107   AGVSLDPAGYSGTLPAPVFASLPFLDTLSLRGNRFHGSLPAGVALPPSLRILVLSGNAFS  166

Query  1089  GGLPRYM-RRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
             G +P  +      L  +D+S N  +G IP  I +L  LTR++L +N LTG +P +  +  
Sbjct  167   GDIPASLFTPASSLHELDLSRNAFTGGIPPQIASLGALTRMELQHNRLTGSLPLMGKMRS  226

Query  912   LNTLALSSNQFFAGL-------PPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDN  754
             L    +S N+    L       PP  V                +A   L  +  LDL++N
Sbjct  227   LVHFDVSDNKLSGPLLDAPGRLPPT-VVSVVARDNRLSGPFQAAAFHALPEMQVLDLTNN  285

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
               +G +       P L ++ + +N    +E        S+L  +D   N + G LP  + 
Sbjct  286   AVTGAVPGAAFEHPALGQLRLGSNQLGTVEEASDGGASSQLLEVDLSGNRITGRLPRCLA  345

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslw--------rnlnLEYNYLEGTLPSEFMTG  418
                 L+TV L  NRF G +PK+Y  R  +            L L+ NYL G LP E    
Sbjct  346   AIPRLRTVGLDRNRFDGGVPKQYAVRAAAGEVVDGKAPFAKLMLQGNYLCGALPRELRQM  405

Query  417   GE-KARASLDHNC-LNCPDHLPWCLG  346
              E  A  SL  NC L CP    +C G
Sbjct  406   KEGGAMVSLADNCLLKCPHKFFFCQG  431



>ref|XP_003536896.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
Length=401

 Score =   133 bits (334),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 122/400 (31%), Positives = 190/400 (48%), Gaps = 40/400 (10%)
 Frame = -3

Query  1464  CFLNAKTL--ESDVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLGILCMT  1294
             CFL  + +   +D   L++ + +++    +P S F S+W+   DPC     +F G+ C  
Sbjct  19    CFLQVQAILDPADFLALQNIRKALED---MPGSDFFSTWDFTADPC-----NFAGVYC--  68

Query  1293  PSDNSSGRISVIDLEGD------GLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINL  1132
                  S +I  ++L GD      GL G L P +G L+ L    +   +  GP+P+++ +L
Sbjct  69    ----DSDKIIALNL-GDPRAGSPGLTGRLDPAVGKLSALAEFTVVPGRIYGPLPETLSDL  123

Query  1131  RKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNE  952
             + +  L ++ NF SG +P  +  LR L  ID+S+N+LSG IP T+  L ELT L L +N 
Sbjct  124   KNLRFLGVNRNFISGQIPTKLGDLRNLRTIDLSYNQLSGRIPPTVGTLPELTNLILCHNR  183

Query  951   LTGKIPDLSGLWQLNTLALSSNQFFAGLPPF---PVrlrtlllghnlltgHISAISRLRY  781
             L+G +P       L  L L  N     LPP    P      L  + L       ++RL  
Sbjct  184   LSGSVPRFES-HTLTRLDLKHNGLSGSLPPDCLPPSLQYLSLSWNQLTGPMDRHLARLDQ  242

Query  780   LTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLL  601
             L  LDLS N+F+GPI  RI + P L  + +  N F+ +        +  +  +D   N L
Sbjct  243   LNYLDLSLNQFTGPIPGRIFSFP-LTNLQLERNQFSGM---VQPVDQVSIPTVDLSYNRL  298

Query  600   QGHLPLNIITYLNLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFM  424
              G +   + T  NL    L +NRF G++P  +    L +  + L L++NYL G   S   
Sbjct  299   YGQISPMLATVQNLY---LNNNRFTGRVPASFVERLLDASIQILYLQHNYLTGIEISPTA  355

Query  423   TGGEKARASLDHNCLNCPDHLPWCLGG----QRPASQCRR  316
                E++   L +NC+  P   P  L       RP +QC +
Sbjct  356   VIPERSSLCLQYNCMVPPVETPCPLRAGKEKTRPTAQCNQ  395



>ref|XP_002309797.2| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90247.2| leucine-rich repeat family protein [Populus trichocarpa]
Length=259

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 126/205 (61%), Gaps = 1/205 (0%)
 Frame = -3

Query  936  PDLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
            P  + L  LNTL LSSN     +P  P+ LR L + HN+L+GHIS  S   +LT LDLS+
Sbjct  48   PFFAKLPLLNTLDLSSNNLQGIVPNLPINLRRLSMSHNVLSGHISPASVFEHLTVLDLSN  107

Query  756  NRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
            NR S PI   ++TLP ++R+N+  N FT +EV    + + + +VLDAH+N L GH P+++
Sbjct  108  NRLSSPIPQEVLTLPMVVRLNIPTNKFTEMEVIPYPSADLQHRVLDAHANRLHGHPPISL  167

Query  576  ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARAS  397
            +    L +++L HN+F G+IP EYG +  S W++L LE N+L G  P +F+     A  S
Sbjct  168  VNVARLSSIDLSHNQFSGRIPVEYGPKPGSSWKSLFLEDNFLTGNPPPQFIDRTVAACNS  227

Query  396  LDHNCLNCPDHLPWCLGGQRPASQC  322
            L  NCL CP ++ +C   Q P  +C
Sbjct  228  LARNCLRCPLNIRFC-REQWPGLEC  251



>gb|KCW60493.1| hypothetical protein EUGRSUZ_H03228 [Eucalyptus grandis]
Length=336

 Score =   130 bits (326),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 114/384 (30%), Positives = 174/384 (45%), Gaps = 86/384 (22%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             T  SDV  L++FK ++DP+S+              PC       L +L +T  DNS    
Sbjct  32    TSPSDVAALKAFKAAVDPSSI-------------PPC-------LAVLDLT--DNS----  65

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
                                              FRGPIP S+ +L  +T L L  N FSG
Sbjct  66    ---------------------------------FRGPIPTSLSSLAALTTLSLRANAFSG  92

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLN  907
              +P +   L+ L+ +D+S+N LSG +P+++ +L  LTRLD+S N L G IP L     L 
Sbjct  93    SVPAFTG-LKALQSLDLSYNSLSGPLPSSLGSLPSLTRLDISFNRLIGSIPKLPP--NLL  149

Query  906   TLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHR  727
              LAL  N     L                      + +    L  ++L+ N  +G +   
Sbjct  150   ELALRGNSLSGPL-------------------SKDSFAGSAQLEVVELAHNSLAGALEPW  190

Query  726   IVTLPELMRINVSANHFTRIEV-TKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTV  550
             +  LP + +I+++ N  TR++V    +     L  +D   N ++G +P N  +Y  L ++
Sbjct  191   LFLLPSVQQIDLANNSLTRVDVAAPPAGGGGGLVAVDLGFNRIEGSVPGNFASYPQLSSL  250

Query  549   NLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSE-FMTGGEKARASLDHNCL-N  376
              L +NR  G IP E+G   ++  R L L+ NYL+G  P+E F +G   A  SL  NCL  
Sbjct  251   TLRYNRLRGDIPAEFG--RKATLRRLFLDGNYLKGKPPAELFSSGAAVAFGSLGDNCLRE  308

Query  375   CPDHLPWCLGGQRPASQCRRSAGG  304
             CP     C   Q+P + C+++ GG
Sbjct  309   CPATSQLCAPSQKPDAVCKQAYGG  332



>emb|CDY06571.1| BnaC02g12950D [Brassica napus]
Length=413

 Score =   130 bits (328),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 132/390 (34%), Positives = 201/390 (52%), Gaps = 12/390 (3%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCE-ATGTHF-LGILCMTPSDNS  1279
             +KT   DV  L+ FK+S+D  S+ P S LSSW+  +DPC+  +G  F  G  C T   + 
Sbjct  19    SKTYWGDVAALKEFKNSVDAKSMTPGSCLSSWDFSVDPCDNLSGEKFTCGFRCDTIV-SG  77

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             SGR++ + L+  G  G L+    N   L TL L+ N F GP+P+S+ NL ++T L LS N
Sbjct  78    SGRVTELILDQAGYSGSLSSLSFNFPYLHTLKLSNNYFSGPLPNSLSNLTRLTSLFLSGN  137

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +   +  +  LE + + +N L+GS+P +   L  L RL+L  N ++G++PDL+ L
Sbjct  138   SFSGSIRGSLGSMPLLEELLLDNNNLNGSVPTSFNRLSRLKRLELQQNNISGELPDLTSL  197

Query  918   WQLNTLALSSNQFFAGL-PPFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFS  745
               LN L +S N+    +    P  L  + + +NL  G I  +   L  L  +DLS N   
Sbjct  198   KNLNYLDVSDNRISGPVTSSLPGSLVQISMRNNLFQGTIPESFRNLTSLEVIDLSHNELG  257

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTK--ESRLQVLDAHSNLLQGHLPLNIIT  571
             G I   I     L ++ +S N FT I+  + S     S L  +D  +N ++G LPL +  
Sbjct  258   GSIPSFIFAHQTLQQLTLSFNGFTSIDSPRYSPSGLPSELISVDLSNNKIRGPLPLFMGL  317

Query  570   YLNLKTVNLGHNRFFGKIPKEY--GsrlrslwrnlnLEYNYLEGTLPSEFMT-GGEKARA  400
                L  ++L +N FFG +P +Y   +   + ++ L L  N+L G +P   M         
Sbjct  318   LPKLSALSLENNSFFGMVPTQYVWKTVSPAGFQRLLLGGNFLFGVVPGPLMALKPGSVNV  377

Query  399   SLDHNC-LNCPDHLPWCLGG-QRPASQCRR  316
              L  NC L CP    +C G  QR  ++CR+
Sbjct  378   QLAGNCFLWCPATFFFCRGQEQRSVTECRK  407



>gb|EPS66742.1| hypothetical protein M569_08034, partial [Genlisea aurea]
Length=420

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 129/395 (33%), Positives = 185/395 (47%), Gaps = 26/395 (7%)
 Frame = -3

Query  1434  DVQVLRSFKDSIDPNSVL--PASFLSSWNLDLDPCEA--TGTHFLGILCMTPSDNSSGRI  1267
             DV+VL+  K +I        PAS ++SW+  +DPC+A  +     GI C   + N S R+
Sbjct  30    DVRVLKLLKGTIVSGGAALPPASCIASWDFAVDPCDAVFSDKFTCGIRCDAYAGNFS-RV  88

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             + + L+     G ++    NL  L  L+++ N F G +P S   L ++ RL LS N  SG
Sbjct  89    TEVALDSAAYSGDISAVDWNLPFLQNLDVSTNAFYGRMPASFSALIQLRRLSLSHNSLSG  148

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLN  907
             GL   +  L  LE + + +N  +G IP     LR L RL+L  N LTG   DL  L  LN
Sbjct  149   GLSDSVASLANLEELYLDNNFFTGGIPPNFGNLRTLKRLELQGNRLTGAFTDLGRLTGLN  208

Query  906   TLALSSNQFFAGLPP-FPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILH  730
              L  S N    GLP   P  L  L+  +N + G I A      L  LDLS N+ SG +  
Sbjct  209   FLDASDNWLSGGLPASLPPSLVELVARNNGIEGEIGANLMPPSLQVLDLSHNKLSGSVPS  268

Query  729   RIVTLPELMRINVSANHFTRIEVTKSSTK---ESRLQVLDAHSNLLQGHLPLNIITYLNL  559
              + T P L ++ +S N    +++           RL   D  +N ++G LP  +     L
Sbjct  269   DLFTHPGLEQLTLSFNELESVQIPDDYYMGLLSDRLVSADLSNNRIEGLLPGFMGLMPRL  328

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY--------NYLEGTLPSEFMTGGEKAR  403
               ++L  NRF+G IP EY  ++                   NYL G +P  F+   E   
Sbjct  329   AALSLEENRFWGFIPPEYVMKIVINGPISGRTQFVRLLLGGNYLFGPIPGGFL---ELKP  385

Query  402   ASLD----HNCL-NCPDHLPWCLGG-QRPASQCRR  316
              S+D     NCL  CP    +C GG Q+P+ QCR+
Sbjct  386   GSVDIRLGDNCLFRCPVRFFFCGGGPQKPSFQCRK  420



>ref|XP_009800454.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana sylvestris]
Length=420

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 132/399 (33%), Positives = 204/399 (51%), Gaps = 28/399 (7%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSD---N  1282
              KT  +D+Q L+  K+ I+PNS+   S LSSW+  +DPC+   +      C    D   +
Sbjct  24    CKTHPTDIQGLQHLKNGINPNSISSGSCLSSWSFSIDPCDNIFSD--RFTCGFRCDLIVS  81

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
                R++ I L+  G  G L   + NL  L  L+++ N   G IP S+ NL ++ RL LS+
Sbjct  82    GFYRVTEISLDQAGYSGSLY--MTNLPHLEVLDMSYNSLSGLIPHSLSNLTRLRRLSLSK  139

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N F+G +P  +  L +L+ + + +N L+GSIP +   L  L RL+L +N +TG +P L  
Sbjct  140   NSFTGKIPSSIGSLLRLQELFLDNNNLTGSIPRSFNGLVNLNRLELQHNNITGDLPVLYQ  199

Query  921   LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISA-----ISRLRYLTALDLSD  757
             L  L  L LS N+       FP R    ++  +L   ++       +  L++L  LDLS 
Sbjct  200   LRNLFFLDLSDNRITGNF--FPSRFSKSIIELSLRNNYLRGEFPLNVGELKFLQVLDLSH  257

Query  756   NRFSGPILHRIVTLPELMRINVSANHFTRIEVTKS-STKESRLQVLDAHSNLLQGHLPLN  580
             N  SG IL  + +   L ++ +S N+FT +++ K  S + ++L  +D   N L G LP  
Sbjct  258   NLLSGIILSVLFSHSSLQQLTLSYNNFTLLQMPKDLSYRNNKLIAIDLSYNNLHGFLPAF  317

Query  579   IITYLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPSEFMTG  418
             + +  NL  +NL HN+F G IP +Y  ++       S +  L L  NYL G +P   +  
Sbjct  318   MASMPNLSALNLEHNKFSGMIPTQYAVKVVVPRNNTSSFERLLLGGNYLFGPIPGPLL--  375

Query  417   GEK---ARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
             G K      SL  NCL  CP+ L  C GG Q+    C++
Sbjct  376   GLKPGSVNVSLVDNCLYICPNTLYICHGGNQKSFLDCKK  414



>ref|XP_010927511.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Elaeis guineensis]
Length=396

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 124/393 (32%), Positives = 183/393 (47%), Gaps = 39/393 (10%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSS  1276
              A T  SDV  L +FK +I P S+ P S L+SWN   DPC    +HFL  L  T +   +
Sbjct  19    GAVTAPSDVAALAAFKAAISPASITPFSCLASWNFSSDPCRPGPSHFLCGLTCTTTGGGA  78

Query  1275  G----RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
                  R++ I L+  G  G LTP +  L+ L  L L  N F GPIP S            
Sbjct  79    ATATDRVTAIALDPAGYSGTLTPLLSQLSLLAHLELPNNAFHGPIPTS------------  126

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL  928
                            L  L+ + +S N  SG IP++++ L  L  LDLS N L G IP  
Sbjct  127   ---------------LPSLQTLILSSNSFSGPIPSSVSKLTSLQILDLSRNPLAGPIPQF  171

Query  927   SG-LWQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLS  760
              G +  L  L LS  + +  LP   P  +    L       T   +  + LR L  ++L+
Sbjct  172   WGSMSGLRRLDLSFTRLYGNLPRALPPNLVNLALRGNSLSGTIKRATFAPLRALEVVELA  231

Query  759   DNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLN  580
              NR  G +      LP L +++++ N  + +EV   S  + +L  +D   N ++G LP  
Sbjct  232   ANRLEGKVEGWFFLLPSLQQVDLANNSLSGVEVGPPSEGQ-QLVAVDLGFNRIEGQLPAA  290

Query  579   IITYLNLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKAR  403
             +  + +L  + L +NR  G IP EY G++    +R L L+ N+L GT+P+  ++ GE   
Sbjct  291   LAGFPSLVALTLRYNRLRGTIPSEYAGAKKGVPFRRLFLDGNFLTGTVPAGLLSSGELV-  349

Query  402   ASLDHNCL-NCPDHLPWCLGGQRPASQCRRSAG  307
              SL  NCL  CP     C   Q+  + C++  G
Sbjct  350   GSLGDNCLEGCPSAAALCSPPQKTEAVCKQGYG  382



>ref|XP_010235773.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Brachypodium distachyon]
Length=433

 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 121/396 (31%), Positives = 172/396 (43%), Gaps = 24/396 (6%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILC-MTPSDNSSGR  1270
             T   D   L S   ++D  ++   S L+SW+   DPC    T   G+ C   P+D+S  R
Sbjct  36    TFPGDKAALASLMSAVDAATIPSYSCLASWDFARDPCA---TFPCGLRCYAAPNDSSYLR  92

Query  1269  ISVIDLEGDGLEGFL-TPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             ++ I L+  G  G L  P + +L  L  L+L  N+F G +P        +  L LS N F
Sbjct  93    VAGISLDPAGYSGTLPAPVLASLPFLAFLSLTGNRFHGALPAGSPLPPSLRVLDLSANAF  152

Query  1092  SGGLPRYM-RRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW  916
             SG +P  +      L+ +D+S N  +G IP+ I +L  LTR+DL +N LTG +P +  + 
Sbjct  153   SGAIPASLFTAPSALQELDLSRNAFTGRIPSQIASLGALTRIDLQHNGLTGSLPWMGDMR  212

Query  915   QLNTLALSSNQFFAGL---PPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
              L  L +S N     L    P  V                +A   L  +  LDL+ N   
Sbjct  213   SLARLDVSGNTLSGSLLDALPRQVVSVVARNSGISGPLKAAAFDALPAMQVLDLTGNAVP  272

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKS--STKESRLQVLDAHSNLLQGHLPLNIIT  571
             G +   +   P L ++ + +N    +E   S      SRL  LD   N + G LP  +  
Sbjct  273   GAVPGAVFRHPALQQLRLGSNQLGSVEEPASGVGASSSRLVELDLSGNRIAGRLPRCLAA  332

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEY----------NYLEGTLPSEFMT  421
                L  V L  NRF G IP EY  R+       + +           NYL G LPS+  T
Sbjct  333   MPRLAVVGLDRNRFTGGIPNEYVVRVADEAAADDGQRAPFARLMLQGNYLCGALPSQMRT  392

Query  420   GGE-KARASLDHNC-LNCPDHLPWCLGG-QRPASQC  322
               E  A  SL  NC L CP    +C G  Q+  + C
Sbjct  393   LKEGGAVVSLADNCLLRCPHKFFFCKGAPQKDHAAC  428



>ref|XP_010026278.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Eucalyptus grandis]
 gb|KCW58985.1| hypothetical protein EUGRSUZ_H01609 [Eucalyptus grandis]
Length=407

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 123/370 (33%), Positives = 184/370 (50%), Gaps = 26/370 (7%)
 Frame = -3

Query  1377  ASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVID--LEGDGLEGFLTPEIGnl  1204
             ++F +SW+   DPC      F G+LC + S N    +S+ D      GL G L P +GNL
Sbjct  51    SNFFASWDFTADPC-----GFPGVLCDSSSPNRVVSLSLGDPRASAPGLTGRLHPALGNL  105

Query  1203  telttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNR  1024
             + LT L L   +  G IP S+  LRK+  L L  NF SGG+P  +  LR L+ +D+S+NR
Sbjct  106   SSLTELTLVPGRVFGRIPQSLYGLRKLRFLGLGRNFLSGGIPPDLGLLRNLQTLDLSYNR  165

Query  1023  LSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPPF---PV  853
             L+GS+P  + +L  L+ L L +N+L+G +P     W L  + L  NQ    +PP    P 
Sbjct  166   LTGSVPRAVGSLPSLSNLVLCHNQLSGLVPPFLS-WTLTRIDLKHNQLSGPIPPTYLPPS  224

Query  852   rlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFT  673
                  L  + L       ++RL  L  LDLS NRF+GPI  R+ + P +  + +  N F 
Sbjct  225   LQYLSLSWNRLSGPVDRLLNRLGRLNYLDLSMNRFTGPIPGRVFSYP-ITSLQLQRNAF-  282

Query  672   RIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEY-Gsr  496
              + + + + + + +  +D   N L G +P    T   ++++ L  NRF G++P  +    
Sbjct  283   -LGLLRPAGRVA-IPTVDLSYNRLSGEIPPEFAT---VQSLYLNSNRFTGQVPGNFVDRL  337

Query  495   lrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCPDHLPWCL--GGQ--RPAS  328
             L S  R L L++N+L G   +        A   L +NC+  P   P  L  G Q  RP  
Sbjct  338   LGSSIRVLYLQHNFLTGIEINPAEEIPVTASLCLQYNCMVPPVQSPCPLKAGTQKARPTW  397

Query  327   QC---RRSAG  307
             QC   RR  G
Sbjct  398   QCHEWRRRKG  407



>ref|XP_003520222.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Glycine max]
Length=403

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 114/371 (31%), Positives = 175/371 (47%), Gaps = 35/371 (9%)
 Frame = -3

Query  1383  LPAS-FLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGD------GLEGFL  1225
             +PAS F SSW+   DPC     +F G+ C       S ++  ++L GD      GL G L
Sbjct  47    MPASDFFSSWDFTADPC-----NFAGVYC------DSDKVIALNL-GDPRAGSPGLTGRL  94

Query  1224  TPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEV  1045
              P +G L+ L    +   +  GP+P+++ +L+ +  L ++ NF SG +P  +  LR L  
Sbjct  95    HPSVGKLSALAEFTVVPGRIYGPLPETLSDLKNLRFLGVNRNFISGEIPTKLGELRNLRT  154

Query  1044  IDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLP  865
             +D+S+N+L+G IP T+  L ELT L L +N L+G +P       L  L L  N     LP
Sbjct  155   VDLSYNQLTGRIPPTVGTLPELTNLILCHNRLSGSVPRFES-HTLTRLDLKHNSLSGSLP  213

Query  864   PF---PVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRIN  694
             P    P      L  + L       ++RL  +  LDLS N+F+GPI   I + P L  + 
Sbjct  214   PNSLPPSLQYLSLSWNQLTGPMDRLLARLDQVKYLDLSLNKFTGPIPGHIFSFP-LTNLQ  272

Query  693   VSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIP  514
             +  N F+          +  +  +D   N L G +   + T  NL    L +NRF G++P
Sbjct  273   LERNQFSG---PVQPVDQVSIPTVDLSYNRLYGQISPMLATVQNLY---LNNNRFTGRVP  326

Query  513   KEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCPDHLPWCLGG--  343
               +    L +  + L L++NYL G   S      E++   L +NC+  P   P  L    
Sbjct  327   ASFVERLLDASIQILYLQHNYLTGIEISPTAVIPERSSLCLQYNCMVPPVETPCPLRAGK  386

Query  342   --QRPASQCRR  316
                RP +QC +
Sbjct  387   EKTRPTTQCNQ  397



>ref|XP_003591587.1| Receptor-like protein kinase [Medicago truncatula]
 ref|XP_003591591.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES61838.1| Serine/Threonine kinase, plant-type protein [Medicago truncatula]
Length=399

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 124/404 (31%), Positives = 198/404 (49%), Gaps = 40/404 (10%)
 Frame = -3

Query  1470  NPCFLNAKTLESDVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLGILCMT  1294
             N   +NA    +D   L+S + +++    +P S F SSW+   DPC     +F G+ C  
Sbjct  20    NQLIVNAILDPADFLALQSIRKALED---MPGSDFFSSWDFTADPC-----NFSGVFC--  69

Query  1293  PSDNSSGRISVIDLEGD------GLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINL  1132
                  S ++  ++L GD      GL G L P IG L+ L    +   +  GP+P +I +L
Sbjct  70    ----DSDKVISLNL-GDPRAGSAGLTGRLDPAIGKLSSLAEFTVVPGRIYGPLPQTISSL  124

Query  1131  RKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNE  952
             + +  L ++ NF SG +P  +  LR L  ID+S+N+L+G IP T+ +L  LT L L +N 
Sbjct  125   KNLRFLGVNRNFISGEIPAELGELRSLRTIDLSYNQLTGKIPPTVGSLPGLTNLILCHNR  184

Query  951   LTGKIPDLSGLWQLNTLALSSNQFFAGLPP--FPVrlrtlllghnlltgHIS-AISRLRY  781
             LTG +P       L+ L L  N     + P   P  L+ L L  N  TG +   ++RL  
Sbjct  185   LTGSLPRFDS-QSLSRLDLKHNSLTGSIGPNFLPASLQYLSLSWNQFTGSMDRVLTRLNQ  243

Query  780   LTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLL  601
             L  LDLS N+F+GP+  ++ + P L  + +  N FT    +     +  +  +D   N L
Sbjct  244   LNYLDLSLNQFTGPLPGKVFSFP-LTNLQLERNQFTG---SVEPVDQVAIPTVDLSFNRL  299

Query  600   QGHL-PLNIITYLNLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEF  427
              G + P+      N++ + L +NRF G++P  +    L +  + L L++NYL G   S  
Sbjct  300   SGQISPM----LANVQNLYLNNNRFTGRVPASFVERLLDASIQILYLQHNYLTGIEISPT  355

Query  426   MTGGEKARASLDHNCLNCPDH--LPWCLGGQ--RPASQCRRSAG  307
                 E++   + +NC+  P     P+  G Q  RP +QC +  G
Sbjct  356   AVIPERSSLCMQYNCMVPPVETPCPFRAGKQKTRPTTQCNQYKG  399



>ref|XP_003553442.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase IMK2-like [Glycine max]
 gb|KHN45393.1| DNA-damage-repair/toleration protein DRT100 [Glycine soja]
Length=391

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 119/386 (31%), Positives = 185/386 (48%), Gaps = 31/386 (8%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVI  1258
             +D   L+S + S+  + V  ++F SSW+   DPC     +F G+ C   +D+    +++ 
Sbjct  25    NDFLALQSIRKSL--HDVPGSNFFSSWDFTADPC-----NFAGVFC---ADDKVIALNLG  74

Query  1257  DLEGD--GLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
             D      GL G L P I  L+ L    +   +  GP+P S+  L+ +  L LS NF SG 
Sbjct  75    DPRAGSPGLTGKLDPSISKLSALADFTVVPGRIYGPLPQSLSQLKNLRFLGLSRNFISGQ  134

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNT  904
             +P  + +LR L  ID+S+N+L+G+IP +I A+ ELT L L +N L+G +P  +  + L  
Sbjct  135   IPSGLGQLRNLRTIDLSYNQLTGTIPPSIGAMPELTNLFLCHNRLSGSVPSFASSYSLTR  194

Query  903   LALSSNQF---FA--GLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
             L L  N     FA   LP  P      L  +         ++RL  L  LDLS N+F+GP
Sbjct  195   LELKHNTLSGSFAEDSLP--PSLQYLSLSWNRFTGPVDRLLTRLNRLNFLDLSLNQFTGP  252

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
             I  ++ T P L  + +  N F+          E  +Q +D   N L G +   + +  NL
Sbjct  253   IPAQLFTFP-LTNLQLERNQFSG---PIQPVNEVTIQTVDLSYNRLSGEVSPMLASVQNL  308

Query  558   KTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
                 L +N F G++P  +    L +  + L L++N+L G   S        +   L +NC
Sbjct  309   Y---LNNNGFTGQVPGSFVERLLAAGIQILYLQHNFLTGIAISPTAEIPVSSTLCLQYNC  365

Query  381   LNCPDH--LPWCLGGQ--RPASQCRR  316
             +  P     P+  G +  RPA QC R
Sbjct  366   MVPPVQTACPFNAGKRKIRPAQQCNR  391



>ref|XP_008796766.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Phoenix dactylifera]
Length=409

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 115/359 (32%), Positives = 174/359 (48%), Gaps = 27/359 (8%)
 Frame = -3

Query  1368  LSSWNLDLDPCEATGTHFLGILCMTPSDNSSG---RISVIDLEGDGLEGFLTPEIGnlte  1198
             L SWN   DPC    +HFL  L  T +   +    R+  I L+  G  G LTP + NL+ 
Sbjct  59    LDSWNFSSDPCRPGPSHFLCGLTCTTTGGGATATYRVFSITLDPAGYSGALTPLLSNLSL  118

Query  1197  lttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLS  1018
             L  L L  N F GPIP S+ +L  +  L+LS N FSG +P  + +L  L+++D+S N L+
Sbjct  119   LAHLELADNAFHGPIPASLSSLSSLQTLILSSNSFSGTIPSSISKLSSLQILDLSRNSLA  178

Query  1017  GSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPPFPVrlrtl  838
             G IP    ++  L  LDLS N L G +P  +    L  LAL  N     +          
Sbjct  179   GLIPQFWGSMSGLRTLDLSFNRLYGNLPQ-TMPPNLVDLALRGNSLSGTI----------  227

Query  837   llghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVT  658
                        +  + LR L  ++L+ NR  G +      LP L +++++ N  + +EV 
Sbjct  228   ---------KRATFAPLRALEVVELAANRLEGKLEGWFFLLPSLQQVDLANNSLSGVEVG  278

Query  657   KSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEY-Gsrlrslw  481
                  + RL  +D   N ++G LP  +  +  L  +++ HN+  G IP EY G++    +
Sbjct  279   PPPPGQ-RLVAVDLGINRIEGQLPAALAGFPALAALSVRHNKLRGAIPSEYAGAKKGVPF  337

Query  480   rnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL-NCPDHLPWCLGGQRPASQCRRSAG  307
               L L+ N+L GT+P+  +  GE    SL  NCL  CP   P C   Q+P + C++  G
Sbjct  338   GRLFLDGNFLTGTVPAGLLRSGELV-GSLGDNCLRGCPPAAPLCSPPQKPKAACKQVYG  395



>gb|KHN36060.1| Receptor-like protein 12 [Glycine soja]
Length=410

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 132/394 (34%), Positives = 197/394 (50%), Gaps = 17/394 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT-GTHF-LGILCMTPSDNS  1279
             +KT   D +VL+  K  ++P SV P S +SSW+  LDPC+   G  F  G  C       
Sbjct  12    SKTHVGDAEVLKELKQGLEPGSVKPGSCVSSWDFTLDPCDNLFGDKFTCGFRCDVVVSGL  71

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G L+    NL  L TL+L+ N F G IP S  NL +++RL LS N
Sbjct  72    S-RVTELALDQAGYSGSLS-FTWNLPYLQTLDLSNNYFSGQIPYSFSNLTRLSRLSLSSN  129

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L  L+ + + +N L G+IP +   L  L RL+L +N+L  ++P+L  L
Sbjct  130   SFSGEIPSSLGTLSNLQELYLDNNNLRGTIPQSFDNLANLKRLELQSNKLNTRLPNLGSL  189

Query  918   WQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
               L  L LS N     LP   P  +   +L   +        +   L  L  +D S N+ 
Sbjct  190   RNLKFLYLSDNSVTGTLPASLPVSLVQISLRNNNLSGVLVGESFKSLTRLQVVDFSSNQL  249

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEV-TKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             SG +      LP L ++ +S N FT +E   K +  +S L  +D  +N L+G LP  +  
Sbjct  250   SGAVPSVFFQLPSLQQLTLSFNEFTNLEAPYKGTESQSGLVAVDLSNNRLKGFLPSFMAV  309

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPSEFMT-GGE  412
                L +++L +N F G+IP ++G +        S +  L L  NYL G +P   +    +
Sbjct  310   MPKLSSLSLENNEFTGRIPTQFGVKTVFPEKGVSSFGRLLLGGNYLLGGIPRPLLALKRD  369

Query  411   KARASLDHNCL-NCPDHLPWCLGGQRPA-SQCRR  316
              A  SL  NCL  CP    +C GGQ+ + +QC R
Sbjct  370   SANVSLVDNCLYRCPHSFFFCQGGQQKSLAQCNR  403



>ref|XP_010933760.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Elaeis guineensis]
Length=430

 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 128/400 (32%), Positives = 179/400 (45%), Gaps = 20/400 (5%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEAT-GTHF-LGILCMTPS  1288
             + +KT   D + L + K  +DP S+LP S LS+W+    DPC+A  G  F  G+ C    
Sbjct  24    VTSKTFPGDTEALNAVKQGVDPASILPGSCLSTWDFAAADPCDAAYGPRFTCGLRCDARD  83

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKIT--RL  1114
                  R++ +  +  G  G L+P + +L  L +L+L  N+    +P            R+
Sbjct  84    AAGFLRVTELAFDPAGYSGSLSPSVWSLPFLESLDLADNRLASAVPPPPPAGLPPRLRRV  143

Query  1113  LLSENFFSGGLPRYMRR---LRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTG  943
              LS N FSG +P +         LE + +  N LSG IP  +  L  L RL+L  N LTG
Sbjct  144   SLSRNAFSGEIPGFSDAPAPAPALEELYLDSNLLSGPIPPGLATLPALRRLELQMNNLTG  203

Query  942   KIPDLSGLWQLNTLALSSN----QFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLT  775
              IPDL  L  L  L  S N    +F +G  P  V   +L           +A++ L  L 
Sbjct  204   GIPDLGPLQNLAFLDASDNALSGEFPSGKLPASVVQISLRNNRLEGEIPGAAVAALPALQ  263

Query  774   ALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQG  595
              +DLS N   G +       P L ++ +S N    I         SRL  LD   N L G
Sbjct  264   VMDLSHNGLWGAVPGAAFEHPSLEQLTLSYNQLESITRPGDGGLWSRLIALDLGHNRLGG  323

Query  594   HLPLNIITYLNLKTVNLGHNRFFGKIPKEY-----GsrlrslwrnlnLEYNYLEGTLPSE  430
              LP  +     L  ++L  NRF G IP +Y     G+     +  L L  NYL G +PS 
Sbjct  324   FLPAFLGLMPRLSALSLEDNRFTGMIPAQYAVRVVGAGGAVPFARLILSGNYLFGPVPSP  383

Query  429   FMTGGE-KARASLDHNCL-NCPDHLPWCLGG-QRPASQCR  319
              +   E  A  SL  NCL  CP    +C GG Q+ ++ CR
Sbjct  384   MVGLKEGSAMVSLADNCLFRCPPEFFFCEGGRQKSSTTCR  423



>ref|XP_009619476.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana tomentosiformis]
Length=421

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 198/399 (50%), Gaps = 28/399 (7%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSD---N  1282
              KT  +D+Q L+  K+ I+PNS+   S LSSWN  +DPC+   +      C    D   +
Sbjct  25    CKTHPTDIQGLQHLKNGINPNSISSGSCLSSWNFTVDPCDNIFSD--RFTCGFRCDLIVS  82

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSE  1102
                R++ I L+  G  G L   I NL  L  L+++ N   G IP S+ NL ++ RL LS+
Sbjct  83    GFYRVTEISLDQAGYSGSLC--ITNLPHLEVLDMSYNLLSGLIPHSLSNLTRLRRLSLSK  140

Query  1101  NFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
             N F+G +P  +  L +L+ + + +N L+GSIP +      L RL+L +N +TG +P    
Sbjct  141   NSFTGKIPSSIGSLLRLQELFLDNNNLTGSIPRSFNGFVNLNRLELQHNNITGDLPIFYQ  200

Query  921   LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISA-----ISRLRYLTALDLSD  757
             L  L  L LS N+       F  R    ++  +L   +++      +  L++L  LDLS 
Sbjct  201   LRNLFFLDLSDNRITGNF--FTTRFSKSIIELSLRNNYLNGEFPLNVGELKFLQVLDLSH  258

Query  756   NRFSGPILHRIVTLPELMRINVSANHFTRIEVTKS-STKESRLQVLDAHSNLLQGHLPLN  580
             N  SG I   +     L ++ +S N+FT ++V +    + ++L  +D   N L G LP  
Sbjct  259   NLLSGIIPSVLFYHSSLQQLTLSYNNFTLLQVPEDLRYRSNKLIAIDLSCNNLHGFLPAF  318

Query  579   IITYLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPSEFMTG  418
             + +   L  +NL HN+F G IP +Y  ++       S +  L L  NYL G +P   +  
Sbjct  319   MASMPKLSALNLEHNKFSGMIPTQYAVKVVVPRNNTSSFERLLLGGNYLFGPIPGPLL--  376

Query  417   GEK---ARASLDHNCLN-CPDHLPWCLGG-QRPASQCRR  316
             G K      SL  NCL  CP+ L  C GG Q+    C++
Sbjct  377   GLKPGSVNVSLVDNCLYMCPNTLYICHGGNQKSFLDCKK  415



>ref|XP_007144581.1| hypothetical protein PHAVU_007G167800g [Phaseolus vulgaris]
 gb|ESW16575.1| hypothetical protein PHAVU_007G167800g [Phaseolus vulgaris]
Length=396

 Score =   124 bits (312),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 118/389 (30%), Positives = 185/389 (48%), Gaps = 38/389 (10%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             +D   L+S + +++    +P S F SSW+   DPC     +F G+ C       S ++  
Sbjct  28    ADFLALQSIRKALED---MPGSHFFSSWDFTADPC-----NFAGVYC------DSDKVIA  73

Query  1260  IDLEGD------GLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             ++L GD      GL G L P +G L+ L    +   +  GP+P+S+  L+ +    ++ N
Sbjct  74    LNL-GDPRAGSPGLTGRLDPALGKLSALAEFTVVPGRIYGPLPESLSGLKNLRFFGVNRN  132

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
             F SG +   +  LR L  ID+S+N+L+G IP T+ +L ELT L L +N L+G +P     
Sbjct  133   FISGEISTKLGELRSLRTIDLSYNQLTGRIPPTVGSLPELTNLILCHNRLSGSLPRFES-  191

Query  918   WQLNTLALSSNQFFAGLPPF---PVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
               L  L L  N     LPP    P      L  + L       +SRL  L  LDLS N+F
Sbjct  192   HTLTRLDLKHNSLSGSLPPNSLPPSLQYLSLAWNKLTGPMDHLLSRLDQLNYLDLSLNQF  251

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             +GPI  RI + P L  + +  N F+          +  +  +D   N L G +   + + 
Sbjct  252   TGPIPDRIFSFP-LTNLQLERNQFSG---PVQPVDQVSIPTVDLSYNRLSGQISPMLAS-  306

Query  567   LNLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
               ++ + L +NRF G++P  +    L +  + L L++NYL G   S      E++   L 
Sbjct  307   --VQYLYLNNNRFTGRVPASFVERLLDASIQILYLQHNYLTGIEISPTAVIPERSSLCLQ  364

Query  390   HNCLNCPDHLPWCL--GGQ--RPASQCRR  316
             +NC+  P   P  L  G Q  RP +QC +
Sbjct  365   YNCMVPPVETPCPLRAGKQKTRPTTQCNQ  393



>ref|XP_007162374.1| hypothetical protein PHAVU_001G146600g [Phaseolus vulgaris]
 gb|ESW34368.1| hypothetical protein PHAVU_001G146600g [Phaseolus vulgaris]
Length=391

 Score =   124 bits (311),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 115/388 (30%), Positives = 188/388 (48%), Gaps = 35/388 (9%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVI  1258
             +D   L+S + S+  + V  ++F +SW+   DPC     +F G+ C      ++ ++  +
Sbjct  24    NDFLALQSIRKSL--HDVPGSNFFASWDFTADPC-----NFAGVYC------ANDKVVAL  70

Query  1257  DLEGD------GLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             +L GD      GL G L   I  L+ L  L +   +  GP+P+S+  L+ +  L +S NF
Sbjct  71    NL-GDPRAGSPGLTGKLDQSISKLSALADLTVVPGRIYGPLPNSLSQLKNLRFLGVSRNF  129

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW  916
              SG +P  + +LR ++ ID+S+N+L+G+IPA+I  L +LT L L +N L+G +P  +  +
Sbjct  130   ISGEIPAGLGQLRNIKTIDLSYNQLTGTIPASIGTLPQLTNLILCHNRLSGSVPSFASAY  189

Query  915   QLNTLALSSNQFFAGLPPF---PVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
              L  L L  N     L P+   P      L  + L       ++RL  L  LDLS N+F+
Sbjct  190   SLTRLELKHNTLSGSLAPYSLPPSLHHLSLSWNKLTGPMDRLLTRLNRLNYLDLSLNQFT  249

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             GPI  +I + P L  + +  N F+          E  +Q +D   N L G +   + +  
Sbjct  250   GPIPAQIFSFP-LTNLQLERNQFSG---PVHPVNEVTIQTVDLSYNRLSGEVSPMLASVQ  305

Query  564   NLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
             NL    L +N F G++P  +    L +  + L L++N+L G   S        +   L +
Sbjct  306   NLY---LNNNWFTGQVPGSFVERLLAAGIQILYLQHNFLTGIAISPTADIPVSSTLCLQY  362

Query  387   NCLNCPDH--LPWCLGGQ--RPASQCRR  316
             NC+  P     P+  G +  RP  QC R
Sbjct  363   NCMVPPVQTACPFNAGRRKIRPPQQCNR  390



>ref|XP_007226927.1| hypothetical protein PRUPE_ppa015866mg [Prunus persica]
 gb|EMJ28126.1| hypothetical protein PRUPE_ppa015866mg [Prunus persica]
Length=142

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = -3

Query  1314  LGILCMTPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIIN  1135
             LGILC  P DNSS RI  I+L+G G +G +T  IGNLTE+T +NLN+N FRGPIPDSI N
Sbjct  9     LGILCSFPLDNSSSRIIAIELDGGGYDGCITLSIGNLTEVTIINLNKNHFRGPIPDSIAN  68

Query  1134  LRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNN  955
             L+K+TR+ LS NF +  +PR ++ L++LE +++S N LS +IP+++  LR LT L  S+N
Sbjct  69    LKKLTRISLSNNFLTVNIPRRLKALKRLESLNISFNALSSTIPSSVGCLRSLTFLSTSSN  128

Query  954   ELTGKIPDLS  925
                G+IPD S
Sbjct  129   GFIGRIPDFS  138



>ref|XP_004496056.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cicer arietinum]
Length=392

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 185/389 (48%), Gaps = 38/389 (10%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             +D   L+S + S++    +P S F SSW+   DPC     +F G+ C       S ++  
Sbjct  24    TDFLALQSIRKSLED---MPGSDFFSSWDFTADPC-----NFSGVYC------DSDKVIA  69

Query  1260  IDLEGD------GLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             ++L GD      GL G L   IG L+ L    +   +  GP+P +I NL+ +  L ++ N
Sbjct  70    LNL-GDPRAGSAGLTGRLDTAIGKLSALAEFTVVPGRIYGPMPQTISNLKNLKFLGVNRN  128

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
             F SG +P  +  LR L  ID+S+N+L+G+IP T+ +L  LT L L +N L+G IP     
Sbjct  129   FISGDIPAGLGELRSLRTIDLSYNQLTGNIPPTVGSLPGLTNLILCHNRLSGSIPRFDS-  187

Query  918   WQLNTLALSSNQFFAGLPPF---PVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
               L+ L L  N     + P    P      L  + L       +SRL  L  LDLS N+F
Sbjct  188   QILSRLDLKHNSLTGSIAPNSLPPSLQYLSLSWNQLTGSMDRVLSRLEQLNYLDLSLNQF  247

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             +G +  RI + P L  + +  N F+    +     +  +  +D   N L G +   + + 
Sbjct  248   TGTLPGRIFSFP-LTNLQLERNQFSG---SVEPVDQVAIPTVDLSYNRLSGQISPMLASV  303

Query  567   LNLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
              NL    L +NRF G++P  +    L +  + L L++NYL G   S      E++   + 
Sbjct  304   QNLY---LNNNRFTGRVPASFVDRLLDASIQILYLQHNYLTGIEISPTAVIPERSSLCMQ  360

Query  390   HNCLNCPDHLPWCL--GGQ--RPASQCRR  316
             +NC+  P   P  L  G Q  RP +QC +
Sbjct  361   YNCMVPPVETPCPLRSGKQKTRPTTQCNQ  389



>ref|XP_003516553.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=421

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 131/394 (33%), Positives = 196/394 (50%), Gaps = 17/394 (4%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEAT-GTHF-LGILCMTPSDNS  1279
             +KT   D +VL+  K  ++P SV P S +SSW+  LDPC+   G  F  G  C       
Sbjct  23    SKTHVGDAEVLKELKQGLEPGSVKPGSCVSSWDFTLDPCDNLFGDKFTCGFRCDVVVSGL  82

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S R++ + L+  G  G L+    NL  L TL+L+ N F G IP S  NL +++RL LS N
Sbjct  83    S-RVTELALDQAGYSGSLS-FTWNLPYLQTLDLSNNYFSGQIPYSFSNLTRLSRLSLSSN  140

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              FSG +P  +  L  L+ + + +N L G+IP +   L  L RL+L +N+L  ++P+L  L
Sbjct  141   SFSGEIPSSLGTLSNLQELYLDNNNLRGTIPQSFDNLANLKRLELQSNKLNTRLPNLGSL  200

Query  918   WQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
               L  L LS N     LP   P  +   +L   +        +   L  L  +D S N+ 
Sbjct  201   RNLKFLYLSDNSVTGTLPASLPVSLVQISLRNNNLSGVLVGESFKSLTRLQVVDFSSNQL  260

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEV-TKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
             S  +      LP L ++ +S N FT +E   K +  +S L  +D  +N L+G LP  +  
Sbjct  261   SSAVPSVFFQLPSLQQLTLSFNEFTNLEAPYKGTESQSGLVAVDLSNNRLKGFLPSFMAV  320

Query  570   YLNLKTVNLGHNRFFGKIPKEYGsrl------rslwrnlnLEYNYLEGTLPSEFMT-GGE  412
                L +++L +N F G+IP ++G +        S +  L L  NYL G +P   +    +
Sbjct  321   MPKLSSLSLENNEFTGRIPTQFGVKTVFPEKGVSSFGRLLLGGNYLLGGIPRPLLALKRD  380

Query  411   KARASLDHNCL-NCPDHLPWCLGGQRPA-SQCRR  316
              A  SL  NCL  CP    +C GGQ+ + +QC R
Sbjct  381   SANVSLVDNCLYRCPHSFFFCQGGQQKSLAQCNR  414



>ref|XP_001772599.1| predicted protein [Physcomitrella patens]
 gb|EDQ62641.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 140/396 (35%), Positives = 195/396 (49%), Gaps = 42/396 (11%)
 Frame = -3

Query  1434  DVQVLRSFKDSIDPNSVLPA-SFLSSW--NLDLDPCEATGTHFLGILCMTPSDNSSGRIS  1264
             D+  LRS K S+   S LP  SF SSW   L ++PC++    F G+ C+     S  RIS
Sbjct  19    DMLALRSIKASM---SDLPGGSFFSSWVFALRINPCQS----FAGLQCI--KVGSFNRIS  69

Query  1263  VIDLE-----GDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
              + L        GL GFL   +GNL  L TL ++    RG +PD+I NL+ +    L  N
Sbjct  70    SLSLGPLSAGTPGLTGFLPHSLGNLIYLQTLTISSGALRGAVPDNIGNLQSLRTFSLGPN  129

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
             + SG LP     LR LE + +  N+L G IP  I+ L  L  L LS N L G IP LS  
Sbjct  130   YLSGPLPSSFANLRNLETLQIRKNQLEGRIPPGISNLSSLKVLVLSENRLYGPIPGLSQ-  188

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
               L  L +S+N    GLP  P  L+ L    N L+G I A+  L  L  LDLS NRFSG 
Sbjct  189   TSLIHLDVSNNYLAGGLPFLPSSLQYLSTTRNQLSGGIDAVKVLTNLAYLDLSYNRFSGG  248

Query  738   ILHRIVTLPELMRINVSANHF-TRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
             I   +   P L  + ++ N F   ++V      E R+ V+D   N L+G    NI  YL 
Sbjct  249   IPSAVFEFP-LSFLLLNHNQFRGAVDV----PAEVRISVVDLSHNKLKG----NISPYLA  299

Query  561   LKT-VNLGHNRFFGKIPKEYGsrlrslw-rnlnLEYNYLE--GTLPSEFMTGGEKARASL  394
               T + L +N F G +P+++ S+++    ++L L++NYL   G L S  +         L
Sbjct  300   GTTNLFLNNNMFIGTVPQDFASKMQEATLQSLYLQHNYLTNFGALASASLP--PSVSVCL  357

Query  393   DHNCLN------CPDHLPWCLGGQRPASQCRRSAGG  304
              +NCL       CP ++   +   RP  QC  ++ G
Sbjct  358   LYNCLVPPPQSLCPPNVD--MPASRPDYQCLDASSG  391



>ref|XP_003520549.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Glycine max]
Length=392

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 119/385 (31%), Positives = 188/385 (49%), Gaps = 29/385 (8%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVI  1258
             +D   L+S + S+  + V  ++F SSW+   DPC     +F G+ C   +D+    +++ 
Sbjct  26    NDFLALQSIRKSL--HDVPGSNFFSSWDFTADPC-----NFAGVFC---ADDKVIALNLG  75

Query  1257  DLEGD--GLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
             D      GL G L P I  L+ L    +   +  GP+P S+  L+ +  L +S NF SG 
Sbjct  76    DPRAGSPGLTGKLDPSISKLSALADFTVVPGRIYGPLPQSLSQLKNLRFLGVSRNFISGE  135

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNT  904
             +P  + +LR L  ID+S+N+LSG+IP +I  + +LT L L +N L+G +P  +  + L  
Sbjct  136   IPAGLGQLRNLRTIDLSYNQLSGAIPPSIGKMPQLTNLFLCHNRLSGSVPSFASAYSLTH  195

Query  903   LALSSNQFFAGLP--PFPVrlrtlllghnlltgHISA-ISRLRYLTALDLSDNRFSGPIL  733
             L L  N     L     P  L+ L L  N  TG +   ++RL  L  LDLS N+F+GPI 
Sbjct  196   LELKHNILSGSLAQDSLPASLQYLSLSWNRFTGPVDGLLTRLNRLNFLDLSLNQFTGPIP  255

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHL-PLNIITYLNLK  556
              +I T P L  + +  N F+          E  +Q +D   N L G + P+      N++
Sbjct  256   AQIFTFP-LTNLQLERNQFSG---PIQPFNEVMIQTVDLSYNRLSGEVSPM----LANVQ  307

Query  555   TVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
              + L +N F G++P  +    L +  + L L++N+L G   S        +   L +NC+
Sbjct  308   NLYLNNNGFTGQVPGSFVERLLAAGIQILYLQHNFLTGIAISPTAEIPVSSTLCLQYNCM  367

Query  378   NCPDH--LPWCLGGQ--RPASQCRR  316
               P     P+  G +  RP  QC R
Sbjct  368   VPPVQTACPFNAGRRKIRPPQQCNR  392



>gb|KCW58984.1| hypothetical protein EUGRSUZ_H01608, partial [Eucalyptus grandis]
Length=407

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 118/373 (32%), Positives = 183/373 (49%), Gaps = 32/373 (9%)
 Frame = -3

Query  1377  ASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSG--RISVIDL-----EGDGLEGFLTP  1219
             +SFL+SW+   DPC      F G+ C    D+SS   R+ V+ L        GL G L P
Sbjct  50    SSFLASWDFTSDPCG-----FPGVSC----DSSSPYRRVHVLSLGDPRASAPGLTGRLDP  100

Query  1218  EIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVID  1039
              IGNL+ LT L +   +  G IP S+  L+ +  L  + NF SGG+P  +  LRKL+ +D
Sbjct  101   AIGNLSSLTDLAILPGRVFGRIPQSLSQLKNLRFLAAARNFLSGGIPADLGLLRKLQTLD  160

Query  1038  VSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPPF  859
             +S+NRL+G +P  + +L  L+ L L +N+L+G +P       L  + L  N+    +PP 
Sbjct  161   LSYNRLTGPLPRAVGSLPLLSNLVLCHNQLSGPVPPFLS-QTLTRIDLKHNELSGPIPPA  219

Query  858   ---PVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVS  688
                P      L  + L       +SRL  L+ LDLS N+F+GPI  ++   P +  +++ 
Sbjct  220   YLPPSLQYLWLSSNRLSGPVDRLLSRLTNLSQLDLSMNQFTGPIPGQVFNYP-ITTLHLQ  278

Query  687   ANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
              N F+      +      +  +D   N L G +   + T   ++++ L +NRF G++P+ 
Sbjct  279   RNAFSGPVRPAAPVA---ITTVDLSYNRLSGEMSPELST---VESLYLNNNRFTGQVPRS  332

Query  507   Y-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCP--DHLPWCLG--G  343
             +    L S  R L L++N+L G           ++   L +NC+  P   H P   G   
Sbjct  333   FVDQLLDSSIRVLYLQHNFLTGIEIDATEKIPVRSSLCLQYNCMVPPAQSHCPSRAGRWK  392

Query  342   QRPASQCRRSAGG  304
              RPA QCR   GG
Sbjct  393   SRPAGQCRAHGGG  405



>ref|XP_010026277.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Eucalyptus 
grandis]
Length=459

 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 119/379 (31%), Positives = 185/379 (49%), Gaps = 32/379 (8%)
 Frame = -3

Query  1377  ASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSG--RISVIDL-----EGDGLEGFLTP  1219
             +SFL+SW+   DPC      F G+ C    D+SS   R+ V+ L        GL G L P
Sbjct  91    SSFLASWDFTSDPCG-----FPGVSC----DSSSPYRRVHVLSLGDPRASAPGLTGRLDP  141

Query  1218  EIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVID  1039
              IGNL+ LT L +   +  G IP S+  L+ +  L  + NF SGG+P  +  LRKL+ +D
Sbjct  142   AIGNLSSLTDLAILPGRVFGRIPQSLSQLKNLRFLAAARNFLSGGIPADLGLLRKLQTLD  201

Query  1038  VSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPPF  859
             +S+NRL+G +P  + +L  L+ L L +N+L+G +P       L  + L  N+    +PP 
Sbjct  202   LSYNRLTGPLPRAVGSLPLLSNLVLCHNQLSGPVPPFLS-QTLTRIDLKHNELSGPIPPA  260

Query  858   ---PVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVS  688
                P      L  + L       +SRL  L+ LDLS N+F+GPI  ++   P +  +++ 
Sbjct  261   YLPPSLQYLWLSSNRLSGPVDRLLSRLTNLSQLDLSMNQFTGPIPGQVFNYP-ITTLHLQ  319

Query  687   ANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
              N F+      +      +  +D   N L G +   + T   ++++ L +NRF G++P+ 
Sbjct  320   RNAFSGPVRPAAPVA---ITTVDLSYNRLSGEMSPELST---VESLYLNNNRFTGQVPRS  373

Query  507   Y-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCP--DHLPWCLG--G  343
             +    L S  R L L++N+L G           ++   L +NC+  P   H P   G   
Sbjct  374   FVDQLLDSSIRVLYLQHNFLTGIEIDATEKIPVRSSLCLQYNCMVPPAQSHCPSRAGRWK  433

Query  342   QRPASQCRRSAGGIM*HDG  286
              RPA QCR   GG   + G
Sbjct  434   SRPAGQCRAHGGGAKMYKG  452



>gb|ACR35989.1| unknown [Zea mays]
 gb|AFW63208.1| receptor-like protein kinase [Zea mays]
Length=440

 Score =   119 bits (299),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 123/402 (31%), Positives = 177/402 (44%), Gaps = 30/402 (7%)
 Frame = -3

Query  1449  KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTP--SDNSS  1276
              T   D   L + + ++  +SV P S LSSW+   DPC A      G+ C  P  +++S 
Sbjct  30    ATFPGDKAALAALRSAVAASSVPPHSCLSSWDFSRDPCAA---FPCGVSCYAPPAANSSY  86

Query  1275  GRISVIDLEGDGLEGFLTPEI-GnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
              R++ + L+  G  G L   +  +L  L +L+L  N+F G +P  +     +  L LS N
Sbjct  87    LRVTAVALDPAGYSGALPAALLSSLPFLASLSLADNRFHGALPAGVPLPPTLRILDLSGN  146

Query  1098  FFSGGLPRYM-RRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
              FSG +P  +      L+ + +S N LSG IP  +  L  LTRLDL +N LTG +P L  
Sbjct  147   AFSGAIPASLFTASSALQELYLSRNALSGGIPPQLALLGALTRLDLQHNALTGTLPSLGA  206

Query  921   LWQLNTLALSSNQFFAG-------LPP--FPVrlrtlllghnlltgHISAISRLRYLTAL  769
             +  L  L +S N            LPP  + V  R       L    ++A+  LR L   
Sbjct  207   MRSLVHLDVSGNVLSGSPLRVPGTLPPSLWSVAARNNSFSGPLSAAALAALPALRVL---  263

Query  768   DLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHL  589
             DL+ N  SG +       P L ++ + +N    ++        S+L  LD   N L G L
Sbjct  264   DLTGNAVSGAVPGAAFAHPALQQLRLGSNQLDAVQEAPDGGSSSQLVELDLSGNRLAGRL  323

Query  588   PLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln--------LEYNYLEGTLPS  433
             P  +     L  V L  NRF G IP+ Y  R  +              L+ NYL G LP 
Sbjct  324   PACLGAMPRLAAVALDRNRFTGGIPERYAVRAAAEESTEQWVPFVRLMLQGNYLCGALPR  383

Query  432   EFMTGGE-KARASLDHNCL-NCPDHLPWCLGG-QRPASQCRR  316
             +     E  A  SL  NCL  CP    +C G  Q+  + C +
Sbjct  384   QLRQIQEGSAVVSLADNCLPRCPHKFFFCQGAPQKDHATCPK  425



>emb|CBI21262.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   120 bits (301),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 125/393 (32%), Positives = 179/393 (46%), Gaps = 55/393 (14%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSG  1273
               ++  D  +L SFK SI   S+ PAS LS WNL  + C     H+ G+ C    D  SG
Sbjct  19    VASVSRDAMLLLSFKSSI---SLDPASLLSDWNLSTNHC-----HWYGVTC----DRFSG  66

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R+ ++ +  +   G +  ++  L +L  L L  N F G IPD I +L  +  L LS N  
Sbjct  67    RLRILSIPHNVFSGEIPADVAKLHKLEILQLQGNNFSGRIPDQISSLLSLRMLNLSYNVV  126

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPAT-ITALRELTRLDLSNNELTGKIP-DLSGL  919
             SG +P  +    KL VID+S+N+LSG I     +    L  L LS+N LT  IP ++   
Sbjct  127   SGQIPDKLIGSGKLRVIDLSNNQLSGEIGVDRFSECEFLVHLKLSHNFLTDNIPAEIGKC  186

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLS--DNRFS  745
             W L TL L SN F   +P                    + I R+  L  LD+S   NR S
Sbjct  187   WNLRTLLLDSNIFEGRIP--------------------AEIGRISQLRVLDVSRNRNRLS  226

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G +  ++  L +L  I +  N+ T  E+     + + L VLD   N L G +P N+    
Sbjct  227   GSLPGQLGMLKDLKWILLGGNNLTG-EIPSQLGQLTSLIVLDLSRNGLTGSIPENLTNAT  285

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPS-------EFMTGGEKA  406
             NL+ V L HNR  G+IP  +     S    L++ +N L G +P        +F  G +  
Sbjct  286   NLEIVLLNHNRLVGEIPSSF--STLSSLTELDVSFNNLSGHIPQLQHLSNCDFFKGNQYL  343

Query  405   RASLDHNCLN----CPDHLPWCLGGQRPASQCR  319
                  H CL+     PD LP  L   +   Q +
Sbjct  344   -----HPCLDPYSAPPDRLPDLLEVHKEYRQSK  371



>ref|XP_002526809.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF35544.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=923

 Score =   122 bits (305),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 116/352 (33%), Positives = 158/352 (45%), Gaps = 52/352 (15%)
 Frame = -3

Query  1464  CFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSD  1285
             C LN    E+D   L SF++ I  +   P   L+SWN           HF     +T S 
Sbjct  26    CLLN----ETDRLALISFRELIVRD---PFGVLNSWN--------NSAHFCDWYGVTCSR  70

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
                 RI  ++L   GL G L+P IGNL+ L  ++   N FRG IP  I  LR++  L LS
Sbjct  71    RHPDRIIALNLTSQGLVGSLSPHIGNLSFLRYVDFRNNSFRGQIPHEIGRLRRLQCLTLS  130

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP---  934
              N F G +P  +     L ++++  N+L GSIPA + +LR+L  L L+ N LTG IP   
Sbjct  131   NNSFCGNIPTNLSYCSNLVILNIIDNKLVGSIPAELGSLRKLEALGLAKNNLTGSIPPSI  190

Query  933   -DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
              +LS LWQL          F G  P                   S++S    L  L L  
Sbjct  191   GNLSSLWQL----------FTGAIP-------------------SSLSNASALEQLALYS  221

Query  756   NRFSGPILHRIVTLPELMRINVSANHFT-RIEVTKSSTKESRLQVLDAHSNLLQGHLPLN  580
             N FSG     +  LP L  +++S N     +    S T  SRL+VLD  SN+ QG LP +
Sbjct  222   NGFSGLFPKDLGLLPHLQYVDISENQLIDDLNFIDSLTNCSRLEVLDLASNIFQGTLPSS  281

Query  579   IITY-LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEF  427
             I     +L  + L  N+    IP   G       R    + NYL G +  +F
Sbjct  282   IANLSRDLMYIALSDNQLHNAIP--LGVENLLNLRFFLFDRNYLSGPIVVDF  331


 Score = 75.5 bits (184),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 69/218 (32%), Positives = 103/218 (47%), Gaps = 21/218 (10%)
 Frame = -3

Query  1161  GPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRE  982
             GPI     N  ++  L L  N F+G +P  +  L  L  + +  N L GSIP+++ +   
Sbjct  325   GPIVVDFKNFSRLEMLDLQGNNFTGTIPISISNLSMLSNLYLGFNNLYGSIPSSLGSCHN  384

Query  981   LTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLP-PFPVrlrtlllghnlltgHI  805
             L  LDLS N LTG IP    +  L++L++  N  F GL  P P                 
Sbjct  385   LIELDLSYNRLTGSIP--GQVIGLSSLSILLNLGFNGLTGPIP-----------------  425

Query  804   SAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQV  625
             S +  L+ L  LDLS+NR SG I   I     L ++++  N F+  E+ +  T    LQ 
Sbjct  426   SEVGSLQKLAELDLSNNRLSGMIPDTIGKCLSLEQLHLEGNSFSG-EIPQVLTALQGLQF  484

Query  624   LDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
             LD   N   G +P ++     LK +NL  N+  G++P+
Sbjct  485   LDLSRNNFIGRIPNSLAALDGLKHLNLSFNQLRGEVPE  522


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 79/190 (42%), Gaps = 46/190 (24%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATIT--  994
             F G IP SI NL  ++ L L  N   G +P  +     L  +D+S+NRL+GSIP  +   
Sbjct  347   FTGTIPISISNLSMLSNLYLGFNNLYGSIPSSLGSCHNLIELDLSYNRLTGSIPGQVIGL  406

Query  993   -----------------------ALRELTRLDLSNNELTGKIPDLSG-LWQLNTLALSSN  886
                                    +L++L  LDLSNN L+G IPD  G    L  L L  N
Sbjct  407   SSLSILLNLGFNGLTGPIPSEVGSLQKLAELDLSNNRLSGMIPDTIGKCLSLEQLHLEGN  466

Query  885   QFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPEL  706
              F   +P                      ++ L+ L  LDLS N F G I + +  L  L
Sbjct  467   SFSGEIP--------------------QVLTALQGLQFLDLSRNNFIGRIPNSLAALDGL  506

Query  705   MRINVSANHF  676
               +N+S N  
Sbjct  507   KHLNLSFNQL  516


 Score = 65.9 bits (159),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 72/125 (58%), Gaps = 0/125 (0%)
 Frame = -3

Query  1245  DGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMR  1066
             +GL G +  E+G+L +L  L+L+ N+  G IPD+I     + +L L  N FSG +P+ + 
Sbjct  418   NGLTGPIPSEVGSLQKLAELDLSNNRLSGMIPDTIGKCLSLEQLHLEGNSFSGEIPQVLT  477

Query  1065  RLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSN  886
              L+ L+ +D+S N   G IP ++ AL  L  L+LS N+L G++P+       + ++L  N
Sbjct  478   ALQGLQFLDLSRNNFIGRIPNSLAALDGLKHLNLSFNQLRGEVPERGIFLNASAVSLLGN  537

Query  885   QFFAG  871
               F G
Sbjct  538   NSFCG  542



>ref|XP_010260748.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nelumbo nucifera]
Length=417

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 129/391 (33%), Positives = 189/391 (48%), Gaps = 35/391 (9%)
 Frame = -3

Query  1434  DVQVLRSFKDSIDPNSVLPAS-FLSSWNLD-LDPCEATGTHFLGILCMTPSDNSSG---R  1270
             D+  L++ K+S+   + LP S F S+W+    DPC      F GI+C +  DN +    R
Sbjct  29    DLGALQTIKNSL---TDLPGSDFFSTWDFSSTDPCNT----FSGIIC-SLDDNVTPPLLR  80

Query  1269  ISVIDL-----EGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             I  + L     +  GL G LTP + NL  LT L L      GPIP  + NL+ +  + L+
Sbjct  81    IDTLTLGTGLADSPGLTGSLTPSLSNLDALTQLILYSGIASGPIPSELGNLKNLRVISLT  140

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N  SG +P  +  L  L  +D+S N+LSGSIPA +  L EL  L L++N L+G++PD++
Sbjct  141   NNRLSGPIPTTLATLPNLHTLDLSGNQLSGSIPAGLAGLTELRVLILASNSLSGELPDVT  200

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                QL  L L  N F   LP  P  LR   +  N + G + A+  L  L  LDLS N+F+
Sbjct  201   --TQLLHLDLKQNNFSGRLPSLPSSLRYFSVSQNQMWGPLDALDPLSELVYLDLSMNQFN  258

Query  744   GPI----LHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             G I     H  ++   L R N+S      + V  +S  E    V+D   N L G L    
Sbjct  259   GSIPESLFHYRLSSMLLQRNNLSGGIPRAVSVDVTSYGEG--SVVDLSHNFLSGELS---  313

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYG-srlrslwrnlnLEYNYLEGTLPSEFMTGGEKARA  400
                  +++V L +N   G +P++Y  S      + L L++N+  G      ++  +    
Sbjct  314   SVLAGVESVFLNNNHLMGIVPEDYARSVYEGNMKTLYLQHNFFSGFPLDSGLSLPDSVSL  373

Query  399   SLDHNCLNCPDHLPWC---LGGQ--RPASQC  322
              L +NC+  P  L  C    G Q  RPA QC
Sbjct  374   CLSYNCMVPPVGLTACPASAGDQLWRPAYQC  404



>ref|XP_010267182.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Nelumbo nucifera]
Length=976

 Score =   121 bits (303),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 146/304 (48%), Gaps = 25/304 (8%)
 Frame = -3

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
             P  ++SG +  +DL  + + G ++ +IG  T L  +++  N   G IP SI NL+K+  L
Sbjct  132   PRGSTSG-LETLDLSNNIISGEISVDIGLFTGLKVVDIGGNVLTGKIPTSISNLQKLEYL  190

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              L+ N   G  PR + ++R L+ I + +N LSG IP  I  L  L  LDL  N LTGKIP
Sbjct  191   TLASNRLVGEAPRELGQMRSLKWIYLGYNNLSGEIPKEIGDLTSLNHLDLVYNNLTGKIP  250

Query  933   -DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
               L  L  L  L L  N     +PP                    +I  LR L +LDLSD
Sbjct  251   SSLGNLSDLRYLFLYQNNLTGSIPP--------------------SIFNLRKLVSLDLSD  290

Query  756   NRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             N  +GPI   ++ L  L  +++ AN+FT   + ++     RLQVL   SN L G +P N+
Sbjct  291   NSLTGPIPELVIQLQNLEILHLFANNFTGT-IPEAIASLPRLQVLQLWSNGLSGKIPQNL  349

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARAS  397
                 NL  V+L  N+  GKIP    +  R     L    N+LEG +P          R  
Sbjct  350   GKQNNLTIVDLSTNKLTGKIPDSLCNSGRLFKLILFS--NFLEGGIPKSLSYCRSLQRVR  407

Query  396   LDHN  385
             L +N
Sbjct  408   LQNN  411


 Score =   106 bits (264),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 138/284 (49%), Gaps = 31/284 (11%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R+ V+ L  +GL G +   +G    LT ++L+ NK  G IPDS+ N  ++ +L+L  NF 
Sbjct  330   RLQVLQLWSNGLSGKIPQNLGKQNNLTIVDLSTNKLTGKIPDSLCNSGRLFKLILFSNFL  389

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP----DLS  925
              GG+P+ +   R L+ + + +NR SG +P   T L  +  LD+S N L+G+I     D+ 
Sbjct  390   EGGIPKSLSYCRSLQRVRLQNNRFSGELPPEFTKLPLVYYLDVSGNNLSGRIDGRRWDMP  449

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
              L  LN   L+ N+F   LP                    S  S    L  LDLS NRF 
Sbjct  450   SLQMLN---LARNRFDGNLPQ-------------------SFGS--EKLENLDLSKNRFL  485

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G I      L +LM++ +S N  T   +    +   +L  LD   N L G +P ++    
Sbjct  486   GTIPPSYGNLSDLMQLKLSENQITG-SIPDELSACKKLVYLDLSQNQLTGRIPASLAEMP  544

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPS  433
              L  +NL  N+ +GKIP+  G         +N+ +N+L G+LPS
Sbjct  545   VLAELNLSENQLYGKIPENLG--NVESLVQVNVSHNHLYGSLPS  586


 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 99/314 (32%), Positives = 151/314 (48%), Gaps = 24/314 (8%)
 Frame = -3

Query  1434  DVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVID  1255
             +V++L SFK  I+     P  FLS WN  +  C+     + GI C+     +S  +S I+
Sbjct  28    EVELLLSFKSCIND----PFRFLSRWNSSVALCD-----WYGITCL-----NSSHVSGIE  73

Query  1254  LEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPR  1075
             L G  + G L+P +  L  + ++NL+ N+F G +P+   +   +  L LS N F+G +PR
Sbjct  74    LSGKNISGELSPYLFRLPFIESINLSNNEFFGELPNETFSCLSLRYLNLSSNNFTGSMPR  133

Query  1074  YMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNTLA  898
                    LE +D+S+N +SG I   I     L  +D+  N LTGKIP  +S L +L  L 
Sbjct  134   --GSTSGLETLDLSNNIISGEISVDIGLFTGLKVVDIGGNVLTGKIPTSISNLQKLEYLT  191

Query  897   LSSNQFFAGLPPFPVrlrtlllghnlltgHISA-----ISRLRYLTALDLSDNRFSGPIL  733
             L+SN+   G  P  +     L    L   ++S      I  L  L  LDL  N  +G I 
Sbjct  192   LASNR-LVGEAPRELGQMRSLKWIYLGYNNLSGEIPKEIGDLTSLNHLDLVYNNLTGKIP  250

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKT  553
               +  L +L  + +  N+ T   +  S     +L  LD   N L G +P  +I   NL+ 
Sbjct  251   SSLGNLSDLRYLFLYQNNLTG-SIPPSIFNLRKLVSLDLSDNSLTGPIPELVIQLQNLEI  309

Query  552   VNLGHNRFFGKIPK  511
             ++L  N F G IP+
Sbjct  310   LHLFANNFTGTIPE  323


 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 148/320 (46%), Gaps = 51/320 (16%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             +DL  + L G +   +GNL++L  L L +N   G IP SI NLRK+  L LS+N  +G +
Sbjct  238   LDLVYNNLTGKIPSSLGNLSDLRYLFLYQNNLTGSIPPSIFNLRKLVSLDLSDNSLTGPI  297

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITAL------------------------RELTR  973
             P  + +L+ LE++ +  N  +G+IP  I +L                          LT 
Sbjct  298   PELVIQLQNLEILHLFANNFTGTIPEAIASLPRLQVLQLWSNGLSGKIPQNLGKQNNLTI  357

Query  972   LDLSNNELTGKIPD-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAI  796
             +DLS N+LTGKIPD L    +L  L L SN    G+P                     ++
Sbjct  358   VDLSTNKLTGKIPDSLCNSGRLFKLILFSNFLEGGIP--------------------KSL  397

Query  795   SRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFT-RIEVTKSSTKESRLQVLD  619
             S  R L  + L +NRFSG +      LP +  ++VS N+ + RI+  +       LQ+L+
Sbjct  398   SYCRSLQRVRLQNNRFSGELPPEFTKLPLVYYLDVSGNNLSGRIDGRRWDMPS--LQMLN  455

Query  618   AHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTL  439
                N   G+LP +  +   L+ ++L  NRF G IP  YG+    +   L+   N + G++
Sbjct  456   LARNRFDGNLPQSFGSE-KLENLDLSKNRFLGTIPPSYGNLSDLMQLKLSE--NQITGSI  512

Query  438   PSEFMTGGEKARASLDHNCL  379
             P E     +     L  N L
Sbjct  513   PDELSACKKLVYLDLSQNQL  532


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 77/149 (52%), Gaps = 5/149 (3%)
 Frame = -3

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
             P    S ++  +DL  +   G + P  GNL++L  L L+ N+  G IPD +   +K+  L
Sbjct  466   PQSFGSEKLENLDLSKNRFLGTIPPSYGNLSDLMQLKLSENQITGSIPDELSACKKLVYL  525

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              LS+N  +G +P  +  +  L  +++S N+L G IP  +  +  L ++++S+N L G +P
Sbjct  526   DLSQNQLTGRIPASLAEMPVLAELNLSENQLYGKIPENLGNVESLVQVNVSHNHLYGSLP  585

Query  933   DLSGLWQLNTLALSSNQF-----FAGLPP  862
                    +N+ A+  N        +GLPP
Sbjct  586   STGAFLAINSSAVLGNNLCGGDIVSGLPP  614


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 88/205 (43%), Gaps = 26/205 (13%)
 Frame = -3

Query  1044  IDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS-GLWQLNTLALSSNQFFAGL  868
             I++S   +SG +   +  L  +  ++LSNNE  G++P+ +     L  L LSSN F   +
Sbjct  72    IELSGKNISGELSPYLFRLPFIESINLSNNEFFGELPNETFSCLSLRYLNLSSNNFTGSM  131

Query  867   PPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVS  688
             P                            L  LDLS+N  SG I   I     L  +++ 
Sbjct  132   PRGSTSG----------------------LETLDLSNNIISGEISVDIGLFTGLKVVDIG  169

Query  687   ANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
              N  T  ++  S +   +L+ L   SN L G  P  +    +LK + LG+N   G+IPKE
Sbjct  170   GNVLTG-KIPTSISNLQKLEYLTLASNRLVGEAPRELGQMRSLKWIYLGYNNLSGEIPKE  228

Query  507   YGsrlrslwrnlnLEYNYLEGTLPS  433
              G        +L   YN L G +PS
Sbjct  229   IGDLTSLNHLDLV--YNNLTGKIPS  251



>ref|XP_009405862.1| PREDICTED: leucine-rich repeat receptor-like protein FASCIATED 
EAR2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 179/369 (49%), Gaps = 39/369 (11%)
 Frame = -3

Query  1377  ASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGD------GLEGFLTPE  1216
             +SF ++W+   DPC      F G+LC         R+  + L GD      GL+G L P 
Sbjct  56    SSFFAAWDFTADPCT-----FSGVLC------DGDRVVALAL-GDPRAGSPGLQGRLDPA  103

Query  1215  IGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDV  1036
             +G L+ L  L+L   +  GP+PD++     +  L LS+N  SG +P  +  L  L  +D+
Sbjct  104   LGRLSALAELSLVPGRVTGPVPDALARCSDLRFLALSKNLLSGPIPPTLGALTHLRTLDL  163

Query  1035  SHNRLSGSIPATITALRELTRLDLSNNELTGKIPDL----SGLWQLNTLALSSNQFFAGL  868
             S+N+L+G +P    A   L+ L L +N+L+G +P      S L +L+   L  NQ    +
Sbjct  164   SYNQLTGPVPTAFAAAPVLSNLILCHNQLSGPLPPFPDSSSALLRLD---LKHNQLSGPV  220

Query  867   PPFPVrlrtlllghnlltgHISAI-SRLRYLTALDLSDNRFSGPILHRIVTLPELMRINV  691
             PP P  L+ L LG N LTG + A+   L  L  LDLS N+  GPI   +  LP L ++ +
Sbjct  221   PPLPPSLQYLALGSNALTGAVDAVLPCLTRLNFLDLSSNQLQGPIPGSVFALP-LAKLQL  279

Query  690   SANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
               N F+      +   +  + V+D   N L G LP  +     +  + L +NRF G++P 
Sbjct  280   QRNAFSG---PVAPDGDVIIPVVDLSYNRLWGRLPPQLAA---VGRLYLNNNRFTGEVPS  333

Query  510   EYGsrlrslwrnlnLEYNYLEG--TLPSEFMTGGEKARASLDHNCLNCPDHLPWCL--GG  343
                  L +  + L L++N+L G    P+   T    A   L +NC+  P   P  L  G 
Sbjct  334   RLVQGLTNGMQLLYLQHNFLTGLEIGPAAAATIPVGASLCLQYNCMAPPFDAPCPLKAGN  393

Query  342   Q--RPASQC  322
             Q  RPA QC
Sbjct  394   QRMRPADQC  402



>ref|NP_001150051.1| receptor-like protein kinase precursor [Zea mays]
 gb|ACG37629.1| receptor-like protein kinase precursor [Zea mays]
Length=440

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 125/411 (30%), Positives = 178/411 (43%), Gaps = 30/411 (7%)
 Frame = -3

Query  1449  KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTP--SDNSS  1276
              T   D   L + + ++  +SV P S LSSW+   DPC A      G+ C  P  +++S 
Sbjct  30    ATFPGDKAALAALRSAVAASSVPPHSCLSSWDFSRDPCAA---FPCGVRCYAPPAANSSY  86

Query  1275  GRISVIDLEGDGLEGFLTPEI-GnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
              R++ + L+  G  G L   +  +L  L +L+L  N+F G +P        +  L LS N
Sbjct  87    LRVTAVALDPAGYSGALPAALLSSLPFLASLSLADNRFHGALPAGXPLPPTLRILDLSGN  146

Query  1098  FFSGGLPRYM-RRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG  922
              FSG +P  +      L+ + +S N LSG IP  +  L  LTRLDL +N LTG +P L  
Sbjct  147   AFSGAIPASLFTASSALQELYLSRNALSGGIPPQLALLGALTRLDLQHNALTGTMPSLGA  206

Query  921   LWQLNTLALSSNQFFAG-------LPP--FPVrlrtlllghnlltgHISAISRLRYLTAL  769
             +  L  L +S N            LPP  + V  R       L    ++A+  LR L   
Sbjct  207   MRSLVHLDVSGNALSGSPLRAPGTLPPSLWSVAARNNSFAEPLSAAALAALPALRVL---  263

Query  768   DLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHL  589
             DL+ N  SG +       P L ++ + +N    ++        S+L  LD   N L G L
Sbjct  264   DLTGNAVSGAVPGAAFAHPSLQQLRLGSNRLDAVQDAPDGGSSSQLVELDLSGNRLAGRL  323

Query  588   PLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnln--------LEYNYLEGTLPS  433
             P  +     L  V L  NRF G IP+ Y  R  +              L+ NYL G LP 
Sbjct  324   PACLGAMPRLAAVALDRNRFTGGIPERYAVRAAAEESTEQWVPFVRLMLQGNYLCGALPR  383

Query  432   EFMTGGE-KARASLDHNCL-NCPDHLPWCLGG-QRPASQCRRSAGGIM*HD  289
             +     E  A  SL  NCL  CP    +C G  Q+  + C +    I   D
Sbjct  384   QLRQIKEDSAVVSLADNCLPRCPHKFFFCQGAPQKDHATCPKCDTSIRRQD  434



>ref|XP_010054697.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1018

 Score =   120 bits (302),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 102/314 (32%), Positives = 145/314 (46%), Gaps = 32/314 (10%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             ++D   L SFK++I  +   P   LSSWN     CE     + G+LC   S    GR++ 
Sbjct  30    QTDRLALASFKNAIHED---PLGVLSSWNDSAHHCE-----WQGVLC---SKRHPGRVTS  78

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             + L   GL+GFL+P IGNL+ L  + L  N F G IP  I NL ++  L LS N F G +
Sbjct  79    LVLRSQGLKGFLSPYIGNLSFLRVIILQNNSFHGEIPPQISNLLRLCVLYLSNNSFGGLI  138

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG-LWQLNT  904
             P  + R   LE +++  N+L G I + + +L  L  L L  N L G IP L G L  L T
Sbjct  139   PSNLSRCSNLETLNLIDNQLVGEIHSDLGSLTRLKLLGLFRNSLVGPIPRLIGNLSLLQT  198

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             L+L  N     +P                      +SRL+ L    LS N+ +G +   I
Sbjct  199   LSLGENALSGEIP--------------------EELSRLKRLILFQLSSNKLTGEVPAGI  238

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
             + + ++   +VS N      +    T    L  L A  NL  G +P  +    +L  ++L
Sbjct  239   LNISDIFSFSVSFNRLWGSFLNDVGTASPSLYRLSACCNLFTGMIPSTLTNATSLGGLSL  298

Query  543   GHNRFFGKIPKEYG  502
               N F G IPK  G
Sbjct  299   SDNNFHGPIPKNLG  312


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 103/205 (50%), Gaps = 8/205 (4%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             +S +DL  + L   +   IG L  L  L L  N   G IP SI N+  +  L LS NFF 
Sbjct  392   LSFLDLMNNFLSNCIPHSIGALFNLHILALGGNMLTGEIPSSIGNITLLNILDLSSNFFQ  451

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRL-DLSNNELTGKIP-DLSGLW  916
             G +P+ +   ++L ++++S N L GS+P  I  L  L+ +  L+NN L+G +P  +  L 
Sbjct  452   GYIPQSLGNCKQLIILELSINNLIGSVPVEIMGLSSLSVVFSLANNNLSGSLPLQVGSLK  511

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI-----SAISRLRYLTALDLSDNR  751
              L  L LS N+   GL P  + +  +L G  L           A+  LR L  LDLS+N 
Sbjct  512   NLGILDLSYNR-LTGLIPASISMCLVLEGLFLEANSFRGQIPEALRPLRGLKELDLSNNN  570

Query  750   FSGPILHRIVTLPELMRINVSANHF  676
             FSGPI   +  L  L  +N+S N  
Sbjct  571   FSGPISSFLAELSLLEYLNLSVNQL  595


 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 70/219 (32%), Positives = 97/219 (44%), Gaps = 22/219 (10%)
 Frame = -3

Query  1161  GPIPDSIINLR-KITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALR  985
             G +P S  NL   I R+ +S N   G +P  +  L  L  +D+ +N LS  IP +I AL 
Sbjct  355   GSLPRSFSNLSTSIKRISMSNNRIQGSIPLALGNLFNLSFLDLMNNFLSNCIPHSIGALF  414

Query  984   ELTRLDLSNNELTGKIPDLSG-LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgH  808
              L  L L  N LTG+IP   G +  LN L LSSN FF G  P                  
Sbjct  415   NLHILALGGNMLTGEIPSSIGNITLLNILDLSSN-FFQGYIP------------------  455

Query  807   ISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQ  628
               ++   + L  L+LS N   G +   I+ L  L  +   AN+     +         L 
Sbjct  456   -QSLGNCKQLIILELSINNLIGSVPVEIMGLSSLSVVFSLANNNLSGSLPLQVGSLKNLG  514

Query  627   VLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
             +LD   N L G +P +I   L L+ + L  N F G+IP+
Sbjct  515   ILDLSYNRLTGLIPASISMCLVLEGLFLEANSFRGQIPE  553


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 109/226 (48%), Gaps = 7/226 (3%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             + +G IP ++ NL  ++ L L  NF S  +P  +  L  L ++ +  N L+G IP++I  
Sbjct  377   RIQGSIPLALGNLFNLSFLDLMNNFLSNCIPHSIGALFNLHILALGGNMLTGEIPSSIGN  436

Query  990   LRELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnllt  814
             +  L  LDLS+N   G IP  L    QL  L LS N     +P   + L +L +  +L  
Sbjct  437   ITLLNILDLSSNFFQGYIPQSLGNCKQLIILELSINNLIGSVPVEIMGLSSLSVVFSLAN  496

Query  813   gHISA-----ISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSS  649
              ++S      +  L+ L  LDLS NR +G I   I     L  + + AN F R ++ ++ 
Sbjct  497   NNLSGSLPLQVGSLKNLGILDLSYNRLTGLIPASISMCLVLEGLFLEANSF-RGQIPEAL  555

Query  648   TKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
                  L+ LD  +N   G +   +     L+ +NL  N+  G++P+
Sbjct  556   RPLRGLKELDLSNNNFSGPISSFLAELSLLEYLNLSVNQLEGQVPE  601


 Score = 62.4 bits (150),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 60/224 (27%), Positives = 100/224 (45%), Gaps = 25/224 (11%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSG--SIPATIT  994
             F G IP ++ N   +  L LS+N F G +P+ + RL+ L +I++ +N L    S  +++ 
Sbjct  279   FTGMIPSTLTNATSLGGLSLSDNNFHGPIPKNLGRLKDLYLIELGYNHLQDDLSFISSLV  338

Query  993   ALRELTRLDLSNNELTGKIP-DLSGL-WQLNTLALSSNQFFAGLPPFPVrlrtlllghnl  820
                +L  L +  N + G +P   S L   +  +++S+N+    +P               
Sbjct  339   NCSKLKTLRMPGNLIHGSLPRSFSNLSTSIKRISMSNNRIQGSIPL--------------  384

Query  819   ltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKE  640
                   A+  L  L+ LDL +N  S  I H I  L  L  + +  N  T  E+  S    
Sbjct  385   ------ALGNLFNLSFLDLMNNFLSNCIPHSIGALFNLHILALGGNMLTG-EIPSSIGNI  437

Query  639   SRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
             + L +LD  SN  QG++P ++     L  + L  N   G +P E
Sbjct  438   TLLNILDLSSNFFQGYIPQSLGNCKQLIILELSINNLIGSVPVE  481


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 70/148 (47%), Gaps = 10/148 (7%)
 Frame = -3

Query  1341  PCEATGTHFLGILCMTPSDNSSG----------RISVIDLEGDGLEGFLTPEIGnltelt  1192
             P E  G   L ++    ++N SG           + ++DL  + L G +   I     L 
Sbjct  479   PVEIMGLSSLSVVFSLANNNLSGSLPLQVGSLKNLGILDLSYNRLTGLIPASISMCLVLE  538

Query  1191  tlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGS  1012
              L L  N FRG IP+++  LR +  L LS N FSG +  ++  L  LE +++S N+L G 
Sbjct  539   GLFLEANSFRGQIPEALRPLRGLKELDLSNNNFSGPISSFLAELSLLEYLNLSVNQLEGQ  598

Query  1011  IPATITALRELTRLDLSNNELTGKIPDL  928
             +P     L   + L   N EL G +PDL
Sbjct  599   VPEGGVFLNASSVLIYGNTELCGGVPDL  626


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 82/305 (27%), Positives = 117/305 (38%), Gaps = 64/305 (21%)
 Frame = -3

Query  1161  GPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATI-----  997
             GPIP  I NL  +  L L EN  SG +P  + RL++L +  +S N+L+G +PA I     
Sbjct  184   GPIPRLIGNLSLLQTLSLGENALSGEIPEELSRLKRLILFQLSSNKLTGEVPAGILNISD  243

Query  996   --------------------TALRELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQF  880
                                 TA   L RL    N  TG IP  L+    L  L+LS N F
Sbjct  244   IFSFSVSFNRLWGSFLNDVGTASPSLYRLSACCNLFTGMIPSTLTNATSLGGLSLSDNNF  303

Query  879   FAGLPP------------FPVrlrtlllghnlltgHISAISRLRY---------------  781
                +P                      L       + S +  LR                
Sbjct  304   HGPIPKNLGRLKDLYLIELGYNHLQDDLSFISSLVNCSKLKTLRMPGNLIHGSLPRSFSN  363

Query  780   ----LTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAH  613
                 +  + +S+NR  G I   +  L  L  +++  N+F    +  S      L +L   
Sbjct  364   LSTSIKRISMSNNRIQGSIPLALGNLFNLSFLDL-MNNFLSNCIPHSIGALFNLHILALG  422

Query  612   SNLLQGHLPLNI--ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTL  439
              N+L G +P +I  IT LN+  ++L  N F G IP+  G         L L  N L G++
Sbjct  423   GNMLTGEIPSSIGNITLLNI--LDLSSNFFQGYIPQSLG--NCKQLIILELSINNLIGSV  478

Query  438   PSEFM  424
             P E M
Sbjct  479   PVEIM  483



>gb|KCW77199.1| hypothetical protein EUGRSUZ_D01548, partial [Eucalyptus grandis]
Length=1002

 Score =   120 bits (302),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 102/314 (32%), Positives = 145/314 (46%), Gaps = 32/314 (10%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             ++D   L SFK++I  +   P   LSSWN     CE     + G+LC   S    GR++ 
Sbjct  14    QTDRLALASFKNAIHED---PLGVLSSWNDSAHHCE-----WQGVLC---SKRHPGRVTS  62

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             + L   GL+GFL+P IGNL+ L  + L  N F G IP  I NL ++  L LS N F G +
Sbjct  63    LVLRSQGLKGFLSPYIGNLSFLRVIILQNNSFHGEIPPQISNLLRLCVLYLSNNSFGGLI  122

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG-LWQLNT  904
             P  + R   LE +++  N+L G I + + +L  L  L L  N L G IP L G L  L T
Sbjct  123   PSNLSRCSNLETLNLIDNQLVGEIHSDLGSLTRLKLLGLFRNSLVGPIPRLIGNLSLLQT  182

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             L+L  N     +P                      +SRL+ L    LS N+ +G +   I
Sbjct  183   LSLGENALSGEIP--------------------EELSRLKRLILFQLSSNKLTGEVPAGI  222

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
             + + ++   +VS N      +    T    L  L A  NL  G +P  +    +L  ++L
Sbjct  223   LNISDIFSFSVSFNRLWGSFLNDVGTASPSLYRLSACCNLFTGMIPSTLTNATSLGGLSL  282

Query  543   GHNRFFGKIPKEYG  502
               N F G IPK  G
Sbjct  283   SDNNFHGPIPKNLG  296


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 103/205 (50%), Gaps = 8/205 (4%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             +S +DL  + L   +   IG L  L  L L  N   G IP SI N+  +  L LS NFF 
Sbjct  376   LSFLDLMNNFLSNCIPHSIGALFNLHILALGGNMLTGEIPSSIGNITLLNILDLSSNFFQ  435

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRL-DLSNNELTGKIP-DLSGLW  916
             G +P+ +   ++L ++++S N L GS+P  I  L  L+ +  L+NN L+G +P  +  L 
Sbjct  436   GYIPQSLGNCKQLIILELSINNLIGSVPVEIMGLSSLSVVFSLANNNLSGSLPLQVGSLK  495

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI-----SAISRLRYLTALDLSDNR  751
              L  L LS N+   GL P  + +  +L G  L           A+  LR L  LDLS+N 
Sbjct  496   NLGILDLSYNR-LTGLIPASISMCLVLEGLFLEANSFRGQIPEALRPLRGLKELDLSNNN  554

Query  750   FSGPILHRIVTLPELMRINVSANHF  676
             FSGPI   +  L  L  +N+S N  
Sbjct  555   FSGPISSFLAELSLLEYLNLSVNQL  579


 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 70/219 (32%), Positives = 97/219 (44%), Gaps = 22/219 (10%)
 Frame = -3

Query  1161  GPIPDSIINLR-KITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALR  985
             G +P S  NL   I R+ +S N   G +P  +  L  L  +D+ +N LS  IP +I AL 
Sbjct  339   GSLPRSFSNLSTSIKRISMSNNRIQGSIPLALGNLFNLSFLDLMNNFLSNCIPHSIGALF  398

Query  984   ELTRLDLSNNELTGKIPDLSG-LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgH  808
              L  L L  N LTG+IP   G +  LN L LSSN FF G  P                  
Sbjct  399   NLHILALGGNMLTGEIPSSIGNITLLNILDLSSN-FFQGYIP------------------  439

Query  807   ISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQ  628
               ++   + L  L+LS N   G +   I+ L  L  +   AN+     +         L 
Sbjct  440   -QSLGNCKQLIILELSINNLIGSVPVEIMGLSSLSVVFSLANNNLSGSLPLQVGSLKNLG  498

Query  627   VLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
             +LD   N L G +P +I   L L+ + L  N F G+IP+
Sbjct  499   ILDLSYNRLTGLIPASISMCLVLEGLFLEANSFRGQIPE  537


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 109/226 (48%), Gaps = 7/226 (3%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             + +G IP ++ NL  ++ L L  NF S  +P  +  L  L ++ +  N L+G IP++I  
Sbjct  361   RIQGSIPLALGNLFNLSFLDLMNNFLSNCIPHSIGALFNLHILALGGNMLTGEIPSSIGN  420

Query  990   LRELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnllt  814
             +  L  LDLS+N   G IP  L    QL  L LS N     +P   + L +L +  +L  
Sbjct  421   ITLLNILDLSSNFFQGYIPQSLGNCKQLIILELSINNLIGSVPVEIMGLSSLSVVFSLAN  480

Query  813   gHISA-----ISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSS  649
              ++S      +  L+ L  LDLS NR +G I   I     L  + + AN F R ++ ++ 
Sbjct  481   NNLSGSLPLQVGSLKNLGILDLSYNRLTGLIPASISMCLVLEGLFLEANSF-RGQIPEAL  539

Query  648   TKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
                  L+ LD  +N   G +   +     L+ +NL  N+  G++P+
Sbjct  540   RPLRGLKELDLSNNNFSGPISSFLAELSLLEYLNLSVNQLEGQVPE  585


 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 60/224 (27%), Positives = 100/224 (45%), Gaps = 25/224 (11%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSG--SIPATIT  994
             F G IP ++ N   +  L LS+N F G +P+ + RL+ L +I++ +N L    S  +++ 
Sbjct  263   FTGMIPSTLTNATSLGGLSLSDNNFHGPIPKNLGRLKDLYLIELGYNHLQDDLSFISSLV  322

Query  993   ALRELTRLDLSNNELTGKIP-DLSGL-WQLNTLALSSNQFFAGLPPFPVrlrtlllghnl  820
                +L  L +  N + G +P   S L   +  +++S+N+    +P               
Sbjct  323   NCSKLKTLRMPGNLIHGSLPRSFSNLSTSIKRISMSNNRIQGSIPL--------------  368

Query  819   ltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKE  640
                   A+  L  L+ LDL +N  S  I H I  L  L  + +  N  T  E+  S    
Sbjct  369   ------ALGNLFNLSFLDLMNNFLSNCIPHSIGALFNLHILALGGNMLTG-EIPSSIGNI  421

Query  639   SRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
             + L +LD  SN  QG++P ++     L  + L  N   G +P E
Sbjct  422   TLLNILDLSSNFFQGYIPQSLGNCKQLIILELSINNLIGSVPVE  465


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 70/148 (47%), Gaps = 10/148 (7%)
 Frame = -3

Query  1341  PCEATGTHFLGILCMTPSDNSSG----------RISVIDLEGDGLEGFLTPEIGnltelt  1192
             P E  G   L ++    ++N SG           + ++DL  + L G +   I     L 
Sbjct  463   PVEIMGLSSLSVVFSLANNNLSGSLPLQVGSLKNLGILDLSYNRLTGLIPASISMCLVLE  522

Query  1191  tlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGS  1012
              L L  N FRG IP+++  LR +  L LS N FSG +  ++  L  LE +++S N+L G 
Sbjct  523   GLFLEANSFRGQIPEALRPLRGLKELDLSNNNFSGPISSFLAELSLLEYLNLSVNQLEGQ  582

Query  1011  IPATITALRELTRLDLSNNELTGKIPDL  928
             +P     L   + L   N EL G +PDL
Sbjct  583   VPEGGVFLNASSVLIYGNTELCGGVPDL  610


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 69/134 (51%), Gaps = 0/134 (0%)
 Frame = -3

Query  1263  VIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
             V  L  + L G L  ++G+L  L  L+L+ N+  G IP SI     +  L L  N F G 
Sbjct  475   VFSLANNNLSGSLPLQVGSLKNLGILDLSYNRLTGLIPASISMCLVLEGLFLEANSFRGQ  534

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNT  904
             +P  +R LR L+ +D+S+N  SG I + +  L  L  L+LS N+L G++P+       ++
Sbjct  535   IPEALRPLRGLKELDLSNNNFSGPISSFLAELSLLEYLNLSVNQLEGQVPEGGVFLNASS  594

Query  903   LALSSNQFFAGLPP  862
             + +  N    G  P
Sbjct  595   VLIYGNTELCGGVP  608


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 82/305 (27%), Positives = 117/305 (38%), Gaps = 64/305 (21%)
 Frame = -3

Query  1161  GPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATI-----  997
             GPIP  I NL  +  L L EN  SG +P  + RL++L +  +S N+L+G +PA I     
Sbjct  168   GPIPRLIGNLSLLQTLSLGENALSGEIPEELSRLKRLILFQLSSNKLTGEVPAGILNISD  227

Query  996   --------------------TALRELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQF  880
                                 TA   L RL    N  TG IP  L+    L  L+LS N F
Sbjct  228   IFSFSVSFNRLWGSFLNDVGTASPSLYRLSACCNLFTGMIPSTLTNATSLGGLSLSDNNF  287

Query  879   FAGLPP------------FPVrlrtlllghnlltgHISAISRLRY---------------  781
                +P                      L       + S +  LR                
Sbjct  288   HGPIPKNLGRLKDLYLIELGYNHLQDDLSFISSLVNCSKLKTLRMPGNLIHGSLPRSFSN  347

Query  780   ----LTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAH  613
                 +  + +S+NR  G I   +  L  L  +++  N+F    +  S      L +L   
Sbjct  348   LSTSIKRISMSNNRIQGSIPLALGNLFNLSFLDL-MNNFLSNCIPHSIGALFNLHILALG  406

Query  612   SNLLQGHLPLNI--ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTL  439
              N+L G +P +I  IT LN+  ++L  N F G IP+  G         L L  N L G++
Sbjct  407   GNMLTGEIPSSIGNITLLNI--LDLSSNFFQGYIPQSLG--NCKQLIILELSINNLIGSV  462

Query  438   PSEFM  424
             P E M
Sbjct  463   PVEIM  467



>gb|KCW63534.1| hypothetical protein EUGRSUZ_G01170 [Eucalyptus grandis]
Length=969

 Score =   120 bits (301),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 99/314 (32%), Positives = 146/314 (46%), Gaps = 32/314 (10%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             ++D+  L SFK++I  +   P   LSSWN     CE     + G+LC   S     R++ 
Sbjct  30    QTDLLALASFKNAIHKD---PFRVLSSWNDSTHHCE-----WQGVLC---SKRHPRRVTS  78

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             + L   GLEGFL+P +GNL+ L  + L  N F G IP  I NL ++  L+LS N F G +
Sbjct  79    LYLRSQGLEGFLSPHVGNLSFLRVIFLQNNSFHGEIPPHIGNLFRLHVLVLSNNSFGGSI  138

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNT  904
             P  + R   LE++++  N+L G I + + +L  L  L LS N L G IP  +  L  L  
Sbjct  139   PSNLSRCLNLEILNLIDNQLVGGIHSNLGSLTRLKGLGLSLNSLVGPIPGSIGNLSLLQK  198

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             L+L+ N     +P                      +SRL+ L    LS N+ +G I   I
Sbjct  199   LSLAENALSGEIP--------------------EELSRLKRLILFQLSSNKLTGEIPTGI  238

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
             + + +++  NV+ N      +    T    L  L    NL  G +   ++    L  + L
Sbjct  239   LNMSDIITFNVNYNQMWGSFLNDVGTTSPSLYFLGVGKNLFTGMISSTLMNATGLGKLYL  298

Query  543   GHNRFFGKIPKEYG  502
              HN F G IPK  G
Sbjct  299   EHNNFHGPIPKNLG  312


 Score = 75.1 bits (183),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 102/216 (47%), Gaps = 21/216 (10%)
 Frame = -3

Query  1155  IPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELT  976
             IP SI  L  + +L LS N F+G +P  +  +  L ++D+S N   G IP +++   +L 
Sbjct  406   IPHSIGALSNLQQLDLSWNMFTGEIPSSIGNITSLGILDLSSNIFRGYIPQSLSNCMQLI  465

Query  975   RLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISA  799
              LDLSNN L G IP ++  L  L+ +   +N   +G  P  V                  
Sbjct  466   GLDLSNNNLIGSIPIEIMDLSSLSIILSLANNNLSGSLPLQV------------------  507

Query  798   ISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLD  619
                L+ L  LDLS NR +G I   I     L R+++ AN F   ++ ++      LQ LD
Sbjct  508   -GSLKNLGILDLSHNRLTGLIPASISMCLVLERLHLEANSFHG-QIPEALRPLRGLQELD  565

Query  618   AHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
                N   G +P  +  +  LK +NL  N+  G++PK
Sbjct  566   LSDNNFSGPIPSFLAGFSLLKYLNLSFNQLEGQVPK  601


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 129/285 (45%), Gaps = 32/285 (11%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSG--SIPATIT  994
             F G I  +++N   + +L L  N F G +P+ + RL+ L  I ++ N L    S  +++ 
Sbjct  279   FTGMISSTLMNATGLGKLYLEHNNFHGPIPKNLGRLKGLYRISLADNHLQDDLSFISSLV  338

Query  993   ALRELTRLDLSNNELTGKIP----DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllgh  826
                 L  L++S N + G +P    +LS    +  + +S N+    +P             
Sbjct  339   NCSNLENLEISRNLIHGSLPRSFFNLSP--SIERIYMSDNRIQGSIPL------------  384

Query  825   nlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSST  646
                     A+  L  L+ L LS+N  +  I H I  L  L ++++S N FT  E+  S  
Sbjct  385   --------ALGNLFNLSFLRLSNNFLTANIPHSIGALSNLQQLDLSWNMFTG-EIPSSIG  435

Query  645   KESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL  466
               + L +LD  SN+ +G++P ++   + L  ++L +N   G IP E    L SL   L+L
Sbjct  436   NITSLGILDLSSNIFRGYIPQSLSNCMQLIGLDLSNNNLIGSIPIEI-MDLSSLSIILSL  494

Query  465   EYNYLEGTLPSEFMTGGEKARASLDHNCLN--CPDHLPWCLGGQR  337
               N L G+LP +  +        L HN L    P  +  CL  +R
Sbjct  495   ANNNLSGSLPLQVGSLKNLGILDLSHNRLTGLIPASISMCLVLER  539


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 67/128 (52%), Gaps = 0/128 (0%)
 Frame = -3

Query  1245  DGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMR  1066
             + L G L  ++G+L  L  L+L+ N+  G IP SI     + RL L  N F G +P  +R
Sbjct  497   NNLSGSLPLQVGSLKNLGILDLSHNRLTGLIPASISMCLVLERLHLEANSFHGQIPEALR  556

Query  1065  RLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSN  886
              LR L+ +D+S N  SG IP+ +     L  L+LS N+L G++P        +++++  N
Sbjct  557   PLRGLQELDLSDNNFSGPIPSFLAGFSLLKYLNLSFNQLEGQVPKGGVFLNASSISIYGN  616

Query  885   QFFAGLPP  862
                 G  P
Sbjct  617   TELCGGVP  624



>gb|EAZ22204.1| hypothetical protein OsJ_05865 [Oryza sativa Japonica Group]
Length=1132

 Score =   120 bits (301),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 109/307 (36%), Positives = 152/307 (50%), Gaps = 29/307 (9%)
 Frame = -3

Query  1254  LEGDGLEGFLTPEIGnltelttln-lnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLP  1078
             L+G+GL+G L   +GNL        L +NK  G IP  I NL+ +T L + +N FSG +P
Sbjct  472   LDGNGLKGSLPSSVGNLAPQLDWLWLKQNKLSGTIPAEIGNLKSLTILYMDDNMFSGSIP  531

Query  1077  RYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW-QLNTL  901
             + +  L  L V+  + N LSG IP +I  L +L    L  N L G IP   G W QL  L
Sbjct  532   QTIGNLTNLLVLSFAKNNLSGRIPDSIGNLSQLNEFYLDRNNLNGSIPANIGQWRQLEKL  591

Query  900   ALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIV  721
              LS N F   +P                   IS++S+      LDLS N F+GPIL  I 
Sbjct  592   NLSHNSFSGSMP--------------SEVFKISSLSQ-----NLDLSHNLFTGPILPEIG  632

Query  720   TLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLG  541
              L  L  I+++ N  T  ++  +  K   L+ L    NLL G +P + +   ++K ++L 
Sbjct  633   NLINLGSISIANNRLTG-DIPSTLGKCVLLEYLHMEGNLLTGSIPQSFMNLKSIKELDLS  691

Query  540   HNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHN---CLNCP  370
              NR  GK+P+     L S  + LNL +N  EGT+PS  +  G  +R  LD N   C N P
Sbjct  692   RNRLSGKVPEFL--TLFSSLQKLNLSFNDFEGTIPSNGVF-GNASRVILDGNYRLCANAP  748

Query  369   DH-LPWC  352
              + LP C
Sbjct  749   GYSLPLC  755


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 130/263 (49%), Gaps = 6/263 (2%)
 Frame = -3

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             G+IS ++L  + LEG +  E+ + + L  L L  N  +G IP S+     + +++L  N 
Sbjct  126   GQISYLNLSINSLEGRIPDELSSCSNLQVLGLWNNSLQGEIPPSLTQCTHLQQVILYNNK  185

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD-LSGL  919
               G +P     LR+L+ +D+S+N L+G IP  + +      +DL  N+LTG+IP+ L+  
Sbjct  186   LEGRIPTGFGTLRELKTLDLSNNALTGDIPPLLGSSPSFVYVDLGGNQLTGRIPEFLANS  245

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTA----LDLSDNR  751
               L  L L  N     +P       TL   +        +I  +  + A    L L+ N+
Sbjct  246   SSLQVLRLMQNSLTGEIPAALFNSSTLTTIYLNRNNLAGSIPPVTAIAAPIQFLSLTQNK  305

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
              +G I   +  L  L+R++++AN+     + +S +K   L+ L    N L G +P +I  
Sbjct  306   LTGGIPPTLGNLSSLVRLSLAANNLVG-SIPESLSKIPALERLILTYNNLSGPVPESIFN  364

Query  570   YLNLKTVNLGHNRFFGKIPKEYG  502
               +L+ + + +N   G++P++ G
Sbjct  365   MSSLRYLEMANNSLIGRLPQDIG  387


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 109/204 (53%), Gaps = 6/204 (3%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             ++++ ++ +   G +   IGNLT L  L+  +N   G IPDSI NL ++    L  N  +
Sbjct  516   LTILYMDDNMFSGSIPQTIGNLTNLLVLSFAKNNLSGRIPDSIGNLSQLNEFYLDRNNLN  575

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTR-LDLSNNELTGKI-PDLSGLW  916
             G +P  + + R+LE +++SHN  SGS+P+ +  +  L++ LDLS+N  TG I P++  L 
Sbjct  576   GSIPANIGQWRQLEKLNLSHNSFSGSMPSEVFKISSLSQNLDLSHNLFTGPILPEIGNLI  635

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISR----LRYLTALDLSDNRF  748
              L ++++++N+    +P    +   L   H        +I +    L+ +  LDLS NR 
Sbjct  636   NLGSISIANNRLTGDIPSTLGKCVLLEYLHMEGNLLTGSIPQSFMNLKSIKELDLSRNRL  695

Query  747   SGPILHRIVTLPELMRINVSANHF  676
             SG +   +     L ++N+S N F
Sbjct  696   SGKVPEFLTLFSSLQKLNLSFNDF  719


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 108/253 (43%), Gaps = 34/253 (13%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYM-RRLRKLEVIDVSHNRLSGSIPATITA  991
               GP+P+SI N+  +  L ++ N   G LP+ +  RL  L+ + +S  +L+G IPA++  
Sbjct  354   LSGPVPESIFNMSSLRYLEMANNSLIGRLPQDIGNRLPNLQSLILSTIQLNGPIPASLAN  413

Query  990   LRELTRLDLSNNELTGKIPDL-----------------SGLW----------QLNTLALS  892
             + +L  + L    LTG +P                   +G W          QL  L L 
Sbjct  414   MTKLEMIYLVATGLTGVVPSFGLLPNLRYLDLAYNHLEAGDWSFLSSLANCTQLKKLLLD  473

Query  891   SNQFFAGLPP-----FPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHR  727
              N     LP       P      L  + L     + I  L+ LT L + DN FSG I   
Sbjct  474   GNGLKGSLPSSVGNLAPQLDWLWLKQNKLSGTIPAEIGNLKSLTILYMDDNMFSGSIPQT  533

Query  726   IVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVN  547
             I  L  L+ ++ + N+ +   +  S    S+L       N L G +P NI  +  L+ +N
Sbjct  534   IGNLTNLLVLSFAKNNLSG-RIPDSIGNLSQLNEFYLDRNNLNGSIPANIGQWRQLEKLN  592

Query  546   LGHNRFFGKIPKE  508
             L HN F G +P E
Sbjct  593   LSHNSFSGSMPSE  605


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 61/109 (56%), Gaps = 0/109 (0%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             +DL  +   G + PEIGNL  L ++++  N+  G IP ++     +  L +  N  +G +
Sbjct  616   LDLSHNLFTGPILPEIGNLINLGSISIANNRLTGDIPSTLGKCVLLEYLHMEGNLLTGSI  675

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
             P+    L+ ++ +D+S NRLSG +P  +T    L +L+LS N+  G IP
Sbjct  676   PQSFMNLKSIKELDLSRNRLSGKVPEFLTLFSSLQKLNLSFNDFEGTIP  724



>ref|XP_008807273.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Phoenix dactylifera]
Length=395

 Score =   116 bits (291),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 120/364 (33%), Positives = 170/364 (47%), Gaps = 30/364 (8%)
 Frame = -3

Query  1377  ASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGD------GLEGFLTPE  1216
             ++F + W+   DPC      F G+ C      S+GR+  + L GD      GL G L+P 
Sbjct  45    STFFAGWDFTGDPC-----GFPGVFC------SAGRVVALAL-GDPRAGSPGLAGRLSPA  92

Query  1215  IGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDV  1036
             +G L+ L  L+L   +  GPIP S+   R +  L LS NF SG +P  +  LR L  +D+
Sbjct  93    LGRLSALAELSLVPGRVVGPIPPSLSLCRSLRFLALSRNFLSGAVPTSLPSLRGLRTLDL  152

Query  1035  SHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPPFP  856
             S N LSG IP  I  +  L+ L L +N L+G+IP       L  L L  N     +P  P
Sbjct  153   SFNLLSGPIPPAIAGIPALSNLILCHNRLSGQIPPFPSSSPLLRLDLKRNSLSGAIPALP  212

Query  855   VrlrtlllghnlltgHIS-AISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANH  679
               LR L L  N L+G +   + RL  L  LDLS N+ SG I  +I + P +  + +  N 
Sbjct  213   ASLRYLSLASNGLSGPVDRVLPRLTRLNYLDLSMNQLSGQIPGQIFSFP-VSSLQLQRND  271

Query  678   FTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEY-G  502
             F+       S  +     +D   N L G +P  +     L    L +NRF GK+P  +  
Sbjct  272   FSGPVRPVGSLADG--ATVDLSYNQLTGPVPGKLAAAGRLY---LDNNRFSGKVPARFVE  326

Query  501   srlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCPDHLPWCL--GGQ--RP  334
               +    + L L++NYL G   S   T        L +NC+  P   P  +  G Q  RP
Sbjct  327   RVVSGAIKVLYLQHNYLTGFGISPAATIPASTSLCLQYNCMVPPVETPCPVKAGRQKTRP  386

Query  333   ASQC  322
             A+QC
Sbjct  387   AAQC  390



>emb|CDX75559.1| BnaA01g01430D [Brassica napus]
Length=1079

 Score =   120 bits (300),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 155/291 (53%), Gaps = 17/291 (6%)
 Frame = -3

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             G + V+DLEG+ L G +   +G +  L  L+L RN F G +P S++NL+++ RL L EN 
Sbjct  333   GSLGVLDLEGNRLTGLVPEFLGYMKALKVLSLGRNSFSGYVPLSMVNLQQLDRLNLGEND  392

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGL  919
              +G  P  +  L  L  +D+S NR +G +P +I+ L  L+ L+LS NE +G+IP  +  L
Sbjct  393   LNGSFPVELMALTNLSELDLSGNRFTGEVPVSISNLSNLSFLNLSGNEFSGEIPASIGNL  452

Query  918   WQLNTLALSSNQF-------FAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLS  760
             ++L +L LS            +GLP   V          ++    S++  LRY   ++LS
Sbjct  453   FKLTSLDLSKQNMSGEVPVELSGLPNLQVIALQENNFSGVVPEGFSSLVSLRY---VNLS  509

Query  759   DNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLN  580
              N FSG I      L  L  +++S NH +   +       S L+VL+  SN L G++P++
Sbjct  510   SNSFSGEIPQTFGFLRVLGSLSLSDNHISG-SIPPEVGNCSALEVLELRSNRLTGNIPVD  568

Query  579   IITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEF  427
             +     LK ++LG N F G+IP      + S   +L+L++N+L G +P  F
Sbjct  569   LSRLSRLKVLDLGRNNFSGEIPP-----MSSSLESLSLDHNHLSGVIPESF  614


 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 96/331 (29%), Positives = 151/331 (46%), Gaps = 22/331 (7%)
 Frame = -3

Query  1386  VLPASFLSSWNLD---LDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGDGLEGFLTPE  1216
             V+PA+F +  NL+   LD    TGT    + C T        ++++ L  +     + PE
Sbjct  202   VIPAAFGALPNLEVIALDNNNLTGTVPFSLFCNT-------SLTIVRLGSNAFSDVVRPE  254

Query  1215  IGnltelttlnlnrNKFR--GPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVI  1042
               N        L+ ++ R  G  P  + ++  +T L +S N FSG +P  +  L+ +E +
Sbjct  255   TVNCRSTGLQVLDLSENRISGRFPMWLTSIVSLTNLDVSGNVFSGEIPAEIGGLKLVEEL  314

Query  1041  DVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ-LNTLALSSNQFFAGLP  865
              +++N L+G IP  I     L  LDL  N LTG +P+  G  + L  L+L  N  F+G  
Sbjct  315   KLANNSLTGEIPVEIKQCGSLGVLDLEGNRLTGLVPEFLGYMKALKVLSLGRNS-FSGYV  373

Query  864   PFPVrlrtlllghnlltgHISA-----ISRLRYLTALDLSDNRFSGPILHRIVTLPELMR  700
             P  +     L   NL    ++      +  L  L+ LDLS NRF+G +   I  L  L  
Sbjct  374   PLSMVNLQQLDRLNLGENDLNGSFPVELMALTNLSELDLSGNRFTGEVPVSISNLSNLSF  433

Query  699   INVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGK  520
             +N+S N F+  E+  S     +L  LD     + G +P+ +    NL+ + L  N F G 
Sbjct  434   LNLSGNEFSG-EIPASIGNLFKLTSLDLSKQNMSGEVPVELSGLPNLQVIALQENNFSGV  492

Query  519   IPKEYGsrlrslwrnlnLEYNYLEGTLPSEF  427
             +P+  G       R +NL  N   G +P  F
Sbjct  493   VPE--GFSSLVSLRYVNLSSNSFSGEIPQTF  521


 Score = 75.5 bits (184),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 111/215 (52%), Gaps = 4/215 (2%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             +++ +DL    + G +  E+  L  L  + L  N F G +P+   +L  +  + LS N F
Sbjct  454   KLTSLDLSKQNMSGEVPVELSGLPNLQVIALQENNFSGVVPEGFSSLVSLRYVNLSSNSF  513

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLW  916
             SG +P+    LR L  + +S N +SGSIP  +     L  L+L +N LTG IP DLS L 
Sbjct  514   SGEIPQTFGFLRVLGSLSLSDNHISGSIPPEVGNCSALEVLELRSNRLTGNIPVDLSRLS  573

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFSGP  739
             +L  L L  N F   +PP    L +L L HN L+G I  + SRL  L+ LDLS N  +G 
Sbjct  574   RLKVLDLGRNNFSGEIPPMSSSLESLSLDHNHLSGVIPESFSRLSNLSKLDLSVNNLTGE  633

Query  738   ILHRI-VTLPELMRINVSANHFTRIEVTKSSTKES  637
             I   + V    L+  NVS N+  + E+  S T  S
Sbjct  634   IPSTLSVIATNLVYFNVSNNNL-KGEIPSSFTNPS  667


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 72/268 (27%), Positives = 119/268 (44%), Gaps = 34/268 (13%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             +  GP+P S+        L +S N FSG +P  +  L +L+++++S+N+L+G+IPA++  
Sbjct  108   EISGPLPLSL------KFLDVSSNVFSGQIPSGLANLTQLQLLNLSYNQLNGAIPASLGK  161

Query  990   LRELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnllt  814
             L+ L  L L  N L G +P  LS    +  L+ S N     +P                 
Sbjct  162   LQSLQYLWLDFNLLQGTLPSALSNCSSIVHLSASGNAIGGVIP-----------------  204

Query  813   gHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESR  634
                +A   L  L  + L +N  +G +   +     L  + + +N F+  +V +  T   R
Sbjct  205   ---AAFGALPNLEVIALDNNNLTGTVPFSLFCNTSLTIVRLGSNAFS--DVVRPETVNCR  259

Query  633   ---LQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLE  463
                LQVLD   N + G  P+ + + ++L  +++  N F G+IP E G         L   
Sbjct  260   STGLQVLDLSENRISGRFPMWLTSIVSLTNLDVSGNVFSGEIPAEIGGLKLVEELKLAN-  318

Query  462   YNYLEGTLPSEFMTGGEKARASLDHNCL  379
              N L G +P E    G      L+ N L
Sbjct  319   -NSLTGEIPVEIKQCGSLGVLDLEGNRL  345



>ref|XP_010068348.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1084

 Score =   120 bits (300),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 99/314 (32%), Positives = 146/314 (46%), Gaps = 32/314 (10%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             ++D+  L SFK++I  +   P   LSSWN     CE     + G+LC   S     R++ 
Sbjct  30    QTDLLALASFKNAIHKD---PFRVLSSWNDSTHHCE-----WQGVLC---SKRHPRRVTS  78

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             + L   GLEGFL+P +GNL+ L  + L  N F G IP  I NL ++  L+LS N F G +
Sbjct  79    LYLRSQGLEGFLSPHVGNLSFLRVIFLQNNSFHGEIPPHIGNLFRLHVLVLSNNSFGGSI  138

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNT  904
             P  + R   LE++++  N+L G I + + +L  L  L LS N L G IP  +  L  L  
Sbjct  139   PSNLSRCLNLEILNLIDNQLVGGIHSNLGSLTRLKGLGLSLNSLVGPIPGSIGNLSLLQK  198

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             L+L+ N     +P                      +SRL+ L    LS N+ +G I   I
Sbjct  199   LSLAENALSGEIP--------------------EELSRLKRLILFQLSSNKLTGEIPTGI  238

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
             + + +++  NV+ N      +    T    L  L    NL  G +   ++    L  + L
Sbjct  239   LNMSDIITFNVNYNQMWGSFLNDVGTTSPSLYFLGVGKNLFTGMISSTLMNATGLGKLYL  298

Query  543   GHNRFFGKIPKEYG  502
              HN F G IPK  G
Sbjct  299   EHNNFHGPIPKNLG  312


 Score = 75.1 bits (183),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 102/216 (47%), Gaps = 21/216 (10%)
 Frame = -3

Query  1155  IPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELT  976
             IP SI  L  + +L LS N F+G +P  +  +  L ++D+S N   G IP +++   +L 
Sbjct  406   IPHSIGALSNLQQLDLSWNMFTGEIPSSIGNITSLGILDLSSNIFRGYIPQSLSNCMQLI  465

Query  975   RLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISA  799
              LDLSNN L G IP ++  L  L+ +   +N   +G  P  V                  
Sbjct  466   GLDLSNNNLIGSIPIEIMDLSSLSIILSLANNNLSGSLPLQV------------------  507

Query  798   ISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLD  619
                L+ L  LDLS NR +G I   I     L R+++ AN F   ++ ++      LQ LD
Sbjct  508   -GSLKNLGILDLSHNRLTGLIPASISMCLVLERLHLEANSFHG-QIPEALRPLRGLQELD  565

Query  618   AHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
                N   G +P  +  +  LK +NL  N+  G++PK
Sbjct  566   LSDNNFSGPIPSFLAGFSLLKYLNLSFNQLEGQVPK  601


 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 129/285 (45%), Gaps = 32/285 (11%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSG--SIPATIT  994
             F G I  +++N   + +L L  N F G +P+ + RL+ L  I ++ N L    S  +++ 
Sbjct  279   FTGMISSTLMNATGLGKLYLEHNNFHGPIPKNLGRLKGLYRISLADNHLQDDLSFISSLV  338

Query  993   ALRELTRLDLSNNELTGKIP----DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllgh  826
                 L  L++S N + G +P    +LS    +  + +S N+    +P             
Sbjct  339   NCSNLENLEISRNLIHGSLPRSFFNLSP--SIERIYMSDNRIQGSIPL------------  384

Query  825   nlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSST  646
                     A+  L  L+ L LS+N  +  I H I  L  L ++++S N FT  E+  S  
Sbjct  385   --------ALGNLFNLSFLRLSNNFLTANIPHSIGALSNLQQLDLSWNMFTG-EIPSSIG  435

Query  645   KESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL  466
               + L +LD  SN+ +G++P ++   + L  ++L +N   G IP E    L SL   L+L
Sbjct  436   NITSLGILDLSSNIFRGYIPQSLSNCMQLIGLDLSNNNLIGSIPIEI-MDLSSLSIILSL  494

Query  465   EYNYLEGTLPSEFMTGGEKARASLDHNCLN--CPDHLPWCLGGQR  337
               N L G+LP +  +        L HN L    P  +  CL  +R
Sbjct  495   ANNNLSGSLPLQVGSLKNLGILDLSHNRLTGLIPASISMCLVLER  539


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 67/128 (52%), Gaps = 0/128 (0%)
 Frame = -3

Query  1245  DGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMR  1066
             + L G L  ++G+L  L  L+L+ N+  G IP SI     + RL L  N F G +P  +R
Sbjct  497   NNLSGSLPLQVGSLKNLGILDLSHNRLTGLIPASISMCLVLERLHLEANSFHGQIPEALR  556

Query  1065  RLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSN  886
              LR L+ +D+S N  SG IP+ +     L  L+LS N+L G++P        +++++  N
Sbjct  557   PLRGLQELDLSDNNFSGPIPSFLAGFSLLKYLNLSFNQLEGQVPKGGVFLNASSISIYGN  616

Query  885   QFFAGLPP  862
                 G  P
Sbjct  617   TELCGGVP  624



>gb|EEC72734.1| hypothetical protein OsI_06350 [Oryza sativa Indica Group]
Length=1031

 Score =   119 bits (299),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 154/307 (50%), Gaps = 29/307 (9%)
 Frame = -3

Query  1254  LEGDGLEGFLTPEIGnlt-elttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLP  1078
             L+G+GL+G L   +GNL  +L  L L +NK  G IP  I NL+ +T L + +N FSG +P
Sbjct  472   LDGNGLKGSLPSSVGNLAPQLDWLWLKQNKLSGTIPAEIGNLKSLTILYMDDNMFSGSIP  531

Query  1077  RYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW-QLNTL  901
             + +  L  L V+  + N LSG IP +I  L +L    L  N L G IP   G W QL  L
Sbjct  532   QTIGNLTNLLVLSFAKNNLSGRIPDSIGNLSQLNEFYLDRNNLNGSIPANIGQWRQLEKL  591

Query  900   ALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIV  721
              LS N F   +P                   IS++S+      LDLS N F+GPIL  I 
Sbjct  592   NLSHNSFSGSMP--------------SEVFKISSLSQ-----NLDLSHNLFTGPILPEIG  632

Query  720   TLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLG  541
              L  L  I+++ N  T  ++  +  K   L+ L    NLL G +P + +   ++K  +L 
Sbjct  633   NLINLGSISIANNRLTG-DIPSTLGKCVLLEYLHMEGNLLTGSIPQSFMNLKSIKEFDLS  691

Query  540   HNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHN---CLNCP  370
              NR  GK+P+     L S  + LNL +N  EGT+PS  +  G  +R  LD N   C N P
Sbjct  692   RNRLSGKVPEFL--TLFSSLQKLNLSFNDFEGTIPSNGVF-GNASRVILDGNYRLCANAP  748

Query  369   DH-LPWC  352
              + LP C
Sbjct  749   GYSLPLC  755


 Score = 84.7 bits (208),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 129/263 (49%), Gaps = 6/263 (2%)
 Frame = -3

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             G+IS ++L  + L G +  E+ + + L  L L  N  +G IP S+     + +++L  N 
Sbjct  126   GQISYLNLSINSLVGRIPDELSSCSNLQVLGLWNNSLQGEIPPSLTQCTHLQQVILYNNK  185

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD-LSGL  919
               G +P     LR+L+ +D+S+N L+G IP  + +      +DL  N+LTG IP+ L+  
Sbjct  186   LEGSIPTGFGTLRELKTLDLSNNALTGEIPPLLGSSPSFVYVDLGGNQLTGGIPEFLANS  245

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTA----LDLSDNR  751
               L  L L  N     +PP      TL   +        +I  +  + A    L L+ N+
Sbjct  246   SSLQVLRLMQNSLTGEIPPALFNSSTLTTIYLNRNNLAGSIPPVTAIAAPIQFLSLTQNK  305

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
              +G I   +  L  L+R++++AN+     + +S +K   L+ L    N L G +P +I  
Sbjct  306   LTGGIPPTLGNLSSLVRLSLAANNLVG-SIPESLSKIPALERLILTYNKLSGPVPESIFN  364

Query  570   YLNLKTVNLGHNRFFGKIPKEYG  502
               +L+ + + +N   G++P++ G
Sbjct  365   MSSLRYLEMANNSLIGRLPQDIG  387


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 84/312 (27%), Positives = 128/312 (41%), Gaps = 60/312 (19%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSI-DPNSVLPASFLSSW-NLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             ++D + L  FK  I DPN  L     SSW N   + C     ++ G+ C   +  +  R+
Sbjct  33    DTDREALLCFKSQISDPNGAL-----SSWTNTSQNFC-----NWQGVSCN--NTQTQLRV  80

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
               +++   GL G + P IG                        NL  I  L LS N F G
Sbjct  81    MALNISSKGLGGSIPPCIG------------------------NLSSIASLDLSSNAFLG  116

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSGLWQL  910
              +P  + RL ++  +++S N L G IP  +++   L  L L NN L G+I P L+    L
Sbjct  117   KVPSELGRLGQISYLNLSINSLVGRIPDELSSCSNLQVLGLWNNSLQGEIPPSLTQCTHL  176

Query  909   NTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILH  730
               + L +N+    +P                    +    LR L  LDLS+N  +G I  
Sbjct  177   QQVILYNNKLEGSIP--------------------TGFGTLRELKTLDLSNNALTGEIPP  216

Query  729   RIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTV  550
              + + P  + +++  N  T   + +     S LQVL    N L G +P  +     L T+
Sbjct  217   LLGSSPSFVYVDLGGNQLTG-GIPEFLANSSSLQVLRLMQNSLTGEIPPALFNSSTLTTI  275

Query  549   NLGHNRFFGKIP  514
              L  N   G IP
Sbjct  276   YLNRNNLAGSIP  287


 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 108/204 (53%), Gaps = 6/204 (3%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             ++++ ++ +   G +   IGNLT L  L+  +N   G IPDSI NL ++    L  N  +
Sbjct  516   LTILYMDDNMFSGSIPQTIGNLTNLLVLSFAKNNLSGRIPDSIGNLSQLNEFYLDRNNLN  575

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTR-LDLSNNELTGKI-PDLSGLW  916
             G +P  + + R+LE +++SHN  SGS+P+ +  +  L++ LDLS+N  TG I P++  L 
Sbjct  576   GSIPANIGQWRQLEKLNLSHNSFSGSMPSEVFKISSLSQNLDLSHNLFTGPILPEIGNLI  635

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISR----LRYLTALDLSDNRF  748
              L ++++++N+    +P    +   L   H        +I +    L+ +   DLS NR 
Sbjct  636   NLGSISIANNRLTGDIPSTLGKCVLLEYLHMEGNLLTGSIPQSFMNLKSIKEFDLSRNRL  695

Query  747   SGPILHRIVTLPELMRINVSANHF  676
             SG +   +     L ++N+S N F
Sbjct  696   SGKVPEFLTLFSSLQKLNLSFNDF  719


 Score = 75.1 bits (183),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 109/254 (43%), Gaps = 34/254 (13%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYM-RRLRKLEVIDVSHNRLSGSIPATIT  994
             K  GP+P+SI N+  +  L ++ N   G LP+ +  RL  L+ + +S  +L+G IPA++ 
Sbjct  353   KLSGPVPESIFNMSSLRYLEMANNSLIGRLPQDIGNRLPNLQSLILSTIQLNGPIPASLA  412

Query  993   ALRELTRLDLSNNELTGKIPDL-----------------SGLW----------QLNTLAL  895
              + +L  + L    LTG +P                   +G W          QL  L L
Sbjct  413   NMTKLEMIYLVATGLTGVVPSFGLLPNLRYLDLAYNHLEAGDWSFLSSLANCTQLKKLLL  472

Query  894   SSNQFFAGLPP-----FPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILH  730
               N     LP       P      L  + L     + I  L+ LT L + DN FSG I  
Sbjct  473   DGNGLKGSLPSSVGNLAPQLDWLWLKQNKLSGTIPAEIGNLKSLTILYMDDNMFSGSIPQ  532

Query  729   RIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTV  550
              I  L  L+ ++ + N+ +   +  S    S+L       N L G +P NI  +  L+ +
Sbjct  533   TIGNLTNLLVLSFAKNNLSG-RIPDSIGNLSQLNEFYLDRNNLNGSIPANIGQWRQLEKL  591

Query  549   NLGHNRFFGKIPKE  508
             NL HN F G +P E
Sbjct  592   NLSHNSFSGSMPSE  605


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 0/109 (0%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             +DL  +   G + PEIGNL  L ++++  N+  G IP ++     +  L +  N  +G +
Sbjct  616   LDLSHNLFTGPILPEIGNLINLGSISIANNRLTGDIPSTLGKCVLLEYLHMEGNLLTGSI  675

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
             P+    L+ ++  D+S NRLSG +P  +T    L +L+LS N+  G IP
Sbjct  676   PQSFMNLKSIKEFDLSRNRLSGKVPEFLTLFSSLQKLNLSFNDFEGTIP  724



>ref|XP_004493629.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Cicer arietinum]
Length=394

 Score =   116 bits (291),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 115/399 (29%), Positives = 183/399 (46%), Gaps = 36/399 (9%)
 Frame = -3

Query  1464  CFLNAKTL---ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMT  1294
             CFL +        D   L+S K ++  + V  ++F SSW+   DPC     +F G+ C  
Sbjct  13    CFLQSAQAILDPIDFLALQSIKRAL--HDVPGSNFFSSWDFTDDPC-----NFAGVYC--  63

Query  1293  PSDNSSGRISVIDLE-----GDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLR  1129
                 +S ++  ++L        GL G +   +G L+ L    +   +  GP+P S+ NL+
Sbjct  64    ----ASDKVIALNLGEPRAGSPGLTGKIDNSVGKLSSLVDFTVTPGRIYGPLPQSLSNLK  119

Query  1128  KITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNEL  949
              +  L +S NF SG +P  + +LR +  ID+S+N+L+GSIP +I  L +L  L L +N L
Sbjct  120   NLKFLGISRNFISGEIPAGLGQLRNIRTIDLSYNQLAGSIPPSIGTLPKLNNLILRHNRL  179

Query  948   TGKIPDLSGLWQLNTLALSSNQFFAGLPPF---PVrlrtlllghnlltgHISAISRLRYL  778
             TG +P  +    LN L L  N     L P    P      L  +         + RL  L
Sbjct  180   TGSVPSFASAQNLNRLDLKHNSLSGSLAPNSLPPSLQYLSLSWNQFTGPLDRVLYRLNRL  239

Query  777   TALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQ  598
               LDLS NRF+G I  ++ + P L+ + +  N             E  +Q +D   N L 
Sbjct  240   NYLDLSLNRFTGSIPPQLFSFP-LINLQLERNQLCG---PVKPFNEVTIQTVDLSYNKLS  295

Query  597   GHLPLNIITYLNLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMT  421
             G +   + +  NL    L +N F G++P  +    L +  + L L++NYL G + +    
Sbjct  296   GEISPLLASVQNLY---LNNNAFTGEVPGSFVERLLAASIQILYLQHNYLTGIVINPTAE  352

Query  420   GGEKARASLDHNCLNCPDHL--PWCLGGQ--RPASQCRR  316
                 +   L +NC+  P  +  P   G Q  RPA +C +
Sbjct  353   IPLSSSLCLQYNCMIPPVQMTCPSKAGYQKIRPARECNQ  391



>emb|CDY36706.1| BnaC02g31270D [Brassica napus]
Length=956

 Score =   119 bits (298),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 99/316 (31%), Positives = 152/316 (48%), Gaps = 33/316 (10%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             +L +D + L SF+  +   S  P S   SW+ +  PC  TG     + C    D    R+
Sbjct  28    SLNTDSEALLSFESQM---SQSPQSLSFSWDPNTSPCNWTG-----VTC----DTRIRRV  75

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             + I+L G GL G ++P IGNL+ LT+L L  N+ RGPIP  I NL ++  L LS N   G
Sbjct  76    ASINLSGHGLTGSISPSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDG  135

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSGLWQL  910
              LP  + +L +L V+D++ N ++G +P  +  L+ LT L+L  N L G I P LS +  L
Sbjct  136   SLPSNLSKLIELRVLDLTSNMITGIVPNQLGDLKNLTILNLGKNLLHGPIPPSLSNISSL  195

Query  909   NTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILH  730
               L+L +N     +P                    + + RL+ L  LDL+ N  SG I  
Sbjct  196   TVLSLGTNSLSGPVP--------------------NELGRLQRLQVLDLTINNLSGTIPP  235

Query  729   RIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTV  550
              I  +  L  + +++N+F     +       +L V +   N   G +P ++ +  N+K +
Sbjct  236   SIYNISSLESLVIASNNFWGQFPSNIGYTLPKLLVFNVCFNKFSGEIPASLYSLTNIKVI  295

Query  549   NLGHNRFFGKIPKEYG  502
                HN   G IP   G
Sbjct  296   RAAHNLLEGTIPSGLG  311


 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 132/264 (50%), Gaps = 31/264 (12%)
 Frame = -3

Query  1281  SSGRISVIDLEGDGLEGFLTPEIGnl-telttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             +S +++ +  +G+ LEG +   IGNL   L+ L +  N+F G IP+SI +L  +T   +S
Sbjct  343   NSSKLNFLAFDGNLLEGVIPVSIGNLPKNLSKLFMGGNRFTGIIPESIGDLTGLTLFNIS  402

Query  1104  ENFFSGGLPR---YMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
             +N  +G +P+    +  L +L  I++SHN+L G IP +    + +  +DLS+N L G IP
Sbjct  403   DNSLTGEIPQDIDSIGDLGELNEINLSHNKLQGRIPPSFENFKNMLSMDLSSNMLNGSIP  462

Query  933   DLSGLWQLNTLA----LSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALD  766
             +  G+  L +L+    LSSN F   +P                      ISRL  L +LD
Sbjct  463   N--GVLNLPSLSAVLNLSSNLFSGPIP--------------------QDISRLESLVSLD  500

Query  765   LSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLP  586
             LS N FSG I   I     L R+N++ N+     +  +  +   L+ LD  SN L G +P
Sbjct  501   LSSNNFSGHIPSSIKDCQSLERLNMAGNNLDG-PIPDALAEVKGLEFLDLSSNQLSGVIP  559

Query  585   LNIITYLNLKTVNLGHNRFFGKIP  514
               +     +K +N+  N   G +P
Sbjct  560   PKLQDLQAMKFLNISFNNLEGWVP  583


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 124/268 (46%), Gaps = 18/268 (7%)
 Frame = -3

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
             PS ++   ++V+ L  + L G +  E+G L  L  L+L  N   G IP SI N+  +  L
Sbjct  187   PSLSNISSLTVLSLGTNSLSGPVPNELGRLQRLQVLDLTINNLSGTIPPSIYNISSLESL  246

Query  1113  LLSENFFSGGLPRYM-RRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI  937
             +++ N F G  P  +   L KL V +V  N+ SG IPA++ +L  +  +  ++N L G I
Sbjct  247   VIASNNFWGQFPSNIGYTLPKLLVFNVCFNKFSGEIPASLYSLTNIKVIRAAHNLLEGTI  306

Query  936   PDLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
             P  SGL  L  L + +  F           + +      L   I + S    L  L    
Sbjct  307   P--SGLGNLPFLEMYNIGF----------NKLVWGKDQNLDSFIKSFSNSSKLNFLAFDG  354

Query  756   NRFSGPILHRIVTLPE-LMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLN  580
             N   G I   I  LP+ L ++ +  N FT I + +S    + L + +   N L G +P +
Sbjct  355   NLLEGVIPVSIGNLPKNLSKLFMGGNRFTGI-IPESIGDLTGLTLFNISDNSLTGEIPQD  413

Query  579   IITYLNL---KTVNLGHNRFFGKIPKEY  505
             I +  +L     +NL HN+  G+IP  +
Sbjct  414   IDSIGDLGELNEINLSHNKLQGRIPPSF  441


 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 87/273 (32%), Positives = 129/273 (47%), Gaps = 19/273 (7%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSI-INLRKITRLLLSENF  1096
             R+ V+DL  + L G + P I N++ L +L +  N F G  P +I   L K+    +  N 
Sbjct  218   RLQVLDLTINNLSGTIPPSIYNISSLESLVIASNNFWGQFPSNIGYTLPKLLVFNVCFNK  277

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELT-GK-------  940
             FSG +P  +  L  ++VI  +HN L G+IP+ +  L  L   ++  N+L  GK       
Sbjct  278   FSGEIPASLYSLTNIKVIRAAHNLLEGTIPSGLGNLPFLEMYNIGFNKLVWGKDQNLDSF  337

Query  939   IPDLSGLWQLNTLALSSNQFFAGLPP----FPVrlrtlllghnlltgHI-SAISRLRYLT  775
             I   S   +LN LA   N     +P      P  L  L +G N  TG I  +I  L  LT
Sbjct  338   IKSFSNSSKLNFLAFDGNLLEGVIPVSIGNLPKNLSKLFMGGNRFTGIIPESIGDLTGLT  397

Query  774   ALDLSDNRFSGPI---LHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNL  604
               ++SDN  +G I   +  I  L EL  IN+S N   +  +  S      +  +D  SN+
Sbjct  398   LFNISDNSLTGEIPQDIDSIGDLGELNEINLSHNKL-QGRIPPSFENFKNMLSMDLSSNM  456

Query  603   LQGHLPLNIITYLNLKTV-NLGHNRFFGKIPKE  508
             L G +P  ++   +L  V NL  N F G IP++
Sbjct  457   LNGSIPNGVLNLPSLSAVLNLSSNLFSGPIPQD  489



>ref|XP_009793939.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=417

 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 126/417 (30%), Positives = 186/417 (45%), Gaps = 81/417 (19%)
 Frame = -3

Query  1434  DVQVLRSFKDSI-DPNSVLPASFLSSWNLDL-DPCEATGTHFLGILCMTPSDNSSGRISV  1261
             D   LR  K+S+ D N   P +F +SWN  + DPC      F GI C T S     R++ 
Sbjct  28    DFSALRDIKNSLTDINPSSPNAFFTSWNFTVSDPCST----FAGISCST-SSFFPRRVTS  82

Query  1260  IDL-----EGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             + L     +  GL G L+P                        SI NL ++T+L+L    
Sbjct  83    LTLGSGLSDSPGLAGTLSP------------------------SIANLSELTQLILCAGI  118

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGL  919
              +G +P  +  L+ L V+ +++NRL+GSIP +I  L  L  LDLS+N+LTG IP  +SGL
Sbjct  119   VTGPIPSQIGTLKNLSVVSLTNNRLTGSIPTSIFTLPNLHTLDLSHNQLTGTIPGSISGL  178

Query  918   WQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
              +L  L + SN+    +P   P  +    L           S    LRYL+   +S NR 
Sbjct  179   TELKVLIIGSNKLNGEIPRLLPAELLHLDLSNNQFSGMLKKSMPLTLRYLS---VSGNRL  235

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPL-----  583
              GP L+ + +L EL+ +++S NHF+      SS   S L  +    N L G +P      
Sbjct  236   WGP-LNVLESLSELVYLDLSMNHFSG--PIPSSLFRSTLSSMFLQRNYLTGGVPQPPLSP  292

Query  582   -NIITYLNLKTVNLGH---------------------NRFFGKIPKEY-Gsrlrslwrnl  472
                + Y +  TV+L H                     NRF G++PKEY  S      + L
Sbjct  293   STAVVYGSGSTVDLSHNLLTGKLTGILAGVETLFLNNNRFTGEVPKEYVESVFNGNTKTL  352

Query  471   nLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCPDHL-----PWCLGGQ--RPASQC  322
              L++NY+ G      +   +     L +NC+  P  +     P   G +  RPA+QC
Sbjct  353   YLQHNYISGFPVESGLLLPDSVALCLSYNCMVPPLPVEFMACPASAGEEVSRPANQC  409



>ref|XP_011033036.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1 
[Populus euphratica]
Length=1033

 Score =   119 bits (298),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 152/298 (51%), Gaps = 16/298 (5%)
 Frame = -3

Query  1383  LPASFLSSWNL-DLDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGDGLEGFLTPEIGn  1207
             +P S  SSWN  D  PC      +LGI C    D+++  +  ++L G  + G L PEIG 
Sbjct  41    VPPSITSSWNASDSTPCS-----WLGIGC----DSTTHSVVSLNLSGYAISGQLGPEIGL  91

Query  1206  ltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHN  1027
             L  L T+ LN + F G IP  + N   +  L LS+N F+G +P   + L+ L+ + +S+N
Sbjct  92    LKHLKTIYLNTSNFSGDIPSQLGNCSLLEHLDLSKNSFTGKIPDGFKYLQNLQYLSLSYN  151

Query  1026  RLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPP----  862
              LSG IP ++T L  L  L L +N L G+IP   S    L+TL LS N F  G P     
Sbjct  152   SLSGEIPESLTRLESLAELFLDHNILEGRIPTGFSDCKNLDTLDLSFNSFSGGFPSDLGN  211

Query  861   FPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSAN  682
             F       ++  +L     S+  +L+ L+ LDLS N+ SG I   +     L  +N+  N
Sbjct  212   FSSLAILAIVNSHLRGAIPSSFGQLKKLSYLDLSQNQLSGRIPPELGDCESLTTLNLYTN  271

Query  681   HFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
                  E+     + S+L+ L+   N L G +P++I    +LK++ + +N   G++P E
Sbjct  272   QLEG-EIPGELGRLSKLENLELFDNRLSGEIPISIWKIASLKSIYVYNNSLSGELPLE  328


 Score = 88.2 bits (217),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 123/253 (49%), Gaps = 27/253 (11%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             ++LE + L G L P+      L  +++++N   GPIP SI N   +T + LS N  +G +
Sbjct  410   LNLEDNNLSGTL-PQFAENPILLYMDISKNNITGPIPPSIGNCSGLTFIRLSMNKLTGSI  468

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW-QLNT  904
             P  +  L  L V+D+S N+L GS+P+ ++   +L   D+  N L G IP     W +L+T
Sbjct  469   PSELGNLINLLVVDLSSNQLEGSLPSQLSRCYKLGEFDVGFNSLNGTIPSSLRNWTRLST  528

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             L LS N F  G+PPF                    +  LR LT L L  N   G I   I
Sbjct  529   LVLSENHFTGGIPPF--------------------LPELRMLTELQLGGNILGGVIPSSI  568

Query  723   VTLPEL-MRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY-LNLKTV  550
              ++  L   +N+S+N F   ++         L+ LD  +N L G L   I+ Y L+   V
Sbjct  569   GSVRSLKYALNLSSNGFVG-KLPPELGNLKMLERLDISNNNLTGTLA--ILDYILSWDKV  625

Query  549   NLGHNRFFGKIPK  511
             N+ +N F G +P+
Sbjct  626   NVSNNHFTGAVPE  638


 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 88/304 (29%), Positives = 138/304 (45%), Gaps = 33/304 (11%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             ++S +DL  + L G + PE+G+   LTTLNL  N+  G IP  +  L K+  L L +N  
Sbjct  238   KLSYLDLSQNQLSGRIPPELGDCESLTTLNLYTNQLEGEIPGELGRLSKLENLELFDNRL  297

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG---  922
             SG +P  + ++  L+ I V +N LSG +P  +T LR+L  + L+ N+  G IP   G   
Sbjct  298   SGEIPISIWKIASLKSIYVYNNSLSGELPLEMTELRQLQNISLAQNQFYGVIPQTLGINS  357

Query  921   --LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
               LW    L    N+F   +PP                 ++    +LR L    +  N+ 
Sbjct  358   SLLW----LDFVGNKFTGEIPP-----------------NLCYGQQLRILV---MGSNQL  393

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
              G I   +   P L R+N+  N+ +         +   L  +D   N + G +P +I   
Sbjct  394   QGSIPSDVGACPTLWRLNLEDNNLS--GTLPQFAENPILLYMDISKNNITGPIPPSIGNC  451

Query  567   LNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDH  388
               L  + L  N+  G IP E G+ +  L  +L+   N LEG+LPS+     +     +  
Sbjct  452   SGLTFIRLSMNKLTGSIPSELGNLINLLVVDLSS--NQLEGSLPSQLSRCYKLGEFDVGF  509

Query  387   NCLN  376
             N LN
Sbjct  510   NSLN  513


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 91/199 (46%), Gaps = 47/199 (24%)
 Frame = -3

Query  1263  VIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
             V+DL  + LEG L  ++    +L   ++  N   G IP S+ N  +++ L+LSEN F+GG
Sbjct  480   VVDLSSNQLEGSLPSQLSRCYKLGEFDVGFNSLNGTIPSSLRNWTRLSTLVLSENHFTGG  539

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNT  904
             +P ++  LR L  + +  N L G IP++I ++R L                         
Sbjct  540   IPPFLPELRMLTELQLGGNILGGVIPSSIGSVRSLKY----------------------A  577

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG--PILH  730
             L LSSN F   LPP                     +  L+ L  LD+S+N  +G   IL 
Sbjct  578   LNLSSNGFVGKLPP--------------------ELGNLKMLERLDISNNNLTGTLAILD  617

Query  729   RIVTLPELMRINVSANHFT  673
              I++     ++NVS NHFT
Sbjct  618   YILSWD---KVNVSNNHFT  633



>ref|XP_009123620.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Brassica 
rapa]
Length=1001

 Score =   119 bits (297),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 98/316 (31%), Positives = 150/316 (47%), Gaps = 33/316 (10%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             +L +D + L SF+  +  N   P S   SW+ +  PC  T     G+ C    D    R+
Sbjct  28    SLNTDREALLSFESQMSQN---PQSLSFSWDPNTSPCNWT-----GVTC----DTRIRRV  75

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             + I+L G GL G ++P IGNL+ LT+L L  N+ RGPIP  I NL ++  L LS N   G
Sbjct  76    TSINLSGHGLTGSISPSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDG  135

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSGLWQL  910
              LP  + +L +L  +D++ N ++G +P  +  L+ LT L+L  N L G I P LS +  L
Sbjct  136   SLPSNLSKLIELRALDLTSNMITGIVPNQLGDLKNLTILNLGKNLLHGPIPPSLSNISSL  195

Query  909   NTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILH  730
               L+L +N     +P                    + + RL+ L  LDL+ N  SG I  
Sbjct  196   TVLSLGTNSLSGPVP--------------------NELGRLQRLQVLDLTINNLSGTIPP  235

Query  729   RIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTV  550
              I  +  L  + +++N+F     +       +L V +   N   G +P ++    N+K +
Sbjct  236   SIYNMSSLESLVIASNNFWGQFPSNIGYTLPKLLVFNVCFNKFSGEIPASLYNLTNIKVI  295

Query  549   NLGHNRFFGKIPKEYG  502
                HN   G IP   G
Sbjct  296   RAAHNLLEGTIPSGLG  311


 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 83/266 (31%), Positives = 142/266 (53%), Gaps = 8/266 (3%)
 Frame = -3

Query  1290  SDNSSGRISVIDLEGDGLEGFLTPEIGnl-telttlnlnrNKFRGPIPDSIINLRKITRL  1114
             S ++S +++ +  +G+ LEG +   IGNL   L+ L +  N+F G IP+SI +L  +T  
Sbjct  340   SFSNSSKLNFLAFDGNLLEGVIPVSIGNLPKNLSKLFMGGNRFTGIIPESIGDLTGLTLF  399

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              +S+N  +G +P+ + +L+ L+V++++ N+L+G IP +I  L  L  ++LS+N+L G+I 
Sbjct  400   NISDNSLTGEIPQDIGKLKGLQVLELARNQLTGRIPDSIGDLGGLNEINLSHNKLQGRIS  459

Query  933   -DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISA-----ISRLRYLTA  772
                     + ++ LSSN     +P   + L +L    NL +   S      ISRL  L +
Sbjct  460   LSFENFKNMLSMDLSSNMLNGSIPNGVLNLPSLSAVLNLSSNLFSGPIPQDISRLESLVS  519

Query  771   LDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGH  592
             LDLS N FSG I   I     L ++N++ N+     +  +  +   L+ LD  SN L G 
Sbjct  520   LDLSSNNFSGHIPSSIKDCQSLEKLNMAGNNLDG-PIPDALAEVKGLEFLDLSSNQLSGV  578

Query  591   LPLNIITYLNLKTVNLGHNRFFGKIP  514
             +P  +     +K +N+  N   G +P
Sbjct  579   IPPRLQDLQAMKFLNISFNNLEGWVP  604


 Score = 79.3 bits (194),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 77/266 (29%), Positives = 125/266 (47%), Gaps = 29/266 (11%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
              +  +DL  + + G +  ++G+L  LT LNL +N   GPIP S+ N+  +T L L  N  
Sbjct  146   ELRALDLTSNMITGIVPNQLGDLKNLTILNLGKNLLHGPIPPSLSNISSLTVLSLGTNSL  205

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG--L  919
             SG +P  + RL++L+V+D++ N LSG+IP +I  +  L  L +++N   G+ P   G  L
Sbjct  206   SGPVPNELGRLQRLQVLDLTINNLSGTIPPSIYNMSSLESLVIASNNFWGQFPSNIGYTL  265

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
              +L    +  N+F   +P                    +++  L  +  +  + N   G 
Sbjct  266   PKLLVFNVCFNKFSGEIP--------------------ASLYNLTNIKVIRAAHNLLEGT  305

Query  738   ILHRIVTLPELMRINVSANHFTR------IEVTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             I   +  LP L   N+  N              KS +  S+L  L    NLL+G +P++I
Sbjct  306   IPSGLGNLPFLEMYNIGFNKLVWGRDQNLDSFIKSFSNSSKLNFLAFDGNLLEGVIPVSI  365

Query  576   ITY-LNLKTVNLGHNRFFGKIPKEYG  502
                  NL  + +G NRF G IP+  G
Sbjct  366   GNLPKNLSKLFMGGNRFTGIIPESIG  391



>ref|XP_006585228.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Glycine max]
Length=1017

 Score =   119 bits (297),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 105/313 (34%), Positives = 161/313 (51%), Gaps = 21/313 (7%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             ++ +D + L SFK  +   ++ P   LSSWN +  PC  TG     +LC    D    R+
Sbjct  35    SITTDREALISFKSQLSNETLSP---LSSWNHNSSPCNWTG-----VLC----DRLGQRV  82

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             + +DL G GL G L+P +GNL+ L +L L  N+FRG IPD I NL  +  L +S N   G
Sbjct  83    TGLDLSGFGLSGHLSPYVGNLSSLQSLQLQNNQFRGVIPDQIGNLLSLKVLNMSSNMLEG  142

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQL  910
              LP  +  L +L+V+D+S N++   IP  I++L++L  L L  N L G IP  L  +  L
Sbjct  143   KLPSNITHLNELQVLDLSSNKIVSKIPEDISSLQKLQALKLGRNSLYGAIPASLGNISSL  202

Query  909   NTLALSSNQFFAGLPPFPVrlrtlllghnlltgHIS-----AISRLRYLTALDLSDNRFS  745
               ++  +N F  G  P  +     L+  +L+  +++     AI  L  L    L+ N F 
Sbjct  203   KNISFGTN-FLTGWIPSELGRLHDLIELDLILNNLNGTVPPAIFNLSSLVNFALASNSFW  261

Query  744   GPILHRIV-TLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             G I   +   LP+L+  N+  N+FT   +  S    + +QV+   SN L+G +P  +   
Sbjct  262   GEIPQDVGHKLPKLIVFNICFNYFTG-GIPGSLHNLTNIQVIRMASNHLEGTVPPGLGNL  320

Query  567   LNLKTVNLGHNRF  529
               LK  N+G+NR 
Sbjct  321   PFLKMYNIGYNRI  333


 Score = 82.0 bits (201),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 79/259 (31%), Positives = 124/259 (48%), Gaps = 24/259 (9%)
 Frame = -3

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             N S  +S + +  +   G +   IG L+ L  LNL+ N   G IP  +  L ++  L L+
Sbjct  373   NLSKDLSTLYMGQNRFNGSIPSSIGRLSGLKLLNLSYNSISGEIPQELGQLEELQELSLA  432

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DL  928
              N  SGG+P  +  L KL ++D+S N+L G IP +   L+ L  +DLS+N+L G IP ++
Sbjct  433   GNEISGGIPSILGNLLKLNLVDLSRNKLVGRIPTSFGNLQNLLYMDLSSNQLNGSIPMEI  492

Query  927   SGLWQL-NTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
               L  L N L LS N F +G  P P                   + RL  + ++D S+N+
Sbjct  493   LNLPTLSNVLNLSMN-FLSG--PIP------------------EVGRLSGVASIDFSNNQ  531

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
                 I         L +++++ N  +   + K+      L+ LD  SN L G +P+ +  
Sbjct  532   LYDGIPSSFSNCLSLEKLSLARNQLSG-PIPKALGDVRGLEALDLSSNQLSGAIPIELQN  590

Query  570   YLNLKTVNLGHNRFFGKIP  514
                LK +NL +N   G IP
Sbjct  591   LQALKLLNLSYNDLEGAIP  609


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 128/287 (45%), Gaps = 30/287 (10%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIIN-LRKITRLLLSENFFSGG  1084
             +DL  + L G + P I NL+ L    L  N F G IP  + + L K+    +  N+F+GG
Sbjct  229   LDLILNNLNGTVPPAIFNLSSLVNFALASNSFWGEIPQDVGHKLPKLIVFNICFNYFTGG  288

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGK-------IPDLS  925
             +P  +  L  ++VI ++ N L G++P  +  L  L   ++  N +          I  L+
Sbjct  289   IPGSLHNLTNIQVIRMASNHLEGTVPPGLGNLPFLKMYNIGYNRIVSSGVRGLDFITSLT  348

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 LN LA+  N     +P                   I  +S  + L+ L +  NRF+
Sbjct  349   NSTHLNFLAIDGNMLEGVIPE-----------------TIGNLS--KDLSTLYMGQNRFN  389

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G I   I  L  L  +N+S N  +  E+ +   +   LQ L    N + G +P  +   L
Sbjct  390   GSIPSSIGRLSGLKLLNLSYNSISG-EIPQELGQLEELQELSLAGNEISGGIPSILGNLL  448

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFM  424
              L  V+L  N+  G+IP  +G+    L+ +L+   N L G++P E +
Sbjct  449   KLNLVDLSRNKLVGRIPTSFGNLQNLLYMDLSS--NQLNGSIPMEIL  493


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 88/160 (55%), Gaps = 11/160 (7%)
 Frame = -3

Query  1383  LPASFLSSWNL---DLDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGDGLEGFLTPEI  1213
             +P SF +  NL   DL   +  G+  + IL +    N      V++L  + L G + PE+
Sbjct  464   IPTSFGNLQNLLYMDLSSNQLNGSIPMEILNLPTLSN------VLNLSMNFLSGPI-PEV  516

Query  1212  GnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVS  1033
             G L+ + +++ + N+    IP S  N   + +L L+ N  SG +P+ +  +R LE +D+S
Sbjct  517   GRLSGVASIDFSNNQLYDGIPSSFSNCLSLEKLSLARNQLSGPIPKALGDVRGLEALDLS  576

Query  1032  HNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
              N+LSG+IP  +  L+ L  L+LS N+L G IP   G++Q
Sbjct  577   SNQLSGAIPIELQNLQALKLLNLSYNDLEGAIPS-GGVFQ  615



>emb|CDP07983.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 96/314 (31%), Positives = 151/314 (48%), Gaps = 37/314 (12%)
 Frame = -3

Query  1449  KTLESDVQVLRSFKDSI-DPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSG  1273
              TL+ D+  L +FK +I DP ++LP +    W+     C     +++GI C T       
Sbjct  31    NTLDHDLDTLLAFKSTISDPQNILPIN----WSTSTSVC-----YWIGISCNTRHR----  77

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R++ I L   GL G + P++GN++ L  L+L  N F G +P  +++LR++  + L+ N F
Sbjct  78    RVAAIQLPKMGLVGTIPPQLGNVSFLVWLDLENNSFHGNLPTQMVHLRRLKHINLAFNSF  137

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLW  916
              GG P ++  L +L  +    NR+SGS+P T++    L    L  N + GK+P + S L 
Sbjct  138   DGGFPSWLEALSRLRYVSFCSNRISGSLPPTLSNATMLETFRLDENLIIGKLPQEWSALQ  197

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPI  736
              L +L + SN+    LPP                    ++  L  L     ++N  SG +
Sbjct  198   NLESLGMQSNKLEGPLPP--------------------SLFNLSSLQHFSFTNNSLSGYL  237

Query  735   LHRIV-TLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
               RI   LP+L  + +S N F+  EV        RLQ+L    N L G++P  I     L
Sbjct  238   PARICDYLPQLQGLYLSRNEFSG-EVPAGIGGCPRLQILSLSYNNLAGNIPKGIWNLTTL  296

Query  558   KTVNLGHNRFFGKI  517
             +T+ LG N   G I
Sbjct  297   RTLVLGGNDIQGTI  310



>gb|KFK30898.1| hypothetical protein AALP_AA6G040400 [Arabis alpina]
Length=395

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 120/388 (31%), Positives = 189/388 (49%), Gaps = 32/388 (8%)
 Frame = -3

Query  1434  DVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLG--ILCMTPSDNSSGRIS  1264
             D   L++ + S+D    LP S F  SW+   DPC  +G +  G  ++ +   D+ +G   
Sbjct  28    DFLALQAIRKSLDD---LPGSNFFDSWDFTADPCTFSGVYCDGDKVIALNLGDSRAG---  81

Query  1263  VIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
                    GL G + P IG L+ LT L++   +  G +P++I + + +  L +S NF SG 
Sbjct  82    -----SPGLSGRIDPAIGKLSSLTELSIVPGRIMGSLPNTISHSKNLRFLAISRNFISGK  136

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNT  904
             +P  +  LR+L  +D+S+N+L+GSIP +I +L ELT L L +N   G IP       L  
Sbjct  137   IPTSLGELRRLRTLDLSYNQLTGSIPISIGSLPELTNLILCHNHFNGTIPRFET-QSLTR  195

Query  903   LALSSNQFFAGLPP--FPVrlrtlllghnlltgHIS-AISRLRYLTALDLSDNRFSGPIL  733
             + L  N     + P  FPV L+ L L  N LTG ++  + RL  L+ LDLS NRF+G I 
Sbjct  196   IDLKRNNLTGVISPVTFPVSLQYLSLAWNQLTGPVNRVLIRLNQLSYLDLSLNRFTGVIP  255

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHL-PLNIITYLNLK  556
              ++   P +  + +  N+F  +        +  +  +D   N   G + PL      N++
Sbjct  256   GQVFGFP-ITNLQLQRNYFYGL---VQPANQVTIPTVDLSYNRFTGEISPL----LSNVQ  307

Query  555   TVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
              + L +NRF G++P  +    L S  + L L++N+L G   S        +   L +NC+
Sbjct  308   NLYLNNNRFTGRVPVSFVDRLLSSSIQTLYLQHNFLTGIEISPAANIPVSSSLCLQYNCM  367

Query  378   NCPDHLPWCL--GGQ--RPASQCRRSAG  307
               P   P  +  G Q  RP  QC    G
Sbjct  368   VPPVQTPCPVKAGSQITRPTIQCMEWRG  395



>ref|XP_010941739.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Elaeis guineensis]
Length=395

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 179/389 (46%), Gaps = 34/389 (9%)
 Frame = -3

Query  1434  DVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVI  1258
             D   L+S + S+   S LP S F + W+   DPC      F G+ C      S  R+  +
Sbjct  28    DYLALQSIRKSL---SDLPGSTFFAGWDFTGDPCS-----FPGVFC------SGDRVVAL  73

Query  1257  DLEGD------GLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
              L GD      GL G L+P +G LT LT L+L   +  GPIP S+   R +  L LS NF
Sbjct  74    AL-GDPRAGSPGLAGRLSPALGRLTALTELSLVPGRVAGPIPTSLSLCRSLRFLALSRNF  132

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW  916
              SG +P  +  L +L  +D+S N LSG+IP  + A+ +L+ L L +N L G+IP      
Sbjct  133   LSGAVPPSLASLHRLRTLDLSFNLLSGTIPPAVAAIPDLSNLILCHNRLAGQIPPFPSSS  192

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHIS-AISRLRYLTALDLSDNRFSGP  739
              L  L L  N     +P  P  LR L L  N L+G +   + RL  L  LDLS N+ SG 
Sbjct  193   PLLRLDLKRNSLSGEIPALPASLRYLSLSSNRLSGPVDRVLPRLTRLNYLDLSMNQLSGQ  252

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
             I  +I + P +  + +  N F+ +     S        +D   N L G +P  +     L
Sbjct  253   IPGQIFSFP-VSSLQLQRNDFSGLVRPVGSPAAG--ATVDLSYNQLTGQVPEALAAAGRL  309

Query  558   KTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
                 L +NRF G++P  +    +    + L L++NYL     S   T        L +NC
Sbjct  310   Y---LNNNRFSGEVPARFVERVVGGAIKVLYLQHNYLTAFGISPAATIPASTSLCLQYNC  366

Query  381   LNCPDHLPWCLGG----QRPASQCRRSAG  307
             +  P   P  +       RPA+QC   +G
Sbjct  367   MVPPVETPCPVKAGRQKTRPAAQCGWRSG  395



>gb|EMT19068.1| LRR receptor-like serine/threonine-protein kinase FLS2 [Aegilops 
tauschii]
Length=481

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 110/394 (28%), Positives = 176/394 (45%), Gaps = 62/394 (16%)
 Frame = -3

Query  1431  VQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGT----HFLGILCMTPSDNSSGRIS  1264
             ++ L +FK ++  +   P   LS W +        G     ++ G+ C     + +GR++
Sbjct  32    LEALLAFKKAVTAD---PLGALSGWTVGAGDAVRGGVPRHCNWTGVAC-----DGAGRVT  83

Query  1263  VIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
              I L    L+G LTP +GN++ L  L+L  N F G IP  +  L ++ +L+L+EN F+GG
Sbjct  84    SIQLLQTQLQGALTPFLGNISTLQLLDLTENAFTGGIPPQLGRLGELQQLILAENGFAGG  143

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG------  922
             +P+ +  L  L+++D+ +N LSG IP+++     +  L L  N LTG+IP   G      
Sbjct  144   IPQELGDLGSLQLLDLGNNSLSGGIPSSLCNCSAMWALGLDTNNLTGQIPSCIGDLDKLQ  203

Query  921   -------------------LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISA  799
                                L Q+ +L LS+N+    +PP                     
Sbjct  204   IFEAFMTNLDGELPPSFAKLTQMKSLDLSANKLSGSIPP--------------------E  243

Query  798   ISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLD  619
             I    +L  L L +NRFSGPI   +     L R+N+ +N FT   + +   +   L+ L 
Sbjct  244   IGNFSHLWILQLVENRFSGPIPSELGRCKNLTRLNIYSNRFTG-AIPRELGELVNLEELR  302

Query  618   AHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTL  439
              + N L   +P ++     L ++ L  NR  G IP E G       + L L  N L GT+
Sbjct  303   LYDNALSSEIPSSLGRCTKLVSLGLSKNRLTGSIPPELG--ELRSLQTLTLHDNRLTGTV  360

Query  438   PSEFMTGGEKARASLDHNCLNCPDHLPWCLGGQR  337
             P+           SL +N L+    LP  +G  R
Sbjct  361   PTSLTNLVNLTYLSLSNNSLS--GRLPENIGALR  392


 Score = 96.7 bits (239),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 125/265 (47%), Gaps = 22/265 (8%)
 Frame = -3

Query  1299  MTPSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKIT  1120
             + PS     ++  +DL  + L G + PEIGN + L  L L  N+F GPIP  +   + +T
Sbjct  216   LPPSFAKLTQMKSLDLSANKLSGSIPPEIGNFSHLWILQLVENRFSGPIPSELGRCKNLT  275

Query  1119  RLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGK  940
             RL +  N F+G +PR +  L  LE + +  N LS  IP+++    +L  L LS N LTG 
Sbjct  276   RLNIYSNRFTGAIPRELGELVNLEELRLYDNALSSEIPSSLGRCTKLVSLGLSKNRLTGS  335

Query  939   IP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDL  763
             IP +L  L  L TL L  N+    +P                    ++++ L  LT L L
Sbjct  336   IPPELGELRSLQTLTLHDNRLTGTVP--------------------TSLTNLVNLTYLSL  375

Query  762   SDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPL  583
             S+N  SG +   I  L  L ++ + +N  +   +  S    + L      SN L GHLP 
Sbjct  376   SNNSLSGRLPENIGALRNLRKLIIHSNSLSG-PIPVSIANCTLLSNASMSSNELTGHLPA  434

Query  582   NIITYLNLKTVNLGHNRFFGKIPKE  508
              +     L   ++G+N   G IPK+
Sbjct  435   GLGQLQGLVFFSVGNNSLNGSIPKD  459



>gb|KHN48112.1| LRR receptor-like serine/threonine-protein kinase EFR [Glycine 
soja]
Length=1017

 Score =   118 bits (295),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 105/313 (34%), Positives = 161/313 (51%), Gaps = 21/313 (7%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             ++ +D + L SFK  +   ++ P   LSSWN +  PC  TG     +LC    D    R+
Sbjct  35    SITTDREALISFKSQLSNENLSP---LSSWNHNSSPCNWTG-----VLC----DRLGQRV  82

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             + +DL G GL G L+P +GNL+ L +L L  N+FRG IPD I NL  +  L +S N   G
Sbjct  83    TGLDLSGFGLSGHLSPYVGNLSSLQSLQLQNNQFRGVIPDQIGNLLSLKVLNMSYNMLEG  142

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQL  910
              LP  +  L +L+V+D+S N++   IP  I++L++L  L L  N L G IP  L  +  L
Sbjct  143   KLPSNITHLNELQVLDLSSNKIVSKIPEDISSLQKLQALKLGRNSLYGAIPASLGNISSL  202

Query  909   NTLALSSNQFFAGLPPFPVrlrtlllghnlltgHIS-----AISRLRYLTALDLSDNRFS  745
               ++  +N F  G  P  +     L+  +L+  +++     AI  L  L    L+ N F 
Sbjct  203   KNISFGTN-FLTGWIPSELGRLHDLIELDLILNNLNGTVPPAIFNLSSLVNFALASNSFW  261

Query  744   GPILHRIV-TLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             G I   +   LP+L+  N+  N+FT   +  S    + +QV+   SN L+G +P  +   
Sbjct  262   GEIPQDVGHKLPKLIVFNICFNYFTG-GIPGSLHNLTNIQVIRMASNHLEGTVPPGLGNL  320

Query  567   LNLKTVNLGHNRF  529
               LK  N+G+NR 
Sbjct  321   PFLKMYNIGYNRI  333


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 79/259 (31%), Positives = 123/259 (47%), Gaps = 24/259 (9%)
 Frame = -3

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             N S  +S + +  +   G +   IG L+ L  LNL+ N   G IP  +  L ++  L L+
Sbjct  373   NLSKDLSTLYMGQNRFNGSIPSSIGRLSGLKLLNLSYNSISGEIPQELGQLEELQELSLA  432

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DL  928
              N  SGG+P  +  L KL ++D+S N+L G IP +   L+ L  +DLS+N+L G IP ++
Sbjct  433   GNEISGGIPSILGNLLKLNLVDLSRNKLVGRIPTSFGNLQNLLYMDLSSNQLNGSIPMEI  492

Query  927   SGLWQL-NTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
               L  L N L LS N F +G  P P                   + RL  + ++D S+N+
Sbjct  493   LNLPTLSNVLNLSMN-FLSG--PIP------------------EVGRLSGVASIDFSNNQ  531

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
                 I         L +++++ N  +   + K       L+ LD  SN L G +P+ +  
Sbjct  532   LYDGIPSSFSNCLSLEKLSLARNQLSG-PIPKVLGDVRGLEALDLSSNQLSGAIPIELQN  590

Query  570   YLNLKTVNLGHNRFFGKIP  514
                LK +NL +N   G IP
Sbjct  591   LQALKLLNLSYNDLEGAIP  609


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 128/287 (45%), Gaps = 30/287 (10%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIIN-LRKITRLLLSENFFSGG  1084
             +DL  + L G + P I NL+ L    L  N F G IP  + + L K+    +  N+F+GG
Sbjct  229   LDLILNNLNGTVPPAIFNLSSLVNFALASNSFWGEIPQDVGHKLPKLIVFNICFNYFTGG  288

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGK-------IPDLS  925
             +P  +  L  ++VI ++ N L G++P  +  L  L   ++  N +          I  L+
Sbjct  289   IPGSLHNLTNIQVIRMASNHLEGTVPPGLGNLPFLKMYNIGYNRIVSSGVRGLNFITSLT  348

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 LN LA+  N     +P                   I  +S  + L+ L +  NRF+
Sbjct  349   NSTHLNFLAIDGNMLEGVIPE-----------------TIGNLS--KDLSTLYMGQNRFN  389

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G I   I  L  L  +N+S N  +  E+ +   +   LQ L    N + G +P  +   L
Sbjct  390   GSIPSSIGRLSGLKLLNLSYNSISG-EIPQELGQLEELQELSLAGNEISGGIPSILGNLL  448

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFM  424
              L  V+L  N+  G+IP  +G+    L+ +L+   N L G++P E +
Sbjct  449   KLNLVDLSRNKLVGRIPTSFGNLQNLLYMDLSS--NQLNGSIPMEIL  493


 Score = 62.0 bits (149),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 88/160 (55%), Gaps = 11/160 (7%)
 Frame = -3

Query  1383  LPASFLSSWNL---DLDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGDGLEGFLTPEI  1213
             +P SF +  NL   DL   +  G+  + IL +    N      V++L  + L G + PE+
Sbjct  464   IPTSFGNLQNLLYMDLSSNQLNGSIPMEILNLPTLSN------VLNLSMNFLSGPI-PEV  516

Query  1212  GnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVS  1033
             G L+ + +++ + N+    IP S  N   + +L L+ N  SG +P+ +  +R LE +D+S
Sbjct  517   GRLSGVASIDFSNNQLYDGIPSSFSNCLSLEKLSLARNQLSGPIPKVLGDVRGLEALDLS  576

Query  1032  HNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
              N+LSG+IP  +  L+ L  L+LS N+L G IP   G++Q
Sbjct  577   SNQLSGAIPIELQNLQALKLLNLSYNDLEGAIPS-GGVFQ  615



>ref|XP_009396739.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Musa acuminata subsp. malaccensis]
Length=388

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 145/309 (47%), Gaps = 60/309 (19%)
 Frame = -3

Query  1425  VLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVIDLEG  1246
              L S +D +DP +VL     SSW  D D C+     + G+ C  P     GR++V+DL  
Sbjct  32    ALLSVRDRLDPFNVL-----SSWGGDDDYCQ-----WRGVSCDGP-----GRVTVLDLSE  76

Query  1245  DGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMR  1066
              GL G ++P IGNLT L  LNL+ N  +G +P    NL  +  LLL  N  +G +P  M 
Sbjct  77    LGLSGSISPAIGNLTNLQFLNLSHNHLQGKLPPEFSNLVYLESLLLGSNRLTGEIPAKMG  136

Query  1065  RLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNTLALSS  889
              L KL ++ +  N L+G IP ++  L  LT LDL  N LTG +P  L+ L  L  L+++ 
Sbjct  137   ALHKLVILSLHDNNLAGRIPPSLGDLSSLTHLDLGENRLTGTLPSSLASLPALQHLSVTR  196

Query  888   NQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPE  709
             N     +P                    ++I  L  LT L L  N+FSG       + P 
Sbjct  197   NNLTGAIP--------------------TSIFHLSTLTHLYLGHNQFSG-------SFPS  229

Query  708   LMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRF  529
              M   +                   LQVL A++N  +GHLP ++     L+ + L HNRF
Sbjct  230   DMGDTL-----------------GHLQVLQANNNNFEGHLPASLPHAGMLREIVLAHNRF  272

Query  528   FGKIPKEYG  502
              G +P + G
Sbjct  273   SGPVPGDIG  281



>ref|XP_009404704.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase IMK2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 118/363 (33%), Positives = 171/363 (47%), Gaps = 29/363 (8%)
 Frame = -3

Query  1377  ASFLSSWNLDLDPCEATGTHFLG--ILCMTPSDNSSGRISVIDLEGDGLEGFLTPEIGnl  1204
             + F S+W+   DPC   G    G  ++ +   D  +G          GL+G L P +G L
Sbjct  53    SDFFSAWDFTDDPCGFPGVFCAGDRVVALALGDPRAG--------SPGLQGRLDPALGRL  104

Query  1203  telttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNR  1024
             + L  L+L   +  GPIPD++     +  L LS+N  SG LP      R+L  +D+S+N+
Sbjct  105   SALAELSLVPGRVTGPIPDALARCSGLRFLALSKNLLSGPLPAGFGSFRRLRTLDLSYNQ  164

Query  1023  LSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPPFPVrlr  844
             LSG +P  +TA   L+ + L +N+L+G IP       L  L L  NQ    +PP P  L+
Sbjct  165   LSGPVPPALTAASALSNIILCHNQLSGPIPRFPRSAALLRLDLKHNQLSGHIPPLPSSLQ  224

Query  843   tlllghnlltgHISAI-SRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRI  667
              L LG N LTG + A+  RL  L  LDLS N   GPI   +  L  L  + +  N F+  
Sbjct  225   YLALGSNALTGSVDAVLPRLTRLNFLDLSSNLLEGPIPGCVFRL-RLEALQLQRNAFSGR  283

Query  666   EVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrs  487
              V +       + V+D   N L G +P  +     +  + L +NRF G++P     RL +
Sbjct  284   VVPQGDVV---IPVVDLSYNRLWGSVPPQLA---GVDRLYLNNNRFTGEVPSRLVQRLSN  337

Query  486   lwrnlnLEYNYLEGTLPSEF----MTGGEKARASLDHNCLNCPDHLPWCL--GGQ--RPA  331
               + L L++N+L G    EF          A   L +NC+  P   P  L  G Q  RP 
Sbjct  338   GMQLLYLQHNFLTGI---EFGPAAAAIPVGAALCLQYNCMVPPFDTPCPLKAGTQKMRPV  394

Query  330   SQC  322
              QC
Sbjct  395   DQC  397



>ref|XP_009146238.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Brassica rapa]
Length=1125

 Score =   117 bits (294),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 101/307 (33%), Positives = 160/307 (52%), Gaps = 17/307 (6%)
 Frame = -3

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             G + V+DLEG+ L G +   +G +  L  L+L RN F G +P S++NL+++ RL L EN 
Sbjct  379   GSLGVLDLEGNRLTGLVPEFLGYMKALKVLSLGRNSFSGYVPLSMVNLQQLDRLNLGEND  438

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG-L  919
              +G  P  +  L  L  +D+S NR +G +P +I+ L  L+ L+LS NE +G+IP   G L
Sbjct  439   LNGSFPVELMALTNLSELDLSGNRFTGEVPVSISNLSNLSFLNLSGNEFSGEIPASVGNL  498

Query  918   WQLNTLALSSNQF-------FAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLS  760
             ++L +L LS            +GLP   V        + ++    S++  LRY   ++LS
Sbjct  499   FKLTSLDLSKQNMSGEVPVELSGLPNLQVIALQENNFYGVVPEGFSSLVSLRY---VNLS  555

Query  759   DNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLN  580
              N FSG I      L  L  +++S NH +   +       S L+VL+  SN L G++P++
Sbjct  556   SNSFSGEIPQTFGFLRVLGSLSLSDNHISG-SIPPEVGNCSALEVLELRSNRLTGNIPVD  614

Query  579   IITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARA  400
             +     LK ++LG N   G+IP      + S   +L+L++N+L G +P  F      +R 
Sbjct  615   LSRLSRLKVLDLGRNNLSGEIPP-----MSSSLESLSLDHNHLSGVIPESFSRLSNLSRL  669

Query  399   SLDHNCL  379
              L  N L
Sbjct  670   DLSVNNL  676


 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 97/331 (29%), Positives = 152/331 (46%), Gaps = 22/331 (7%)
 Frame = -3

Query  1386  VLPASFLSSWNLD---LDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGDGLEGFLTPE  1216
             V+PA+F +  NL+   LD    TGT    + C T        ++++ L  +     + PE
Sbjct  248   VIPAAFGALPNLEVIALDNNNLTGTVPFSLFCNT-------SLTIVRLGSNAFSDVVRPE  300

Query  1215  IGnltelttlnlnrNKFR--GPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVI  1042
               N        L+ ++ R  G  P  + ++  +T L +S N FSG +P  +  L+ LE +
Sbjct  301   TVNCRSTGLQVLDLSENRISGRFPMWLTSIVSLTNLDVSGNVFSGEIPAEIGGLKLLEEL  360

Query  1041  DVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ-LNTLALSSNQFFAGLP  865
              +++N L+G IP  I     L  LDL  N LTG +P+  G  + L  L+L  N  F+G  
Sbjct  361   KLANNSLTGEIPVEIKQCGSLGVLDLEGNRLTGLVPEFLGYMKALKVLSLGRNS-FSGYV  419

Query  864   PFPVrlrtlllghnlltgHISA-----ISRLRYLTALDLSDNRFSGPILHRIVTLPELMR  700
             P  +     L   NL    ++      +  L  L+ LDLS NRF+G +   I  L  L  
Sbjct  420   PLSMVNLQQLDRLNLGENDLNGSFPVELMALTNLSELDLSGNRFTGEVPVSISNLSNLSF  479

Query  699   INVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGK  520
             +N+S N F+  E+  S     +L  LD     + G +P+ +    NL+ + L  N F+G 
Sbjct  480   LNLSGNEFSG-EIPASVGNLFKLTSLDLSKQNMSGEVPVELSGLPNLQVIALQENNFYGV  538

Query  519   IPKEYGsrlrslwrnlnLEYNYLEGTLPSEF  427
             +P+  G       R +NL  N   G +P  F
Sbjct  539   VPE--GFSSLVSLRYVNLSSNSFSGEIPQTF  567


 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 106/204 (52%), Gaps = 7/204 (3%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             +++ +DL    + G +  E+  L  L  + L  N F G +P+   +L  +  + LS N F
Sbjct  500   KLTSLDLSKQNMSGEVPVELSGLPNLQVIALQENNFYGVVPEGFSSLVSLRYVNLSSNSF  559

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLW  916
             SG +P+    LR L  + +S N +SGSIP  +     L  L+L +N LTG IP DLS L 
Sbjct  560   SGEIPQTFGFLRVLGSLSLSDNHISGSIPPEVGNCSALEVLELRSNRLTGNIPVDLSRLS  619

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFSGP  739
             +L  L L  N     +PP    L +L L HN L+G I  + SRL  L+ LDLS N  +G 
Sbjct  620   RLKVLDLGRNNLSGEIPPMSSSLESLSLDHNHLSGVIPESFSRLSNLSRLDLSVNNLTGE  679

Query  738   I---LHRIVTLPELMRINVSANHF  676
             I   L  I T   L+  NVS+N+ 
Sbjct  680   IPSTLSLIAT--NLVYFNVSSNNL  701


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 100/409 (24%), Positives = 159/409 (39%), Gaps = 89/409 (22%)
 Frame = -3

Query  1452  AKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATG-THFLGILCMTPSDNSS  1276
             A   +S++  L +FK ++      P   L+SW    DP   +    + G+ C      ++
Sbjct  21    ADDTQSEIDALTAFKLNLHD----PLGALTSW----DPSTPSAPCDWRGVFC------TN  66

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
              R++ I L    L G ++  I +L  L  L+L  N F G IP S+    ++  + L  N 
Sbjct  67    RRVTEIRLPRLQLSGRISDRISDLRMLRKLSLRSNSFNGTIPPSLAYCTRLLSVFLQYNS  126

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLS----------------------------------  1018
              +G LP  M+ L +LEV +V+ NRLS                                  
Sbjct  127   LTGKLPPGMKNLTELEVFNVAGNRLSGEISGPLPLSLKFLDVSSNVFSGQIPSGLANLTQ  186

Query  1017  ------------GSIPATITALRELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQFF  877
                         G+IPA++  L+ L  L L  N L G +P  LS    +  L+ S N   
Sbjct  187   LQLLNLSYNQLNGAIPASLGKLQSLQYLWLDFNLLQGTLPSALSNCSSIVHLSASGNAIG  246

Query  876   AGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRI  697
               +P                    +A   L  L  + L +N  +G +   +     L  +
Sbjct  247   GVIP--------------------AAFGALPNLEVIALDNNNLTGTVPFSLFCNTSLTIV  286

Query  696   NVSANHFTRIEVTKSSTKESR---LQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFF  526
              + +N F+  +V +  T   R   LQVLD   N + G  P+ + + ++L  +++  N F 
Sbjct  287   RLGSNAFS--DVVRPETVNCRSTGLQVLDLSENRISGRFPMWLTSIVSLTNLDVSGNVFS  344

Query  525   GKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
             G+IP E G         L    N L G +P E    G      L+ N L
Sbjct  345   GEIPAEIGGLKLLEELKLAN--NSLTGEIPVEIKQCGSLGVLDLEGNRL  391


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 57/123 (46%), Gaps = 23/123 (19%)
 Frame = -3

Query  1161  GPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVS-----------------  1033
             G IP  + N   +  L L  N  +G +P  + RL +L+V+D+                  
Sbjct  585   GSIPPEVGNCSALEVLELRSNRLTGNIPVDLSRLSRLKVLDLGRNNLSGEIPPMSSSLES  644

Query  1032  ----HNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLA--LSSNQFFAG  871
                 HN LSG IP + + L  L+RLDLS N LTG+IP    L   N +   +SSN     
Sbjct  645   LSLDHNHLSGVIPESFSRLSNLSRLDLSVNNLTGEIPSTLSLIATNLVYFNVSSNNLKGE  704

Query  870   LPP  862
             +PP
Sbjct  705   IPP  707



>ref|XP_004298715.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460-like [Fragaria vesca subsp. vesca]
Length=885

 Score =   117 bits (293),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 152/318 (48%), Gaps = 19/318 (6%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVI  1258
             ++ ++L  FK ++  +   P + L SW L  +PC+     F G+LC     N+ G +  I
Sbjct  30    TEKEILLQFKGNVTSD---PYNSLGSWVLSGNPCQ----DFSGVLC-----NADGFVDKI  77

Query  1257  DLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLP  1078
              L    + G L+P +  L  L  L L  NKF G +P    +++ + ++ +S N  SG +P
Sbjct  78    VLWNTSIGGVLSPALAGLKSLRVLTLFGNKFVGNLPQEYSDIQTLWKINVSSNALSGFIP  137

Query  1077  RYMRRLRKLEVIDVSHNRLSGSIPATITALRELTR-LDLSNNELTGKIPD-LSGLWQLNT  904
              ++  L  + ++D+S N  +G IP+ +      T+ + LS+N L G IP+ L+    L  
Sbjct  138   EFIGDLPNIRLLDLSRNGFTGEIPSALFKYCNKTKFISLSHNSLLGSIPESLTNCLNLEG  197

Query  903   LALSSNQFFAGLP----PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPI  736
                SSN    G+P      P      +  + L    +  +S  + L  LDL  N F+G  
Sbjct  198   FDFSSNNLSGGIPLGTCDIPRLDYVSVRSNVLSGSVVQQLSACKSLKLLDLGSNMFTGAA  257

Query  735   LHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLK  556
                IV L  L   NVS N F   E+ + +     +Q  DA  N L+G +PL+I    +LK
Sbjct  258   PFGIVGLSNLSYFNVSHNEFNG-EIPEITACSETMQYFDASWNELEGEVPLSIKNCRSLK  316

Query  555   TVNLGHNRFFGKIPKEYG  502
              + LG NR  G IP+  G
Sbjct  317   VLELGFNRLSGSIPEVLG  334


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 104/223 (47%), Gaps = 6/223 (3%)
 Frame = -3

Query  1161  GPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRE  982
             G IP+S+ N   +     S N  SGG+P     + +L+ + V  N LSGS+   ++A + 
Sbjct  183   GSIPESLTNCLNLEGFDFSSNNLSGGIPLGTCDIPRLDYVSVRSNVLSGSVVQQLSACKS  242

Query  981   LTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI  805
             L  LDL +N  TG  P  + GL  L+   +S N+F   +P       T+           
Sbjct  243   LKLLDLGSNMFTGAAPFGIVGLSNLSYFNVSHNEFNGEIPEITACSETMQYFDASWNELE  302

Query  804   S----AISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKES  637
                  +I   R L  L+L  NR SG I   +  L  L+ I +  N  +   + K+ T   
Sbjct  303   GEVPLSIKNCRSLKVLELGFNRLSGSIPEVLGDLDRLLVIQLCNNSLSGT-IPKTLTNIQ  361

Query  636   RLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
              LQVLD H+  L G +P +I   + L+ +++  N   G+IP++
Sbjct  362   LLQVLDLHNLNLVGEIPNDISNCMFLRQLDVSGNGLRGEIPQK  404


 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/258 (26%), Positives = 113/258 (44%), Gaps = 22/258 (9%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R+  + +  + L G +  ++     L  L+L  N F G  P  I+ L  ++   +S N F
Sbjct  218   RLDYVSVRSNVLSGSVVQQLSACKSLKLLDLGSNMFTGAAPFGIVGLSNLSYFNVSHNEF  277

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG-LW  916
             +G +P        ++  D S N L G +P +I   R L  L+L  N L+G IP++ G L 
Sbjct  278   NGEIPEITACSETMQYFDASWNELEGEVPLSIKNCRSLKVLELGFNRLSGSIPEVLGDLD  337

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPI  736
             +L  + L +N     +P                      ++ ++ L  LDL +    G I
Sbjct  338   RLLVIQLCNNSLSGTIP--------------------KTLTNIQLLQVLDLHNLNLVGEI  377

Query  735   LHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLK  556
              + I     L +++VS N   R E+ +     + L++LD H N L G +P ++     L+
Sbjct  378   PNDISNCMFLRQLDVSGNGL-RGEIPQKLYNMTYLEILDLHKNQLNGSIPPDLGNLSRLQ  436

Query  555   TVNLGHNRFFGKIPKEYG  502
              ++L  N   G IP   G
Sbjct  437   FLDLSQNLLSGLIPSSLG  454


 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 94/220 (43%), Gaps = 46/220 (21%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             +  G +P SI N R +  L L  N  SG +P  +  L +L VI + +N LSG+IP T+T 
Sbjct  300   ELEGEVPLSIKNCRSLKVLELGFNRLSGSIPEVLGDLDRLLVIQLCNNSLSGTIPKTLTN  359

Query  990   LRELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnllt  814
             ++ L  LDL N  L G+IP D+S    L  L +S N     +P                 
Sbjct  360   IQLLQVLDLHNLNLVGEIPNDISNCMFLRQLDVSGNGLRGEIP-----------------  402

Query  813   gHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESR  634
                  +  + YL  LDL  N+ +G I       P+L  +                   SR
Sbjct  403   ---QKLYNMTYLEILDLHKNQLNGSI------PPDLGNL-------------------SR  434

Query  633   LQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIP  514
             LQ LD   NLL G +P ++    NL   NL  N   G IP
Sbjct  435   LQFLDLSQNLLSGLIPSSLGNLSNLTYFNLSSNDLSGIIP  474


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 73/135 (54%), Gaps = 2/135 (1%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             + V+DL    L G +  +I N   L  L+++ N  RG IP  + N+  +  L L +N  +
Sbjct  363   LQVLDLHNLNLVGEIPNDISNCMFLRQLDVSGNGLRGEIPQKLYNMTYLEILDLHKNQLN  422

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQL  910
             G +P  +  L +L+ +D+S N LSG IP+++  L  LT  +LS+N+L+G IP  + +   
Sbjct  423   GSIPPDLGNLSRLQFLDLSQNLLSGLIPSSLGNLSNLTYFNLSSNDLSGIIP--TTVQGY  480

Query  909   NTLALSSNQFFAGLP  865
                A  +N +  G P
Sbjct  481   GRYAFINNPYLCGSP  495



>ref|XP_002448543.1| hypothetical protein SORBIDRAFT_06g028760 [Sorghum bicolor]
 gb|EES12871.1| hypothetical protein SORBIDRAFT_06g028760 [Sorghum bicolor]
Length=1188

 Score =   117 bits (294),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 163/344 (47%), Gaps = 42/344 (12%)
 Frame = -3

Query  1431  VQVLRSFKDSI--DPNSVLPASFLSSWNLDLDPCEATGTHF------LGILCMTPSDNSS  1276
             ++ L +FK+++  DPN  L     SSW +        G  F       G+ C     + +
Sbjct  44    LEALLAFKEAVTADPNGTL-----SSWTVGTGNGRGGGGGFPPHCNWTGVAC-----DGA  93

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             G ++ I+L   GL G LTP +GN+T L  L+L  N+F G IP  +  L ++  L L +N 
Sbjct  94    GHVTSIELAETGLRGTLTPFLGNITTLRMLDLTSNRFGGAIPPQLGRLDELKGLGLGDNS  153

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG-L  919
             F+G +P  +  L  L+V+D+S+N L G IP+ +     +T+  + NN+LTG +PD  G L
Sbjct  154   FTGAIPPELGELGSLQVLDLSNNTLGGGIPSRLCNCSAMTQFSVFNNDLTGAVPDCIGDL  213

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
               LN L LS N     LPP                    + ++L  L  LDLS N+ SGP
Sbjct  214   VNLNELILSLNNLDGELPP--------------------SFAKLTQLETLDLSSNQLSGP  253

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
             I   I     L  +++  N F+   +     +   L  L+ +SN L G +P  +    NL
Sbjct  254   IPSWIGNFSSLNIVHMFENQFSG-AIPPELGRCKNLTTLNMYSNRLTGAIPSELGELTNL  312

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEF  427
             K + L  N    +IP+  G    +   +L L  N   GT+P+E 
Sbjct  313   KVLLLYSNALSSEIPRSLG--RCTSLLSLVLSKNQFTGTIPTEL  354


 Score =   103 bits (258),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 89/264 (34%), Positives = 135/264 (51%), Gaps = 10/264 (4%)
 Frame = -3

Query  1275  GRIS---VIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             GR+S   ++ L+ + L G +  EIGNLT+L TL L  N+F G +P SI N+  +  L L 
Sbjct  499   GRLSELILLQLQFNALSGEIPEEIGNLTKLITLPLEGNRFAGRVPKSISNMSSLQGLRLQ  558

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLS  925
              N   G LP  +  LR+L ++ V+ NR  G IP  ++ LR L+ LD+SNN L G +P   
Sbjct  559   HNSLEGTLPDEIFGLRQLTILSVASNRFVGPIPDAVSNLRSLSFLDMSNNALNGTVPAAV  618

Query  924   G-LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI------SAISRLRYLTALD  766
             G L QL  L LS N+    +P   +   + L  +  L+ ++      + I  L  + ++D
Sbjct  619   GNLGQLLMLDLSHNRLAGAIPGAVIAKLSTLQMYLNLSNNMFTGPIPAEIGGLAMVQSID  678

Query  765   LSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLP  586
             LS+NR SG     +     L  +++SAN+ T         +   L  L+   N L G +P
Sbjct  679   LSNNRLSGGFPATLARCKNLYSLDLSANNLTVALPADLFPQLDVLTSLNISGNELDGDIP  738

Query  585   LNIITYLNLKTVNLGHNRFFGKIP  514
              NI    N++T++   N F G IP
Sbjct  739   SNIGALKNIQTLDASRNAFTGAIP  762


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 92/288 (32%), Positives = 131/288 (45%), Gaps = 8/288 (3%)
 Frame = -3

Query  1233  GFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRK  1054
             G +  E+G L  L  L L+ NK  G +P S+++L  +T L  S+N  SG LP  +  L+ 
Sbjct  348   GTIPTELGKLRSLRKLMLHANKLTGTVPASLMDLVNLTYLSFSDNSLSGPLPANIGSLQN  407

Query  1053  LEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFF  877
             L+V+++  N LSG IPA+IT    L    ++ NE +G +P  L  L  LN L+L  N+  
Sbjct  408   LQVLNIDTNSLSGPIPASITNCTSLYNASMAFNEFSGPLPAGLGQLQNLNFLSLGDNKLS  467

Query  876   AGLPPFPVrlrtlllghnlltgHISAIS----RLRYLTALDLSDNRFSGPILHRIVTLPE  709
               +P        L            ++S    RL  L  L L  N  SG I   I  L +
Sbjct  468   GDIPEDLFDCSNLRTLDLAWNSFTGSLSPRVGRLSELILLQLQFNALSGEIPEEIGNLTK  527

Query  708   LMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRF  529
             L+ + +  N F    V KS +  S LQ L    N L+G LP  I     L  +++  NRF
Sbjct  528   LITLPLEGNRFAG-RVPKSISNMSSLQGLRLQHNSLEGTLPDEIFGLRQLTILSVASNRF  586

Query  528   FGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHN  385
              G IP             L++  N L GT+P+     G+     L HN
Sbjct  587   VGPIPDAV--SNLRSLSFLDMSNNALNGTVPAAVGNLGQLLMLDLSHN  632


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 90/310 (29%), Positives = 137/310 (44%), Gaps = 32/310 (10%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             ++++ +  +   G + PE+G    LTTLN+  N+  G IP  +  L  +  LLL  N  S
Sbjct  264   LNIVHMFENQFSGAIPPELGRCKNLTTLNMYSNRLTGAIPSELGELTNLKVLLLYSNALS  323

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQ  913
               +PR + R   L  + +S N+ +G+IP  +  LR L +L L  N+LTG +P  L  L  
Sbjct  324   SEIPRSLGRCTSLLSLVLSKNQFTGTIPTELGKLRSLRKLMLHANKLTGTVPASLMDLVN  383

Query  912   LNTLALSSNQFFAGLP---------------------PFPVrlrtlllghnlltg-----  811
             L  L+ S N     LP                     P P  +      +N         
Sbjct  384   LTYLSFSDNSLSGPLPANIGSLQNLQVLNIDTNSLSGPIPASITNCTSLYNASMAFNEFS  443

Query  810   --HISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKES  637
                 + + +L+ L  L L DN+ SG I   +     L  ++++ N FT   ++    + S
Sbjct  444   GPLPAGLGQLQNLNFLSLGDNKLSGDIPEDLFDCSNLRTLDLAWNSFTG-SLSPRVGRLS  502

Query  636   RLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYN  457
              L +L    N L G +P  I     L T+ L  NRF G++PK       S  + L L++N
Sbjct  503   ELILLQLQFNALSGEIPEEIGNLTKLITLPLEGNRFAGRVPKSI--SNMSSLQGLRLQHN  560

Query  456   YLEGTLPSEF  427
              LEGTLP E 
Sbjct  561   SLEGTLPDEI  570


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 128/264 (48%), Gaps = 10/264 (4%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             + V++++ + L G +   I N T L   ++  N+F GP+P  +  L+ +  L L +N  S
Sbjct  408   LQVLNIDTNSLSGPIPASITNCTSLYNASMAFNEFSGPLPAGLGQLQNLNFLSLGDNKLS  467

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQ  913
             G +P  +     L  +D++ N  +GS+   +  L EL  L L  N L+G+IP ++  L +
Sbjct  468   GDIPEDLFDCSNLRTLDLAWNSFTGSLSPRVGRLSELILLQLQFNALSGEIPEEIGNLTK  527

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISA-----ISRLRYLTALDLSDNRF  748
             L TL L  N+ FAG  P  +   + L G  L    +       I  LR LT L ++ NRF
Sbjct  528   LITLPLEGNR-FAGRVPKSISNMSSLQGLRLQHNSLEGTLPDEIFGLRQLTILSVASNRF  586

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
              GPI   +  L  L  +++S N      V  +     +L +LD   N L G +P  +I  
Sbjct  587   VGPIPDAVSNLRSLSFLDMSNNALNGT-VPAAVGNLGQLLMLDLSHNRLAGAIPGAVIAK  645

Query  567   LNL--KTVNLGHNRFFGKIPKEYG  502
             L+     +NL +N F G IP E G
Sbjct  646   LSTLQMYLNLSNNMFTGPIPAEIG  669


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -3

Query  1134  LRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNN  955
             L  +T L +S N   G +P  +  L+ ++ +D S N  +G+IPA +  L  L  L+LS+N
Sbjct  720   LDVLTSLNISGNELDGDIPSNIGALKNIQTLDASRNAFTGAIPAALANLTSLRSLNLSSN  779

Query  954   ELTGKIPDLSGLWQLNTLALSSNQFFAGL  868
             +L G +PD SG++  + L++SS Q  AGL
Sbjct  780   QLEGPVPD-SGVF--SNLSMSSLQGNAGL  805



>ref|XP_010041038.1| PREDICTED: putative receptor-like protein kinase At3g47110, partial 
[Eucalyptus grandis]
Length=796

 Score =   117 bits (293),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 96/310 (31%), Positives = 144/310 (46%), Gaps = 30/310 (10%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             ++D   L SFK++I  +   P   LSSWN     CE     + G+LC   S    GR++ 
Sbjct  12    QTDRLALASFKNAIHED---PFGVLSSWNDSTHHCE-----WQGVLC---SKRHPGRVTS  60

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             + L   GL+GFL+ ++GNL+ L  + L  N F G IP  I NL  +  L LS N F G +
Sbjct  61    LVLRSQGLKGFLSSQVGNLSFLRVIFLQNNSFHGEIPPQISNLLHLRVLFLSNNSFGGPI  120

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTL  901
             P  + R   L+++++  N+L G I + + +L  L  L L+ N L G IP   G   L   
Sbjct  121   PSNLSRCSNLKILNLIDNQLVGGIHSNLGSLTRLKYLGLTQNSLVGPIPRSIGNLSLLDH  180

Query  900   ALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIV  721
                S    +G  P                   + +SRL+ LT   LS N+ +G +   I+
Sbjct  181   LSLSRNVLSGEIP-------------------AELSRLKRLTFFQLSLNKLTGEVPAGIL  221

Query  720   TLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLG  541
              + +L   +VS N  +        T    LQ+  A  NL  G +P  ++    L+  +L 
Sbjct  222   NISDLFLFDVSYNQLSGSFFNDVGTTSPSLQIFGARDNLFTGMIPSTLMNATGLRLFSLS  281

Query  540   HNRFFGKIPK  511
             +N F G IPK
Sbjct  282   NNNFHGPIPK  291


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 77/260 (30%), Positives = 120/260 (46%), Gaps = 21/260 (8%)
 Frame = -3

Query  1287  DNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLL  1108
              N S  I  I LE + ++G +   +GNL  L+ L+L  N     IP SI  L  +  L L
Sbjct  344   SNLSTSIKAISLEKNRIQGSIPLALGNLFNLSYLSLRDNFLTDCIPHSIGALSNLQSLFL  403

Query  1107  SENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-D  931
               N F+G +P  +  +  L ++D+S+N   G IP ++   ++L  LDLSNN L G IP +
Sbjct  404   GGNMFTGEIPSLIGNITSLNMLDLSYNIFQGYIPQSLGNCKQLILLDLSNNNLIGSIPVE  463

Query  930   LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
             + GL  L+ L   +N   +G  P  V                     L+ L  +DLS N 
Sbjct  464   IVGLSSLSILLSLANNNLSGSLPLQV-------------------GSLKNLGVIDLSYNG  504

Query  750   FSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIIT  571
              +G I   I     L ++ + AN F   ++ ++      LQ LD  +N   G +P  +  
Sbjct  505   LTGLIPTSISECLVLEKLYLEANSF-HGQIPEAFRPLRGLQELDLSNNNFSGPIPSFLAE  563

Query  570   YLNLKTVNLGHNRFFGKIPK  511
                L  +NL  N+  G++P+
Sbjct  564   LSLLMYLNLSFNQLEGQVPE  583


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 68/221 (31%), Positives = 95/221 (43%), Gaps = 22/221 (10%)
 Frame = -3

Query  1161  GPIPDSIINLR-KITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALR  985
             G +P SI NL   I  + L +N   G +P  +  L  L  + +  N L+  IP +I AL 
Sbjct  337   GSLPRSISNLSTSIKAISLEKNRIQGSIPLALGNLFNLSYLSLRDNFLTDCIPHSIGALS  396

Query  984   ELTRLDLSNNELTGKIPDLSG-LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgH  808
              L  L L  N  TG+IP L G +  LN L LS N F   +P                   
Sbjct  397   NLQSLFLGGNMFTGEIPSLIGNITSLNMLDLSYNIFQGYIP-------------------  437

Query  807   ISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQ  628
               ++   + L  LDLS+N   G I   IV L  L  +   AN+     +         L 
Sbjct  438   -QSLGNCKQLILLDLSNNNLIGSIPVEIVGLSSLSILLSLANNNLSGSLPLQVGSLKNLG  496

Query  627   VLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEY  505
             V+D   N L G +P +I   L L+ + L  N F G+IP+ +
Sbjct  497   VIDLSYNGLTGLIPTSISECLVLEKLYLEANSFHGQIPEAF  537


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 69/128 (54%), Gaps = 0/128 (0%)
 Frame = -3

Query  1245  DGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMR  1066
             + L G L  ++G+L  L  ++L+ N   G IP SI     + +L L  N F G +P   R
Sbjct  479   NNLSGSLPLQVGSLKNLGVIDLSYNGLTGLIPTSISECLVLEKLYLEANSFHGQIPEAFR  538

Query  1065  RLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSN  886
              LR L+ +D+S+N  SG IP+ +  L  L  L+LS N+L G++P+      ++++++  N
Sbjct  539   PLRGLQELDLSNNNFSGPIPSFLAELSLLMYLNLSFNQLEGQVPEGGLFLNVSSVSIYGN  598

Query  885   QFFAGLPP  862
                 G  P
Sbjct  599   TELCGGVP  606



>ref|XP_010556795.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase IMK2 [Tarenaya hassleriana]
Length=402

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 114/397 (29%), Positives = 176/397 (44%), Gaps = 30/397 (8%)
 Frame = -3

Query  1464  CFLNAKTLESDVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLG--ILCMT  1294
             C + A     D   L++ + S+     LP S F  SW+   DPC   G +  G  ++ + 
Sbjct  25    CLVEAILDPVDFLALQAIRKSL---VDLPGSNFFQSWDFTSDPCTFAGVYCDGDKVVALN  81

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
               D  +G          GL G + P IG L+ L  L++   +  GP+PD++   + +  L
Sbjct  82    LGDPRAG--------SPGLSGRIDPAIGKLSALAELSIVPGRIIGPLPDTVSQSKDLRFL  133

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              +S NF SG +P  +  LR L  +D+S+N+L+G+IP +I +L EL+ L L +N L+G IP
Sbjct  134   AISRNFLSGEIPASLGELRGLRTLDLSYNQLTGTIPPSIGSLSELSNLILCHNHLSGSIP  193

Query  933   DLSGLWQLNTLALSSNQFFAGLPPF---PVrlrtlllghnlltgHISAISRLRYLTALDL  763
                    L  + L  N     L P    P      L  + +       +  L  L  LDL
Sbjct  194   PFIS-QTLTRVDLKRNNLTGTLLPATLPPSLQYLSLAWNQITGPVDRVLLNLDQLNYLDL  252

Query  762   SDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPL  583
             S NRF+G I  RI T P +  + +  N+F  +        +  +  +D   N   G +  
Sbjct  253   SLNRFTGTIPGRIFTFP-MTNLQLQRNYFYGV---VQPANQVTIATVDLSYNRFSGEISP  308

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKA  406
              + T  NL    L +NRF G++P  +    L +  + L L++NYL G   S        +
Sbjct  309   LLSTVQNLY---LNNNRFSGEVPASFVERLLAASIQTLYLQHNYLTGIEISPAAEIPVSS  365

Query  405   RASLDHNCLNCPDHLPWCLGG----QRPASQCRRSAG  307
                L +NC+  P   P  L       RP +QC    G
Sbjct  366   SLCLQYNCMVPPLQTPCPLKAGPQKTRPTTQCNEWRG  402



>ref|XP_003532799.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Glycine max]
Length=1006

 Score =   117 bits (293),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 99/316 (31%), Positives = 149/316 (47%), Gaps = 33/316 (10%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             ++ +D + L SFK  +   ++ P   LSSWN +  PC  TG     +LC    D    R+
Sbjct  35    SITTDREALISFKSQLSNENLSP---LSSWNHNSSPCNWTG-----VLC----DRLGQRV  82

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             + +DL G GL G L+P +GNL+ L +L L  N+FRG IPD I NL  +  L +S N   G
Sbjct  83    TGLDLSGYGLSGHLSPYVGNLSSLQSLQLQNNQFRGVIPDQIGNLLSLKVLNMSYNMLEG  142

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQL  910
              LP  +  L +L+V+D+S N++   IP  I++L++L  L L  N L G IP  L  +  L
Sbjct  143   KLPSNITHLNELQVLDLSSNKIVSKIPEDISSLQKLQALKLGRNSLFGAIPASLGNISSL  202

Query  909   NTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILH  730
               ++  +N F  G  P                   S + RL  L  LDLS N  +G +  
Sbjct  203   KNISFGTN-FLTGWIP-------------------SELGRLHDLIELDLSLNHLNGTVPP  242

Query  729   RIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTV  550
              I  L  L+   +++N F          K  +L V     N   G +P ++    N++ +
Sbjct  243   AIYNLSSLVNFALASNSFWGEIPQDVGHKLPKLIVFCICFNYFTGRIPGSLHNLTNIQVI  302

Query  549   NLGHNRFFGKIPKEYG  502
              +  N   G +P   G
Sbjct  303   RMASNHLEGSVPPGLG  318


 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 97/339 (29%), Positives = 161/339 (47%), Gaps = 57/339 (17%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPA----SFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGR  1270
             +++QV+R   + ++  SV P      FL ++N+  +   ++G    G+  +T   NS+  
Sbjct  297   TNIQVIRMASNHLE-GSVPPGLGNLPFLCTYNIRYNWIVSSGVR--GLDFITSLTNST-H  352

Query  1269  ISVIDLEGDGLEGFLTPEIGnlte-lttlnlnrNKFRGPIPDSII---------------  1138
             ++ + ++G+ LEG +   IGNL++ L+TL + +N+F G IP SI                
Sbjct  353   LNFLAIDGNMLEGVIPETIGNLSKDLSTLYMGQNRFNGSIPSSIGRLSGLKLLNLSYNSI  412

Query  1137  ---------NLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALR  985
                       L ++  L L+ N  SGG+P  +  L KL ++D+S N+L G IP +   L+
Sbjct  413   SGEIPQELGQLEELQELSLAGNEISGGIPSILGNLLKLNLVDLSRNKLVGRIPTSFGNLQ  472

Query  984   ELTRLDLSNNELTGKIP-DLSGLWQL-NTLALSSNQFFAGLPPFPVrlrtlllghnlltg  811
              L  +DLS+N+L G IP ++  L  L N L LS N F +G  P P               
Sbjct  473   NLLYMDLSSNQLNGSIPMEILNLPTLSNVLNLSMN-FLSG--PIP---------------  514

Query  810   HISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRL  631
                 + RL  + ++D S+N+  G I         L ++ +  N  +   + K+      L
Sbjct  515   ---EVGRLSSVASIDFSNNQLYGGIPSSFSNCLSLEKLFLPRNQLSG-PIPKALGDVRGL  570

Query  630   QVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIP  514
             + LD  SN L G +P+ +     LK +NL +N   G IP
Sbjct  571   ETLDLSSNQLSGTIPIELQNLHGLKLLNLSYNDIEGAIP  609


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 127/287 (44%), Gaps = 30/287 (10%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIIN-LRKITRLLLSENFFSGG  1084
             +DL  + L G + P I NL+ L    L  N F G IP  + + L K+    +  N+F+G 
Sbjct  229   LDLSLNHLNGTVPPAIYNLSSLVNFALASNSFWGEIPQDVGHKLPKLIVFCICFNYFTGR  288

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGK-------IPDLS  925
             +P  +  L  ++VI ++ N L GS+P  +  L  L   ++  N +          I  L+
Sbjct  289   IPGSLHNLTNIQVIRMASNHLEGSVPPGLGNLPFLCTYNIRYNWIVSSGVRGLDFITSLT  348

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 LN LA+  N     +P                   I  +S  + L+ L +  NRF+
Sbjct  349   NSTHLNFLAIDGNMLEGVIPE-----------------TIGNLS--KDLSTLYMGQNRFN  389

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G I   I  L  L  +N+S N  +  E+ +   +   LQ L    N + G +P  +   L
Sbjct  390   GSIPSSIGRLSGLKLLNLSYNSISG-EIPQELGQLEELQELSLAGNEISGGIPSILGNLL  448

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFM  424
              L  V+L  N+  G+IP  +G+    L+ +L+   N L G++P E +
Sbjct  449   KLNLVDLSRNKLVGRIPTSFGNLQNLLYMDLSS--NQLNGSIPMEIL  493


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 89/170 (52%), Gaps = 10/170 (6%)
 Frame = -3

Query  1383  LPASFLSSWNL---DLDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGDGLEGFLTPEI  1213
             +P SF +  NL   DL   +  G+  + IL +    N      V++L  + L G + PE+
Sbjct  464   IPTSFGNLQNLLYMDLSSNQLNGSIPMEILNLPTLSN------VLNLSMNFLSGPI-PEV  516

Query  1212  GnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVS  1033
             G L+ + +++ + N+  G IP S  N   + +L L  N  SG +P+ +  +R LE +D+S
Sbjct  517   GRLSSVASIDFSNNQLYGGIPSSFSNCLSLEKLFLPRNQLSGPIPKALGDVRGLETLDLS  576

Query  1032  HNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQ  883
              N+LSG+IP  +  L  L  L+LS N++ G IP       L+ + L  N+
Sbjct  577   SNQLSGTIPIELQNLHGLKLLNLSYNDIEGAIPGAGVFQNLSAVHLEGNR  626



>gb|KCW82356.1| hypothetical protein EUGRSUZ_C03760 [Eucalyptus grandis]
Length=1107

 Score =   117 bits (293),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 109/366 (30%), Positives = 180/366 (49%), Gaps = 46/366 (13%)
 Frame = -3

Query  1437  SDVQVLRSFKDSI--DPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRIS  1264
             +D + L  F+ +I  DP + + +S   +W +  + CE     ++G++C     N   R++
Sbjct  30    TDQEALLQFESTIKVDPTNTIKSS---NWTVKANFCE-----WIGVIC----SNRRHRVT  77

Query  1263  VIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
              ++L   GL+G L+P +GNL+ L +L+L  N F G I   I +LR++  L+L  N F G 
Sbjct  78    ALNLSHMGLQGRLSPYLGNLSLLVSLDLRNNSFYGMILIEIGHLRRLKELILELNQFEGN  137

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNT  904
             +P  + + + LEV+ ++ NRL G IP   +A  +L +LDLS+N+L G+IP   G      
Sbjct  138   IPPILTQCQNLEVMSLATNRLIGGIPREFSAFPKLQQLDLSSNDLRGQIPSFMGNISTLQ  197

Query  903   LALSSNQFFAGLPP-----------------------------FPVrlrtlllghnlltg  811
             + + +N    GL P                             +P      L  +     
Sbjct  198   IIILANATLTGLIPSALFNRSLTWVNLTDNYLSGSLPSDLCYRWPNIQMLSLHQNQFDGL  257

Query  810   HISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRL  631
                 +++ + L  L LS NRF G I   I +L +L +++ +AN+ T   +T++    S L
Sbjct  258   LPETLTQCKELIILRLSYNRFQGSIPRDIGSLQKLQKLSFAANNLTG-TITRTIGNMSSL  316

Query  630   QVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYL  451
             Q L   SN ++G +P  I   +NL+ + L  N   G++P+E      S  + LNL YN L
Sbjct  317   QWLIIGSNYVEGEIPSEIGNLVNLQQMVLVENLLTGQVPQEV--FNISSLQVLNLMYNSL  374

Query  450   EGTLPS  433
              G+LPS
Sbjct  375   SGSLPS  380


 Score = 88.2 bits (217),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 117/249 (47%), Gaps = 31/249 (12%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENF-FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
              RG IP+SI N     ++L+++N    G +P+ M  L++L  +++ +N L  SIP++I  
Sbjct  478   LRGSIPESIKNFSNSLQILVAQNCQIRGCIPKEMGFLKRLTFLNLGNNGLDNSIPSSIGG  537

Query  990   LRELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnllt  814
             L  L RL L NN L G IPD +  L  L  L L  N+    +P                 
Sbjct  538   LERLQRLYLDNNHLEGPIPDEICNLTGLGELVLGQNRISGSIP-----------------  580

Query  813   gHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTR---IEVTKSSTK  643
                + I  L  L    +S N  +  I   +  L EL+ +N+S N F+    +E+ K    
Sbjct  581   ---NCIGNLSILQKFLISSNNMTLVIPSSLWGLQELIFLNLSLNSFSGGLPLEIGKMRAI  637

Query  642   ESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLE  463
             ES    +D   N L G +P +I  + +L ++NL  N F G IP+  G         L+L 
Sbjct  638   ES----IDLSWNRLTGAIPSSIQEFESLASLNLSRNSFQGLIPQSIG--HLKGLDFLDLS  691

Query  462   YNYLEGTLP  436
             YN L GT+P
Sbjct  692   YNELSGTIP  700


 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 121/258 (47%), Gaps = 22/258 (9%)
 Frame = -3

Query  1284  NSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLS  1105
             N S  + ++  +   + G +  E+G L  LT LNL  N     IP SI  L ++ RL L 
Sbjct  488   NFSNSLQILVAQNCQIRGCIPKEMGFLKRLTFLNLGNNGLDNSIPSSIGGLERLQRLYLD  547

Query  1104  ENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD-L  928
              N   G +P  +  L  L  + +  NR+SGSIP  I  L  L +  +S+N +T  IP  L
Sbjct  548   NNHLEGPIPDEICNLTGLGELVLGQNRISGSIPNCIGNLSILQKFLISSNNMTLVIPSSL  607

Query  927   SGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
              GL +L  L LS N F  GLP                      I ++R + ++DLS NR 
Sbjct  608   WGLQELIFLNLSLNSFSGGLPL--------------------EIGKMRAIESIDLSWNRL  647

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             +G I   I     L  +N+S N F  + + +S      L  LD   N L G +P ++   
Sbjct  648   TGAIPSSIQEFESLASLNLSRNSFQGL-IPQSIGHLKGLDFLDLSYNELSGTIPKSMEGL  706

Query  567   LNLKTVNLGHNRFFGKIP  514
              +L+T+NL  N+  G+IP
Sbjct  707   AHLQTLNLSFNKLSGEIP  724


 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 75/136 (55%), Gaps = 0/136 (0%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             ++L  +   G L  EIG +  + +++L+ N+  G IP SI     +  L LS N F G +
Sbjct  616   LNLSLNSFSGGLPLEIGKMRAIESIDLSWNRLTGAIPSSIQEFESLASLNLSRNSFQGLI  675

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTL  901
             P+ +  L+ L+ +D+S+N LSG+IP ++  L  L  L+LS N+L+G+IP+       + L
Sbjct  676   PQSIGHLKGLDFLDLSYNELSGTIPKSMEGLAHLQTLNLSFNKLSGEIPNGGPFGNFSAL  735

Query  900   ALSSNQFFAGLPPFPV  853
             +   N+   G   F V
Sbjct  736   SFIGNEALCGNAIFQV  751


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 103/219 (47%), Gaps = 23/219 (11%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             +F G +P+++   +++  L LS N F G +PR +  L+KL+ +  + N L+G+I  TI  
Sbjct  253   QFDGLLPETLTQCKELIILRLSYNRFQGSIPRDIGSLQKLQKLSFAANNLTGTITRTIGN  312

Query  990   LRELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnllt  814
             +  L  L + +N + G+IP ++  L  L  + L  N     +P                 
Sbjct  313   MSSLQWLIIGSNYVEGEIPSEIGNLVNLQQMVLVENLLTGQVP-----------------  355

Query  813   gHISAISRLRYLTALDLSDNRFSGPI-LHRIVTLPELMRINVSANHFTRIEVTKSSTKES  637
                  +  +  L  L+L  N  SG +   R ++LP L  +++++N F   ++    +  S
Sbjct  356   ---QEVFNISSLQVLNLMYNSLSGSLPSGRDLSLPNLEGLHLASNGFGG-KIPLYFSNFS  411

Query  636   RLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGK  520
              L + D   N L G +P+ +    NL+  ++G N+  G+
Sbjct  412   NLILFDVGDNQLSGPIPMGLGNLKNLEIFDIGFNQLTGE  450



>gb|KCW63516.1| hypothetical protein EUGRSUZ_G011492, partial [Eucalyptus grandis]
Length=485

 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 100/314 (32%), Positives = 144/314 (46%), Gaps = 32/314 (10%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             ++D   L SF+++ID +   P   LSSWN  ++ CE     + G+LC   S    GR+  
Sbjct  30    QTDRLALASFRNAIDED---PFRVLSSWNDSINHCE-----WQGVLC---SKRHPGRVMS  78

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             + L   GL GFL+P IGNL+ L  + L  N F G IP  I NL ++  L LS N F G +
Sbjct  79    LILRSQGLGGFLSPHIGNLSFLKIVVLQNNSFGGEIPSQIGNLFRLRNLDLSNNSFGGSI  138

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSGLWQLNT  904
             P  + R   LE +++  NRL G I + + +L  L  L LS N L G I P +  L  L  
Sbjct  139   PSNLSRCSNLESLNLVDNRLVGGICSNLGSLPRLKFLRLSKNNLVGPIPPSIGNLSLLQH  198

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             L+L+ N F   +P                      +SRL  L    LS N+ +G I   I
Sbjct  199   LSLAENAFQGEIP--------------------EELSRLERLIYFQLSSNKLTGEIPLGI  238

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
               +  +    V  N       +   T    L  L   +N+  G +P ++    +L+ + L
Sbjct  239   FNISGINYFYVGWNQLRGSFPSDIGTTLPSLYYLGGLNNMFTGIIPSSLTNTTSLRGLYL  298

Query  543   GHNRFFGKIPKEYG  502
              +N F G IPK  G
Sbjct  299   ANNNFHGPIPKNLG  312


 Score = 58.9 bits (141),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 60/226 (27%), Positives = 96/226 (42%), Gaps = 49/226 (22%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLR-----------------------  1057
             F G IP S+ N   +  L L+ N F G +P+ + RL+                       
Sbjct  279   FTGIIPSSLTNTTSLRGLYLANNNFHGPIPKNLGRLKGLYVIALGLNQLQDDLSFISSLA  338

Query  1056  ---KLEVIDVSHNRLSGSIPATITALR-ELTRLDLSNNELTGKIPDLSG-LWQLNTLALS  892
                 LE++ V  N + GS+P +I+ L   + ++ +SNN + G IP   G L+ L  L+L 
Sbjct  339   NCSNLEILSVEENSIHGSLPTSISNLSTSIKQISMSNNLIHGTIPSAFGNLFNLTYLSLK  398

Query  891   SNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLP  712
             +N     LP                     +I  L  L  L LS N F+G I   I  + 
Sbjct  399   NNSLTDSLP--------------------DSIGALYNLRVLFLSRNMFTGEIPPSIGNMT  438

Query  711   ELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
              L R+ +  N+F    + +S    ++L  L+  +N L G +P+ I+
Sbjct  439   SLNRLFLQDNNFQGY-IPQSLGNCTQLIELELSNNSLSGSIPVEIV  483


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 66/154 (43%), Gaps = 22/154 (14%)
 Frame = -3

Query  1170  KFRGPIPDSIINLR-KITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATIT  994
                G +P SI NL   I ++ +S N   G +P     L  L  + + +N L+ S+P +I 
Sbjct  352   SIHGSLPTSISNLSTSIKQISMSNNLIHGTIPSAFGNLFNLTYLSLKNNSLTDSLPDSIG  411

Query  993   ALRELTRLDLSNNELTGKI-PDLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnll  817
             AL  L  L LS N  TG+I P +  +  LN L L  N F   +P                
Sbjct  412   ALYNLRVLFLSRNMFTGEIPPSIGNMTSLNRLFLQDNNFQGYIP----------------  455

Query  816   tgHISAISRLRYLTALDLSDNRFSGPILHRIVTL  715
                  ++     L  L+LS+N  SG I   IV L
Sbjct  456   ----QSLGNCTQLIELELSNNSLSGSIPVEIVGL  485



>gb|KHN48111.1| LRR receptor-like serine/threonine-protein kinase EFR [Glycine 
soja]
Length=1006

 Score =   117 bits (292),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 99/316 (31%), Positives = 149/316 (47%), Gaps = 33/316 (10%)
 Frame = -3

Query  1446  TLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRI  1267
             ++ +D + L SFK  +   ++ P   LSSWN +  PC  TG     +LC    D    R+
Sbjct  35    SITTDREALISFKSQLSNENLSP---LSSWNHNSSPCNWTG-----VLC----DRLGQRV  82

Query  1266  SVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSG  1087
             + +DL G GL G L+P +GNL+ L +L L  N+FRG IPD I NL  +  L +S N   G
Sbjct  83    TGLDLSGFGLSGHLSPYVGNLSSLQSLQLQNNQFRGVIPDQIGNLLSLKVLNMSYNMLEG  142

Query  1086  GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQL  910
              LP  +  L +L+V+D+S N++   IP  I++L++L  L L  N L G IP  L  +  L
Sbjct  143   KLPSNITHLNELQVLDLSSNKIVSKIPEDISSLQKLQALKLGRNSLYGAIPASLGNISSL  202

Query  909   NTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILH  730
               ++  +N F  G  P                   S + RL  L  LDLS N  +G +  
Sbjct  203   KNISFGTN-FLTGWIP-------------------SELGRLHDLIELDLSLNHLNGTVPP  242

Query  729   RIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTV  550
              I  L  L+   +++N F          K  +L V     N   G +P ++    N++ +
Sbjct  243   AIYNLSSLVNFALASNSFWGEIPQDVGHKLPKLIVFCICFNYFTGRIPGSLHNLTNIQVI  302

Query  549   NLGHNRFFGKIPKEYG  502
              +  N   G +P   G
Sbjct  303   RMASNHLEGSVPPGLG  318


 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 97/339 (29%), Positives = 161/339 (47%), Gaps = 57/339 (17%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPA----SFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGR  1270
             +++QV+R   + ++  SV P      FL ++N+  +   ++G    G+  +T   NS+  
Sbjct  297   TNIQVIRMASNHLE-GSVPPGLGNLPFLCTYNIRYNWIVSSGVR--GLDFITSLTNST-H  352

Query  1269  ISVIDLEGDGLEGFLTPEIGnlte-lttlnlnrNKFRGPIPDSII---------------  1138
             ++ + ++G+ LEG +   IGNL++ L+TL + +N+F G IP SI                
Sbjct  353   LNFLAIDGNMLEGVIPETIGNLSKDLSTLYMGQNRFNGSIPSSIGRLSGLKLLNLSYNSI  412

Query  1137  ---------NLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALR  985
                       L ++  L L+ N  SGG+P  +  L KL ++D+S N+L G IP +   L+
Sbjct  413   SGEIPQELGQLEELQELSLAGNEISGGIPSILGNLLKLNLVDLSRNKLVGRIPTSFGNLQ  472

Query  984   ELTRLDLSNNELTGKIP-DLSGLWQL-NTLALSSNQFFAGLPPFPVrlrtlllghnlltg  811
              L  +DLS+N+L G IP ++  L  L N L LS N F +G  P P               
Sbjct  473   NLLYMDLSSNQLNGSIPMEILNLPTLSNVLNLSMN-FLSG--PIP---------------  514

Query  810   HISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRL  631
                 + RL  + ++D S+N+  G I         L ++ +  N  +   + K+      L
Sbjct  515   ---EVGRLSSVASIDFSNNQLYGGIPSSFSNCLSLEKLFLPRNQLSG-PIPKALGDVRGL  570

Query  630   QVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIP  514
             + LD  SN L G +P+ +     LK +NL +N   G IP
Sbjct  571   ETLDLSSNQLSGTIPIELQNLHGLKLLNLSYNDIEGAIP  609


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 127/287 (44%), Gaps = 30/287 (10%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIIN-LRKITRLLLSENFFSGG  1084
             +DL  + L G + P I NL+ L    L  N F G IP  + + L K+    +  N+F+G 
Sbjct  229   LDLSLNHLNGTVPPAIYNLSSLVNFALASNSFWGEIPQDVGHKLPKLIVFCICFNYFTGR  288

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGK-------IPDLS  925
             +P  +  L  ++VI ++ N L GS+P  +  L  L   ++  N +          I  L+
Sbjct  289   IPGSLHNLTNIQVIRMASNHLEGSVPPGLGNLPFLCTYNIRYNWIVSSGVRGLDFITSLT  348

Query  924   GLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
                 LN LA+  N     +P                   I  +S  + L+ L +  NRF+
Sbjct  349   NSTHLNFLAIDGNMLEGVIPE-----------------TIGNLS--KDLSTLYMGQNRFN  389

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
             G I   I  L  L  +N+S N  +  E+ +   +   LQ L    N + G +P  +   L
Sbjct  390   GSIPSSIGRLSGLKLLNLSYNSISG-EIPQELGQLEELQELSLAGNEISGGIPSILGNLL  448

Query  564   NLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFM  424
              L  V+L  N+  G+IP  +G+    L+ +L+   N L G++P E +
Sbjct  449   KLNLVDLSRNKLVGRIPTSFGNLQNLLYMDLSS--NQLNGSIPMEIL  493


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 89/170 (52%), Gaps = 10/170 (6%)
 Frame = -3

Query  1383  LPASFLSSWNL---DLDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGDGLEGFLTPEI  1213
             +P SF +  NL   DL   +  G+  + IL +    N      V++L  + L G + PE+
Sbjct  464   IPTSFGNLQNLLYMDLSSNQLNGSIPMEILNLPTLSN------VLNLSMNFLSGPI-PEV  516

Query  1212  GnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVS  1033
             G L+ + +++ + N+  G IP S  N   + +L L  N  SG +P+ +  +R LE +D+S
Sbjct  517   GRLSSVASIDFSNNQLYGGIPSSFSNCLSLEKLFLPRNQLSGPIPKALGDVRGLETLDLS  576

Query  1032  HNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQ  883
              N+LSG+IP  +  L  L  L+LS N++ G IP       L+ + L  N+
Sbjct  577   SNQLSGTIPIELQNLHGLKLLNLSYNDIEGAIPGAGVFQNLSAVHLEGNR  626



>ref|XP_010038143.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
 gb|KCW49960.1| hypothetical protein EUGRSUZ_K03420 [Eucalyptus grandis]
Length=409

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 185/392 (47%), Gaps = 38/392 (10%)
 Frame = -3

Query  1437  SDVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             +D   L+S + S+D    +P S F  SW+   DPC     +F G+LC       + R+  
Sbjct  41    NDFLALQSIRKSLDD---MPGSTFFGSWDFTADPC-----NFAGVLC------DADRVIA  86

Query  1260  IDLEGD------GLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             ++L GD      GL G +   +G L+ L  L +   +  G +P ++  L+ +  L +S N
Sbjct  87    LNL-GDPRAGSPGLTGRIDAAVGRLSSLAELTVVPGRVYGSLPQTLYQLKSLRFLAVSRN  145

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
             F SG +P  +  LR L  +D+S+N+L+G+IP  +  L EL+ L L +N+L+G +P     
Sbjct  146   FISGEIPANLGLLRSLRTLDLSYNQLTGAIPRAVGTLPELSNLILCHNKLSGSVPPFVS-  204

Query  918   WQLNTLALSSNQFFAGLPP--FPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRF  748
               L  L L  N     L P   P  L+ L L  N L G +  A+SR+  L  LDLS NRF
Sbjct  205   ESLTRLDLKHNDLSGTLGPLTLPASLQYLSLSWNQLGGPVDGALSRMDRLNYLDLSMNRF  264

Query  747   SGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITY  568
             SGPI  R+   P +  + +  N    +E       +  +  +D   N L G +     T 
Sbjct  265   SGPIPARLFAFP-ITNLQLQRNW---LEGPVEPASQVSIPTVDLSYNRLSGQISPMFSTV  320

Query  567   LNLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLD  391
              NL    L +NRF G++P  +    L +  + L L++N+L G   +            L 
Sbjct  321   QNLY---LNNNRFTGQVPGSFVDRLLAANIQTLYLQHNFLTGIEINPTADIPLSTSFCLQ  377

Query  390   HNCLNCPDHLPWCL--GGQ--RPASQCRRSAG  307
             +NC+  P   P  L  G Q  RP SQC +  G
Sbjct  378   YNCMVPPVQTPCPLKAGKQKTRPTSQCSQWRG  409



>ref|XP_006854860.1| hypothetical protein AMTR_s00182p00028790 [Amborella trichopoda]
 gb|ERN16327.1| hypothetical protein AMTR_s00182p00028790 [Amborella trichopoda]
Length=1106

 Score =   117 bits (292),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 149/302 (49%), Gaps = 25/302 (8%)
 Frame = -3

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             G + V+DL G+ + G +    G+ + LT L L+ N F G +PDS   L  + RL L+ N 
Sbjct  296   GSLQVLDLRGNVINGSIPSWFGSFSSLTDLYLSSNVFSGILPDSFGQLTLLQRLALAGNL  355

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATI-TALRELTRLDLSNNELTGKIP-DLSG  922
              +G  P  +    +L+V+D+  N  SG IPA++ ++LR L  L L  N+ +G IP  L  
Sbjct  356   LTGNFPEVIESFTQLQVLDLEDNLFSGKIPASLGSSLRALRALSLGGNQFSGAIPASLIN  415

Query  921   LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG  742
             L  L TL+L SN+    +P +                    +++L  LT LDLS NRF G
Sbjct  416   LSSLETLSLRSNKLSGNIPEY--------------------LTQLSNLTVLDLSQNRFYG  455

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
              I  +I  L  L  +NVS N  +  ++ +S      L+VLD     L G LP  +    N
Sbjct  456   GIPPQIGDLQSLRDLNVSGNQLSG-KIPQSIGNLLNLRVLDLGQQNLSGELPSELSGLPN  514

Query  561   LKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNC  382
             L+ ++L  N F G+IP+  G    S  + LNL +N+  G +P  F         SL HN 
Sbjct  515   LQVLSLPENSFSGEIPE--GFSSLSSLQYLNLTFNHFSGQIPPAFGFLQSLQTLSLSHNI  572

Query  381   LN  376
             L+
Sbjct  573   LS  574


 Score =   109 bits (273),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 95/301 (32%), Positives = 135/301 (45%), Gaps = 25/301 (8%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelt-tlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             ++ V+DLE +   G +   +G+       L+L  N+F G IP S+INL  +  L L  N 
Sbjct  369   QLQVLDLEDNLFSGKIPASLGSSLRALRALSLGGNQFSGAIPASLINLSSLETLSLRSNK  428

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG-L  919
              SG +P Y+ +L  L V+D+S NR  G IP  I  L+ L  L++S N+L+GKIP   G L
Sbjct  429   LSGNIPEYLTQLSNLTVLDLSQNRFYGGIPPQIGDLQSLRDLNVSGNQLSGKIPQSIGNL  488

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
               L  L L        LP                    S +S L  L  L L +N FSG 
Sbjct  489   LNLRVLDLGQQNLSGELP--------------------SELSGLPNLQVLSLPENSFSGE  528

Query  738   ILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNL  559
             I     +L  L  +N++ NHF+  ++  +      LQ L    N+L G +P  I     L
Sbjct  529   IPEGFSSLSSLQYLNLTFNHFSG-QIPPAFGFLQSLQTLSLSHNILSGGIPAEIGNCSAL  587

Query  558   KTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCL  379
               +    NRF G+IP +          +L    N   G++P E       +   LDHN L
Sbjct  588   TVLEFRSNRFSGRIPSDLSRLSHLQSLDLG--INDFRGSIPPEISECSSLSSLILDHNHL  645

Query  378   N  376
             N
Sbjct  646   N  646


 Score = 78.6 bits (192),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 96/203 (47%), Gaps = 5/203 (2%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             + V+DL    L G L  E+  L  L  L+L  N F G IP+   +L  +  L L+ N FS
Sbjct  491   LRVLDLGQQNLSGELPSELSGLPNLQVLSLPENSFSGEIPEGFSSLSSLQYLNLTFNHFS  550

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQ  913
             G +P     L+ L+ + +SHN LSG IPA I     LT L+  +N  +G+IP DLS L  
Sbjct  551   GQIPPAFGFLQSLQTLSLSHNILSGGIPAEIGNCSALTVLEFRSNRFSGRIPSDLSRLSH  610

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAI----SRLRYLTALDLSDNRFS  745
             L +L L  N F   +PP      +L             I    + L +L  LDLS N  S
Sbjct  611   LQSLDLGINDFRGSIPPEISECSSLSSLILDHNHLNGTIPDSFANLTHLEMLDLSVNNLS  670

Query  744   GPILHRIVTLPELMRINVSANHF  676
             G I  ++  +  L   NVS N  
Sbjct  671   GNIPAKLTRITSLKSFNVSYNKL  693


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITAL  988
             FRG IP  I     ++ L+L  N  +G +P     L  LE++D+S N LSG+IPA +T +
Sbjct  621   FRGSIPPEISECSSLSSLILDHNHLNGTIPDSFANLTHLEMLDLSVNNLSGNIPAKLTRI  680

Query  987   RELTRLDLSNNELTGKIP  934
               L   ++S N+L G+IP
Sbjct  681   TSLKSFNVSYNKLEGEIP  698


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 67/136 (49%), Gaps = 1/136 (1%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             +  + L  + L G +  EIGN + LT L    N+F G IP  +  L  +  L L  N F 
Sbjct  563   LQTLSLSHNILSGGIPAEIGNCSALTVLEFRSNRFSGRIPSDLSRLSHLQSLDLGINDFR  622

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQ  913
             G +P  +     L  + + HN L+G+IP +   L  L  LDLS N L+G IP  L+ +  
Sbjct  623   GSIPPEISECSSLSSLILDHNHLNGTIPDSFANLTHLEMLDLSVNNLSGNIPAKLTRITS  682

Query  912   LNTLALSSNQFFAGLP  865
             L +  +S N+    +P
Sbjct  683   LKSFNVSYNKLEGEIP  698



>ref|XP_010064788.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=989

 Score =   117 bits (292),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 100/320 (31%), Positives = 152/320 (48%), Gaps = 32/320 (10%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNS  1279
             L  +T ++D   L  FKDS+D +S+     LSSWN     CE     + GI+C       
Sbjct  3     LAMQTNQTDQLALIYFKDSVDKDSL---GILSSWNDSSHHCE-----WPGIVC---GGRH  51

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
               R+  ++L   GL G L+P +GNL+ L +L L  N FRG IP SI +L ++ RL+LS N
Sbjct  52    PERVVSLNLMSKGLGGLLSPHVGNLSFLRSLVLQNNSFRGKIPQSIGHLFRLRRLVLSNN  111

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSG  922
              FSG +P  + +   LEV+++  N+L G IP  + +L +L  L L+ N LTG IP  +  
Sbjct  112   SFSGQMPTNLSQCSNLEVLNLIDNQLVGKIPHELGSLSKLRALFLAKNSLTGSIPCSIGN  171

Query  921   LWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG  742
             L QL +L++  N     +P                      +S+LR L  + L+ N+ +G
Sbjct  172   LSQLFSLSVGRNGLQGEIP--------------------ETLSKLRGLRNVQLAFNQLTG  211

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
              I   I  +  ++  +   N                L  LD   NL  G +P ++    N
Sbjct  212   KIPPAIFNMSSIIYFSAGDNQLRGSIPPNIGATLPSLDYLDFSRNLFTGVIPPSLSNASN  271

Query  561   LKTVNLGHNRFFGKIPKEYG  502
             L+ ++  HN F G +P   G
Sbjct  272   LQYISFDHNNFHGPMPTNLG  291


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 82/251 (33%), Positives = 116/251 (46%), Gaps = 32/251 (13%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLL-LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
               G +PDSI NL    RL+ +S N   G +P  +  L  L  +D+S+N LSG +P+ I A
Sbjct  332   LEGLLPDSIGNLSNSVRLIAMSSNTMYGTIPPSIGNLFNLSYLDLSNNSLSGHVPSCIGA  391

Query  990   LRELTRLDLSNNELTGKIPDLSG-------------------------LWQLNTLALSSN  886
             L  L  L LS N LTG+IP L G                           QL  L LS+N
Sbjct  392   LYNLRNLYLSINMLTGEIPSLIGNLTLLSLLYLPFNNFYGEIPQSLGNCRQLIELELSNN  451

Query  885   QFFAGLPPFPVrlrtlllghnlltgHISA-----ISRLRYLTALDLSDNRFSGPILHRIV  721
                  +P   + L T+ +  NL    +S      +  L  L  LDLS N+ +GPI   I 
Sbjct  452   NLSGPIPREVLSLSTISIIFNLAHNQLSGSLPSQVGSLTNLVELDLSYNKLTGPIPSSIS  511

Query  720   TLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLG  541
                 L R+N++ N F   E+  +      LQ LD   N L G +P  +   ++LK +NL 
Sbjct  512   KCLLLGRLNLAVNSFYG-EIPPALGTLRGLQELDVSHNDLSGEIPSFLTQLMDLKYLNLS  570

Query  540   HNRFFGKIPKE  508
              N+  G++PK+
Sbjct  571   SNKLEGEVPKQ  581


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = -3

Query  1269  ISVI-DLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             IS+I +L  + L G L  ++G+LT L  L+L+ NK  GPIP SI     + RL L+ N F
Sbjct  467   ISIIFNLAHNQLSGSLPSQVGSLTNLVELDLSYNKLTGPIPSSISKCLLLGRLNLAVNSF  526

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
              G +P  +  LR L+ +DVSHN LSG IP+ +T L +L  L+LS+N+L G++P  +    
Sbjct  527   YGEIPPALGTLRGLQELDVSHNDLSGEIPSFLTQLMDLKYLNLSSNKLEGEVPKQAVFLN  586

Query  912   LNTLALSSNQFFAG  871
             ++ + +  N+   G
Sbjct  587   VSAVFVYENRNLCG  600


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 129/309 (42%), Gaps = 35/309 (11%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSI-INLRKITRLLLSENFFSGG  1084
             + L  + L G + P I N++ +   +   N+ RG IP +I   L  +  L  S N F+G 
Sbjct  202   VQLAFNQLTGKIPPAIFNMSSIIYFSAGDNQLRGSIPPNIGATLPSLDYLDFSRNLFTGV  261

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNT  904
             +P  +     L+ I   HN   G +P  +  L+ L  + L +N+L      ++ L   + 
Sbjct  262   IPPSLSNASNLQYISFDHNNFHGPMPTNLGRLKALEEMFLMSNQLRDDFSFITSLTNCSM  321

Query  903   LAL--SSNQFFAGLPPFPVrlrtlllghnlltgHIS------AISRLRYLTALDLSDNRF  748
             L +    + F  GL P  +   +  +    ++ +        +I  L  L+ LDLS+N  
Sbjct  322   LEIIGVDHNFLEGLLPDSIGNLSNSVRLIAMSSNTMYGTIPPSIGNLFNLSYLDLSNNSL  381

Query  747   SGPILHRIVTLPELMRINVSANHFT-----------------------RIEVTKSSTKES  637
             SG +   I  L  L  + +S N  T                         E+ +S     
Sbjct  382   SGHVPSCIGALYNLRNLYLSINMLTGEIPSLIGNLTLLSLLYLPFNNFYGEIPQSLGNCR  441

Query  636   RLQVLDAHSNLLQGHLPLNIITYLNLKTV-NLGHNRFFGKIPKEYGsrlrslwrnlnLEY  460
             +L  L+  +N L G +P  +++   +  + NL HN+  G +P + G    +    L+L Y
Sbjct  442   QLIELELSNNNLSGPIPREVLSLSTISIIFNLAHNQLSGSLPSQVG--SLTNLVELDLSY  499

Query  459   NYLEGTLPS  433
             N L G +PS
Sbjct  500   NKLTGPIPS  508



>ref|XP_010455961.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase IMK2 [Camelina sativa]
Length=395

 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 119/400 (30%), Positives = 182/400 (46%), Gaps = 40/400 (10%)
 Frame = -3

Query  1458  LNAKTLESDVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLGILCMTPSDN  1282
             ++A  +  D   L++ + S+D    LP S F  SW+   DPC      F G+ C      
Sbjct  20    VDAIIVPVDFLALQAIRKSLDD---LPGSNFFDSWDFTSDPCS-----FAGVFC------  65

Query  1281  SSGRISVIDLEGD------GLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKIT  1120
                +++ ++L GD      GL G L P IG L+ LT L++   +  G +P +I   + + 
Sbjct  66    DGDKVTALNL-GDQKAGSPGLSGRLDPAIGKLSALTELSIVPGRIMGSLPHAISQAKNLR  124

Query  1119  RLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGK  940
              L +S NF SG +P  +  L  L+ +D+S+N+L+GSIP +I +L EL+ L L +N L G 
Sbjct  125   FLAISRNFLSGEIPASLGELTGLKTLDLSYNQLTGSIPPSIGSLPELSNLILCHNHLNGS  184

Query  939   IPDLSGLWQLNTLALSSNQFFAGLPPF---PVrlrtlllghnlltgHISAISRLRYLTAL  769
             IP       L  + L  N     +PP    P      L  + L       + RL  L  L
Sbjct  185   IPQFLS-QTLTRIDLKRNNLTGVIPPTSLPPSMQYLSLAWNQLTGRVDRVLLRLNQLNYL  243

Query  768   DLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHL  589
             DLS NRF+G I  +I   P +  + +  N F           E  +  +D   N   G L
Sbjct  244   DLSLNRFTGAIPGQIFAFP-ITNLQLQRNFFYG---AIQPANEVTIPTIDLSYNRFSGEL  299

Query  588   -PLNIITYLNLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGTLPSEFMTGG  415
              PL      N++ + L +NRF G++P  +    L +  + L L++N+L G   S      
Sbjct  300   SPL----LSNVQNLYLNNNRFTGQVPVSFVDRLLAANIQTLYLQHNFLTGIQISPAADIP  355

Query  414   EKARASLDHNCLNCPDHLPWCL--GGQ--RPASQCRRSAG  307
               +   L +NC+  P   P  +  G Q  RP +QC    G
Sbjct  356   VSSSLCLQYNCMVLPVQTPCPVKAGSQKTRPTTQCNEWRG  395



>emb|CDP03580.1| unnamed protein product [Coffea canephora]
Length=407

 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 121/394 (31%), Positives = 183/394 (46%), Gaps = 44/394 (11%)
 Frame = -3

Query  1434  DVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLG--ILCMTPSDNSSGRIS  1264
             D   L+S + S+D    LP S F +SW+   DPC   G + +G  ++ +   D  +G   
Sbjct  36    DFLALQSIRKSLDD---LPGSHFFASWDFTSDPCNFAGVYCVGDNVIALNLGDPRAG---  89

Query  1263  VIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
                    GL G L P IG L+ LT   +   +  GP+P+S+  L+ +  L +S NF SG 
Sbjct  90    -----SPGLTGRLDPAIGKLSALTEFTVVPGRIVGPLPESLSQLKNLRFLAVSRNFISGQ  144

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNT  904
             +P  + +LR L  +D+S N+L+GSIP ++ AL  L+ + L +N L+G +P       L  
Sbjct  145   IPATLGQLRGLHTLDLSFNQLAGSIPWSVGALPALSNVILCHNRLSGPVPPFVS-QTLTR  203

Query  903   LALSSNQFF-----AGLPP-FPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG  742
             L L  N        A LPP       +       +   +S ++RL Y   LDLS N+F+G
Sbjct  204   LDLKQNDLSGSLSPASLPPSLEYLSLSWNRFSGPVDRLLSGLNRLNY---LDLSLNQFTG  260

Query  741   PILHRIVTLPELMRINVSANHFTR-IEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYL  565
              I  R+ + P +  + +  N F+  +E     T    +  +D   N L G +     T  
Sbjct  261   CIPGRLFSFP-ITNLQLQRNLFSGPVEPVDQVT----IPTVDLSYNRLSGDISALFATVQ  315

Query  564   NLKTVNLGHNRFFGKIPKE-YGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARAS---  397
             NL    L +NRF G++P       L +  + L L++NYL G    +   G E   +S   
Sbjct  316   NLY---LNNNRFMGQVPNSLVDRLLSAGIQILYLQHNYLTGI---DINPGAEIPVSSSLC  369

Query  396   LDHNCLNCPDHLPWCL--GGQ--RPASQCRRSAG  307
             L +NC+  P   P  L  G Q  RP  QC    G
Sbjct  370   LQYNCMVPPLQTPCPLKAGKQKTRPTDQCIEWKG  403



>gb|KEH19361.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=890

 Score =   116 bits (291),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 105/313 (34%), Positives = 154/313 (49%), Gaps = 52/313 (17%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             +++ +DL  + LEG L PE+  L  LT L+L  N+F+G IP S+ NL K+T L +S N  
Sbjct  123   KLTHLDLSANFLEGQLPPELWLLKNLTFLDLFNNRFKGEIPSSLGNLSKLTHLNMSYNNL  182

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSGLW  916
              G LP  +  L KL  +D+S N L G +P ++  L +LT LDLS N L G++ P L  L 
Sbjct  183   EGQLPHSLGNLSKLTHLDLSANILKGQLPPSLANLSKLTHLDLSANFLKGQLPPSLGNLS  242

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPI  736
             +L  L LS+N     LP                    S +  L+ LT LDLS NRF G I
Sbjct  243   KLTHLDLSANFLKGQLP--------------------SELWLLKNLTFLDLSYNRFKGEI  282

Query  735   LHRIVTLPELMRINVSANH------------------------FTRIEVTKSSTKE----  640
                +  L +L  +N+S NH                         T ++++ +  K     
Sbjct  283   PSSLGNLKQLQHLNISHNHVQGFIPFELVFLKNIITFDLSHNRLTDLDLSSNYLKGPVGN  342

Query  639   -SRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLE  463
              ++LQ+L+   N +QG +PL +    N+ T++L HNR  G +P        +    L++ 
Sbjct  343   LNQLQLLNISHNNIQGSIPLELGFLRNIITLDLSHNRLNGNLPN--FLTNLTQLDYLDIS  400

Query  462   YNYLEGTLPSEFM  424
             YN L GTLPS+F 
Sbjct  401   YNLLIGTLPSKFF  413


 Score = 85.1 bits (209),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 117/251 (47%), Gaps = 32/251 (13%)
 Frame = -3

Query  1134  LRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNN  955
             LRKIT          G + + +  L KL  +D+S N L G +P  +  L+ LT LDL NN
Sbjct  105   LRKIT--------LEGTISKEIGHLSKLTHLDLSANFLEGQLPPELWLLKNLTFLDLFNN  156

Query  954   ELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYL  778
                G+IP  L  L +L  L +S N     LP                     ++  L  L
Sbjct  157   RFKGEIPSSLGNLSKLTHLNMSYNNLEGQLP--------------------HSLGNLSKL  196

Query  777   TALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQ  598
             T LDLS N   G +   +  L +L  +++SAN F + ++  S    S+L  LD  +N L+
Sbjct  197   THLDLSANILKGQLPPSLANLSKLTHLDLSAN-FLKGQLPPSLGNLSKLTHLDLSANFLK  255

Query  597   GHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTG  418
             G LP  +    NL  ++L +NRF G+IP   G       ++LN+ +N+++G +P E +  
Sbjct  256   GQLPSELWLLKNLTFLDLSYNRFKGEIPSSLG--NLKQLQHLNISHNHVQGFIPFELVFL  313

Query  417   GEKARASLDHN  385
                    L HN
Sbjct  314   KNIITFDLSHN  324


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 82/287 (29%), Positives = 133/287 (46%), Gaps = 45/287 (16%)
 Frame = -3

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
             PS  +  +++ +DL  + L+G L  E+  L  LT L+L+ N+F+G IP S+ NL+++  L
Sbjct  236   PSLGNLSKLTHLDLSANFLKGQLPSELWLLKNLTFLDLSYNRFKGEIPSSLGNLKQLQHL  295

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              +S N   G +P  +  L+ +   D+SHNR              LT LDLS+N L G + 
Sbjct  296   NISHNHVQGFIPFELVFLKNIITFDLSHNR--------------LTDLDLSSNYLKGPVG  341

Query  933   DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDN  754
             +L+   QL  L +S N     +P                      +  LR +  LDLS N
Sbjct  342   NLN---QLQLLNISHNNIQGSIPL--------------------ELGFLRNIITLDLSHN  378

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
             R +G + + +  L +L  +++S N       +K       L  +D   NL+ G +P +I 
Sbjct  379   RLNGNLPNFLTNLTQLDYLDISYNLLIGTLPSKFFPFNDNLFFMDLSHNLISGQIPSHIR  438

Query  573   TYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPS  433
              +  L   NL +N   G IP+            +++ YN LEG +P+
Sbjct  439   GFHEL---NLSNNNLTGTIPQS-----LCNVYYVDISYNCLEGPIPN  477



>emb|CDX69210.1| BnaC01g02430D [Brassica napus]
Length=1076

 Score =   116 bits (291),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 100/307 (33%), Positives = 160/307 (52%), Gaps = 17/307 (6%)
 Frame = -3

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
             G + V+DLEG+ L G +   +G +  L  L+L RN F G +P S++NL+++ RL L EN 
Sbjct  333   GSLGVLDLEGNRLTGLVPEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLDRLDLGEND  392

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG-L  919
              +G  P  +  L  L  +D+S NR +G +P +I+ L  L+ L+LS NE +G+IP   G L
Sbjct  393   LNGSFPVELMALTNLSDLDLSGNRFTGEVPVSISNLSNLSFLNLSGNEFSGEIPASVGNL  452

Query  918   WQLNTLALSSNQF-------FAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLS  760
             ++L +L LS            +GLP   V          L+    S++  LRY   ++LS
Sbjct  453   FKLTSLDLSKQNMSGEIPVELSGLPNLQVIALQENNFSGLVPEGFSSLVSLRY---VNLS  509

Query  759   DNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLN  580
              N FSG I      L  L+ +++S NH +   +       S L++L+  SN L G++P++
Sbjct  510   SNSFSGEIPQTFGFLRVLVALSLSDNHISG-SIPPEVGNCSALEILELRSNRLTGNIPVD  568

Query  579   IITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARA  400
             +     LK ++LG N   G+I       + S  ++L+L++N+L G +P  F      +R 
Sbjct  569   LSRLSRLKVMDLGRNNLSGEISP-----MSSSLQSLSLDHNHLSGVIPESFSRLSNLSRL  623

Query  399   SLDHNCL  379
              L  N L
Sbjct  624   DLSVNNL  630


 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 135/278 (49%), Gaps = 24/278 (9%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             +D+ G+   G +  EIG L  L  L L  N   G IP  I     +  L L  N  +G +
Sbjct  290   LDVSGNVFSGEIPAEIGGLKLLEELKLANNSLNGEIPVEIKQCGSLGVLDLEGNRLTGLV  349

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNT  904
             P ++  ++ L+V+ +  N  SG +P+++  L++L RLDL  N+L G  P +L  L  L+ 
Sbjct  350   PEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLDRLDLGENDLNGSFPVELMALTNLSD  409

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             L LS N+F   +P                     +IS L  L+ L+LS N FSG I   +
Sbjct  410   LDLSGNRFTGEVP--------------------VSISNLSNLSFLNLSGNEFSGEIPASV  449

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
               L +L  +++S  + +  E+    +    LQV+    N   G +P    + ++L+ VNL
Sbjct  450   GNLFKLTSLDLSKQNMSG-EIPVELSGLPNLQVIALQENNFSGLVPEGFSSLVSLRYVNL  508

Query  543   GHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSE  430
               N F G+IP+ +G     +  +L+   N++ G++P E
Sbjct  509   SSNSFSGEIPQTFGFLRVLVALSLSD--NHISGSIPPE  544


 Score = 72.4 bits (176),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 92/207 (44%), Gaps = 28/207 (14%)
 Frame = -3

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-  934
             LSEN  SG  P ++  +  L  +DVS N  SG IPA I  L+ L  L L+NN L G+IP 
Sbjct  268   LSENRISGRFPMWLTSIVSLTNLDVSGNVFSGEIPAEIGGLKLLEELKLANNSLNGEIPV  327

Query  933   DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDN  754
             ++     L  L L  N+    +P F                    +  ++ L  L L  N
Sbjct  328   EIKQCGSLGVLDLEGNRLTGLVPEF--------------------LGYMKALKVLSLGRN  367

Query  753   RFSGPILHRIVTLPELMRINVSANHFTR---IEVTKSSTKESRLQVLDAHSNLLQGHLPL  583
              FSG +   +V L +L R+++  N       +E+   +     L  LD   N   G +P+
Sbjct  368   SFSGYVPSSMVNLQQLDRLDLGENDLNGSFPVELMALTN----LSDLDLSGNRFTGEVPV  423

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEYG  502
             +I    NL  +NL  N F G+IP   G
Sbjct  424   SISNLSNLSFLNLSGNEFSGEIPASVG  450


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 69/250 (28%), Positives = 109/250 (44%), Gaps = 34/250 (14%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATI---  997
              +G +P ++ N   I  L  SEN   G +P     L  LEVI +S+N LSG++P ++   
Sbjct  175   LQGTLPSALSNCSSIVHLSASENAIGGVIPAAFGALPNLEVIALSNNNLSGTVPFSLLCN  234

Query  996   ----------TALRELTR-------------LDLSNNELTGKIPD-LSGLWQLNTLALSS  889
                        A  ++ R             LDLS N ++G+ P  L+ +  L  L +S 
Sbjct  235   TSLTIVRLGSNAFSDVVRPETVNCRSSGLQVLDLSENRISGRFPMWLTSIVSLTNLDVSG  294

Query  888   NQFFAGLPPFPVrlrtlllghnlltgHISA-----ISRLRYLTALDLSDNRFSGPILHRI  724
             N  F+G  P  +    LL    L    ++      I +   L  LDL  NR +G +   +
Sbjct  295   N-VFSGEIPAEIGGLKLLEELKLANNSLNGEIPVEIKQCGSLGVLDLEGNRLTGLVPEFL  353

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
               +  L  +++  N F+   V  S     +L  LD   N L G  P+ ++   NL  ++L
Sbjct  354   GYMKALKVLSLGRNSFSGY-VPSSMVNLQQLDRLDLGENDLNGSFPVELMALTNLSDLDL  412

Query  543   GHNRFFGKIP  514
               NRF G++P
Sbjct  413   SGNRFTGEVP  422


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 104/201 (52%), Gaps = 4/201 (2%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             +++ +DL    + G +  E+  L  L  + L  N F G +P+   +L  +  + LS N F
Sbjct  454   KLTSLDLSKQNMSGEIPVELSGLPNLQVIALQENNFSGLVPEGFSSLVSLRYVNLSSNSF  513

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLW  916
             SG +P+    LR L  + +S N +SGSIP  +     L  L+L +N LTG IP DLS L 
Sbjct  514   SGEIPQTFGFLRVLVALSLSDNHISGSIPPEVGNCSALEILELRSNRLTGNIPVDLSRLS  573

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI-SAISRLRYLTALDLSDNRFSGP  739
             +L  + L  N     + P    L++L L HN L+G I  + SRL  L+ LDLS N  +G 
Sbjct  574   RLKVMDLGRNNLSGEISPMSSSLQSLSLDHNHLSGVIPESFSRLSNLSRLDLSVNNLTGE  633

Query  738   ILHRIVTLPELMRINVSANHF  676
             I   I T   L+  NVS N+ 
Sbjct  634   IPPLIAT--NLVYFNVSNNNL  652


 Score = 65.5 bits (158),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 66/246 (27%), Positives = 114/246 (46%), Gaps = 24/246 (10%)
 Frame = -3

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPD  931
             +S N F+G +P  +  L +L+++++S+N+L+G+IPA++  L+ L  L L  N L G +P 
Sbjct  122   VSSNVFTGQIPSGLANLTQLQLLNLSYNQLNGAIPASLGKLQSLEYLWLDFNLLQGTLPS  181

Query  930   -LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDN  754
              LS    +  L+ S N     +P                    +A   L  L  + LS+N
Sbjct  182   ALSNCSSIVHLSASENAIGGVIP--------------------AAFGALPNLEVIALSNN  221

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIEVTKS-STKESRLQVLDAHSNLLQGHLPLNI  577
               SG +   ++    L  + + +N F+ +   ++ + + S LQVLD   N + G  P+ +
Sbjct  222   NLSGTVPFSLLCNTSLTIVRLGSNAFSDVVRPETVNCRSSGLQVLDLSENRISGRFPMWL  281

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARAS  397
              + ++L  +++  N F G+IP E G         L    N L G +P E    G      
Sbjct  282   TSIVSLTNLDVSGNVFSGEIPAEIGGLKLLEELKLAN--NSLNGEIPVEIKQCGSLGVLD  339

Query  396   LDHNCL  379
             L+ N L
Sbjct  340   LEGNRL  345


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 56/121 (46%), Gaps = 22/121 (18%)
 Frame = -3

Query  1161  GPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVS-----------------  1033
             G IP  + N   +  L L  N  +G +P  + RL +L+V+D+                  
Sbjct  539   GSIPPEVGNCSALEILELRSNRLTGNIPVDLSRLSRLKVMDLGRNNLSGEISPMSSSLQS  598

Query  1032  ----HNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLP  865
                 HN LSG IP + + L  L+RLDLS N LTG+IP L     L    +S+N     +P
Sbjct  599   LSLDHNHLSGVIPESFSRLSNLSRLDLSVNNLTGEIPPLIAT-NLVYFNVSNNNLKGEIP  657

Query  864   P  862
             P
Sbjct  658   P  658



>gb|KCW69037.1| hypothetical protein EUGRSUZ_F02592, partial [Eucalyptus grandis]
Length=993

 Score =   116 bits (291),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 151/317 (48%), Gaps = 32/317 (10%)
 Frame = -3

Query  1449  KTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGR  1270
             +T ++D   L  FKDS+D +S+     LSSWN     CE     + GI+C         R
Sbjct  2     QTNQTDQLALIYFKDSVDKDSL---GILSSWNDSSHHCE-----WPGIVC---GGRHPER  50

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             +  ++L   GL G L+P +GNL+ L +L L  N FRG IP SI +L ++ RL+LS N FS
Sbjct  51    VVSLNLMSKGLGGLLSPHVGNLSFLRSLVLQNNSFRGKIPQSIGHLFRLRRLVLSNNSFS  110

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQ  913
             G +P  + +   LEV+++  N+L G IP  + +L +L  L L+ N LTG IP  +  L Q
Sbjct  111   GQMPTNLSQCSNLEVLNLIDNQLVGKIPHELGSLSKLRALFLAKNSLTGSIPCSIGNLSQ  170

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L +L++  N     +P                      +S+LR L  + L+ N+ +G I 
Sbjct  171   LFSLSVGRNGLQGEIP--------------------ETLSKLRGLRNVQLAFNQLTGKIP  210

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKT  553
               I  +  ++  +   N                L  LD   NL  G +P ++    NL+ 
Sbjct  211   PAIFNMSSIIYFSAGDNQLRGSIPPNIGATLPSLDYLDFSRNLFTGVIPPSLSNASNLQY  270

Query  552   VNLGHNRFFGKIPKEYG  502
             ++  HN F G +P   G
Sbjct  271   ISFDHNNFHGPMPTNLG  287


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 82/251 (33%), Positives = 116/251 (46%), Gaps = 32/251 (13%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLL-LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
               G +PDSI NL    RL+ +S N   G +P  +  L  L  +D+S+N LSG +P+ I A
Sbjct  328   LEGLLPDSIGNLSNSVRLIAMSSNTMYGTIPPSIGNLFNLSYLDLSNNSLSGHVPSCIGA  387

Query  990   LRELTRLDLSNNELTGKIPDLSG-------------------------LWQLNTLALSSN  886
             L  L  L LS N LTG+IP L G                           QL  L LS+N
Sbjct  388   LYNLRNLYLSINMLTGEIPSLIGNLTLLSLLYLPFNNFYGEIPQSLGNCRQLIELELSNN  447

Query  885   QFFAGLPPFPVrlrtlllghnlltgHISA-----ISRLRYLTALDLSDNRFSGPILHRIV  721
                  +P   + L T+ +  NL    +S      +  L  L  LDLS N+ +GPI   I 
Sbjct  448   NLSGPIPREVLSLSTISIIFNLAHNQLSGSLPSQVGSLTNLVELDLSYNKLTGPIPSSIS  507

Query  720   TLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLG  541
                 L R+N++ N F   E+  +      LQ LD   N L G +P  +   ++LK +NL 
Sbjct  508   KCLLLGRLNLAVNSFYG-EIPPALGTLRGLQELDVSHNDLSGEIPSFLTQLMDLKYLNLS  566

Query  540   HNRFFGKIPKE  508
              N+  G++PK+
Sbjct  567   SNKLEGEVPKQ  577


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = -3

Query  1269  ISVI-DLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             IS+I +L  + L G L  ++G+LT L  L+L+ NK  GPIP SI     + RL L+ N F
Sbjct  463   ISIIFNLAHNQLSGSLPSQVGSLTNLVELDLSYNKLTGPIPSSISKCLLLGRLNLAVNSF  522

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
              G +P  +  LR L+ +DVSHN LSG IP+ +T L +L  L+LS+N+L G++P  +    
Sbjct  523   YGEIPPALGTLRGLQELDVSHNDLSGEIPSFLTQLMDLKYLNLSSNKLEGEVPKQAVFLN  582

Query  912   LNTLALSSNQFFAG  871
             ++ + +  N+   G
Sbjct  583   VSAVFVYENRNLCG  596


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 79/329 (24%), Positives = 128/329 (39%), Gaps = 75/329 (23%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSI-INLRKITRLLLSENFFSGG  1084
             + L  + L G + P I N++ +   +   N+ RG IP +I   L  +  L  S N F+G 
Sbjct  198   VQLAFNQLTGKIPPAIFNMSSIIYFSAGDNQLRGSIPPNIGATLPSLDYLDFSRNLFTGV  257

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNE----------------  952
             +P  +     L+ I   HN   G +P  +  L+ L  + L +N+                
Sbjct  258   IPPSLSNASNLQYISFDHNNFHGPMPTNLGRLKALEEMFLMSNQLRDDFSFITSLTNCSM  317

Query  951   ----------LTGKIPDLSGLW--QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgH  808
                       L G +PD  G     +  +A+SSN  +  +PP                  
Sbjct  318   LEIIGVDHNFLEGLLPDSIGNLSNSVRLIAMSSNTMYGTIPP------------------  359

Query  807   ISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFT---------------  673
               +I  L  L+ LDLS+N  SG +   I  L  L  + +S N  T               
Sbjct  360   --SIGNLFNLSYLDLSNNSLSGHVPSCIGALYNLRNLYLSINMLTGEIPSLIGNLTLLSL  417

Query  672   --------RIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTV-NLGHNRFFGK  520
                       E+ +S     +L  L+  +N L G +P  +++   +  + NL HN+  G 
Sbjct  418   LYLPFNNFYGEIPQSLGNCRQLIELELSNNNLSGPIPREVLSLSTISIIFNLAHNQLSGS  477

Query  519   IPKEYGsrlrslwrnlnLEYNYLEGTLPS  433
             +P + G    +    L+L YN L G +PS
Sbjct  478   LPSQVG--SLTNLVELDLSYNKLTGPIPS  504



>ref|XP_010249537.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 isoform X2 [Nelumbo nucifera]
Length=986

 Score =   116 bits (291),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 94/263 (36%), Positives = 135/263 (51%), Gaps = 25/263 (10%)
 Frame = -3

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
             P  + SG + ++DL  + L G +  +IG  T+L  L++  +  +G IP SI NL+K+  L
Sbjct  149   PRGSISG-LEILDLSNNLLSGEIPADIGLFTDLKVLDIGGSALKGKIPHSISNLKKLQFL  207

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              L+ N  +G +PR + ++R L+ I + +N LSG IP  I  L  L  LDL  N LTG+IP
Sbjct  208   TLASNQLAGEIPRELGQMRSLKWIYLGYNNLSGEIPKEIGDLTSLNHLDLVYNNLTGEIP  267

Query  933   -DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
               L  L  L  L L  N+    +P                     +I  LR L +LDLSD
Sbjct  268   SSLGNLTDLRYLFLYQNKLTGSIP--------------------LSIFDLRKLVSLDLSD  307

Query  756   NRFSGPILHRIVTLPELMRINVSANHFT-RIEVTKSSTKESRLQVLDAHSNLLQGHLPLN  580
             N  +GPI   ++ L +L  +++  N FT  I V  +S    RLQVL   SN L G +P N
Sbjct  308   NSLNGPIPELVIQLQDLQILHLFGNDFTGTIPVALASLP--RLQVLQLWSNRLSGEIPKN  365

Query  579   IITYLNLKTVNLGHNRFFGKIPK  511
             +    NL  ++L  N   GKIP+
Sbjct  366   LGKQNNLTVLDLSTNNLTGKIPE  388


 Score =   101 bits (251),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 84/265 (32%), Positives = 124/265 (47%), Gaps = 25/265 (9%)
 Frame = -3

Query  1161  GPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRE  982
             GPIP+ +I L+ +  L L  N F+G +P  +  L +L+V+ +  NRLSG IP  +     
Sbjct  312   GPIPELVIQLQDLQILHLFGNDFTGTIPVALASLPRLQVLQLWSNRLSGEIPKNLGKQNN  371

Query  981   LTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI  805
             LT LDLS N LTGKIP+ L  L  L  L L SN    G+P                    
Sbjct  372   LTVLDLSTNNLTGKIPERLCNLGGLYKLILFSNLLEGGIP--------------------  411

Query  804   SAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQV  625
              ++S  R L  + L +NRFSG +      LP +  +++S N+ T   + +       LQ+
Sbjct  412   KSLSYCRSLQRVRLQNNRFSGELSPEFTKLPLIYYLDISGNNLTG-RIDRRQWDMPSLQM  470

Query  624   LDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEG  445
             L    N   G+LP++  +   L+ ++L  N   G IP+ YG    S    L L  N + G
Sbjct  471   LSLARNRFTGNLPISFGSK-KLENLDLSENSISGTIPRSYG--GLSELTQLKLSQNQISG  527

Query  444   TLPSEFMTGGEKARASLDHNCLNCP  370
              +P E  +  +     L  N L+ P
Sbjct  528   FIPEELSSCTKLVTLDLSENHLSGP  552


 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 124/260 (48%), Gaps = 11/260 (4%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R+ V+ L  + L G +   +G    LT L+L+ N   G IP+ + NL  + +L+L  N  
Sbjct  347   RLQVLQLWSNRLSGEIPKNLGKQNNLTVLDLSTNNLTGKIPERLCNLGGLYKLILFSNLL  406

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW-  916
              GG+P+ +   R L+ + + +NR SG +    T L  +  LD+S N LTG+I      W 
Sbjct  407   EGGIPKSLSYCRSLQRVRLQNNRFSGELSPEFTKLPLIYYLDISGNNLTGRIDRRQ--WD  464

Query  915   --QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISR----LRYLTALDLSDN  754
                L  L+L+ N+F   L P     + L             I R    L  LT L LS N
Sbjct  465   MPSLQMLSLARNRFTGNL-PISFGSKKLENLDLSENSISGTIPRSYGGLSELTQLKLSQN  523

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
             + SG I   + +  +L+ +++S NH +   +  S  +   L  LD   N L G +P N+ 
Sbjct  524   QISGFIPEELSSCTKLVTLDLSENHLSG-PIPASLAEMPVLGELDLSENQLIGEIPANLG  582

Query  573   TYLNLKTVNLGHNRFFGKIP  514
                +L  VN+ HN F+G +P
Sbjct  583   KVESLVEVNISHNHFYGSLP  602


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 92/338 (27%), Positives = 140/338 (41%), Gaps = 82/338 (24%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSS  1276
             NA     D+++L SFK+SI+ +      FLSSWN  +  C     ++ GI C+     +S
Sbjct  38    NAVAEGDDLELLLSFKNSINDS----FRFLSSWNSSVAFC-----NWYGITCV-----NS  83

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
               +S I+L G  + G L+P +               FR         L  I  + LS N 
Sbjct  84    SHVSRIELSGKNISGELSPFL---------------FR---------LSFIESINLSNNE  119

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGS----------------------IPATITALRE  982
             F+G LP        L  +++S+N  +GS                      IPA I    +
Sbjct  120   FTGELPNETFSCLSLRYLNLSNNNFTGSIPRGSISGLEILDLSNNLLSGEIPADIGLFTD  179

Query  981   LTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI  805
             L  LD+  + L GKIP  +S L +L  L L+SNQ    +P                    
Sbjct  180   LKVLDIGGSALKGKIPHSISNLKKLQFLTLASNQLAGEIP--------------------  219

Query  804   SAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQV  625
               + ++R L  + L  N  SG I   I  L  L  +++  N+ T  E+  S    + L+ 
Sbjct  220   RELGQMRSLKWIYLGYNNLSGEIPKEIGDLTSLNHLDLVYNNLTG-EIPSSLGNLTDLRY  278

Query  624   LDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
             L  + N L G +PL+I     L +++L  N   G IP+
Sbjct  279   LFLYQNKLTGSIPLSIFDLRKLVSLDLSDNSLNGPIPE  316


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 78/149 (52%), Gaps = 5/149 (3%)
 Frame = -3

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
             P    S ++  +DL  + + G +    G L+ELT L L++N+  G IP+ + +  K+  L
Sbjct  483   PISFGSKKLENLDLSENSISGTIPRSYGGLSELTQLKLSQNQISGFIPEELSSCTKLVTL  542

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              LSEN  SG +P  +  +  L  +D+S N+L G IPA +  +  L  +++S+N   G +P
Sbjct  543   DLSENHLSGPIPASLAEMPVLGELDLSENQLIGEIPANLGKVESLVEVNISHNHFYGSLP  602

Query  933   DLSGLWQLNTLALSSNQFF-----AGLPP  862
                    +N+ A++ N        +GLPP
Sbjct  603   STGAFLAINSSAVTGNDLCGGNIASGLPP  631



>ref|XP_004502093.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase IMK2-like [Cicer arietinum]
Length=511

 Score =   115 bits (287),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 121/421 (29%), Positives = 185/421 (44%), Gaps = 81/421 (19%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL-DPCEATGTHFLGILCMTPSDNS  1279
             N K    D++ L S K+++   S    SF S+WN    +PC +    F G+ C     ++
Sbjct  119   NPKINPLDLKALLSIKNTLTELSS-SNSFFSTWNFTAPNPCSS----FSGVTC-----SN  168

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
               R++++ L  D L                         G +P SI  L ++T+L+LS  
Sbjct  169   INRVTILSLGTDTL----------------------PLAGSLPRSISQLTELTQLILSPG  206

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSG  922
               +G +P  + +L KL VI + +NR +GSIP+T ++L  L  LDLS+N+LTG I P L+ 
Sbjct  207   IVTGSIPPQLAQLTKLRVISLPNNRFTGSIPSTFSSLTNLHTLDLSHNQLTGSIPPSLTE  266

Query  921   LWQLNTLALSSNQFFAGLP---PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNR  751
             L QL  L L+SN     LP     P+    L           S  S LRYL+   LS NR
Sbjct  267   LPQLRILILASNSVTGSLPENVSSPLIHLDLKNNQLTGPLPTSIPSSLRYLS---LSQNR  323

Query  750   FSGPILHRIVTLPELMRINVSANHF--------------------------------TRI  667
               GP+ + + +L EL+ +++S N F                                   
Sbjct  324   MWGPLTNGLESLSELVFLDLSMNQFFGPIPAQLFFRPTLSSLLLQRNNLSGGLPQRPNDK  383

Query  666   EVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEY-Gsrlr  490
             E +  S+   +  ++D   N L G L      +  ++++ L +NR  G++P+EY     R
Sbjct  384   EPSIGSSSYGQGSIVDLSHNSLSGELS---TVFDGVESLFLNNNRLMGRVPEEYVKGVCR  440

Query  489   slwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCPDHL---PWCLGGQ--RPASQ  325
                R L L++NY  G    E     +     L +NC+  P  L   P   G Q  RPA+Q
Sbjct  441   GSTRTLYLQHNYFTGIPLEEGTVMPDTVSLCLSYNCMEPPATLMTCPASAGDQLSRPAAQ  500

Query  324   C  322
             C
Sbjct  501   C  501



>ref|WP_039118712.1| hypothetical protein, partial [Flavobacterium sp. JRM]
Length=364

 Score =   112 bits (281),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 124/228 (54%), Gaps = 10/228 (4%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             K  G IP  I  L  +  L L++N F+G +P  + +L++L+V+D+  N+L+G IP +I  
Sbjct  51    KVTGNIPPEIGQLENLQILYLNQNEFTGTIPLEIMQLKQLQVVDLRANKLTGEIPVSIKE  110

Query  990   LRELTRLDLSNNELTGKIPDLSGLWQLNT---LALSSNQFFAGLPPFPVrlrtlllghnl  820
             L +L  L+L +N+LTG IP  SG+ QL     LALS+NQ   G+ P  V+L  L L    
Sbjct  111   LTKLKTLNLGSNQLTGTIP--SGIGQLENLEMLALSNNQLTGGIIPEIVKLSKLYLLFLN  168

Query  819   ltgHI----SAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKS  652
                      S I +L YL  + L  N+ SGPI   +  L  L+ ++++ N F+  E+ K 
Sbjct  169   NNLLTGPIPSGIGQLEYLKEIYLYTNKLSGPIPKELGLLSNLITLSLNYNQFSG-EIPKE  227

Query  651   STKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
                  +L+ L    N L G +P  I T L+L+ ++LG N+  G IP E
Sbjct  228   LGNLKKLKTLYLSVNQLAGLVPPEIYTLLDLEALHLGENQLTGTIPLE  275


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 121/245 (49%), Gaps = 24/245 (10%)
 Frame = -3

Query  1152  PDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTR  973
             P  I  L+ +T   ++ N  +G +P  + +L  L+++ ++ N  +G+IP  I  L++L  
Sbjct  33    PAEIEELKYLTYFNVNVNKVTGNIPPEIGQLENLQILYLNQNEFTGTIPLEIMQLKQLQV  92

Query  972   LDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAI  796
             +DL  N+LTG+IP  +  L +L TL L SNQ    +P                    S I
Sbjct  93    VDLRANKLTGEIPVSIKELTKLKTLNLGSNQLTGTIP--------------------SGI  132

Query  795   SRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDA  616
              +L  L  L LS+N+ +G I+  IV L +L  + ++ N  T   +     +   L+ +  
Sbjct  133   GQLENLEMLALSNNQLTGGIIPEIVKLSKLYLLFLNNNLLTG-PIPSGIGQLEYLKEIYL  191

Query  615   HSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLP  436
             ++N L G +P  +    NL T++L +N+F G+IPKE G       + L L  N L G +P
Sbjct  192   YTNKLSGPIPKELGLLSNLITLSLNYNQFSGEIPKELG--NLKKLKTLYLSVNQLAGLVP  249

Query  435   SEFMT  421
              E  T
Sbjct  250   PEIYT  254


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 101/195 (52%), Gaps = 29/195 (15%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             I L  + L G +  E+G L+ L TL+LN N+F G IP  + NL+K+  L LS N  +G +
Sbjct  189   IYLYTNKLSGPIPKELGLLSNLITLSLNYNQFSGEIPKELGNLKKLKTLYLSVNQLAGLV  248

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG-LWQLNT  904
             P  +  L  LE + +  N+L+G+IP  I  +  LT L  +NN+ TG IP   G L +LN+
Sbjct  249   PPEIYTLLDLEALHLGENQLTGTIPLEINKMTNLTFLAFNNNKFTGIIPPAIGQLTKLNS  308

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYL-TALDLSDNRFSGPILHR  727
             L L +NQF   +P                    S IS+L  L +A +LS N   GPI   
Sbjct  309   LFLHANQFSGSIP--------------------SEISQLTNLSSAFNLSYNLLEGPI---  345

Query  726   IVTLPELMRINVSAN  682
                 P L +I +SAN
Sbjct  346   ----PNLDKIGLSAN  356


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/230 (29%), Positives = 108/230 (47%), Gaps = 21/230 (9%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
              + ++ L  + L G + PEI  L++L  L LN N   GPIP  I  L  +  + L  N  
Sbjct  137   NLEMLALSNNQLTGGIIPEIVKLSKLYLLFLNNNLLTGPIPSGIGQLEYLKEIYLYTNKL  196

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLW  916
             SG +P+ +  L  L  + +++N+ SG IP  +  L++L  L LS N+L G +P ++  L 
Sbjct  197   SGPIPKELGLLSNLITLSLNYNQFSGEIPKELGNLKKLKTLYLSVNQLAGLVPPEIYTLL  256

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPI  736
              L  L L  NQ    +P                      I+++  LT L  ++N+F+G I
Sbjct  257   DLEALHLGENQLTGTIP--------------------LEINKMTNLTFLAFNNNKFTGII  296

Query  735   LHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLP  586
                I  L +L  + + AN F+    ++ S   +     +   NLL+G +P
Sbjct  297   PPAIGQLTKLNSLFLHANQFSGSIPSEISQLTNLSSAFNLSYNLLEGPIP  346


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 1/132 (1%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             ++  + L  + L G + PEI  L +L  L+L  N+  G IP  I  +  +T L  + N F
Sbjct  233   KLKTLYLSVNQLAGLVPPEIYTLLDLEALHLGENQLTGTIPLEINKMTNLTFLAFNNNKF  292

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTR-LDLSNNELTGKIPDLSGLW  916
             +G +P  + +L KL  + +  N+ SGSIP+ I+ L  L+   +LS N L G IP+L  + 
Sbjct  293   TGIIPPAIGQLTKLNSLFLHANQFSGSIPSEISQLTNLSSAFNLSYNLLEGPIPNLDKIG  352

Query  915   QLNTLALSSNQF  880
                   L  N+F
Sbjct  353   LSANFGLHGNKF  364



>gb|KCW62999.1| hypothetical protein EUGRSUZ_G00600, partial [Eucalyptus grandis]
Length=827

 Score =   116 bits (290),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 96/310 (31%), Positives = 143/310 (46%), Gaps = 30/310 (10%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             ++D   L SFK++I  +   P   LSSWN     CE     + G+LC   S    GR++ 
Sbjct  14    QTDRLALASFKNAIHKD---PFGVLSSWNDSTHHCE-----WQGVLC---SKRHPGRVTS  62

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             + L   GL+GFL+ ++GNL+ L  + L  N F G I   I NL  +  L LS N F G +
Sbjct  63    LVLRSQGLKGFLSSQVGNLSFLRVIFLQNNSFHGEISPQISNLLHLRVLFLSNNSFGGPI  122

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTL  901
             P  + R   LE++++  N+L G I + + +L  L  L L+ N L G IP   G   L   
Sbjct  123   PSNLSRCSNLEILNLIDNQLVGGIHSNLGSLTRLKYLGLTQNSLVGPIPRSIGNLSLLDH  182

Query  900   ALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIV  721
                S    +G  P                   + +SRL+ LT   LS N+ +G +   I+
Sbjct  183   LSLSRNVLSGEIP-------------------AELSRLKRLTFFQLSLNKLTGEVPAGIL  223

Query  720   TLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLG  541
              + +L   +VS N  +        T    LQ+  A  NL  G +P  ++    L+  +L 
Sbjct  224   NISDLFLFDVSYNQLSGSFFNDVGTTSPSLQIFGARDNLFTGMIPSTLMNATGLRLFSLS  283

Query  540   HNRFFGKIPK  511
             +N F G IPK
Sbjct  284   NNNFHGPIPK  293


 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 99/201 (49%), Gaps = 23/201 (11%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             +S +DL  + L   +   IG L+ L  L L  N F G IP  I N+  +  L LS+N F 
Sbjct  376   LSFLDLTDNFLTDCIPHSIGALSNLQKLLLGGNMFTGEIPSLIGNITSLNLLDLSDNIFQ  435

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATIT--ALRELTRLDLSNNELTGKIP-DLSGL  919
             G +P+ +   ++L ++D+S+N L GSIP  I   +L+ L  +DLS N LTG IP  +S  
Sbjct  436   GYIPQSLGNCKQLILLDLSNNNLIGSIPVEIVVGSLKNLGVIDLSYNGLTGLIPTSISEC  495

Query  918   WQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGP  739
               L  L L +N F   +P                     A   LR L  LDLS+N FSGP
Sbjct  496   LVLEKLYLEANSFHGQIP--------------------EAFRPLRGLQELDLSNNNFSGP  535

Query  738   ILHRIVTLPELMRINVSANHF  676
             I   +  L  LM +N+S N  
Sbjct  536   IPSFLAELSLLMYLNLSFNQL  556


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 101/219 (46%), Gaps = 27/219 (12%)
 Frame = -3

Query  1146  SIINLRKITRLLLSENFFSGGLPRYMRRLR-KLEVIDVSHNRLSGSIPATITALRELTRL  970
             S++N   +  L +  N   G LPR +  L   +E I + +NR+ GSIP  +  L  L+ L
Sbjct  320   SLVNCSSLEILEMRRNLIHGSLPRSISYLSTSIERICLGNNRIQGSIPLALGNLFNLSFL  379

Query  969   DLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAIS  793
             DL++N LT  IP  +  L  L  L L  N F   +P                    S I 
Sbjct  380   DLTDNFLTDCIPHSIGALSNLQKLLLGGNMFTGEIP--------------------SLIG  419

Query  792   RLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTR---IEVTKSSTKESRLQVL  622
              +  L  LDLSDN F G I   +    +L+ +++S N+      +E+   S K   L V+
Sbjct  420   NITSLNLLDLSDNIFQGYIPQSLGNCKQLILLDLSNNNLIGSIPVEIVVGSLKN--LGVI  477

Query  621   DAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEY  505
             D   N L G +P +I   L L+ + L  N F G+IP+ +
Sbjct  478   DLSYNGLTGLIPTSISECLVLEKLYLEANSFHGQIPEAF  516


 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 100/221 (45%), Gaps = 20/221 (9%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             + +G IP ++ NL  ++ L L++NF +  +P  +  L  L+ + +  N  +G IP+ I  
Sbjct  361   RIQGSIPLALGNLFNLSFLDLTDNFLTDCIPHSIGALSNLQKLLLGGNMFTGEIPSLIGN  420

Query  990   LRELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnllt  814
             +  L  LDLS+N   G IP  L    QL  L LS+N     +P   V             
Sbjct  421   ITSLNLLDLSDNIFQGYIPQSLGNCKQLILLDLSNNNLIGSIPVEIV-------------  467

Query  813   gHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESR  634
                  +  L+ L  +DLS N  +G I   I     L ++ + AN F   ++ ++      
Sbjct  468   -----VGSLKNLGVIDLSYNGLTGLIPTSISECLVLEKLYLEANSFHG-QIPEAFRPLRG  521

Query  633   LQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
             LQ LD  +N   G +P  +     L  +NL  N+  G++PK
Sbjct  522   LQELDLSNNNFSGPIPSFLAELSLLMYLNLSFNQLEGQVPK  562


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 76/138 (55%), Gaps = 3/138 (2%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEI--GnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             ++ ++DL  + L G +  EI  G+L  L  ++L+ N   G IP SI     + +L L  N
Sbjct  447   QLILLDLSNNNLIGSIPVEIVVGSLKNLGVIDLSYNGLTGLIPTSISECLVLEKLYLEAN  506

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGL  919
              F G +P   R LR L+ +D+S+N  SG IP+ +  L  L  L+LS N+L G++P     
Sbjct  507   SFHGQIPEAFRPLRGLQELDLSNNNFSGPIPSFLAELSLLMYLNLSFNQLEGQVPKGGLF  566

Query  918   WQLNTLALSSN-QFFAGL  868
               ++++++  N + + G+
Sbjct  567   LNVSSVSIYGNTELYGGV  584



>ref|XP_003620837.1| Receptor-like protein kinase [Medicago truncatula]
 gb|KEH15854.1| leucine-rich receptor-like kinase family protein, putative [Medicago 
truncatula]
Length=432

 Score =   113 bits (283),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 85/259 (33%), Positives = 144/259 (56%), Gaps = 26/259 (10%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             +++ +++  + LEG L   +GNL++LT L+L+ N  +G +P S+ NL K+T L LS NF 
Sbjct  186   KLTHLNMSYNNLEGQLPHSLGNLSKLTHLDLSANILKGQLPPSLANLSKLTHLDLSANFL  245

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLW  916
              G LP  +  L+ L  +D+S+NR  G IP+++  L++L  LD+S+N + G IP +L  L 
Sbjct  246   KGQLPSELWLLKNLTFLDLSYNRFKGQIPSSLGNLKQLENLDISDNYIEGHIPFELGFLK  305

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPI  736
              L+TL LS+N F   +P                    S++  L+ L  L++S N   G I
Sbjct  306   NLSTLGLSNNIFKGEIP--------------------SSLGNLKQLQHLNISHNHVQGFI  345

Query  735   LHRIVTLPELMRINVSANHFTRIEVTKSSTKE-----SRLQVLDAHSNLLQGHLPLNIIT  571
                +V L  ++  ++S N  T ++++ +  K      ++LQ+L+   N +QG +PL +  
Sbjct  346   PFELVFLKNIITFDLSHNRLTDLDLSSNYLKGPVGNLNQLQLLNISHNNIQGSIPLELGF  405

Query  570   YLNLKTVNLGHNRFFGKIP  514
               N+ T++L HNR  G +P
Sbjct  406   LRNIITLDLSHNRLNGNLP  424


 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 129/251 (51%), Gaps = 26/251 (10%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             +++ +DL  + LEG L PE+  L  LT L+L  N+F+G IP S+ NL K+T L +S N  
Sbjct  138   KLTHLDLSANFLEGQLPPELWLLKNLTFLDLFNNRFKGEIPSSLGNLSKLTHLNMSYNNL  197

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQ  913
              G LP  +  L KL  +D+S N L G +P ++  L +LT LDLS N L G++P  S LW 
Sbjct  198   EGQLPHSLGNLSKLTHLDLSANILKGQLPPSLANLSKLTHLDLSANFLKGQLP--SELWL  255

Query  912   LNTLA---LSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSG  742
             L  L    LS N+F   +P                    S++  L+ L  LD+SDN   G
Sbjct  256   LKNLTFLDLSYNRFKGQIP--------------------SSLGNLKQLENLDISDNYIEG  295

Query  741   PILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLN  562
              I   +  L  L  + +S N F + E+  S     +LQ L+   N +QG +P  ++   N
Sbjct  296   HIPFELGFLKNLSTLGLSNNIF-KGEIPSSLGNLKQLQHLNISHNHVQGFIPFELVFLKN  354

Query  561   LKTVNLGHNRF  529
             + T +L HNR 
Sbjct  355   IITFDLSHNRL  365


 Score =   102 bits (253),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 130/268 (49%), Gaps = 24/268 (9%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITAL  988
               G I   I +L K+T L LS NF  G LP  +  L+ L  +D+ +NR  G IP+++  L
Sbjct  125   LEGTISKEIGHLSKLTHLDLSANFLEGQLPPELWLLKNLTFLDLFNNRFKGEIPSSLGNL  184

Query  987   RELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltg  811
              +LT L++S N L G++P  L  L +L  L LS+N     LPP                 
Sbjct  185   SKLTHLNMSYNNLEGQLPHSLGNLSKLTHLDLSANILKGQLPP-----------------  227

Query  810   HISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRL  631
                +++ L  LT LDLS N   G +   +  L  L  +++S N F + ++  S     +L
Sbjct  228   ---SLANLSKLTHLDLSANFLKGQLPSELWLLKNLTFLDLSYNRF-KGQIPSSLGNLKQL  283

Query  630   QVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYL  451
             + LD   N ++GH+P  +    NL T+ L +N F G+IP   G       ++LN+ +N++
Sbjct  284   ENLDISDNYIEGHIPFELGFLKNLSTLGLSNNIFKGEIPSSLG--NLKQLQHLNISHNHV  341

Query  450   EGTLPSEFMTGGEKARASLDHNCLNCPD  367
             +G +P E +         L HN L   D
Sbjct  342   QGFIPFELVFLKNIITFDLSHNRLTDLD  369


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 74/145 (51%), Gaps = 30/145 (21%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             ++  +D+  + +EG +  E+G L  L+TL L+ N F+G IP S+ NL+++  L +S N  
Sbjct  282   QLENLDISDNYIEGHIPFELGFLKNLSTLGLSNNIFKGEIPSSLGNLKQLQHLNISHNHV  341

Query  1092  SGGLP--------------------------RYMR----RLRKLEVIDVSHNRLSGSIPA  1003
              G +P                           Y++     L +L+++++SHN + GSIP 
Sbjct  342   QGFIPFELVFLKNIITFDLSHNRLTDLDLSSNYLKGPVGNLNQLQLLNISHNNIQGSIPL  401

Query  1002  TITALRELTRLDLSNNELTGKIPDL  928
              +  LR +  LDLS+N L G +P+ 
Sbjct  402   ELGFLRNIITLDLSHNRLNGNLPNF  426



>ref|XP_002871261.1| extra sporogenous cells [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47520.1| extra sporogenous cells [Arabidopsis lyrata subsp. lyrata]
Length=1180

 Score =   116 bits (290),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 95/307 (31%), Positives = 148/307 (48%), Gaps = 12/307 (4%)
 Frame = -3

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
             P D S   +  +DL+ +   G +   +   T L   + + N+  G +P  I N   +TRL
Sbjct  406   PEDLSKLPLMAVDLDSNNFTGEIPKSLWKSTNLMEFSASYNRLEGYLPAEIGNAASLTRL  465

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
             +LS+N   G +PR + +L  L V++++ N+L G IP  +     LT LDL NN L G+IP
Sbjct  466   VLSDNQLKGEIPREIGKLTSLSVLNLNSNKLQGKIPKELGDCTCLTTLDLGNNNLQGQIP  525

Query  933   D-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
             D ++GL QL  L LS N     +P  P                +  +S L++    DLS 
Sbjct  526   DRITGLSQLQCLVLSYNNLSGSIPSKP--------SAYFHQIDMPDLSFLQHHGIFDLSY  577

Query  756   NRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             NR SG I   +     L+ I +S NH +  E+  S ++ + L +LD   N L G +P  +
Sbjct  578   NRLSGSIPEELGNCVVLVEILLSNNHLSG-EIPASLSRLTNLTILDLSGNALTGSIPKEM  636

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARAS  397
                L L+ +NL +N+  G IP+ +G     +  NL    N L+G++P+      E     
Sbjct  637   GHSLKLQGLNLANNQLNGYIPESFGLLDSLVKLNLTK--NKLDGSVPASLGNLKELTHMD  694

Query  396   LDHNCLN  376
             L  N L+
Sbjct  695   LSFNNLS  701


 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 95/326 (29%), Positives = 145/326 (44%), Gaps = 34/326 (10%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             +S +D+  + L G + PEIG L+ L+ L +  N F G IP  + N+  +        FF 
Sbjct  152   LSSLDVSNNSLSGEIPPEIGKLSNLSDLYMGLNSFSGQIPPEVGNISLLKNFGAPSCFFK  211

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSGLWQ  913
             G LP+ + +L+ L  +D+S+N L  SIP +   L+ L+ L+L + EL G I P+L     
Sbjct  212   GPLPKEISKLKHLAKLDLSYNPLKCSIPKSFGELQNLSILNLVSAELIGLIPPELGKCKS  271

Query  912   LNTLALSSNQFFAGLP----PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
             L TL LS N     LP      P+   +        +   S I + + L +L L++NRFS
Sbjct  272   LKTLMLSFNSLSGSLPLELSEIPLLTFSAERNQLSGSLP-SWIGKWKVLDSLLLANNRFS  330

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQ-----------  598
             G I   I   P L  +++++N  T   + +       L+ +D   NLL            
Sbjct  331   GEIPREIEDCPMLKHLSLASNLLTG-SIPRELCGSGSLEEIDLSGNLLSGTIEEVFNGCS  389

Query  597   -------------GHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYN  457
                          G +P + ++ L L  V+L  N F G+IPK       +     +  YN
Sbjct  390   SLVELVLTNNQINGSIPED-LSKLPLMAVDLDSNNFTGEIPKSL--WKSTNLMEFSASYN  446

Query  456   YLEGTLPSEFMTGGEKARASLDHNCL  379
              LEG LP+E        R  L  N L
Sbjct  447   RLEGYLPAEIGNAASLTRLVLSDNQL  472


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 87/275 (32%), Positives = 125/275 (45%), Gaps = 25/275 (9%)
 Frame = -3

Query  1251  EGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRY  1072
             E + L G L   IG    L +L L  N+F G IP  I +   +  L L+ N  +G +PR 
Sbjct  301   ERNQLSGSLPSWIGKWKVLDSLLLANNRFSGEIPREIEDCPMLKHLSLASNLLTGSIPRE  360

Query  1071  MRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNTLAL  895
             +     LE ID+S N LSG+I         L  L L+NN++ G IP DLS L  L  + L
Sbjct  361   LCGSGSLEEIDLSGNLLSGTIEEVFNGCSSLVELVLTNNQINGSIPEDLSKL-PLMAVDL  419

Query  894   SSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTL  715
              SN F   +P                     ++ +   L     S NR  G +   I   
Sbjct  420   DSNNFTGEIP--------------------KSLWKSTNLMEFSASYNRLEGYLPAEIGNA  459

Query  714   PELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHN  535
               L R+ +S N   + E+ +   K + L VL+ +SN LQG +P  +     L T++LG+N
Sbjct  460   ASLTRLVLSDNQL-KGEIPREIGKLTSLSVLNLNSNKLQGKIPKELGDCTCLTTLDLGNN  518

Query  534   RFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSE  430
                G+IP        S  + L L YN L G++PS+
Sbjct  519   NLQGQIPDRI--TGLSQLQCLVLSYNNLSGSIPSK  551


 Score = 84.7 bits (208),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 126/269 (47%), Gaps = 34/269 (13%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             +SV++L  + L+G +  E+G+ T LTTL+L  N  +G IPD I  L ++  L+LS N  S
Sbjct  486   LSVLNLNSNKLQGKIPKELGDCTCLTTLDLGNNNLQGQIPDRITGLSQLQCLVLSYNNLS  545

Query  1089  GGLPR----YMRR--------LRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELT  946
             G +P     Y  +        L+   + D+S+NRLSGSIP  +     L  + LSNN L+
Sbjct  546   GSIPSKPSAYFHQIDMPDLSFLQHHGIFDLSYNRLSGSIPEELGNCVVLVEILLSNNHLS  605

Query  945   GKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTAL  769
             G+IP  LS L  L  L LS N     +P                      +     L  L
Sbjct  606   GEIPASLSRLTNLTILDLSGNALTGSIP--------------------KEMGHSLKLQGL  645

Query  768   DLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHL  589
             +L++N+ +G I      L  L+++N++ N      V  S      L  +D   N L G L
Sbjct  646   NLANNQLNGYIPESFGLLDSLVKLNLTKNKLDG-SVPASLGNLKELTHMDLSFNNLSGEL  704

Query  588   PLNIITYLNLKTVNLGHNRFFGKIPKEYG  502
                + T + L  + +  N+F G+IP E G
Sbjct  705   SSELSTMVKLVGLYIEQNKFTGEIPSELG  733


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 108/232 (47%), Gaps = 19/232 (8%)
 Frame = -3

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQ  913
             G +P+ +  L+ L+ + ++ N+ SG IP+ I  L++L  LDLS N LTG +P  LS L Q
Sbjct  67    GRIPKEISTLKNLKELRLAGNQFSGKIPSEIWKLKQLQTLDLSGNSLTGLLPSQLSELHQ  126

Query  912   LNTLALSSNQFFAGLPP-----FPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRF  748
             L  L LS N F   LPP     FP      +  ++L       I +L  L+ L +  N F
Sbjct  127   LLYLDLSDNHFSGSLPPSFFLSFPALSSLDVSNNSLSGEIPPEIGKLSNLSDLYMGLNSF  186

Query  747   SGPILHRIVTLPELMRINVSANH-----FTRIEVTKSSTKESRLQVLDAHSNLLQGHLPL  583
             SG I       PE+  I++  N      F +  + K  +K   L  LD   N L+  +P 
Sbjct  187   SGQI------PPEVGNISLLKNFGAPSCFFKGPLPKEISKLKHLAKLDLSYNPLKCSIPK  240

Query  582   NIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEF  427
             +     NL  +NL      G IP E G       + L L +N L G+LP E 
Sbjct  241   SFGELQNLSILNLVSAELIGLIPPELG--KCKSLKTLMLSFNSLSGSLPLEL  290


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 100/341 (29%), Positives = 147/341 (43%), Gaps = 48/341 (14%)
 Frame = -3

Query  1317  FLGILCM---TPSDNSSGR-ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIP  1150
             ++G+ C+    P + S+ + +  + L G+   G +  EI  L +L TL+L+ N   G +P
Sbjct  59    WVGVTCLFGRIPKEISTLKNLKELRLAGNQFSGKIPSEIWKLKQLQTLDLSGNSLTGLLP  118

Query  1149  DSIINLRKITRLLLSENFFSGGL-PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTR  973
               +  L ++  L LS+N FSG L P +      L  +DVS+N LSG IP  I  L  L+ 
Sbjct  119   SQLSELHQLLYLDLSDNHFSGSLPPSFFLSFPALSSLDVSNNSLSGEIPPEIGKLSNLSD  178

Query  972   LDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAIS  793
             L +  N  +G+IP   G   L     + + FF G  P P                   IS
Sbjct  179   LYMGLNSFSGQIPPEVGNISLLKNFGAPSCFFKG--PLP-----------------KEIS  219

Query  792   RLRYLTALDLSDNRFSGPILHRIVTLPELMRIN-VSANHFTRI--EVTKSST--------  646
             +L++L  LDLS N     I      L  L  +N VSA     I  E+ K  +        
Sbjct  220   KLKHLAKLDLSYNPLKCSIPKSFGELQNLSILNLVSAELIGLIPPELGKCKSLKTLMLSF  279

Query  645   -----------KESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGs  499
                         E  L    A  N L G LP  I  +  L ++ L +NRF G+IP+E   
Sbjct  280   NSLSGSLPLELSEIPLLTFSAERNQLSGSLPSWIGKWKVLDSLLLANNRFSGEIPREI--  337

Query  498   rlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLN  376
                 + ++L+L  N L G++P E    G      L  N L+
Sbjct  338   EDCPMLKHLSLASNLLTGSIPRELCGSGSLEEIDLSGNLLS  378


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 88/218 (40%), Gaps = 47/218 (22%)
 Frame = -3

Query  1023  LSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrl  847
             L G IP  I+ L+ L  L L+ N+ +GKIP ++  L QL TL LS N     LP      
Sbjct  65    LFGRIPKEISTLKNLKELRLAGNQFSGKIPSEIWKLKQLQTLDLSGNSLTGLLP------  118

Query  846   rtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRI  667
                           S +S L  L  LDLSDN FSG       +LP    ++  A      
Sbjct  119   --------------SQLSELHQLLYLDLSDNHFSG-------SLPPSFFLSFPA------  151

Query  666   EVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrs  487
                        L  LD  +N L G +P  I    NL  + +G N F G+IP E G+    
Sbjct  152   -----------LSSLDVSNNSLSGEIPPEIGKLSNLSDLYMGLNSFSGQIPPEVGNISLL  200

Query  486   lwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNC  373
                       + +G LP E       A+  L +N L C
Sbjct  201   KNFGAPS--CFFKGPLPKEISKLKHLAKLDLSYNPLKC  236


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 78/136 (57%), Gaps = 1/136 (1%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             ++++DL G+ L G +  E+G+  +L  LNL  N+  G IP+S   L  + +L L++N   
Sbjct  618   LTILDLSGNALTGSIPKEMGHSLKLQGLNLANNQLNGYIPESFGLLDSLVKLNLTKNKLD  677

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQ  913
             G +P  +  L++L  +D+S N LSG + + ++ + +L  L +  N+ TG+IP +L  L Q
Sbjct  678   GSVPASLGNLKELTHMDLSFNNLSGELSSELSTMVKLVGLYIEQNKFTGEIPSELGNLTQ  737

Query  912   LNTLALSSNQFFAGLP  865
             L  L +S N     +P
Sbjct  738   LEYLDVSENLLSGEIP  753


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 1/137 (1%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             ++  ++L  + L G++    G L  L  LNL +NK  G +P S+ NL+++T + LS N  
Sbjct  641   KLQGLNLANNQLNGYIPESFGLLDSLVKLNLTKNKLDGSVPASLGNLKELTHMDLSFNNL  700

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLW  916
             SG L   +  + KL  + +  N+ +G IP+ +  L +L  LD+S N L+G+IP  + GL 
Sbjct  701   SGELSSELSTMVKLVGLYIEQNKFTGEIPSELGNLTQLEYLDVSENLLSGEIPTKICGLP  760

Query  915   QLNTLALSSNQFFAGLP  865
              L  L L+ N     +P
Sbjct  761   NLEFLNLAKNNLRGEVP  777



>ref|XP_010112694.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
 gb|EXC34652.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
Length=404

 Score =   113 bits (282),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 119/409 (29%), Positives = 183/409 (45%), Gaps = 47/409 (11%)
 Frame = -3

Query  1464  CFLNAKTLES-------DVQVLRSFKDSIDPNSVLPAS-FLSSWNLDLDPCEATGTHFLG  1309
             CFLN   + +       D   L+S + ++     LP S F +SW+   DPC     +F G
Sbjct  20    CFLNCNVMIAFAILDPLDFLALQSIRKALHD---LPGSNFFASWDFTADPC-----NFAG  71

Query  1308  ILCMTPSDNSSGRISVIDLEGD------GLEGFLTPEIGnltelttlnlnrNKFRGPIPD  1147
             + C       + ++  ++L GD      GL G + P IG L+ L   ++   +  G +P 
Sbjct  72    VYC------DADKVISLNL-GDPRAGSPGLTGRIDPAIGKLSALAEFSIVSGRVYGKLPQ  124

Query  1146  SIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLD  967
             S+  L+ +  L +S NF SG +P  +  LR L  +D+S+N+LSG IP  I  L ELT L 
Sbjct  125   SMSQLKNLRFLAVSRNFISGEIPATLGHLRGLRTLDLSYNQLSGGIPRAIGTLPELTNLI  184

Query  966   LSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPPF---PVrlrtlllghnlltgHISAI  796
             L +N L+G +P       L  L L  N       P    P      +  +         +
Sbjct  185   LCHNHLSGSVPPFLS-QSLTRLDLKHNGLSGSFAPGSLPPSLQYLSISWNKFTGPMDRLL  243

Query  795   SRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDA  616
             +RL  L  LDLS N+F+G I  R+ T P +  + +  N F+          +  +  +D 
Sbjct  244   NRLDRLNYLDLSLNQFTGQIPGRVFTYP-ITNLQLQRNQFSG---PLQPVDQVTIPTVDL  299

Query  615   HSNLLQGHL-PLNIITYLNLKTVNLGHNRFFGKIPKEY-GsrlrslwrnlnLEYNYLEGT  442
               N L G + PL    +  ++ + L +NRF G++P  +    L +  + L L++NYL G 
Sbjct  300   SYNRLSGEISPL----FSTVENLYLNNNRFMGQVPATFVDRLLAASIQILYLQHNYLTGI  355

Query  441   LPSEFMTGGEKARASLDHNCLNCPDHLPWCL--GGQ--RPASQCRRSAG  307
               S        +   L +NC+  P   P  L  G Q  RP SQC    G
Sbjct  356   QISPTAEIPLSSSLCLQYNCMVPPVQTPCPLRAGKQITRPTSQCIEWKG  404



>gb|KCW63514.1| hypothetical protein EUGRSUZ_G01147, partial [Eucalyptus grandis]
Length=999

 Score =   116 bits (290),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 148/314 (47%), Gaps = 32/314 (10%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             ++D+  L SFK++I  +   P   LSSWN     CE     + G+LC   S    G ++ 
Sbjct  30    QTDLLALASFKNAIHKD---PFRVLSSWNDSTHHCE-----WQGVLC---SRRHPGSVTS  78

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             +DL   GLEG L+  +GNL+ L  L L  N F G IP  I NL ++  L+LS N F G +
Sbjct  79    LDLRSQGLEGLLSSYVGNLSFLRILFLQNNSFHGEIPPQIGNLLRLYVLVLSNNSFDGLI  138

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSGLWQLNT  904
             P  +     LE +++  N+L G I + +++L  L  L L+ N L G I P +  L  L  
Sbjct  139   PSNISHCSNLETLNLIDNQLVGGIHSDLSSLTRLKGLGLALNGLVGPIPPSIGNLSLLQK  198

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             L+L +N     +P                      +SRL+ LT   L+ N+  G +L  +
Sbjct  199   LSLGANVLSGEIPV--------------------ELSRLKRLTFFQLAFNKLIGEVLAGL  238

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
             + + +++  +V+ N      +   ST    L  L AH NL  G +   +    +L  + L
Sbjct  239   LNISDIVYFDVAYNQLRGNFLNDVSTASPSLHRLGAHDNLFTGMILSALTNVTSLGELAL  298

Query  543   GHNRFFGKIPKEYG  502
             G N F G IPK  G
Sbjct  299   GQNNFHGPIPKNLG  312


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 116/226 (51%), Gaps = 7/226 (3%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             + +G +P ++ +L  ++ L LS NF +  +P  +  L  L+ +++  N+ +G IP++I  
Sbjct  376   RIQGSLPLALGHLFNLSFLGLSNNFLTDCIPHSIGALSNLQQLELDGNKFTGEIPSSIGN  435

Query  990   LRELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnllt  814
             +  L  LDLS+N   G IP  L    QL TL LS+N     +P   + L +L +  +L  
Sbjct  436   ITLLYLLDLSSNIFQGHIPQSLGNCRQLITLNLSNNNLIGSIPIEIMDLSSLSIILSLAN  495

Query  813   gHISA-----ISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSS  649
              ++S      +  L+ L  LDLS N  +G I   I     L R+++ AN F   ++ K+ 
Sbjct  496   NNLSGSVPLQVGSLKNLGILDLSHNLLTGLIPTSISECLVLERLHLEANSFHG-QIPKAL  554

Query  648   TKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
                  LQ LD  +N   G +P  +  +L LK +NL  N+  G++P+
Sbjct  555   LPLRGLQELDFSNNKFSGPIPSFLAEFLLLKYLNLSFNQLEGQVPE  600


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 103/237 (43%), Gaps = 45/237 (19%)
 Frame = -3

Query  1146  SIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLD  967
             S++N   +T L +  N F G  PR    L  ++ + +S+NR+ GS+P  +  L  L+ L 
Sbjct  336   SLVNCSDLTHLEMRMNLFYGSFPRSFSNLSTIKWVSMSNNRIQGSLPLALGHLFNLSFLG  395

Query  966   LSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISR  790
             LSNN LT  IP  +  L  L  L L  N+F   +P                    S+I  
Sbjct  396   LSNNFLTDCIPHSIGALSNLQQLELDGNKFTGEIP--------------------SSIGN  435

Query  789   LRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTR---IEVTKSSTKE-------  640
             +  L  LDLS N F G I   +    +L+ +N+S N+      IE+   S+         
Sbjct  436   ITLLYLLDLSSNIFQGHIPQSLGNCRQLITLNLSNNNLIGSIPIEIMDLSSLSIILSLAN  495

Query  639   --------------SRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
                             L +LD   NLL G +P +I   L L+ ++L  N F G+IPK
Sbjct  496   NNLSGSVPLQVGSLKNLGILDLSHNLLTGLIPTSISECLVLERLHLEANSFHGQIPK  552


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 81/282 (29%), Positives = 128/282 (45%), Gaps = 27/282 (10%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSG--SIPATIT  994
             F G I  ++ N+  +  L L +N F G +P+ + RL+ L +I +  N+L    S  +++ 
Sbjct  279   FTGMILSALTNVTSLGELALGQNNFHGPIPKNLGRLKGLYLIALGDNQLQDVLSFISSLV  338

Query  993   ALRELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnll  817
                +LT L++  N   G  P   S L  +  +++S+N+    LP                
Sbjct  339   NCSDLTHLEMRMNLFYGSFPRSFSNLSTIKWVSMSNNRIQGSLPL---------------  383

Query  816   tgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKES  637
                  A+  L  L+ L LS+N  +  I H I  L  L ++ +  N FT  E+  S    +
Sbjct  384   -----ALGHLFNLSFLGLSNNFLTDCIPHSIGALSNLQQLELDGNKFTG-EIPSSIGNIT  437

Query  636   RLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYN  457
              L +LD  SN+ QGH+P ++     L T+NL +N   G IP E    L SL   L+L  N
Sbjct  438   LLYLLDLSSNIFQGHIPQSLGNCRQLITLNLSNNNLIGSIPIEI-MDLSSLSIILSLANN  496

Query  456   YLEGTLPSEFMTGGEKARASLDHNCLN--CPDHLPWCLGGQR  337
              L G++P +  +        L HN L    P  +  CL  +R
Sbjct  497   NLSGSVPLQVGSLKNLGILDLSHNLLTGLIPTSISECLVLER  538



>emb|CDP18529.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 131/434 (30%), Positives = 190/434 (44%), Gaps = 89/434 (21%)
 Frame = -3

Query  1434  DVQVLRSFKDSID--PNSVLP--ASFLSSWNLDL-DPCEATGTHFLGILCMTPSDNSSGR  1270
             D+  L+  ++S+   P+S  P  A F +SW+    DPC      F GI C +P  N    
Sbjct  37    DLSALQQIENSLTDVPSSRAPPSARFFTSWDFSSHDPCST----FAGITCSSPFLNPRRV  92

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
              S+I   G GL G L                     G +  SI NL ++ +L+L+    +
Sbjct  93    TSLI--LGTGLSGSL------------------GLAGSLSPSISNLTELNQLVLNPGIVT  132

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSGLWQ  913
             G +P  +  LR L VI +++NRL+GSIP +I AL  L  LDLSNN+L G I P +S L Q
Sbjct  133   GPIPAQLGSLRNLRVISLTNNRLTGSIPLSIYALPNLHTLDLSNNQLWGSIPPSISHLDQ  192

Query  912   LNTLALSSNQ---------------------FFAGLPP--FPVrlrtlllghnlltgHIS  802
             L  L L+SN+                     FF+G  P   P+ +R L    N + G ++
Sbjct  193   LKVLVLASNRLSGEIPNELPTQLLHLDLKNNFFSGTLPARMPLSIRYLSASGNSMWGPLN  252

Query  801   AISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRL---  631
              +  L  L  LD+S NRFSG I       P L R ++S+    R  ++    ++      
Sbjct  253   GLESLSELVYLDISMNRFSGTI------PPSLFRSSLSSMLLQRNNLSGGVPQQKNTTTP  306

Query  630   -------------------QVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
                                 ++D   N L G LP     +  ++T+ L +NRF GK+PKE
Sbjct  307   LSSPSSSSSSLKLDFYGEGSIVDLSHNTLTGELPAG--AFSGVETLFLNNNRFTGKVPKE  364

Query  507   Y-GsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARASLDHNCLNCPDHLPWC---LGGQ  340
             Y  S      + L L++NYL        +   +     L +NC+  P  L  C    G Q
Sbjct  365   YVESLYSGGTKTLYLQHNYLTDFPIISDLKLPDSVSVCLSYNCMVPPVGLTACPASAGEQ  424

Query  339   --RPASQCRRSAGG  304
               RPA QC +   G
Sbjct  425   LSRPAYQCSKFNNG  438



>ref|XP_010249536.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 isoform X1 [Nelumbo nucifera]
Length=991

 Score =   116 bits (290),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 94/263 (36%), Positives = 135/263 (51%), Gaps = 25/263 (10%)
 Frame = -3

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
             P  + SG + ++DL  + L G +  +IG  T+L  L++  +  +G IP SI NL+K+  L
Sbjct  154   PRGSISG-LEILDLSNNLLSGEIPADIGLFTDLKVLDIGGSALKGKIPHSISNLKKLQFL  212

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              L+ N  +G +PR + ++R L+ I + +N LSG IP  I  L  L  LDL  N LTG+IP
Sbjct  213   TLASNQLAGEIPRELGQMRSLKWIYLGYNNLSGEIPKEIGDLTSLNHLDLVYNNLTGEIP  272

Query  933   -DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
               L  L  L  L L  N+    +P                     +I  LR L +LDLSD
Sbjct  273   SSLGNLTDLRYLFLYQNKLTGSIP--------------------LSIFDLRKLVSLDLSD  312

Query  756   NRFSGPILHRIVTLPELMRINVSANHFT-RIEVTKSSTKESRLQVLDAHSNLLQGHLPLN  580
             N  +GPI   ++ L +L  +++  N FT  I V  +S    RLQVL   SN L G +P N
Sbjct  313   NSLNGPIPELVIQLQDLQILHLFGNDFTGTIPVALASLP--RLQVLQLWSNRLSGEIPKN  370

Query  579   IITYLNLKTVNLGHNRFFGKIPK  511
             +    NL  ++L  N   GKIP+
Sbjct  371   LGKQNNLTVLDLSTNNLTGKIPE  393


 Score =   100 bits (250),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 84/265 (32%), Positives = 124/265 (47%), Gaps = 25/265 (9%)
 Frame = -3

Query  1161  GPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRE  982
             GPIP+ +I L+ +  L L  N F+G +P  +  L +L+V+ +  NRLSG IP  +     
Sbjct  317   GPIPELVIQLQDLQILHLFGNDFTGTIPVALASLPRLQVLQLWSNRLSGEIPKNLGKQNN  376

Query  981   LTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI  805
             LT LDLS N LTGKIP+ L  L  L  L L SN    G+P                    
Sbjct  377   LTVLDLSTNNLTGKIPERLCNLGGLYKLILFSNLLEGGIP--------------------  416

Query  804   SAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQV  625
              ++S  R L  + L +NRFSG +      LP +  +++S N+ T   + +       LQ+
Sbjct  417   KSLSYCRSLQRVRLQNNRFSGELSPEFTKLPLIYYLDISGNNLTG-RIDRRQWDMPSLQM  475

Query  624   LDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEG  445
             L    N   G+LP++  +   L+ ++L  N   G IP+ YG    S    L L  N + G
Sbjct  476   LSLARNRFTGNLPISFGSK-KLENLDLSENSISGTIPRSYG--GLSELTQLKLSQNQISG  532

Query  444   TLPSEFMTGGEKARASLDHNCLNCP  370
              +P E  +  +     L  N L+ P
Sbjct  533   FIPEELSSCTKLVTLDLSENHLSGP  557


 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 124/260 (48%), Gaps = 11/260 (4%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R+ V+ L  + L G +   +G    LT L+L+ N   G IP+ + NL  + +L+L  N  
Sbjct  352   RLQVLQLWSNRLSGEIPKNLGKQNNLTVLDLSTNNLTGKIPERLCNLGGLYKLILFSNLL  411

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLW-  916
              GG+P+ +   R L+ + + +NR SG +    T L  +  LD+S N LTG+I      W 
Sbjct  412   EGGIPKSLSYCRSLQRVRLQNNRFSGELSPEFTKLPLIYYLDISGNNLTGRIDRRQ--WD  469

Query  915   --QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISR----LRYLTALDLSDN  754
                L  L+L+ N+F   L P     + L             I R    L  LT L LS N
Sbjct  470   MPSLQMLSLARNRFTGNL-PISFGSKKLENLDLSENSISGTIPRSYGGLSELTQLKLSQN  528

Query  753   RFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNII  574
             + SG I   + +  +L+ +++S NH +   +  S  +   L  LD   N L G +P N+ 
Sbjct  529   QISGFIPEELSSCTKLVTLDLSENHLSG-PIPASLAEMPVLGELDLSENQLIGEIPANLG  587

Query  573   TYLNLKTVNLGHNRFFGKIP  514
                +L  VN+ HN F+G +P
Sbjct  588   KVESLVEVNISHNHFYGSLP  607


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 92/338 (27%), Positives = 140/338 (41%), Gaps = 82/338 (24%)
 Frame = -3

Query  1455  NAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSS  1276
             NA     D+++L SFK+SI+ +      FLSSWN  +  C     ++ GI C+     +S
Sbjct  43    NAVAEGDDLELLLSFKNSINDS----FRFLSSWNSSVAFC-----NWYGITCV-----NS  88

Query  1275  GRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENF  1096
               +S I+L G  + G L+P +               FR         L  I  + LS N 
Sbjct  89    SHVSRIELSGKNISGELSPFL---------------FR---------LSFIESINLSNNE  124

Query  1095  FSGGLPRYMRRLRKLEVIDVSHNRLSGS----------------------IPATITALRE  982
             F+G LP        L  +++S+N  +GS                      IPA I    +
Sbjct  125   FTGELPNETFSCLSLRYLNLSNNNFTGSIPRGSISGLEILDLSNNLLSGEIPADIGLFTD  184

Query  981   LTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHI  805
             L  LD+  + L GKIP  +S L +L  L L+SNQ    +P                    
Sbjct  185   LKVLDIGGSALKGKIPHSISNLKKLQFLTLASNQLAGEIP--------------------  224

Query  804   SAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQV  625
               + ++R L  + L  N  SG I   I  L  L  +++  N+ T  E+  S    + L+ 
Sbjct  225   RELGQMRSLKWIYLGYNNLSGEIPKEIGDLTSLNHLDLVYNNLTG-EIPSSLGNLTDLRY  283

Query  624   LDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
             L  + N L G +PL+I     L +++L  N   G IP+
Sbjct  284   LFLYQNKLTGSIPLSIFDLRKLVSLDLSDNSLNGPIPE  321


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 78/149 (52%), Gaps = 5/149 (3%)
 Frame = -3

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
             P    S ++  +DL  + + G +    G L+ELT L L++N+  G IP+ + +  K+  L
Sbjct  488   PISFGSKKLENLDLSENSISGTIPRSYGGLSELTQLKLSQNQISGFIPEELSSCTKLVTL  547

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
              LSEN  SG +P  +  +  L  +D+S N+L G IPA +  +  L  +++S+N   G +P
Sbjct  548   DLSENHLSGPIPASLAEMPVLGELDLSENQLIGEIPANLGKVESLVEVNISHNHFYGSLP  607

Query  933   DLSGLWQLNTLALSSNQFF-----AGLPP  862
                    +N+ A++ N        +GLPP
Sbjct  608   STGAFLAINSSAVTGNDLCGGNIASGLPP  636



>emb|CBI19800.3| unnamed protein product [Vitis vinifera]
Length=898

 Score =   115 bits (289),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 158/327 (48%), Gaps = 25/327 (8%)
 Frame = -3

Query  1464  CFLNAKTLESDVQVLRSFKDSIDPNSVLPASFLSSWNLDL--DPCEATGTHFLGILCMTP  1291
             C   +    S+++ L +FK ++      P   L  WN      PC+     + GILC   
Sbjct  20    CAQRSADALSEIKALTAFKLNLHD----PLGALDGWNSSTPSAPCD-----WRGILCY--  68

Query  1290  SDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLL  1111
                 +GR+  + L    L G LT ++ NL +L  L+L+ N F G +P S+     +  + 
Sbjct  69    ----NGRVWELRLPRLQLGGRLTDQLSNLRQLRKLSLHSNAFNGSVPLSLSQCSLLRAVY  124

Query  1110  LSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-  934
             L  N FSGGLP  +  L  L+V++V+HN LSG IP  +   R L  LDLS+N  +G IP 
Sbjct  125   LHYNSFSGGLPPALTNLTNLQVLNVAHNFLSGGIPGNLP--RNLRYLDLSSNAFSGNIPA  182

Query  933   DLSGLWQLNTLALSSNQFFAGLPP----FPVrlrtlllghnlltgHISAISRLRYLTALD  766
             + S    L  + LS NQF  G+P             L  + L     SAIS L  L  LD
Sbjct  183   NFSVASSLQLINLSFNQFSGGVPASIGELQQLQYLWLDSNQLYGTIPSAISNLSTLRILD  242

Query  765   LSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLP  586
             LS N FSG +   I  L  L  + V AN+  + EV +   K S LQVLD   N   G LP
Sbjct  243   LSGNFFSGVLPIEIGNLLRLEELRV-ANNSLQGEVPREIQKCSLLQVLDLEGNRFSGQLP  301

Query  585   LNIITYLNLKTVNLGHNRFFGKIPKEY  505
               +    +LKT++LG N F G IP  +
Sbjct  302   PFLGALTSLKTLSLGRNHFSGSIPASF  328


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 119/248 (48%), Gaps = 24/248 (10%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITAL  988
             F G IP +      +  + LS N FSGG+P  +  L++L+ + +  N+L G+IP+ I+ L
Sbjct  176   FSGNIPANFSVASSLQLINLSFNQFSGGVPASIGELQQLQYLWLDSNQLYGTIPSAISNL  235

Query  987   RELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltg  811
               L  LDLS N  +G +P ++  L +L  L +++N     +P                  
Sbjct  236   STLRILDLSGNFFSGVLPIEIGNLLRLEELRVANNSLQGEVP------------------  277

Query  810   HISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRL  631
                 I +   L  LDL  NRFSG +   +  L  L  +++  NHF+   +  S    S+L
Sbjct  278   --REIQKCSLLQVLDLEGNRFSGQLPPFLGALTSLKTLSLGRNHFSG-SIPASFRNLSQL  334

Query  630   QVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYL  451
             +VL+   N L G +   ++   NL  +NL  N+F+G++P  +G         L+L  N++
Sbjct  335   EVLNLSENNLIGDVLEELLLLSNLSILNLSFNKFYGEVPATFG--FLQSLVVLSLSQNHV  392

Query  450   EGTLPSEF  427
                +PSE 
Sbjct  393   SSVIPSEL  400


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 76/266 (29%), Positives = 115/266 (43%), Gaps = 31/266 (12%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             + ++DL G+   G L  EIGNL  L  L +  N  +G +P  I     +  L L  N FS
Sbjct  238   LRILDLSGNFFSGVLPIEIGNLLRLEELRVANNSLQGEVPREIQKCSLLQVLDLEGNRFS  297

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQL  910
             G LP ++  L  L+ + +  N  SGSIPA+   L +L  L+LS N L G + +   L   
Sbjct  298   GQLPPFLGALTSLKTLSLGRNHFSGSIPASFRNLSQLEVLNLSENNLIGDVLEELLLLSN  357

Query  909   NTLALSS-NQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
              ++   S N+F+  +P                    +    L+ L  L LS N  S  I 
Sbjct  358   LSILNLSFNKFYGEVP--------------------ATFGFLQSLVVLSLSQNHVSSVIP  397

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGH---------LPLN  580
               +    +L  + + +N  +  E+    ++ S L+ LD   N L G          +P+N
Sbjct  398   SELGNCSDLEALELRSNRLSG-EIPGELSRLSHLKELDLGQNNLTGEIPEDISNGVIPVN  456

Query  579   IITYLNLKTVNLGHNRFFGKIPKEYG  502
                   LK +NL  N   G+IPK  G
Sbjct  457   FSGISTLKYLNLSQNNLEGEIPKMLG  482


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 116/255 (45%), Gaps = 37/255 (15%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             + V+DLEG+   G L P +G LT L TL+L RN F G IP S  NL ++  L LSEN   
Sbjct  286   LQVLDLEGNRFSGQLPPFLGALTSLKTLSLGRNHFSGSIPASFRNLSQLEVLNLSENNLI  345

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQ  913
             G +   +  L  L ++++S N+  G +PAT   L+ L  L LS N ++  IP +L     
Sbjct  346   GDVLEELLLLSNLSILNLSFNKFYGEVPATFGFLQSLVVLSLSQNHVSSVIPSELGNCSD  405

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L  L L SN+    +P                      +SRL +L  LDL  N  +G I 
Sbjct  406   LEALELRSNRLSGEIP--------------------GELSRLSHLKELDLGQNNLTGEI-  444

Query  732   HRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKT  553
                   PE +   V   +F+ I         S L+ L+   N L+G +P  + +     +
Sbjct  445   ------PEDISNGVIPVNFSGI---------STLKYLNLSQNNLEGEIPKMLGSQFTDPS  489

Query  552   VNLGHNRFFGKIPKE  508
             V   + +  GK  KE
Sbjct  490   VFAMNPKLCGKPLKE  504



>ref|XP_010423232.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Camelina sativa]
Length=1219

 Score =   116 bits (290),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 92/307 (30%), Positives = 150/307 (49%), Gaps = 12/307 (4%)
 Frame = -3

Query  1293  PSDNSSGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRL  1114
             P D S   +  +DL+ +   G +   +   T+L   + + N+ +G +P  I N   +TRL
Sbjct  445   PEDLSKLPLMALDLDSNNFTGEIPTSLWTSTDLMEFSASYNRLQGSLPAEIGNAASLTRL  504

Query  1113  LLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP  934
             +LS+N   G +PR + +L  L V++++ N+L G IP  +     LT LDL NN L G+IP
Sbjct  505   VLSDNQLQGEIPREIGKLASLSVLNLNSNKLQGKIPNELGDCTSLTTLDLGNNNLQGQIP  564

Query  933   D-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSD  757
             D ++GL QL  L LS N     +P  P                +  +S L++    DLS 
Sbjct  565   DRITGLAQLQCLVLSYNNLSGSIPSKP--------SSYFHQTDMPDLSFLQHHGVFDLSF  616

Query  756   NRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNI  577
             NR +GPI   +     ++ I +S NH + + +  S ++ + L +LD   N L G +P  +
Sbjct  617   NRLTGPIPEELGDCVVVVEILLSNNHLSGV-IPASLSRLTNLTILDVSGNALTGSIPEEM  675

Query  576   ITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSEFMTGGEKARAS  397
                  L+ +NL +N+  G IP+ +G     +  NL    N L+G++P+      E     
Sbjct  676   GHSPKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTK--NQLDGSVPASLGNLKEVTHMD  733

Query  396   LDHNCLN  376
             L  N L+
Sbjct  734   LSINKLS  740


 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 111/222 (50%), Gaps = 22/222 (10%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             +  GPIP+ + +   +  +LLS N  SG +P  + RL  L ++DVS N L+GSIP  +  
Sbjct  618   RLTGPIPEELGDCVVVVEILLSNNHLSGVIPASLSRLTNLTILDVSGNALTGSIPEEMGH  677

Query  990   LRELTRLDLSNNELTGKIPDLSGLW-QLNTLALSSNQFFAGLPPFPVrlrtlllghnllt  814
               +L  L+L+NN+L G IP+  GL   L  L L+ NQ    +P                 
Sbjct  678   SPKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNQLDGSVP-----------------  720

Query  813   gHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESR  634
                +++  L+ +T +DLS N+ SG +   +  + +L+ + +  N FT  E+       ++
Sbjct  721   ---ASLGNLKEVTHMDLSINKLSGELPSALSQMLKLVGLYIEQNRFTG-EIPSDLGNLTQ  776

Query  633   LQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
             L+  DA  N L G +P  I    NL  +NL  N   G++P++
Sbjct  777   LEYFDASENWLSGEIPTKICGLPNLVFLNLAKNHLGGEVPRD  818


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 145/327 (44%), Gaps = 34/327 (10%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             +S +D+  + L G + PEIG L+ L+ L +  N F G IP  I N+  +   +    FF 
Sbjct  191   LSSLDVSNNSLSGKIPPEIGKLSNLSDLYMGLNSFSGLIPPEIGNISLLKNFVAPSCFFK  250

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQ  913
             G LP  + +L+ L  +D+S+N L  SIP +   L+ L+ L+L + +L G IP +L     
Sbjct  251   GPLPNEISKLKHLAKLDLSYNPLKSSIPKSFGELQNLSILNLVSADLNGMIPSELGNCKS  310

Query  912   LNTLALSSNQFFAGLP----PFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFS  745
             L TL LS N     LP      P+   +        +   S I + + L +L L++NRF+
Sbjct  311   LKTLMLSFNSLSGSLPLELSEIPLLTFSAERNQLSGSLP-SWIGKWKELDSLLLANNRFT  369

Query  744   GPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQ-----------  598
             G I   I   P L  +++++N  T   + K       L+ +D   NLL            
Sbjct  370   GQIPPEIEDCPMLKHLSLASNLLTG-SIPKELCGSGSLEEIDLSGNLLSGTIEEVFLGCS  428

Query  597   -------------GHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYN  457
                          G +P + ++ L L  ++L  N F G+IP        +     +  YN
Sbjct  429   SLIELVLTNNKINGSIPED-LSKLPLMALDLDSNNFTGEIPTSL--WTSTDLMEFSASYN  485

Query  456   YLEGTLPSEFMTGGEKARASLDHNCLN  376
              L+G+LP+E        R  L  N L 
Sbjct  486   RLQGSLPAEIGNAASLTRLVLSDNQLQ  512


 Score = 84.7 bits (208),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 87/275 (32%), Positives = 127/275 (46%), Gaps = 25/275 (9%)
 Frame = -3

Query  1251  EGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRY  1072
             E + L G L   IG   EL +L L  N+F G IP  I +   +  L L+ N  +G +P+ 
Sbjct  340   ERNQLSGSLPSWIGKWKELDSLLLANNRFTGQIPPEIEDCPMLKHLSLASNLLTGSIPKE  399

Query  1071  MRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNTLAL  895
             +     LE ID+S N LSG+I         L  L L+NN++ G IP DLS L  L  L L
Sbjct  400   LCGSGSLEEIDLSGNLLSGTIEEVFLGCSSLIELVLTNNKINGSIPEDLSKL-PLMALDL  458

Query  894   SSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTL  715
              SN F   +P                    +++     L     S NR  G +   I   
Sbjct  459   DSNNFTGEIP--------------------TSLWTSTDLMEFSASYNRLQGSLPAEIGNA  498

Query  714   PELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHN  535
               L R+ +S N   + E+ +   K + L VL+ +SN LQG +P  +    +L T++LG+N
Sbjct  499   ASLTRLVLSDNQL-QGEIPREIGKLASLSVLNLNSNKLQGKIPNELGDCTSLTTLDLGNN  557

Query  534   RFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLPSE  430
                G+IP        +  + L L YN L G++PS+
Sbjct  558   NLQGQIPDRI--TGLAQLQCLVLSYNNLSGSIPSK  590


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 118/253 (47%), Gaps = 9/253 (4%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITAL  988
              +G +   + +L  ++ L LS N  SG +P+ +  L+ L+ + ++ N  SG IP  I  +
Sbjct  80    LKGHLFPPLFSLPSLSVLDLSGNSLSGQIPKEISSLKNLKALCLARNHFSGKIPPEIGEM  139

Query  987   RELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPP-----FPVrlrtlllgh  826
             ++L  LDLS N LTG +P  LS L QL  L LS N F   L P     FP      +  +
Sbjct  140   KQLQTLDLSGNSLTGLLPSQLSELPQLLYLDLSDNHFSGSLSPSFFLGFPALSSLDVSNN  199

Query  825   nlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSST  646
             +L       I +L  L+ L +  N FSG I   I  +  L++  V+ + F +  +    +
Sbjct  200   SLSGKIPPEIGKLSNLSDLYMGLNSFSGLIPPEIGNI-SLLKNFVAPSCFFKGPLPNEIS  258

Query  645   KESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnL  466
             K   L  LD   N L+  +P +     NL  +NL      G IP E G       + L L
Sbjct  259   KLKHLAKLDLSYNPLKSSIPKSFGELQNLSILNLVSADLNGMIPSELG--NCKSLKTLML  316

Query  465   EYNYLEGTLPSEF  427
              +N L G+LP E 
Sbjct  317   SFNSLSGSLPLEL  329


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 95/199 (48%), Gaps = 45/199 (23%)
 Frame = -3

Query  1269  ISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFS  1090
             ++++D+ G+ L G +  E+G+  +L  LNL  N+  G IP+S   L  + +L L++N   
Sbjct  657   LTILDVSGNALTGSIPEEMGHSPKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNQLD  716

Query  1089  GGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQ  913
             G +P  +  L+++  +D+S N+LSG +P+ ++ + +L  L +  N  TG+IP DL  L Q
Sbjct  717   GSVPASLGNLKEVTHMDLSINKLSGELPSALSQMLKLVGLYIEQNRFTGEIPSDLGNLTQ  776

Query  912   LNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPIL  733
             L        ++F                                    D S+N  SG I 
Sbjct  777   L--------EYF------------------------------------DASENWLSGEIP  792

Query  732   HRIVTLPELMRINVSANHF  676
              +I  LP L+ +N++ NH 
Sbjct  793   TKICGLPNLVFLNLAKNHL  811


 Score = 62.4 bits (150),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 75/139 (54%), Gaps = 1/139 (1%)
 Frame = -3

Query  1278  SGRISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSEN  1099
             S ++  ++L  + L G +    G L  L  LNL +N+  G +P S+ NL+++T + LS N
Sbjct  678   SPKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNQLDGSVPASLGNLKEVTHMDLSIN  737

Query  1098  FFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSG  922
               SG LP  + ++ KL  + +  NR +G IP+ +  L +L   D S N L+G+IP  + G
Sbjct  738   KLSGELPSALSQMLKLVGLYIEQNRFTGEIPSDLGNLTQLEYFDASENWLSGEIPTKICG  797

Query  921   LWQLNTLALSSNQFFAGLP  865
             L  L  L L+ N     +P
Sbjct  798   LPNLVFLNLAKNHLGGEVP  816



>ref|XP_010068334.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1011

 Score =   115 bits (289),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 148/314 (47%), Gaps = 32/314 (10%)
 Frame = -3

Query  1440  ESDVQVLRSFKDSIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRISV  1261
             ++D+  L SFK++I  +   P   LSSWN     CE     + G+LC   S    G ++ 
Sbjct  30    QTDLLALASFKNAIHKD---PFRVLSSWNDSTHHCE-----WQGVLC---SRRHPGSVTS  78

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             +DL   GLEG L+  +GNL+ L  L L  N F G IP  I NL ++  L+LS N F G +
Sbjct  79    LDLRSQGLEGLLSSYVGNLSFLRILFLQNNSFHGEIPPQIGNLLRLYVLVLSNNSFDGLI  138

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSGLWQLNT  904
             P  +     LE +++  N+L G I + +++L  L  L L+ N L G I P +  L  L  
Sbjct  139   PSNISHCSNLETLNLIDNQLVGGIHSDLSSLTRLKGLGLALNGLVGPIPPSIGNLSLLQK  198

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             L+L +N     +P                      +SRL+ LT   L+ N+  G +L  +
Sbjct  199   LSLGANVLSGEIPV--------------------ELSRLKRLTFFQLAFNKLIGEVLAGL  238

Query  723   VTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNL  544
             + + +++  +V+ N      +   ST    L  L AH NL  G +   +    +L  + L
Sbjct  239   LNISDIVYFDVAYNQLRGNFLNDVSTASPSLHRLGAHDNLFTGMILSALTNVTSLGELAL  298

Query  543   GHNRFFGKIPKEYG  502
             G N F G IPK  G
Sbjct  299   GQNNFHGPIPKNLG  312


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 116/226 (51%), Gaps = 7/226 (3%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             + +G +P ++ +L  ++ L LS NF +  +P  +  L  L+ +++  N+ +G IP++I  
Sbjct  376   RIQGSLPLALGHLFNLSFLGLSNNFLTDCIPHSIGALSNLQQLELDGNKFTGEIPSSIGN  435

Query  990   LRELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnllt  814
             +  L  LDLS+N   G IP  L    QL TL LS+N     +P   + L +L +  +L  
Sbjct  436   ITLLYLLDLSSNIFQGHIPQSLGNCRQLITLNLSNNNLIGSIPIEIMDLSSLSIILSLAN  495

Query  813   gHISA-----ISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSS  649
              ++S      +  L+ L  LDLS N  +G I   I     L R+++ AN F   ++ K+ 
Sbjct  496   NNLSGSVPLQVGSLKNLGILDLSHNLLTGLIPTSISECLVLERLHLEANSFHG-QIPKAL  554

Query  648   TKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
                  LQ LD  +N   G +P  +  +L LK +NL  N+  G++P+
Sbjct  555   LPLRGLQELDFSNNKFSGPIPSFLAEFLLLKYLNLSFNQLEGQVPE  600


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 103/237 (43%), Gaps = 45/237 (19%)
 Frame = -3

Query  1146  SIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLD  967
             S++N   +T L +  N F G  PR    L  ++ + +S+NR+ GS+P  +  L  L+ L 
Sbjct  336   SLVNCSDLTHLEMRMNLFYGSFPRSFSNLSTIKWVSMSNNRIQGSLPLALGHLFNLSFLG  395

Query  966   LSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISR  790
             LSNN LT  IP  +  L  L  L L  N+F   +P                    S+I  
Sbjct  396   LSNNFLTDCIPHSIGALSNLQQLELDGNKFTGEIP--------------------SSIGN  435

Query  789   LRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTR---IEVTKSSTKE-------  640
             +  L  LDLS N F G I   +    +L+ +N+S N+      IE+   S+         
Sbjct  436   ITLLYLLDLSSNIFQGHIPQSLGNCRQLITLNLSNNNLIGSIPIEIMDLSSLSIILSLAN  495

Query  639   --------------SRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
                             L +LD   NLL G +P +I   L L+ ++L  N F G+IPK
Sbjct  496   NNLSGSVPLQVGSLKNLGILDLSHNLLTGLIPTSISECLVLERLHLEANSFHGQIPK  552


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 81/282 (29%), Positives = 128/282 (45%), Gaps = 27/282 (10%)
 Frame = -3

Query  1167  FRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSG--SIPATIT  994
             F G I  ++ N+  +  L L +N F G +P+ + RL+ L +I +  N+L    S  +++ 
Sbjct  279   FTGMILSALTNVTSLGELALGQNNFHGPIPKNLGRLKGLYLIALGDNQLQDVLSFISSLV  338

Query  993   ALRELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnll  817
                +LT L++  N   G  P   S L  +  +++S+N+    LP                
Sbjct  339   NCSDLTHLEMRMNLFYGSFPRSFSNLSTIKWVSMSNNRIQGSLPL---------------  383

Query  816   tgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKES  637
                  A+  L  L+ L LS+N  +  I H I  L  L ++ +  N FT  E+  S    +
Sbjct  384   -----ALGHLFNLSFLGLSNNFLTDCIPHSIGALSNLQQLELDGNKFTG-EIPSSIGNIT  437

Query  636   RLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYN  457
              L +LD  SN+ QGH+P ++     L T+NL +N   G IP E    L SL   L+L  N
Sbjct  438   LLYLLDLSSNIFQGHIPQSLGNCRQLITLNLSNNNLIGSIPIEI-MDLSSLSIILSLANN  496

Query  456   YLEGTLPSEFMTGGEKARASLDHNCLN--CPDHLPWCLGGQR  337
              L G++P +  +        L HN L    P  +  CL  +R
Sbjct  497   NLSGSVPLQVGSLKNLGILDLSHNLLTGLIPTSISECLVLER  538



>gb|KCW82341.1| hypothetical protein EUGRSUZ_C03742 [Eucalyptus grandis]
Length=1093

 Score =   115 bits (289),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 100/337 (30%), Positives = 166/337 (49%), Gaps = 60/337 (18%)
 Frame = -3

Query  1437  SDVQVLRSFKD--SIDPNSVLPASFLSSWNLDLDPCEATGTHFLGILCMTPSDNSSGRIS  1264
             +D + L  FK    +DP + +      +W ++ + CE     ++G++C     N   R++
Sbjct  39    TDQEALLHFKSMMEVDPTNNIKGG---NWTVEANFCE-----WIGVVC----SNRKQRVT  86

Query  1263  VIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGG  1084
              +DL   GL+G L+P +GNL+ L +L+L  N F G I   I +LR++  L+L  N F G 
Sbjct  87    ALDLSHMGLQGRLSPYLGNLSLLASLDLRNNSFYGMILIEIGHLRRLKELILELNQFEGN  146

Query  1083  LPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSG------  922
             +P  + + + LEV+ ++ NRL+G IP    A  +L +L+LS+N+L G+IP   G      
Sbjct  147   IPPILTQCQNLEVMSLATNRLTGGIPREFGAFPKLQQLNLSSNDLRGQIPSFLGNISTLQ  206

Query  921   -LWQLNT------------------LALSSNQFFAGLPPFPVrlrtlllghnlltgHISA  799
              +  +NT                  LAL+ NQF   LP                      
Sbjct  207   VIRLVNTTLTGSIPSALFNRSLTWMLALNKNQFSGPLP--------------------ET  246

Query  798   ISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLD  619
             +++ + L  L LS NRF G I   I +L +L ++ ++ N+ T   + ++    S L  LD
Sbjct  247   LTQCKELIILGLSSNRFQGSIPRDIGSLQKLQKLFIAVNNLTG-TIPRTIGNISSLHKLD  305

Query  618   AHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKE  508
               SN ++G +P  I   +NL+ ++L  N   GK+P+E
Sbjct  306   IGSNHIEGVIPSEIGNLVNLQLMDLSKNLLTGKVPQE  342


 Score = 72.4 bits (176),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 114/254 (45%), Gaps = 46/254 (18%)
 Frame = -3

Query  1272  RISVIDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFF  1093
             R++ + L  + L+  +   IG L  L  L L+ N  +GPIP+ I NL  +  LLL +N  
Sbjct  501   RLTFLKLSNNALDCNIPSSIGGLERLQRLYLDNNHLKGPIPNEICNLTSLEELLLRQNRI  560

Query  1092  SGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLW  916
             SG +   +  LR L+   +S N ++  IP ++  L+EL  L+LS N   G++P ++  + 
Sbjct  561   SGSILNCIENLRSLQKFLISLNNMTSVIPVSLWGLQELIFLNLSLNSFNGELPLEIGKMR  620

Query  915   QLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPI  736
              + ++ LS N+    +P                    S+I     L +L+LS N F G I
Sbjct  621   AIESIDLSWNRLTGAIP--------------------SSIQEFESLASLNLSMNSFQGSI  660

Query  735   LHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLK  556
                    P+      S  H   ++             LD   N L G +P ++   + L+
Sbjct  661   -------PQ------SIGHLKGMD------------FLDLSYNELSGTIPESLEGLVYLQ  695

Query  555   TVNLGHNRFFGKIP  514
              +NL  N+  G+IP
Sbjct  696   NLNLSFNKLSGEIP  709


 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 75/136 (55%), Gaps = 0/136 (0%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             ++L  +   G L  EIG +  + +++L+ N+  G IP SI     +  L LS N F G +
Sbjct  601   LNLSLNSFNGELPLEIGKMRAIESIDLSWNRLTGAIPSSIQEFESLASLNLSMNSFQGSI  660

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTL  901
             P+ +  L+ ++ +D+S+N LSG+IP ++  L  L  L+LS N+L+G+IP+       + L
Sbjct  661   PQSIGHLKGMDFLDLSYNELSGTIPESLEGLVYLQNLNLSFNKLSGEIPNGGSFGNFSAL  720

Query  900   ALSSNQFFAGLPPFPV  853
             +   N+   G   F V
Sbjct  721   SFIGNEALCGNAIFQV  736


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 60/235 (26%), Positives = 93/235 (40%), Gaps = 48/235 (20%)
 Frame = -3

Query  1065  RLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKI-PDLSGLWQLNTLALSS  889
             R +++  +D+SH  L G +   +  L  L  LDL NN   G I  ++  L +L  L L  
Sbjct  81    RKQRVTALDLSHMGLQGRLSPYLGNLSLLASLDLRNNSFYGMILIEIGHLRRLKELILEL  140

Query  888   NQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPE  709
             NQF   +PP                     +++ + L  + L+ NR +G I       P+
Sbjct  141   NQFEGNIPPI--------------------LTQCQNLEVMSLATNRLTGGIPREFGAFPK  180

Query  708   LMRINVSANHFTRIEVTKSSTKESRLQV------------------------LDAHSNLL  601
             L ++N+S+N   R ++       S LQV                        L  + N  
Sbjct  181   LQQLNLSSNDL-RGQIPSFLGNISTLQVIRLVNTTLTGSIPSALFNRSLTWMLALNKNQF  239

Query  600   QGHLPLNIITYLNLKTVNLGHNRFFGKIPKEYGsrlrslwrnlnLEYNYLEGTLP  436
              G LP  +     L  + L  NRF G IP++ GS  +     +    N L GT+P
Sbjct  240   SGPLPETLTQCKELIILGLSSNRFQGSIPRDIGSLQKLQKLFIA--VNNLTGTIP  292



>ref|XP_006296914.1| hypothetical protein CARUB_v10012906mg [Capsella rubella]
 gb|EOA29812.1| hypothetical protein CARUB_v10012906mg [Capsella rubella]
Length=957

 Score =   115 bits (289),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 144/296 (49%), Gaps = 20/296 (7%)
 Frame = -3

Query  1362  SWNLDLDPCEATGTHFLGILCMTPSDNSSGRISVIDLEGDGLEGFLTPE-----IGnlte  1198
             SW  D D C     ++ GI C    D  SG I  +DL    L G L+ +     + +L  
Sbjct  71    SWEKDSDCC-----YWDGITC----DEKSGDIIEVDLSFSSLSGQLSSKSSLFRLQHLHF  121

Query  1197  lttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLS  1018
             +T +NL+ N F GPIP S+ N   +T L +S N FSG +P ++  L  L  +D SHN L 
Sbjct  122   VTKINLSNNDFVGPIPSSLGNFSSLTTLDVSRNHFSGKIPSWIGNLSHLTSLDFSHNSLV  181

Query  1017  GSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNTLALSSNQFFAGLPP----FPV  853
             G IP+++  L  LT ++LS N+  GK+P  +  L  L    LS N FF  LPP       
Sbjct  182   GEIPSSLAYLSNLTSINLSYNDFDGKLPSSIENLSSLAIFRLSRNNFFGELPPSIGNLLH  241

Query  852   rlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFT  673
                  L  +N      S++  L +LT++D  +N F G I      L  L  + +S N+F 
Sbjct  242   LTNLSLDRNNFSGKISSSLGNLSHLTSIDFHNNNFDGEIPFSFGNLSHLTSLVLSVNNFV  301

Query  672   RIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEY  505
                +  S    ++L +L+  SN L G LP  ++    L  ++L +N+  G IP  +
Sbjct  302   G-AIPSSLGSLNKLSILNVKSNKLSGSLPDALVNMKKLSKLSLSNNQLIGTIPSSF  356


 Score = 79.0 bits (193),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 103/201 (51%), Gaps = 21/201 (10%)
 Frame = -3

Query  1260  IDLEGDGLEGFLTPEIGnltelttlnlnrNKFRGPIPDSIINLRKITRLLLSENFFSGGL  1081
             + L+ +   G ++  +GNL+ LT+++ + N F G IP S  NL  +T L+LS N F G +
Sbjct  245   LSLDRNNFSGKISSSLGNLSHLTSIDFHNNNFDGEIPFSFGNLSHLTSLVLSVNNFVGAI  304

Query  1080  PRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTGKIP-DLSGLWQLNT  904
             P  +  L KL +++V  N+LSGS+P  +  +++L++L LSNN+L G IP     +  L+T
Sbjct  305   PSSLGSLNKLSILNVKSNKLSGSLPDALVNMKKLSKLSLSNNQLIGTIPSSFFTIPSLDT  364

Query  903   LALSSNQFFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRI  724
             + L +NQ    L                       IS    L  L L +N F GPI   +
Sbjct  365   ITLDNNQLNGTLE-------------------FGNISSSSKLIVLRLGNNHFIGPISKSL  405

Query  723   VTLPELMRINVSANHFTRIEV  661
               L  L  +++S N  T++ V
Sbjct  406   SKLARLKELDLS-NLNTQVSV  425


 Score = 75.5 bits (184),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 70/251 (28%), Positives = 111/251 (44%), Gaps = 36/251 (14%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSGGLPRYMRRLRKLEVIDVSHNRLSGSIPATITA  991
             +  G IP+ + +   +  L +  N   G LPR + R+  LEV++V  NR++ + P+ +++
Sbjct  616   RLSGVIPEDVFD--SLILLDVGHNQLEGKLPRSLVRVSFLEVLNVESNRINDTFPSWLSS  673

Query  990   LRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPP-FPV---rlrtlllghn  823
             L+EL  L L +N   G I  +     L  + +S NQF   LPP F V    + +L    +
Sbjct  674   LQELHILVLRSNAFHGPIQQIK-FATLRIIDISDNQFNGTLPPSFFVNLLAMFSLAKNED  732

Query  822   lltgHISAISRLRYL----------------------------TALDLSDNRFSGPILHR  727
               T   + +S   Y+                            TA+D S N+F G I   
Sbjct  733   QSTRETTLMSHKNYMSTDHYYFYSMVLMNKGIEMQLERVLNIFTAIDFSRNKFEGEIPRS  792

Query  726   IVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVN  547
             I  L EL  +N+S N F+   +  S     +L+ LD   N + G +P  +    NL  +N
Sbjct  793   IGLLKELYVLNLSNNAFSG-HIPSSMANMIKLESLDVSQNNISGEIPQELGNLSNLARMN  851

Query  546   LGHNRFFGKIP  514
               HNR  G +P
Sbjct  852   FSHNRLVGLVP  862


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 81/187 (43%), Gaps = 27/187 (14%)
 Frame = -3

Query  1044  IDVSHNRLSGSIPATITALR-----ELTRLDLSNNELTGKIPD-LSGLWQLNTLALSSNQ  883
             +D+S + LSG + +  +  R      +T+++LSNN+  G IP  L     L TL +S N 
Sbjct  96    VDLSFSSLSGQLSSKSSLFRLQHLHFVTKINLSNNDFVGPIPSSLGNFSSLTTLDVSRNH  155

Query  882   FFAGLPPFPVrlrtlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELM  703
             F   +P                    S I  L +LT+LD S N   G I   +  L  L 
Sbjct  156   FSGKIP--------------------SWIGNLSHLTSLDFSHNSLVGEIPSSLAYLSNLT  195

Query  702   RINVSANHFTRIEVTKSSTKESRLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFG  523
              IN+S N F   ++  S    S L +     N   G LP +I   L+L  ++L  N F G
Sbjct  196   SINLSYNDFDG-KLPSSIENLSSLAIFRLSRNNFFGELPPSIGNLLHLTNLSLDRNNFSG  254

Query  522   KIPKEYG  502
             KI    G
Sbjct  255   KISSSLG  261


 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 55/214 (26%), Positives = 89/214 (42%), Gaps = 68/214 (32%)
 Frame = -3

Query  1110  LSENFFSG----GLPRYMRRLRKLEVIDVSHNRLSGSIPATITALRELTRLDLSNNELTG  943
             LSE + SG      P+ +R   ++  +DVS+N++ G +P  + +L  L  ++LSNN   G
Sbjct  486   LSEIYLSGCSITEFPKILRTQDQMTTLDVSNNKIKGQVPGWLWSLANLQYVNLSNNTFIG  545

Query  942   ----------KIPDLSGLWQLNTLALSSNQFFAGLPPFPVrlrtlllghnlltgHISAIS  793
                        +P+      +  L  S+N F   +P F                    I 
Sbjct  546   FGRSTNLGLSSVPES----YMKQLFGSNNSFTGKIPSF--------------------IC  581

Query  792   RLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIEVTKSSTKESRLQVLDAH  613
              L YLT LDL++N+ SG I H +                              +QVL+  
Sbjct  582   ELSYLTTLDLANNKLSGSIPHCM----------------------------GNIQVLNLR  613

Query  612   SNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPK  511
              N L G +P ++   L L  +++GHN+  GK+P+
Sbjct  614   HNRLSGVIPEDVFDSLIL--LDVGHNQLEGKLPR  645


 Score = 58.9 bits (141),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 101/235 (43%), Gaps = 48/235 (20%)
 Frame = -3

Query  1170  KFRGPIPDSIINLRKITRLLLSENFFSG-------GLPR----YMRRLRKLEVIDVSHNR  1024
             K +G +P  + +L  +  + LS N F G       GL      YM++L        S+N 
Sbjct  518   KIKGQVPGWLWSLANLQYVNLSNNTFIGFGRSTNLGLSSVPESYMKQLFG------SNNS  571

Query  1023  LSGSIPATITALRELTRLDLSNNELTGKIPDLSGLWQLNTLALSSNQFFAGLPPFPVrlr  844
              +G IP+ I  L  LT LDL+NN+L+G IP   G   +  L L  N+  +G+ P  V   
Sbjct  572   FTGKIPSFICELSYLTTLDLANNKLSGSIPHCMG--NIQVLNLRHNR-LSGVIPEDV---  625

Query  843   tlllghnlltgHISAISRLRYLTALDLSDNRFSGPILHRIVTLPELMRINVSANHFTRIE  664
                                  L  LD+  N+  G +   +V +  L  +NV +N   RI 
Sbjct  626   ------------------FDSLILLDVGHNQLEGKLPRSLVRVSFLEVLNVESN---RIN  664

Query  663   VTKSSTKES--RLQVLDAHSNLLQGHLPLNIITYLNLKTVNLGHNRFFGKIPKEY  505
              T  S   S   L +L   SN   G  P+  I +  L+ +++  N+F G +P  +
Sbjct  665   DTFPSWLSSLQELHILVLRSNAFHG--PIQQIKFATLRIIDISDNQFNGTLPPSF  717



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4492291485948