BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c35704_g1_i1 len=1656 path=[1:0-1655]

Length=1656
                                                                      Score     E

ref|XP_009597175.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    489   2e-164   
ref|XP_002280624.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    478   2e-160   Vitis vinifera
ref|XP_002276823.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    471   2e-157   Vitis vinifera
ref|XP_010658496.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    471   2e-157   
ref|XP_002280528.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    471   2e-157   Vitis vinifera
gb|AGX93071.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    471   2e-157   
ref|XP_002281029.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    470   3e-157   Vitis vinifera
ref|XP_002280470.2|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    469   6e-157   Vitis vinifera
ref|XP_002276555.2|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    468   9e-156   Vitis vinifera
gb|AGX93067.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    465   3e-155   
ref|XP_002276771.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    459   6e-153   Vitis vinifera
ref|XP_002276617.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    459   8e-153   Vitis vinifera
ref|XP_011076758.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    455   2e-151   
gb|AIE12477.1|  UGT4                                                    454   4e-151   
ref|XP_009597174.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    454   4e-151   
emb|CDP16024.1|  unnamed protein product                                453   1e-150   
gb|AGX93068.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    452   3e-150   
gb|AGX93069.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    451   7e-150   
sp|U3U992.1|UGT8_CATRO  RecName: Full=7-deoxyloganetic acid gluco...    451   9e-150   
gb|AGX93072.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    451   1e-149   
gb|AGX93065.1|  7-deoxyloganetic acid UDP-glucosyltransferase           451   1e-149   
ref|XP_010277669.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    451   1e-149   
ref|XP_009800319.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    448   1e-148   
ref|XP_011038346.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    448   1e-148   
ref|XP_010262685.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    447   3e-148   
ref|XP_009590620.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    449   3e-148   
ref|XP_004235055.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    444   4e-147   
ref|XP_006379615.1|  hypothetical protein POPTR_0008s06270g             443   1e-146   
gb|AGX93070.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    443   1e-146   
ref|XP_007009132.1|  UDP-glucosyltransferase family 1 protein           443   1e-146   
gb|AGX93066.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    442   2e-146   
gb|EYU19962.1|  hypothetical protein MIMGU_mgv1a005720mg                441   4e-146   
ref|XP_007009133.1|  UDP-glucosyltransferase family 1 protein           441   6e-146   
ref|XP_009802463.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    440   2e-145   
dbj|BAP90373.1|  UDP-glycose: glycosyltransferase UGT709H1              439   3e-145   
ref|XP_009608691.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    439   5e-145   
emb|CDP05607.1|  unnamed protein product                                437   2e-144   
dbj|BAK55741.1|  UDP-glucose glucosyltransferase                        437   3e-144   
ref|XP_010674287.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    437   5e-144   
ref|XP_010318075.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    436   6e-144   
ref|XP_009613526.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    436   7e-144   
ref|XP_010650643.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    435   1e-143   
ref|XP_007009131.1|  UDP-glucosyltransferase family 1 protein           434   3e-143   
ref|XP_010650608.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    434   6e-143   
ref|XP_009795416.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    433   7e-143   
ref|XP_006355163.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       433   8e-143   
emb|CDP19643.1|  unnamed protein product                                432   9e-143   
ref|XP_009804549.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    433   9e-143   
emb|CDP05611.1|  unnamed protein product                                433   1e-142   
emb|CDP19644.1|  unnamed protein product                                433   2e-142   
dbj|BAK55740.1|  UDP-glucose glucosyltransferase                        432   4e-142   
ref|XP_006435571.1|  hypothetical protein CICLE_v10031408mg             431   5e-142   
ref|XP_006486448.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       431   5e-142   
ref|XP_009589440.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    430   1e-141   
gb|AIS39472.1|  flavonoid UDP-glucosyltransferase 3                     429   2e-141   
gb|KDP44850.1|  hypothetical protein JCGZ_01350                         430   2e-141   
ref|XP_006355679.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       429   5e-141   
ref|XP_004239922.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    428   8e-141   
ref|XP_010674283.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    427   3e-140   
ref|XP_006355680.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       426   6e-140   
gb|KDO69251.1|  hypothetical protein CISIN_1g011832mg                   424   2e-139   
ref|XP_006367215.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       424   3e-139   
ref|XP_006435572.1|  hypothetical protein CICLE_v10031404mg             423   4e-139   
ref|XP_010262684.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    424   4e-139   
gb|KDO69253.1|  hypothetical protein CISIN_1g011848mg                   423   6e-139   
ref|XP_006367216.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       421   3e-138   
ref|XP_011076757.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    421   5e-138   
emb|CBI31575.3|  unnamed protein product                                420   1e-137   
ref|XP_010318076.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    419   3e-137   
ref|XP_010674284.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    418   7e-137   
gb|EYU19963.1|  hypothetical protein MIMGU_mgv1a005336mg                417   2e-136   
ref|XP_009589441.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    416   3e-136   
gb|EYU19961.1|  hypothetical protein MIMGU_mgv1a005050mg                416   7e-136   
ref|XP_006435573.1|  hypothetical protein CICLE_v10031368mg             413   6e-135   
ref|XP_011100060.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    412   1e-134   
gb|ACS87994.1|  UDP-glucosyltransferase family 1 protein                410   7e-134   Citrus sinensis [apfelsine]
ref|XP_011084978.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    410   1e-133   
ref|XP_004150246.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       405   6e-132   
ref|XP_008811497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       405   1e-131   
emb|CDP04614.1|  unnamed protein product                                405   2e-131   
gb|KDO69252.1|  hypothetical protein CISIN_1g011848mg                   403   3e-131   
ref|XP_008464906.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    404   3e-131   
ref|XP_008464907.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    402   9e-131   
ref|XP_006362115.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       402   2e-130   
ref|XP_008464643.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       402   4e-130   
ref|XP_004149949.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       400   5e-130   
ref|XP_011084983.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    400   3e-129   
ref|XP_004231996.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    398   3e-129   
ref|XP_004171873.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       398   4e-129   
gb|KGN50614.1|  hypothetical protein Csa_5G196570                       398   5e-129   
ref|XP_010032068.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    397   8e-129   
ref|XP_004235101.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    397   1e-128   
ref|XP_007158356.1|  hypothetical protein PHAVU_002G145900g             396   2e-128   
ref|XP_011085130.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    396   2e-128   
gb|AFJ53009.1|  UDP-glycosyltransferase 1                               396   2e-128   
ref|XP_006373896.1|  hypothetical protein POPTR_0016s10010g             396   4e-128   
ref|XP_010032069.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    395   5e-128   
gb|KHG01935.1|  UDP-glycosyltransferase 85A1                            407   2e-127   
ref|XP_011014019.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    394   4e-127   
gb|KDO38335.1|  hypothetical protein CISIN_1g044936mg                   392   4e-127   
ref|XP_004150245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       393   5e-127   
ref|XP_011084985.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    392   8e-127   
ref|XP_004172562.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       392   1e-126   
ref|XP_011014018.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    392   1e-126   
ref|XP_006429244.1|  hypothetical protein CICLE_v10013877mg             391   1e-126   
ref|XP_006361975.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       391   1e-126   
gb|AFJ53008.1|  UDP-glycosyltransferase 1                               391   3e-126   
ref|XP_010316061.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    390   4e-126   
ref|XP_006357780.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       390   4e-126   
ref|XP_004162780.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       390   6e-126   
ref|XP_003517688.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       389   1e-125   
ref|XP_011000049.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    389   1e-125   
ref|XP_006357782.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       389   1e-125   
gb|KGN50615.1|  UDP-glucosyltransferase family 1 protein                388   4e-125   
ref|XP_007158358.1|  hypothetical protein PHAVU_002G146100g             388   4e-125   
gb|AIE12478.1|  UGT5                                                    387   5e-125   
ref|XP_007158359.1|  hypothetical protein PHAVU_002G146200g             387   8e-125   
ref|XP_002530397.1|  UDP-glucuronosyltransferase, putative              387   9e-125   Ricinus communis
ref|XP_006429243.1|  hypothetical protein CICLE_v10011602mg             386   2e-124   
ref|XP_006481394.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       385   2e-124   
ref|XP_008359771.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       386   2e-124   
ref|XP_008388093.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       386   2e-124   
ref|XP_008370121.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       385   4e-124   
ref|XP_010316060.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    384   5e-124   
ref|XP_010688868.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    385   7e-124   
ref|XP_010905381.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    384   1e-123   
gb|KDO43669.1|  hypothetical protein CISIN_1g011792mg                   383   2e-123   
ref|XP_006423294.1|  hypothetical protein CICLE_v10030404mg             383   2e-123   
ref|XP_010923184.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    383   4e-123   
emb|CDO99846.1|  unnamed protein product                                379   2e-122   
ref|XP_008785471.1|  PREDICTED: UDP-glycosyltransferase 85A4-like       381   2e-122   
ref|XP_010032067.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    381   3e-122   
gb|KDO58004.1|  hypothetical protein CISIN_1g037999mg                   377   1e-121   
ref|XP_009346996.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    378   2e-121   
gb|KDO38337.1|  hypothetical protein CISIN_1g011531mg                   378   2e-121   
gb|KDO61155.1|  hypothetical protein CISIN_1g037374mg                   377   4e-121   
ref|XP_008388092.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       377   5e-121   
ref|XP_007026849.1|  UDP-glucosyl transferase 85A3, putative            376   9e-121   
ref|XP_008353149.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       377   9e-121   
emb|CAN77812.1|  hypothetical protein VITISV_010344                     382   1e-120   Vitis vinifera
ref|XP_010923186.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    376   2e-120   
gb|AGZ84549.1|  glycosyltransferase KGT31                               374   5e-120   
emb|CAN68538.1|  hypothetical protein VITISV_039646                     372   2e-119   Vitis vinifera
gb|KHG01936.1|  UDP-glycosyltransferase 85A1                            385   4e-119   
ref|XP_010923185.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    372   4e-119   
ref|XP_010674282.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    372   2e-118   
ref|XP_004302685.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       369   3e-118   
ref|XP_009759439.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    369   1e-117   
gb|AFK79038.1|  glycosyltransferase UGT6                                367   7e-117   
ref|XP_010666049.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    366   3e-116   
ref|XP_008785470.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       365   3e-116   
dbj|BAB86929.1|  glucosyltransferase-11                                 364   3e-116   Vigna angularis [azuki bean]
ref|XP_010666054.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    364   8e-116   
ref|XP_003517692.2|  PREDICTED: UDP-glycosyltransferase 85A3-like       361   2e-114   
gb|KHN04919.1|  UDP-glycosyltransferase 85A3                            360   2e-114   
dbj|BAB86920.1|  glucosyltransferase-2                                  360   3e-114   Vigna angularis [azuki bean]
ref|XP_004512576.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       358   7e-114   
gb|KHN04913.1|  UDP-glycosyltransferase 85A2                            357   2e-113   
ref|XP_003613025.1|  UDP-glucuronosyltransferase 1-1                    356   6e-113   
ref|XP_003613028.1|  Cis-zeatin O-glucosyltransferase                   353   8e-112   
emb|CAN67315.1|  hypothetical protein VITISV_036458                     352   2e-111   Vitis vinifera
dbj|BAB86930.1|  glucosyltransferase-12                                 352   3e-111   Vigna angularis [azuki bean]
gb|AFJ53007.1|  UDP-glycosyltransferase 1                               349   3e-110   
ref|XP_007026845.1|  UDP-glucosyl transferase 85A3, putative isof...    347   2e-109   
ref|XP_003613026.1|  UDP-glucuronosyltransferase 1-6                    346   3e-109   
ref|XP_004305167.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       343   4e-108   
emb|CBI31566.3|  unnamed protein product                                344   5e-108   
ref|XP_010674285.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    344   1e-107   
emb|CDP14405.1|  unnamed protein product                                338   1e-107   
gb|KHG08953.1|  hypothetical protein F383_15475                         342   3e-107   
ref|XP_010676681.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    341   1e-106   
ref|XP_007026851.1|  UDP-Glycosyltransferase superfamily protein ...    339   3e-106   
dbj|BAM63146.1|  uncharacterized glucosyltransferase 2                  338   6e-106   
ref|XP_010044032.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    337   8e-106   
gb|EPS60746.1|  hypothetical protein M569_14056                         337   1e-105   
ref|XP_007026848.1|  UDP-glucosyl transferase 85A3, putative isof...    337   1e-105   
ref|XP_007026850.1|  UDP-glucosyl transferase 85A4-like protein i...    337   2e-105   
emb|CBI36709.3|  unnamed protein product                                336   2e-105   
emb|CDP05613.1|  unnamed protein product                                332   2e-104   
ref|XP_007026847.1|  UDP-glucosyl transferase 85A3, putative isof...    335   2e-104   
ref|XP_007207170.1|  hypothetical protein PRUPE_ppa022102mg             333   3e-104   
emb|CBI36705.3|  unnamed protein product                                331   3e-104   
ref|XP_007207618.1|  hypothetical protein PRUPE_ppa019804mg             332   2e-103   
ref|XP_006361974.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       328   2e-103   
ref|XP_007206751.1|  hypothetical protein PRUPE_ppa025141mg             330   9e-103   
ref|XP_006379614.1|  hypothetical protein POPTR_0008s06270g             326   1e-102   
ref|XP_007026846.1|  UDP-glucosyl transferase 85A3, putative isof...    327   3e-102   
ref|XP_008242286.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       327   8e-102   
ref|XP_007207791.1|  hypothetical protein PRUPE_ppa025605mg             325   7e-101   
ref|XP_008346926.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       325   1e-100   
gb|EPS61663.1|  hypothetical protein M569_13131                         322   1e-99    
ref|XP_004305165.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       322   2e-99    
gb|KHN15666.1|  UDP-glycosyltransferase 85A7                            320   2e-99    
ref|XP_008242262.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       318   1e-98    
ref|XP_009594030.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    314   5e-98    
ref|XP_003522179.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       315   4e-97    
ref|XP_003560193.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    314   1e-96    
ref|NP_001148991.1|  cytokinin-O-glucosyltransferase 2                  313   2e-96    Zea mays [maize]
gb|ACF88457.1|  unknown                                                 313   2e-96    Zea mays [maize]
ref|XP_007133982.1|  hypothetical protein PHAVU_010G009000g             312   7e-96    
ref|NP_001175205.1|  Os07g0489200                                       311   1e-95    
dbj|BAC57706.1|  putative glucosyltransferase-2                         311   2e-95    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059664.1|  Os07g0486700                                       311   3e-95    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ03904.1|  hypothetical protein OsI_26038                          311   3e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_007133898.1|  hypothetical protein PHAVU_010G001300g             310   5e-95    
gb|EAZ39840.1|  hypothetical protein OsJ_24281                          310   7e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003520949.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       309   1e-94    
ref|XP_004173134.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    302   2e-94    
gb|EMT06489.1|  Cytokinin-O-glucosyltransferase 2                       307   3e-94    
ref|XP_008467017.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       301   3e-94    
gb|EAZ03903.1|  hypothetical protein OsI_26037                          307   7e-94    Oryza sativa Indica Group [Indian rice]
ref|NP_001059665.1|  Os07g0487100                                       307   9e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957723.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       303   1e-92    
ref|XP_003560194.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    303   3e-92    
ref|XP_002462875.1|  hypothetical protein SORBIDRAFT_02g033580          303   4e-92    Sorghum bicolor [broomcorn]
emb|CBI31568.3|  unnamed protein product                                298   4e-92    
dbj|BAJ98857.1|  predicted protein                                      301   5e-92    
ref|NP_001175206.1|  Os07g0489950                                       302   5e-92    
gb|EAZ03912.1|  hypothetical protein OsI_26045                          301   8e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_003575790.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    300   3e-91    
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    300   4e-91    
ref|XP_008242242.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       295   9e-90    
ref|XP_003576916.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    296   1e-89    
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    295   4e-89    
ref|XP_003563101.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    295   4e-89    
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    291   1e-87    
gb|KCW66540.1|  hypothetical protein EUGRSUZ_F00337                     290   1e-87    
gb|EAZ39846.1|  hypothetical protein OsJ_24286                          287   3e-87    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059667.1|  Os07g0489300                                       287   7e-87    Oryza sativa Japonica Group [Japonica rice]
gb|KHG03787.1|  hypothetical protein F383_26945                         283   8e-87    
ref|NP_001059671.1|  Os07g0490100                                       288   1e-86    Oryza sativa Japonica Group [Japonica rice]
gb|EEC82058.1|  hypothetical protein OsI_26044                          288   1e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_008450117.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       287   2e-86    
ref|XP_007219664.1|  hypothetical protein PRUPE_ppa023956mg             285   2e-86    
gb|ACD03242.1|  UDP-glycosyltransferase UGT709A10                       287   2e-86    Avena strigosa
gb|EAZ03162.1|  hypothetical protein OsI_25314                          287   4e-86    Oryza sativa Indica Group [Indian rice]
gb|KCW66542.1|  hypothetical protein EUGRSUZ_F00339                     285   1e-85    
ref|XP_006658565.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       286   1e-85    
gb|KCW66544.1|  hypothetical protein EUGRSUZ_F00340                     285   1e-85    
ref|XP_009781211.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    281   2e-85    
ref|XP_004306404.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       285   2e-85    
dbj|BAJ90455.1|  predicted protein                                      285   2e-85    
dbj|BAJ89885.1|  predicted protein                                      285   3e-85    
gb|KGN54319.1|  hypothetical protein Csa_4G303180                       282   2e-84    
dbj|BAJ85877.1|  predicted protein                                      283   2e-84    
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    281   4e-84    
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     281   5e-84    
ref|XP_004957721.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       280   6e-84    
ref|NP_001062593.1|  Os09g0119600                                       281   7e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                    280   1e-83    
gb|EMT13629.1|  Cytokinin-O-glucosyltransferase 2                       280   1e-83    
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    280   2e-83    
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             280   2e-83    
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     279   2e-83    
gb|KDO69249.1|  hypothetical protein CISIN_1g0487532mg                  273   3e-83    
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             279   3e-83    
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            279   3e-83    
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       279   4e-83    
gb|EMT31313.1|  Cytokinin-O-glucosyltransferase 2                       278   4e-83    
gb|EMS59486.1|  UDP-glycosyltransferase 85A2                            279   8e-83    
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       278   8e-83    
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    278   1e-82    
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      278   1e-82    
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       277   1e-82    
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    278   1e-82    
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    277   1e-82    
gb|KFK44333.1|  hypothetical protein AALP_AA1G244500                    277   2e-82    
gb|EEE67190.1|  hypothetical protein OsJ_24292                          278   2e-82    Oryza sativa Japonica Group [Japonica rice]
gb|EMS64262.1|  UDP-glycosyltransferase 85A2                            277   3e-82    
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             276   4e-82    
ref|XP_002462874.1|  hypothetical protein SORBIDRAFT_02g033570          276   5e-82    Sorghum bicolor [broomcorn]
gb|EAZ39839.1|  hypothetical protein OsJ_24280                          275   5e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007207189.1|  hypothetical protein PRUPE_ppa017055mg             275   7e-82    
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    275   7e-82    
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    275   1e-81    
gb|AIF76151.1|  UDP-glucosyltransferase UGT85U2                         275   1e-81    
ref|XP_004963489.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       275   1e-81    
ref|XP_003579567.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    275   2e-81    
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  274   2e-81    
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    274   3e-81    
gb|KGN43695.1|  hypothetical protein Csa_7G059660                       274   3e-81    
gb|AFK38894.1|  unknown                                                 273   4e-81    
gb|KEH35119.1|  UDP-glucosyltransferase family protein                  273   4e-81    
ref|XP_009370709.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    273   5e-81    
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       273   5e-81    
ref|XP_010646820.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    273   6e-81    
ref|XP_004155505.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       273   8e-81    
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                    273   8e-81    
gb|ABR16342.1|  unknown                                                 272   9e-81    
ref|XP_006416204.1|  hypothetical protein EUTSA_v10007489mg             273   1e-80    
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    272   1e-80    
ref|XP_011087901.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    272   1e-80    
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            272   2e-80    
ref|XP_010027305.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    272   2e-80    
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       272   2e-80    
ref|XP_009413574.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    271   2e-80    
gb|EMS55955.1|  UDP-glycosyltransferase 85A2                            272   2e-80    
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             272   2e-80    
gb|EMT17620.1|  Cytokinin-O-glucosyltransferase 2                       285   2e-80    
ref|XP_003592231.1|  Cytokinin-O-glucosyltransferase                    272   2e-80    
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       271   3e-80    
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       271   3e-80    
gb|EMT13628.1|  Cytokinin-O-glucosyltransferase 2                       280   3e-80    
emb|CDY38225.1|  BnaC05g17420D                                          271   4e-80    
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  271   4e-80    
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       271   4e-80    
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       271   5e-80    
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   5e-80    
ref|XP_010459988.1|  PREDICTED: UDP-glycosyltransferase 85A2            271   5e-80    
ref|XP_006661032.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       270   6e-80    
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   6e-80    
ref|XP_006416205.1|  hypothetical protein EUTSA_v10007502mg             270   7e-80    
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   7e-80    
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   7e-80    
ref|XP_010027911.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   7e-80    
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       270   1e-79    
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            270   1e-79    
dbj|BAJ95377.1|  predicted protein                                      269   1e-79    
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         270   1e-79    
ref|XP_010477499.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    270   1e-79    
ref|XP_006593894.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       270   1e-79    
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             270   1e-79    
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   1e-79    
ref|XP_009350671.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   1e-79    
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         269   2e-79    
ref|XP_002891115.1|  predicted protein                                  270   2e-79    
ref|XP_011087902.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    269   2e-79    
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      270   2e-79    
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       269   2e-79    
ref|XP_003519003.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       269   2e-79    
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    269   3e-79    
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       269   3e-79    
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       268   3e-79    
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             268   4e-79    
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   4e-79    
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   4e-79    
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   4e-79    
gb|ABV68925.1|  mandelonitrile glucosyltransferase UGT85A19             268   5e-79    
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             268   5e-79    
emb|CDY62991.1|  BnaC07g48390D                                          267   5e-79    
ref|XP_010025433.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   6e-79    
ref|XP_007227474.1|  hypothetical protein PRUPE_ppa004968mg             268   6e-79    
gb|EYU18466.1|  hypothetical protein MIMGU_mgv1a005711mg                267   7e-79    
ref|XP_010025432.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   7e-79    
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       267   7e-79    
ref|XP_002310553.1|  hypothetical protein POPTR_0007s05230g             268   7e-79    
emb|CDY41486.1|  BnaA08g20880D                                          267   8e-79    
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       268   8e-79    
gb|AHL38933.1|  glycosyltransferase                                     267   8e-79    
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    267   8e-79    
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       267   8e-79    
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    267   9e-79    
ref|XP_004299647.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       267   9e-79    
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       267   1e-78    
gb|EMT23148.1|  Cytokinin-O-glucosyltransferase 2                       267   1e-78    
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          267   1e-78    
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                    267   1e-78    
emb|CDY46643.1|  BnaA07g10530D                                          267   1e-78    
gb|KCW62086.1|  hypothetical protein EUGRSUZ_H04754                     266   1e-78    
gb|ACJ84649.1|  unknown                                                 266   1e-78    
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    267   2e-78    
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    266   2e-78    
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    269   2e-78    
ref|XP_010025429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    266   2e-78    
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             266   2e-78    
ref|XP_008219457.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       266   2e-78    
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                266   2e-78    
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          266   2e-78    
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       266   2e-78    
ref|XP_008370128.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       259   3e-78    
gb|AEO45782.1|  cyanohydrin UDP-glucosyltransferase UGT85K5             266   4e-78    
dbj|BAJ87346.1|  predicted protein                                      266   4e-78    
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       266   4e-78    
ref|XP_009145349.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    265   4e-78    
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    265   5e-78    
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       265   5e-78    
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             265   5e-78    
ref|XP_006416203.1|  hypothetical protein EUTSA_v10009957mg             272   5e-78    
ref|XP_007047909.1|  UDP-glucosyl transferase 85A2                      265   5e-78    
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             265   5e-78    
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       265   5e-78    
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    265   6e-78    
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                            265   6e-78    
ref|XP_007047908.1|  UDP-glucosyl transferase 85A2                      265   6e-78    
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       265   6e-78    
emb|CDY62992.1|  BnaC07g48400D                                          265   7e-78    
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         265   7e-78    
ref|XP_003618637.1|  Cytokinin-O-glucosyltransferase                    265   7e-78    
gb|AFK33787.1|  unknown                                                 265   7e-78    
gb|AFK37311.1|  unknown                                                 265   8e-78    
gb|ABR18044.1|  unknown                                                 265   8e-78    
ref|XP_010025430.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    265   8e-78    
ref|XP_007146161.1|  hypothetical protein PHAVU_006G017500g             265   9e-78    
ref|XP_010498708.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       266   9e-78    
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    265   9e-78    
gb|EAZ39850.1|  hypothetical protein OsJ_24290                          264   9e-78    
ref|NP_173652.1|  UDP-glucosyl transferase 85A7                         265   9e-78    
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    265   1e-77    
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    265   1e-77    
ref|XP_006649062.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       265   1e-77    
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             264   1e-77    
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       264   1e-77    
ref|XP_002893219.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    265   1e-77    
gb|EMS64263.1|  UDP-glycosyltransferase 85A2                            265   1e-77    
gb|KEH25029.1|  UDP-glucosyltransferase family protein                  264   1e-77    
ref|XP_009103242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       265   1e-77    
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like       265   1e-77    
ref|XP_003556840.1|  PREDICTED: UDP-glycosyltransferase 85A2            264   1e-77    
gb|AIE12476.1|  UGT7                                                    264   2e-77    
gb|KHN24338.1|  UDP-glycosyltransferase 85A3                            263   2e-77    
ref|XP_004303931.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       264   2e-77    
ref|XP_008353241.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       263   2e-77    
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    263   2e-77    
emb|CDY46645.1|  BnaA07g10510D                                          263   2e-77    
ref|XP_004502000.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       263   2e-77    
ref|XP_006853219.1|  hypothetical protein AMTR_s00038p00218410          263   3e-77    
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    263   3e-77    
ref|XP_002525853.1|  UDP-glucuronosyltransferase, putative              263   3e-77    
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg             263   3e-77    
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    263   4e-77    
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          263   4e-77    
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       263   4e-77    
ref|XP_008234165.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       263   4e-77    
gb|ABK24277.1|  unknown                                                 263   4e-77    
ref|XP_010658655.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    255   4e-77    
ref|XP_011023081.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    263   4e-77    
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                            262   4e-77    
ref|XP_002307922.1|  hypothetical protein POPTR_0006s02450g             263   4e-77    
gb|KCW62094.1|  hypothetical protein EUGRSUZ_H04766                     261   6e-77    
emb|CDX91674.1|  BnaC08g05930D                                          262   6e-77    
gb|KCW66543.1|  hypothetical protein EUGRSUZ_F00340                     260   6e-77    
gb|EYU18467.1|  hypothetical protein MIMGU_mgv1a005587mg                262   6e-77    
ref|XP_006853218.1|  hypothetical protein AMTR_s00038p00217680          262   7e-77    
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             262   8e-77    
gb|EMS53235.1|  UDP-glycosyltransferase 85A2                            262   8e-77    
ref|XP_010680525.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    262   8e-77    
gb|AEO45781.1|  cyanohydrin UDP-glucosyltransferase UGT85K4             262   9e-77    
ref|XP_007148402.1|  hypothetical protein PHAVU_006G205500g             262   1e-76    
gb|ABB88577.1|  UDP-glucosyltransferase                                 262   1e-76    
ref|XP_010025434.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    262   1e-76    
gb|AIF76152.1|  UDP-glucosyltransferase UGT85U1                         261   1e-76    
ref|XP_003575222.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    262   1e-76    
dbj|BAO51839.1|  UDP-glycosyltransferase 85A34                          262   1e-76    
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  261   1e-76    
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    262   2e-76    
ref|XP_008386170.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       261   2e-76    
gb|AFK34769.1|  unknown                                                 261   2e-76    
ref|XP_003576223.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    261   2e-76    
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    261   2e-76    
gb|KCW62089.1|  hypothetical protein EUGRSUZ_H04760                     261   2e-76    
gb|AFJ52997.1|  UDP-glycosyltransferase 1                               261   2e-76    
gb|KCW45340.1|  hypothetical protein EUGRSUZ_L00994                     260   2e-76    
ref|XP_008378324.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       261   3e-76    
dbj|BAJ95038.1|  predicted protein                                      261   3e-76    
ref|XP_008358180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       260   3e-76    
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       261   3e-76    
gb|KEH35117.1|  UDP-glucosyltransferase family protein                  260   3e-76    
ref|XP_008229740.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       261   4e-76    
ref|XP_008221698.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       260   4e-76    
gb|KHN33534.1|  UDP-glycosyltransferase 85A2                            260   5e-76    
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g             260   5e-76    
ref|XP_003545683.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       260   5e-76    
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    260   5e-76    
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       260   6e-76    
dbj|BAJ96474.1|  predicted protein                                      260   6e-76    
ref|XP_008234196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       260   6e-76    
ref|NP_001048164.1|  Os02g0755600                                       260   6e-76    
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              259   6e-76    
ref|XP_004489451.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       260   7e-76    
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                       259   7e-76    
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    259   7e-76    
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    260   7e-76    
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    259   7e-76    
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    259   7e-76    
dbj|BAB86928.1|  glucosyltransferase-10                                 259   8e-76    
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    259   9e-76    
emb|CDP13143.1|  unnamed protein product                                259   9e-76    
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     259   1e-75    
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       259   1e-75    
gb|KFK44332.1|  hypothetical protein AALP_AA1G244400                    259   1e-75    
ref|XP_008219458.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       259   1e-75    
gb|ACU24374.1|  unknown                                                 259   1e-75    
ref|XP_007224968.1|  hypothetical protein PRUPE_ppa020820mg             259   1e-75    
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             259   1e-75    
ref|XP_010937416.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    259   1e-75    
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             259   1e-75    
dbj|BAJ99359.1|  predicted protein                                      259   1e-75    
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             259   1e-75    
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    259   2e-75    
dbj|BAG80542.1|  glycosyltransferase                                    259   2e-75    
dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          259   2e-75    
dbj|BAO51833.1|  UDP-glycosyltransferase 85K10                          258   2e-75    
ref|XP_008234156.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       258   2e-75    
ref|XP_010477498.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    260   2e-75    
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    258   2e-75    
ref|XP_003575202.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    259   2e-75    
ref|XP_007042919.1|  UDP-glycosyltransferase 85A1                       258   2e-75    
ref|XP_007047910.1|  UDP-glucosyl transferase 85A2                      258   2e-75    
ref|XP_004953968.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       258   3e-75    
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    258   3e-75    



>ref|XP_009597175.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=489

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 242/476 (51%), Positives = 327/476 (69%), Gaps = 13/476 (3%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   H++ ML LA+LLCLS + VTFI T+  +N L   +D+ SRF  + GFRFETIP
Sbjct  13    FPFPVQGHVNPMLKLAELLCLSGIHVTFINTLSIQNRLSRNTDIQSRFNRFPGFRFETIP  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA-------PQRCIIA  482
             DGL + +   ++ +   +V +  SL +TAKP LKEI++ +G    +       P  C+IA
Sbjct  73    DGLSNKVPQTYQETHKVMV-IFDSLRSTAKPILKEIILAAGCPSGSSEVTRQGPVTCVIA  131

Query  483   DGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKG  662
             DG  + A++VAE+VG+PI+ F   SAA+ W Y  +P LIQ GELPF G ++D PI S+KG
Sbjct  132   DGILSVALEVAEDVGIPILYFRTASAASFWIYLCLPQLIQNGELPFPGNELDVPIASIKG  191

Query  663   MEKLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGD  839
             ME LLRRRDLP  CRVD ++ P  + ++ E +K  RTK  I+N+F+E+EG  LDQ+R   
Sbjct  192   MESLLRRRDLPSFCRVDSVDVPILQMVLTETQKTLRTKGLILNTFEEVEGPILDQIR-NH  250

Query  840   MLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLT  1019
             +  +Y+IGPLH  L+NK+ S +++ +  SN + E+ K C+ WLD QP NSV+YV FG+L 
Sbjct  251   LPKLYSIGPLHAHLKNKIASESISQSIHSNSIWEEDKSCLKWLDDQPANSVIYVSFGSLV  310

Query  1020  LVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQ  1199
              V++  L EFWHGL+NSGQRFLW +    + +   E  ++  E+  G+     +V WAPQ
Sbjct  311   TVTKNVLTEFWHGLVNSGQRFLWVIRHDSITDNDKE-AQIEEELKEGVIENGYIVSWAPQ  369

Query  1200  QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDT  1379
             +EVLAH+A+GGFLTH GWNS +ESI+ GVPMI WP  ADQQ+NSR++ EVWK+GLDMKDT
Sbjct  370   EEVLAHTAIGGFLTHSGWNSTLESIIEGVPMICWPQLADQQINSRYVEEVWKLGLDMKDT  429

Query  1380  CDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             CDR IIEKMVRDLME+R+ EFLQRA   A  A+    E GSS S+L  L++DI  M
Sbjct  430   CDRVIIEKMVRDLMELRRSEFLQRANDMAKLARASVAEAGSSDSNLARLVQDIVSM  485



>ref|XP_002280624.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=479

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 234/470 (50%), Positives = 321/470 (68%), Gaps = 13/470 (3%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   +I+SML LA+LLCL+ ++VTF+   +    LL +S++ +RF  Y GFRFETI 
Sbjct  13    FPFPIQGNINSMLKLAELLCLADIQVTFLNCHYPHRRLLSYSNIQARFSRYPGFRFETIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT---SGGEDSAPQRCIIADGFA  494
             DGLP     +H  +    + ++  +  T  P   E++++   S  +  +P  CIIADG  
Sbjct  73    DGLPM----EHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSASDTRSPLTCIIADGLM  128

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
             +FA+DVA EVG+P+I F P+SA + WAYFS+P LI+AGE+PF G DMD  + SV GME  
Sbjct  129   SFAIDVANEVGLPVIIFRPISACSFWAYFSLPQLIEAGEVPFRGGDMDRLVASVPGMEGF  188

Query  675   LRRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             LRRR LP + RV+D+  P  + +M+ FR+  R    +IN+F +LEG  L Q+R       
Sbjct  189   LRRRHLPSSGRVNDVAYPGLQHLMKIFRQAQRAHSLVINTFDDLEGPVLSQIR-DHYPRT  247

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             YAIGPLH  L++KL S   + + SSN   ++ K C+ WLDRQPP SV+YV FG+L ++++
Sbjct  248   YAIGPLHAHLKSKLAS-ETSTSQSSNSFRKEDKSCIPWLDRQPPKSVIYVSFGSLAIITK  306

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVL  1211
             + L EFWHGL+NSG RFLW + P  ++ K  ER + P E+L G + R  VV WAPQ+EVL
Sbjct  307   DELGEFWHGLVNSGNRFLWVIRPDALVGKDEER-QTPAELLEGTKDRGYVVGWAPQEEVL  365

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
              H AVGGFLTH GWNS +ESIV G+PMI WP++ADQQ+NSRF+  VWK+G+DMKD+CDR 
Sbjct  366   KHPAVGGFLTHGGWNSTLESIVEGLPMICWPYFADQQINSRFVSHVWKLGMDMKDSCDRV  425

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
              +EKMVRDLM  ++DEF++ A   A  AK+C  +GGSS  +L +LIEDI+
Sbjct  426   TVEKMVRDLMVEKRDEFMKAADTLATLAKKCVGDGGSSSCNLNSLIEDIR  475



>ref|XP_002276823.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=480

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 235/471 (50%), Positives = 321/471 (68%), Gaps = 12/471 (3%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LA+LL ++ L VTF+ + + ++ LL  +D+ +RF  Y GFRF+TI 
Sbjct  13    FPFPAQGHVNSMLKLAELLSVAGLHVTFLNSEYNQHRLLLHTDIQTRFSGYPGFRFQTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG-GEDSAPQ-RCIIADGFAN  497
             DGL    T DH  +G  ++ L   L ATAKP  +E+V++ G G D+ P   CIIADG  +
Sbjct  73    DGL----TTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIMS  128

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             F +D+A EVG+PIISF  +SA + WAYFS   LI++GELP  G DMD+ + S+ GME  L
Sbjct  129   FTIDIANEVGIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQLVTSIPGMEGFL  188

Query  678   RRRDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R+RDLP   RV +L+D      M E ++  R    I+N+F++LEG  L Q+R      +Y
Sbjct  189   RKRDLPSLIRVSNLDDEGLLLVMKETQQTPRAHALILNTFEDLEGPILGQIR-NHCPKIY  247

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPLH  L+ +L S + T + SSN   ++ + C+ WLD QP  SV+YV FG+LT++S +
Sbjct  248   TIGPLHAHLKTRLASESTT-SQSSNSFRQEDRSCIAWLDHQPSKSVIYVSFGSLTVISRK  306

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              L EF HGL+NSG RFLW +    +  +  E  + P E++ G + R  +VEWAPQ+EVLA
Sbjct  307   QLIEFCHGLVNSGSRFLWVIRTDSLAEEDGEH-QTPAELMEGAKERSYIVEWAPQEEVLA  365

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H AVGGFLTH GWNS +ESI AGVPMI WP++ADQQ+NSRF+  VWK+G DMKDTCDR I
Sbjct  366   HPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSDMKDTCDRLI  425

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKMVRDLME RKDE L+ A + A  A++C  EGGSS  +L +L+++I+ M
Sbjct  426   VEKMVRDLMEERKDELLKTADKMATRARKCVSEGGSSYCNLSSLVDEIRLM  476



>ref|XP_010658496.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=480

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 234/472 (50%), Positives = 321/472 (68%), Gaps = 12/472 (3%)
 Frame = +3

Query  147   AYPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
              +PFP   H++SML LA+LL L+ L++TF+ + +  + LL +++++ RF  Y GFRF+TI
Sbjct  12    VFPFPIQGHVNSMLKLAELLSLAGLRITFLNSYYTHSRLLRYTNILDRFTRYPGFRFQTI  71

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG-GEDSAPQ-RCIIADGFA  494
              DGL    T DH  +G  ++ L   L ATAKP  +E+V++ G G D+ P   CIIADG  
Sbjct  72    SDGL----TTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIM  127

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
             +F +D+A EVG+PIISF  +SA + WAYFS   LI++GELP  G DMD+ + S+ GME  
Sbjct  128   SFTIDIANEVGIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQLVTSIPGMEGF  187

Query  675   LRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             LR+RDLP   RV +L+D     +  E ++  R    I+N+F++LEG  L Q+R       
Sbjct  188   LRKRDLPSLIRVSNLDDERLLLVTKETQQTPRAYALILNTFEDLEGPILGQIR-NHCPKT  246

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y IGPLH  L  +L S + T + SSN L ++ + C+ WL+RQP  SV+YV FG++T+++ 
Sbjct  247   YTIGPLHAHLETRLASESTT-SQSSNSLRQEDRSCIAWLNRQPSKSVIYVSFGSVTVITR  305

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVL  1211
             + L EF +GL+NSG RFLW +    +  +  ER + P E+L G + R  +VEWAPQ+EVL
Sbjct  306   KQLIEFCYGLVNSGSRFLWVIRTDSLAEEDGER-QTPAELLEGAKERSYIVEWAPQEEVL  364

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
             AH AVGGFLTH GWNS +ESI AGVPMI WP++ADQQ+NSRF+  VWK+G DMKDTCDR 
Sbjct  365   AHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSDMKDTCDRL  424

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             I+EKMVRDLME R+DE L+ A   A  A++C  EGGSS  +L +LIE+I+ M
Sbjct  425   IVEKMVRDLMEERRDELLKTADMMATRARKCVSEGGSSYCNLSSLIEEIRLM  476



>ref|XP_002280528.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=479

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/470 (49%), Positives = 317/470 (67%), Gaps = 13/470 (3%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   +++SML L +LLCL+ ++VTF+   +    LL +S++ +RF  Y GFRFETI 
Sbjct  13    FPFPIQGNVNSMLKLTELLCLAGIQVTFLNCHYPHRRLLSYSNIQARFSRYPGFRFETIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT---SGGEDSAPQRCIIADGFA  494
             DGLP     +H  +    + ++  +  T  P   E++++   S  +  +P  CIIADG  
Sbjct  73    DGLPM----EHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSASDTRSPLTCIIADGLM  128

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
             +F++DVA EVG+P+I F  +SA + WAYFS+P LI+AGE+PF G DMD  + SV GME  
Sbjct  129   SFSIDVANEVGLPVIIFRAISACSFWAYFSLPQLIEAGEVPFRGGDMDRLVASVPGMEGF  188

Query  675   LRRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             LRRRDLP  CRV D+++P  +  M+  RK       +IN+F +LEG  L Q+R       
Sbjct  189   LRRRDLPSCCRVKDVDNPDLQNPMKNIRKTHGAHAQVINTFDDLEGPILSQIR-NHFPRT  247

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y IGPLH LL++KL +   + + SSN   E+ + C+ WLDRQP  SV+YV FG+L ++++
Sbjct  248   YTIGPLHALLKSKLAT-ETSTSQSSNSFWEEDRSCIPWLDRQPSKSVIYVSFGSLAIITK  306

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVL  1211
             E L EFWHGL+NSG RFLW + P  ++ K  ER + P E+L G + R  VV WAPQ+EVL
Sbjct  307   EELREFWHGLVNSGSRFLWVIRPDALVGKDEER-QTPAELLEGTKDRGYVVGWAPQEEVL  365

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
              H AVGGFLTH GWNS +ESIV G+PMI WP++ADQQ+NSRF+  VWK+G+DMKD+CDR 
Sbjct  366   KHPAVGGFLTHGGWNSTLESIVEGLPMICWPYFADQQINSRFVSHVWKLGMDMKDSCDRV  425

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
              +EKMVRDLM  ++DEF++ A   A  AK+C  +GGSS  +L +LIEDI+
Sbjct  426   TVEKMVRDLMVEKRDEFMEAADTLATLAKKCVGDGGSSSCNLNSLIEDIR  475



>gb|AGX93071.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Vinca 
minor]
Length=482

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 317/469 (68%), Gaps = 10/469 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SML LA+LLCL+ L +TF+ +  + N L+  ++V SRF  Y GF+F+TI DGL
Sbjct  18    PIQGHVNSMLRLAELLCLAKLDITFVVSDFSHNRLIKHTNVASRFARYPGFQFQTISDGL  77

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA---PQRCIIADGFANFA  503
             P    DDH  +G  ++ +L S      P  K +++ +    S+   P  CIIADG  +FA
Sbjct  78    P----DDHPRAGEKVMDILPSTKNVTGPLFKRMMIENNCFASSTRRPTTCIIADGVLSFA  133

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D AEE GVP+I F  VSA A WA FS+P LI++G++P  G  MD  +  V GME  LRR
Sbjct  134   GDFAEENGVPLIYFRTVSACAFWACFSMPELIESGDIPIKGNGMDLLVKGVAGMETFLRR  193

Query  684   RDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLPG CRV+D+ +P  + +  E R+  R +  I+N+F++LEG  L Q+R   +  ++ I
Sbjct  194   RDLPGFCRVNDMSEPKLQIIKTETRQTTRAQAAILNTFEDLEGPILSQIR-KHIPRLFTI  252

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP H  L ++L + N+  + SS    E+ + C+DWLD QPP SVLYV FG++T+V+   L
Sbjct  253   GPSHSHLNSRLETQNIKTSISSGSFWEEDRSCVDWLDSQPPRSVLYVSFGSITVVTRAQL  312

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSG RFLW + P  ++ K  E   VP E+  G + R  +V WAPQ+EVL HS
Sbjct  313   LEFWHGLVNSGHRFLWVMRPDSIMGKDGE-NRVPHELEEGTKERGYMVGWAPQEEVLNHS  371

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGF THCGWNS +ESIVAGVPMI WP++ADQ +NSRF+ E+WKIGLDMKD+CDR II 
Sbjct  372   AIGGFFTHCGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDSCDREIIV  431

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVR+LMEV+KDEF++RA + A  A++   EGGSS S+L+ L+E I+ +
Sbjct  432   KMVRELMEVKKDEFMERADEMAKLARKAVSEGGSSYSNLDALVEYIRSL  480



>ref|XP_002281029.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=475

 Score =   470 bits (1209),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 236/469 (50%), Positives = 314/469 (67%), Gaps = 11/469 (2%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   H++SML LA+LL L+ L++TF+ + +  + LL +++++ RF  Y+GFRF+TI 
Sbjct  13    FPFPIQGHVNSMLKLAELLSLAGLRITFLNSDYTHSRLLRYTNILDRFTRYAGFRFQTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  +GV +  +   + AT KP  +E+++ S    S P  CIIADG   FA
Sbjct  73    DGLPL----DHPRTGVQLKDMFDGMKATTKPLFREMIM-SWCRSSDPVTCIIADGIMGFA  127

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             +DV  EVGVP ISF   S  A WAYFS+P LI+AGE+PF   DMD+ + SV GME  LRR
Sbjct  128   IDVGNEVGVPTISFRTSSPCAFWAYFSLPQLIEAGEVPFKDDDMDQLVTSVPGMEGFLRR  187

Query  684   RDLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CR  D  DP  +  M+E R+  R    I+N+F++L+G+TL Q+R      +Y I
Sbjct  188   RDLPSFCRTKDANDPNLQLVMIETRQTPRADALILNTFEDLDGATLSQIR-SHCPKLYTI  246

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L+++L S   T +  SN L E+ K+C+ WLDRQP  SV+YV FG+LT++++E L
Sbjct  247   GPLHAHLKSRLAS-ETTASQFSNSLWEEDKRCIPWLDRQPSKSVIYVSFGSLTVITKEEL  305

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSG RFLW + P  +  K  E  + P ++    + R  +V W PQ+EVLAH 
Sbjct  306   MEFWHGLVNSGSRFLWVIRPDSLTEKDGE-FQPPAQLWEVTKERGQIVGWVPQEEVLAHP  364

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             AVGGFLT+ GWNS +ESI AGVPMI WP++ADQQVNSRF+  VWK+G+DMKDTCDR  IE
Sbjct  365   AVGGFLTYSGWNSTIESIFAGVPMICWPYFADQQVNSRFVSHVWKLGMDMKDTCDRVTIE  424

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVRDLME R+ EF + A+  A  A+    EGGSS  +   LIE I+ M
Sbjct  425   KMVRDLMEKRRTEFTKSAEAMAKLARSSLSEGGSSYCNFSRLIESIRLM  473



>ref|XP_002280470.2| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetic acid glucosyltransferase-like 
[Vitis vinifera]
Length=479

 Score =   469 bits (1208),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 229/470 (49%), Positives = 318/470 (68%), Gaps = 13/470 (3%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   +++SML LA+LLCL+ ++VTF+   +    LL +S++ +RF  Y GFRFETI 
Sbjct  13    FPFPIQGNVNSMLKLAELLCLAGIQVTFLNCHYPHRRLLSYSNIQARFSRYPGFRFETIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT---SGGEDSAPQRCIIADGFA  494
             DGLP     +H  +    + ++  +  T KP   +++++   S  +  +P  C+IADG  
Sbjct  73    DGLPM----EHPRTAEQFLDIVDGVKTTTKPLFMKMMISWCRSASDTRSPLTCVIADGLM  128

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
             +FA+DVA EVG+P+I F  +SA + WAYFS+P LI+AGE+PF G DMD  + SV GME  
Sbjct  129   SFAIDVANEVGLPVIIFRAISACSFWAYFSLPQLIEAGEVPFRGGDMDRLVASVPGMEGF  188

Query  675   LRRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             LRRRDLP  C + D++DP  + +M+  R+  R    +IN+F +LEG  L Q+R       
Sbjct  189   LRRRDLPSCCXLKDVDDPDLQNLMKNTRQTHRAHALVINTFDDLEGPILSQIR-NHCPRT  247

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y IGPLH LL+ KL +   + + SSN   E+ + C+ WLDRQP  SV+YV FG+L ++++
Sbjct  248   YTIGPLHALLKTKLAT-ETSTSQSSNSFWEEDRSCIPWLDRQPSKSVIYVSFGSLAIITK  306

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVL  1211
             E L EFWHGL+NSG RFLW + P  ++ K  ER + P E+L G + R  VV WAPQ+EVL
Sbjct  307   EELREFWHGLVNSGSRFLWVIRPDALVGKDEER-QTPAELLEGTKDRGYVVGWAPQEEVL  365

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
              H AVGGFLTH GWNS +ESIV G+PMI WP++ADQQ+NSRF+  VWK+G+DMKD+CDR 
Sbjct  366   KHPAVGGFLTHGGWNSTLESIVEGLPMICWPYFADQQINSRFVSHVWKLGMDMKDSCDRV  425

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
              +EKMVRDLM  ++DEF++ A   A  AK+C  + GSS  +L +LIEDI+
Sbjct  426   TVEKMVRDLMVEKRDEFMEAADTLATLAKKCVGDSGSSSCNLNSLIEDIR  475



>ref|XP_002276555.2| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=509

 Score =   468 bits (1203),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 230/467 (49%), Positives = 316/467 (68%), Gaps = 11/467 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   +++SML LA+LLCL+ ++VTF+   +  + LL +S+V +RF  Y GFRFETI DGL
Sbjct  43    PLQGNVNSMLKLAELLCLAGIQVTFLNCHYPHHCLLSYSNVQARFSRYPGFRFETISDGL  102

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT---SGGEDSAPQRCIIADGFANFA  503
             P     +H  +    + ++  +  T  P   E++++   S  +   P  CI+AD   +FA
Sbjct  103   PM----EHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSTSDTRPPLTCIMADQLMSFA  158

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              DVA EVG+PI+ F  +SA + WAYFS P LI+AGE+P  G DMD  ++SV GME  LRR
Sbjct  159   TDVANEVGLPIVIFCAISACSFWAYFSFPQLIEAGEVPITGDDMDRLVVSVPGMEGFLRR  218

Query  684   RDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP + RV+D+  P  + +M+ FR+  R    +IN+F +LEG  L Q+R       YA+
Sbjct  219   RDLPSSGRVNDVAYPGLQHLMKIFRQAQRAHALVINTFDDLEGPVLSQIR-DHYPRTYAV  277

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L++KL S   + + SSN   E+ K C+ WLDRQPP SV+YV FG+L +++++ L
Sbjct  278   GPLHAHLKSKLAS-ETSTSQSSNSFREEDKSCILWLDRQPPKSVIYVSFGSLAIITKDEL  336

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSG RFLW + P  ++ K  ER + P E+L G + R  VV WAPQ+EVL H 
Sbjct  337   REFWHGLVNSGSRFLWVIRPDALVGKDEER-QTPAELLEGTKDRGYVVGWAPQEEVLQHP  395

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             AVGGFLTH GWNS +ESI+AG+PMI WP++ADQQ+NSRF+  VWK+G+DMKDTCDR  +E
Sbjct  396   AVGGFLTHSGWNSTLESIIAGLPMICWPYFADQQINSRFVSHVWKLGMDMKDTCDRVTVE  455

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             KMVRDLME ++ EF++ A   A SAK+   EGGSS  +L +LIE+I+
Sbjct  456   KMVRDLMEEKRAEFMKAADTMATSAKKSVSEGGSSYCNLGSLIEEIR  502



>gb|AGX93067.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Cinchona 
calisaya]
Length=483

 Score =   465 bits (1196),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 233/469 (50%), Positives = 313/469 (67%), Gaps = 10/469 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SML LA+LLCLS L +TFI +  + N LL  + V  RF  Y GFRF+TI DGL
Sbjct  19    PIQGHVNSMLRLAELLCLSDLDITFIVSEFSHNRLLKHTSVALRFARYPGFRFQTISDGL  78

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR---CIIADGFANFA  503
             P    DDH  +G  ++ ++ ++     P  K +++      SA +R   CIIADG  +FA
Sbjct  79    P----DDHPRAGEQVMDIMPAIKNVTGPLFKRMMIEKNCFASANRRPITCIIADGVLSFA  134

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D AE+  +P++ F  VSA + WA F +P LI+AG++P  G+ MD P+ SV GME  LRR
Sbjct  135   GDFAEQKRIPLVYFRTVSACSFWACFCMPQLIEAGDIPVKGEGMDLPVKSVPGMEGFLRR  194

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLPG CRV+D+ +P  + +  E R+  R +  I+N+F++LEG  L ++R   M  +Y I
Sbjct  195   RDLPGFCRVNDINEPKLQIIKNETRQTPRAQAAILNTFEDLEGPILAEIR-KYMPRLYTI  253

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP H  L  +L + N   + SS    E+ + C++WL+ QPP SV+YV FG++T+V+ E L
Sbjct  254   GPSHSQLTARLEAQNTKTSISSGSFWEEDRSCIEWLNSQPPKSVIYVSFGSITVVTREQL  313

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFW GL+NSGQRFLW + P  ++ K  E  ++P E+  G + R  +V WAPQ+EVL HS
Sbjct  314   LEFWCGLVNSGQRFLWVMRPDSLMGKDGE-SQIPAELEKGTKERGYMVGWAPQEEVLNHS  372

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGF TH GWNS +ESIV GVPMI WP++ADQ +NSRF+ EVWKIGLDMKDTCDR IIE
Sbjct  373   AIGGFFTHSGWNSTLESIVTGVPMICWPYFADQMINSRFVSEVWKIGLDMKDTCDRIIIE  432

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVRDLM+VRKDEF QRA   A  A++   EGGSS  +L+ L+E IK M
Sbjct  433   KMVRDLMDVRKDEFSQRADDMAKLARKAVNEGGSSYQNLDALVEYIKSM  481



>ref|XP_002276771.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=480

 Score =   459 bits (1181),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 232/471 (49%), Positives = 314/471 (67%), Gaps = 12/471 (3%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFPS  H++SML LA+LL +  L VTF+ + + ++ L   +D+ +RF  Y GFRF+TI 
Sbjct  13    FPFPSQGHVNSMLKLAELLSVVGLHVTFLNSDYNQHRLFLHTDIQTRFSRYPGFRFQTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG-GEDSAPQ-RCIIADGFAN  497
             DGL    T DH  +G  ++ L   L ATAKP  +E++++ G G D+ P   CIIADG  +
Sbjct  73    DGL----TTDHPRTGERVMDLFEGLKATAKPIFRELMISRGQGSDTRPPVSCIIADGMMS  128

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             F +D+A EVG+PIISF  VSA + WAYFS   LI++GELP  G DMD+ + S+ GME  L
Sbjct  129   FTIDIANEVGIPIISFRTVSACSFWAYFSALKLIESGELPLKGNDMDQLVTSIPGMEGFL  188

Query  678   RRRDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R+RDLP   RV +L+D        E ++  R    I+N+F++LEG  L Q+R       Y
Sbjct  189   RKRDLPSLLRVSNLDDEGLLLLTKETQQTPRAHALILNTFEDLEGPILGQIR-NHCPKTY  247

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPLH  L+ +L S + T + SSN   ++ + C+ WLD QP  SV+YV FG++ ++S +
Sbjct  248   TIGPLHAHLKTRLASESTT-SQSSNSFRQEDRSCIAWLDHQPSKSVIYVSFGSMVVISRK  306

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              L EF +GL+NS  RFLW +    +  +  E  + P E++ G + R  +VEWAPQ+EVLA
Sbjct  307   QLIEFCYGLVNSSSRFLWVIRTDSLAEEDGEH-QTPAELMEGAKERSYIVEWAPQEEVLA  365

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H AVGGFLTH GWNS +ESI AGVPMI WP++ADQQ+NSRF+  VWK+G DMKDTCDR I
Sbjct  366   HPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSDMKDTCDRLI  425

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKMVRDLME RKDE L+ A   A  A++C  EGGSS  +L +LIE+I+ M
Sbjct  426   VEKMVRDLMEERKDELLKTADMMATRARKCVSEGGSSYCNLSSLIEEIRLM  476



>ref|XP_002276617.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
 ref|XP_010658495.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=478

 Score =   459 bits (1180),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 232/471 (49%), Positives = 314/471 (67%), Gaps = 12/471 (3%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFPS  H++SML LA+LL +  L VTF+ + + ++ L   +D+ +RF  Y GFRF+TI 
Sbjct  13    FPFPSQGHVNSMLKLAELLSVVGLHVTFLNSDYNQHRLFLHTDIQTRFSRYPGFRFQTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG-GEDSAPQ-RCIIADGFAN  497
             DGL    T DH  +G  ++ L   L ATAKP  +E++++ G G D+ P   CIIADG  +
Sbjct  73    DGL----TTDHPRTGERVMDLFEGLKATAKPIFRELMISRGQGSDTRPPVSCIIADGMMS  128

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             F +D+A EVG+PIISF  VSA + WAYFS   LI++GELP  G DMD+ + S+ GME  L
Sbjct  129   FTIDIANEVGIPIISFRTVSACSFWAYFSALKLIESGELPLKGNDMDQLVTSIPGMEGFL  188

Query  678   RRRDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R+RDLP   RV +L+D        E ++  R    I+N+F++LEG  L Q+R       Y
Sbjct  189   RKRDLPSLLRVSNLDDEGLLLVTKETQQTPRAHALILNTFEDLEGPILGQIR-NHCPKTY  247

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPLH  L+ +L S + T + SSN   ++ + C+ WLD QP  SV+YV FG++ ++S +
Sbjct  248   TIGPLHAHLKTRLASESTT-SQSSNSFRQEDRSCIAWLDHQPSKSVIYVSFGSMVVISRK  306

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              L EF +GL+NS  RFLW +    +  +  E  + P E++ G + R  +VEWAPQ+EVLA
Sbjct  307   QLIEFCYGLVNSSSRFLWVIRTDSLAEEDGEH-QTPAELMEGAKERSYIVEWAPQEEVLA  365

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H AVGGFLTH GWNS +ESI AGVPMI WP++ADQQ+NSRF+  VWK+G DMKDTCDR I
Sbjct  366   HPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSDMKDTCDRLI  425

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKMVRDLME RKDE L+ A   A  A++C  EGGSS  +L +LIE+I+ M
Sbjct  426   VEKMVRDLMEERKDELLETADMMATRARKCVSEGGSSYCNLSSLIEEIRLM  476



>ref|XP_011076758.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=475

 Score =   455 bits (1171),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/466 (50%), Positives = 295/466 (63%), Gaps = 14/466 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++S L LA+LLCL+H+ VTF+ T H    LL  S++ +RF  Y GFR +TI DGL
Sbjct  16    PLQGPVNSTLKLAELLCLAHIDVTFLVTDHIHARLLRHSNIQTRFSSYPGFRIQTISDGL  75

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDV  512
             P          G   ++L  SL +  KP  KE++   G        C+IADG   F  DV
Sbjct  76    PEA-----HPRGDRFLELFDSLKSKTKPLFKEVLRCGGFS------CVIADGILGFTCDV  124

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDL  692
             A EV VPI     +SAA  W +F IP +I+AGE+PF G D+D  + SV GME+ LRRRDL
Sbjct  125   ANEVRVPIFYIRTISAACLWVFFCIPKIIEAGEIPFEGDDLDILVKSVPGMERYLRRRDL  184

Query  693   PGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPL  869
             P  CR  DL DP  + +  E  +  R    I+N+F+ELEG  L +MR     N+Y IGPL
Sbjct  185   PSFCRSGDLADPNIQLYKTESEENPRAYGLILNTFEELEGPILAEMR-SMCPNIYTIGPL  243

Query  870   HELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEF  1049
             H  L+ KL +   + T  SN L E+ + C+ WLD QPP SV+YV FG+L + +   L EF
Sbjct  244   HAHLKAKLAAKATSPTAFSNSLWEEDRSCIAWLDSQPPKSVIYVSFGSLAVTTSNQLMEF  303

Query  1050  WHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVG  1229
             WHGL+NSGQRFLW + P  +  K  E  EVP E+    + R  +V W PQ+EVLAH +VG
Sbjct  304   WHGLVNSGQRFLWVIRPDSIAAKSWE-SEVPVELSKATKERGYIVGWTPQEEVLAHPSVG  362

Query  1230  GFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMV  1409
             GFLTH GWNS +ESI  GVPMI WP++ DQQVNSR + E WK+GLDMKDTCDR IIEKMV
Sbjct  363   GFLTHSGWNSTLESIYEGVPMICWPYFIDQQVNSRLVEEAWKLGLDMKDTCDRSIIEKMV  422

Query  1410  RDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R LM+V K++FL+RA Q A SAK C   GGSS ++ E L+EDIK M
Sbjct  423   RSLMDVGKEKFLERADQMAKSAKRCLSNGGSSHNNFERLVEDIKSM  468



>gb|AIE12477.1| UGT4 [Panax ginseng]
Length=478

 Score =   454 bits (1169),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 230/468 (49%), Positives = 301/468 (64%), Gaps = 13/468 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++SM  LA+LLCL+ + +TF+ T      LL ++D+ SRF  Y GFR ETI DG+
Sbjct  17    PLQGPVNSMFKLAELLCLAGIHITFLVTDFIHTRLLRYTDIHSRFNRYPGFRLETISDGM  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS--GGEDSAPQRCIIADGFANFAV  506
             P    +DH   G  I++L  SL    KP  KE++ T   G +   P  CIIADG   F  
Sbjct  77    P----EDH-PRGDRIMELFDSLKTNTKPLFKELLTTGSLGSDKGRPITCIIADGIMGFTC  131

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
             DVA E+G+PII    +SA   W +F +P+LI+AGELPFNG D+D PI SV G E  LR R
Sbjct  132   DVANEIGIPIIYVRTISACCLWVFFCLPNLIEAGELPFNGDDLDTPIKSVPGTENSLRIR  191

Query  687   DLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHII-NSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLP  CR  D+  P  +     R+  R  + +I N+F++LEG  L QMR     N+Y IG
Sbjct  192   DLPSFCRSGDICHPSIQLYKTERQELRRAYGLILNTFEDLEGPILSQMRTV-CPNLYPIG  250

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
             PLH  L+ KL + + +   SSN L ++ K C+ WLD QPP SV+YV FG+L +++ + L 
Sbjct  251   PLHTHLKTKLAAESTSPAISSNSLWKEDKSCITWLDSQPPKSVIYVSFGSLAIMTRDQLM  310

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EFWHGL+NSG +FLW + P  V        ++P E+  G + R  +V WAPQ+EVLAH +
Sbjct  311   EFWHGLVNSGCKFLWVIRPDSVAGD----SQIPAEVAEGTKERGYIVGWAPQEEVLAHPS  366

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             VGGFLTH GWNS +ES++ G PMI WP++ DQQVNSRF+ E WK+GLDMKDTCDR I EK
Sbjct  367   VGGFLTHSGWNSTLESVIEGKPMICWPYFMDQQVNSRFVEEFWKLGLDMKDTCDRVIFEK  426

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             MV+DLM  R+DEF++ A Q A   K+C  EGGSS  +L+ LIEDIK M
Sbjct  427   MVKDLMVERRDEFMKSADQMARLGKKCLSEGGSSYCNLDRLIEDIKLM  474



>ref|XP_009597174.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   454 bits (1169),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 241/480 (50%), Positives = 315/480 (66%), Gaps = 29/480 (6%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLS-HLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
             +PFP+  H+H MLNLA+LL LS ++ VTFI  +   N LL  +D+ SRF  + GFRF+TI
Sbjct  14    FPFPALGHVHPMLNLAELLSLSSNIHVTFINALSIHNRLLRCTDLQSRFGRFPGFRFKTI  73

Query  321   P----DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGE---------DSA  461
                  DGLPH  +DD       I+ +L SL  TAKP LKE+ +    E            
Sbjct  74    NLGLGDGLPH-TSDD-------IMAVLKSLRTTAKPLLKELFLLDNCELGTTDKIIGQVP  125

Query  462   PQRCIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDE  641
             P  C+I+DG    A++VAEE G+P   F   SA++ WAY+ IP LI AGELPF+G D+D 
Sbjct  126   PVTCLISDGILIIALEVAEERGIPTFHFRTSSASSFWAYYCIPQLIHAGELPFSGNDLDT  185

Query  642   PILSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMMEFR-KCFRTKHHIINSFQELEGSTL  818
             PI +VKGME  LRRRDLP  CRVD+L +  F+ +        RTK  I N+F+ LEG  L
Sbjct  186   PIANVKGMESFLRRRDLPSFCRVDNLGEGTFQCVRSVTLSTLRTKGLIFNTFEGLEGPIL  245

Query  819   DQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLY  998
             DQ+R+ D+ N+Y IGPLH  L+NKL S +   + SSNGL E+ + C+ WLD QP  SVLY
Sbjct  246   DQIRV-DIPNIYTIGPLHAHLKNKLASESKGKSISSNGLWEEDRSCLKWLDEQPSRSVLY  304

Query  999   VCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCC  1178
             V FG++  +++  L EFWHGL+NSGQ+FLW +   ++ +K      +  E+  G +    
Sbjct  305   VSFGSVITLTKHELTEFWHGLVNSGQQFLWVIRHDVIKDKD---DVLEVELKEGRKENGY  361

Query  1179  VVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKI  1358
             +V WAPQ+EVLAH ++GGFLTH GWNS +ES+   VPMI WP  ADQQVNSRF+GEVWK+
Sbjct  362   IVSWAPQEEVLAHPSIGGFLTHSGWNSTLESLYEAVPMICWPQLADQQVNSRFVGEVWKL  421

Query  1359  GLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             GLD+KDTCDR IIEKMV +LME R++EFLQRA +    A+    EGGSS  +L+ LI+DI
Sbjct  422   GLDLKDTCDRVIIEKMVSELMEARRNEFLQRANEMTKLARASVSEGGSSTRNLDRLIQDI  481



>emb|CDP16024.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   453 bits (1166),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 225/469 (48%), Positives = 306/469 (65%), Gaps = 11/469 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++ MLNLA+L CL  L VTFI T H ++ L   SDV SRF  Y  FRF TIPDGL
Sbjct  18    PLQGPVNCMLNLAELFCLGDLHVTFINTDHVQDRLRSCSDVESRFERYPNFRFHTIPDGL  77

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS--GGEDSAPQRCIIADGFANFAV  506
             P    +D   +G  I++L+ SL   ++P  + +V +   G     P  CIIADG  +FAV
Sbjct  78    P----EDSPRTGGHILKLIQSLEVVSQPIFRAMVTSGSLGHNSEKPATCIIADGIFSFAV  133

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
             D+A+E+GVP+I F  +S    W Y  IP LI+A E PF G D+D P+ S++ ME ++RRR
Sbjct  134   DIAKEIGVPLIYFDTISPCGLWTYLCIPKLIEAQEFPFKGDDLDAPLSSLQEMECIMRRR  193

Query  687   DLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHII-NSFQELEGSTLDQMR-IGDMLNVYAI  860
             DLP  CRV +++DP  + ++E  +       II N+F+EL+  TL  MR +G    VYAI
Sbjct  194   DLPSFCRVREIDDPLIRIILEEDRQLPLAQAIIFNTFEELDRGTLSLMRTLGP--TVYAI  251

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L+++L +   +   SS+ L ++ K C+ WL+ QP  SV+YV  G+L  ++++ L
Sbjct  252   GPLHTHLKSRLAA-TTSPPASSHSLWKEDKSCIAWLNDQPVKSVIYVSIGSLATMTKDQL  310

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              E W+GL+NSG RFLW   P  +     +  ++P E+    + R  +V+WAPQ+EVL H 
Sbjct  311   MEIWYGLVNSGVRFLWVQRPGSIAGSAAKGDQIPEELAKATQERGYIVDWAPQEEVLGHP  370

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
              +GGFLTH GWNS +ESI  GVPMIGWP++ DQQVNSR+L EVWK+GLDMKDTCDR I+E
Sbjct  371   GIGGFLTHSGWNSTLESIAEGVPMIGWPYFVDQQVNSRYLLEVWKLGLDMKDTCDRVIVE  430

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMV+D+M++R+DEFL RA + A  A     EGGSS + L+NLIEDIK M
Sbjct  431   KMVKDVMQLRRDEFLPRANEMAKLANSSVSEGGSSYNDLDNLIEDIKLM  479



>gb|AGX93068.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Amsonia 
hubrichtii]
Length=482

 Score =   452 bits (1163),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 230/469 (49%), Positives = 315/469 (67%), Gaps = 10/469 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SML LA+LLCL+ L +TFI +  + + L+  +++ SRF  Y GF+F+TI DGL
Sbjct  18    PIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLVKHTNIASRFARYPGFQFQTISDGL  77

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS---GGEDSAPQRCIIADGFANFA  503
             P    DDH  +G  ++ +L +      P  K+++V           P  CIIADG  +FA
Sbjct  78    P----DDHPRAGERVMDILPATKNVTGPLFKQMMVEKNFFATTTRRPITCIIADGVLSFA  133

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D AEE G+P+I F  VSA + WA F +P LI+AG++P  G  MD  + SV GME  LRR
Sbjct  134   GDFAEETGIPLIYFRTVSACSFWACFCMPELIEAGDIPIKGNGMDLIVKSVPGMECFLRR  193

Query  684   RDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLPG CRV+D+ +P  + +  E R+  R +  I+N+F++LEG  L Q+R   M  ++ I
Sbjct  194   RDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIR-KHMPRLFTI  252

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP H  L ++L S N+  + SS    E+ + C+DWLD QPP SVLYV FG++T+V+ + L
Sbjct  253   GPSHSHLTSRLESKNIKTSISSGSFWEEDRSCVDWLDAQPPKSVLYVSFGSITVVTRDQL  312

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSGQRFLW + P  ++ +   + ++P E+  G + R  +V WAPQ+EVL H 
Sbjct  313   LEFWHGLVNSGQRFLWVMRPDSIMGED-GKSQIPAELEEGTKARGYMVGWAPQEEVLNHP  371

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGF TH GWNS +ESIV+GVPMI WP++ADQ +NSRF+ E+WKIGLDMKDTCDR  IE
Sbjct  372   AIGGFFTHSGWNSTLESIVSGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCDRDAIE  431

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVR+LMEVRKDEFLQR+   A  A++   EGGSS ++L+ L+E IK M
Sbjct  432   KMVRELMEVRKDEFLQRSDHIAKLARKAVGEGGSSYANLDGLVEYIKSM  480



>gb|AGX93069.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Rauvolfia 
serpentina]
Length=482

 Score =   451 bits (1161),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 234/469 (50%), Positives = 314/469 (67%), Gaps = 10/469 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SML LA+LLCL+ L +TF+ +  + + L+  +DV SRF  Y GFRF+TI DGL
Sbjct  18    PIQGHVNSMLRLAELLCLAELDITFVVSEFSHSRLIKHTDVASRFARYPGFRFQTISDGL  77

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR---CIIADGFANFA  503
                  DDH  +G  ++ +L S      P  K++++      SA +R   CIIADG  +FA
Sbjct  78    ----ADDHPRAGERVMDILPSTKNVTGPLFKQMMLEKNCFASATRRPITCIIADGVLSFA  133

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D AEE G+P+I F  VSA + WA F +P LI+AG++P  G  MD  + SV GME  LRR
Sbjct  134   GDFAEEKGIPLIYFRTVSACSFWACFCMPELIEAGDIPIKGNGMDLTVKSVPGMETFLRR  193

Query  684   RDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLPG CRV+D+ +P  + +  E R+  R +  I+N+F++LEG TL Q+R   M  ++ I
Sbjct  194   RDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPTLSQIR-KHMPRLFTI  252

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP H  L ++L + N+  + SS    E+ + C+DWLD QPP SVLYV FG++T+V+ + L
Sbjct  253   GPSHSHLTSRLETRNIKTSISSGSFWEEDRSCVDWLDSQPPRSVLYVSFGSITVVTRDQL  312

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL++SGQRFLW + P  +L K  E  ++P E+  G   R  +V WAPQ+EVL H 
Sbjct  313   LEFWHGLVDSGQRFLWVMRPDSILGKDGE-NQIPPELEEGTRARGYMVGWAPQEEVLYHP  371

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS +ESIV GVPMI WP++ADQ +NSRF+ E+WKIGLDMKDTCDR  I 
Sbjct  372   AIGGFLTHSGWNSTLESIVVGVPMICWPYFADQMINSRFVSELWKIGLDMKDTCDRDTIV  431

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVR+LME RKDEFLQRA Q A  A+    EGGSS  +L+ L+E I+ +
Sbjct  432   KMVRELMEHRKDEFLQRADQMAKLARMAVSEGGSSYCNLDGLVEYIQSL  480



>sp|U3U992.1|UGT8_CATRO RecName: Full=7-deoxyloganetic acid glucosyltransferase; AltName: 
Full=UDP-glucose glucosyltransferase 8; Short=CrUGT8; AltName: 
Full=UDP-glycosyltransferase 709C2 [Catharanthus roseus]
 dbj|BAO01109.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=482

 Score =   451 bits (1160),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 231/469 (49%), Positives = 317/469 (68%), Gaps = 10/469 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SML LA+LLCL+ L +TFI +  + + L+  ++V SRF  Y GF+F+ I DGL
Sbjct  18    PIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLIKHTNVASRFARYPGFQFQPISDGL  77

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR---CIIADGFANFA  503
             P    DDH  +G  ++ +L S      P  K+++V +    SA +R   CIIADG  +FA
Sbjct  78    P----DDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGVLSFA  133

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D A+E G+P+I F  VSA + WA F +P LI++G++P  G  MD  + SV GME  LRR
Sbjct  134   GDFAQEKGIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNGMDLIVKSVPGMETFLRR  193

Query  684   RDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLPG CRV+D+ +P  + +  E R+  R +  I+N+F++LEG  L Q+R   M  ++ I
Sbjct  194   RDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIR-KHMPRLFTI  252

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP H  L ++L + N+    SS    E+ + C+DWLD QPP SVLYV FG++T+V+ + L
Sbjct  253   GPSHSHLTSRLETKNIKTLISSGSFWEEDRSCVDWLDAQPPRSVLYVSFGSITVVTRDQL  312

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFW+GL+NSGQRFLW + P  ++ K  +  ++P ++  G + R  +V WAPQ+EVL H 
Sbjct  313   LEFWYGLVNSGQRFLWVMRPDSIMGKDGQ-SQIPADLEEGTKARGYMVGWAPQEEVLNHP  371

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS +ESIVAGVPMI WP++ADQ +NSRF+ E+WKIGLDMKDTCDR  I 
Sbjct  372   AIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCDRETIV  431

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVR+LME+RKDEFLQRA   A  AKE   EGGSS S+L+ L++ IK +
Sbjct  432   KMVRELMEIRKDEFLQRADHMAKLAKEAVSEGGSSYSNLDGLVDYIKSL  480



>gb|AGX93072.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Catharanthus 
longifolius]
Length=482

 Score =   451 bits (1160),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/469 (49%), Positives = 317/469 (68%), Gaps = 10/469 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SML LA+LLCL+ L +TFI +  + + L+  ++V SRF  Y GF+F+ I DGL
Sbjct  18    PIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLIKHTNVASRFARYPGFQFQPISDGL  77

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR---CIIADGFANFA  503
             P    DDH  +G  ++ +L S      P  K+++V +    SA +R   CIIADG  +FA
Sbjct  78    P----DDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGVLSFA  133

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D A+E G+P+I F  VSA + WA F +P LI++G++P  G  MD  + SV GME  LRR
Sbjct  134   GDFAQEKGIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNGMDLIVKSVPGMETFLRR  193

Query  684   RDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLPG CRV+D+ +P  + +  E R+  R +  I+N+F++LEG  L Q+R   M  ++ I
Sbjct  194   RDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIR-KHMPRLFTI  252

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP H  L ++L + N+    SS    E+ + C+DWLD QPP SVLYV FG++T+V+ + L
Sbjct  253   GPSHSHLTSRLETKNIKTLISSGSFWEEDRSCVDWLDAQPPRSVLYVSFGSITVVTRDQL  312

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFW+GL+NSGQRFLW + P  ++ K  +  ++P ++  G + R  +V WAPQ+EVL H 
Sbjct  313   LEFWYGLVNSGQRFLWVMRPDSIMGKDGQ-SQIPADLEEGTKARGYMVGWAPQEEVLNHP  371

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS +ESIVAGVPMI WP++ADQ +NSRF+ E+WKIGLDMKDTCDR  I 
Sbjct  372   AIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCDRETIM  431

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVR+LME+RKDEFLQRA   A  AKE   EGGSS S+L+ L++ IK +
Sbjct  432   KMVRELMEIRKDEFLQRADHMAKLAKEAVSEGGSSYSNLDGLVDYIKSL  480



>gb|AGX93065.1| 7-deoxyloganetic acid UDP-glucosyltransferase [Catharanthus roseus]
 gb|AGX93073.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Catharanthus 
ovalis]
 gb|AHK60835.1| 7-deoxyloganetic acid-O-glucosyl transferase [Catharanthus roseus]
Length=482

 Score =   451 bits (1159),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/469 (49%), Positives = 317/469 (68%), Gaps = 10/469 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SML LA+LLCL+ L +TFI +  + + L+  ++V SRF  Y GF+F+ I DGL
Sbjct  18    PIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLIKHTNVASRFARYPGFQFQPISDGL  77

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR---CIIADGFANFA  503
             P    DDH  +G  ++ +L S      P  K+++V +    SA +R   CIIADG  +FA
Sbjct  78    P----DDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGVLSFA  133

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D A+E G+P+I F  VSA + WA F +P LI++G++P  G  MD  + SV GME  LRR
Sbjct  134   GDFAQEKGIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNGMDLIVKSVPGMETFLRR  193

Query  684   RDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLPG CRV+D+ +P  + +  E R+  R +  I+N+F++LEG  L Q+R   M  ++ I
Sbjct  194   RDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIR-KHMPRLFTI  252

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP H  L ++L + N+    SS    E+ + C+DWLD QPP SVLYV FG++T+V+ + L
Sbjct  253   GPSHSHLTSRLETKNIKTLISSGSFWEEDRSCVDWLDAQPPRSVLYVSFGSITVVTRDQL  312

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFW+GL+NSGQRFLW + P  ++ K  +  ++P ++  G + R  +V WAPQ+EVL H 
Sbjct  313   LEFWYGLVNSGQRFLWVMRPDSIMGKDGQ-SQIPADLEEGTKARGYMVGWAPQEEVLNHP  371

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS +ESIVAGVPMI WP++ADQ +NSRF+ E+WKIGLDMKDTCDR  I 
Sbjct  372   AIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCDRETIV  431

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVR+LME+RKDEFLQRA   A  AKE   EGGSS S+L+ L++ IK +
Sbjct  432   KMVRELMEIRKDEFLQRADHMAKLAKEAVSEGGSSYSNLDGLVDYIKSL  480



>ref|XP_010277669.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=497

 Score =   451 bits (1160),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 234/473 (49%), Positives = 316/473 (67%), Gaps = 14/473 (3%)
 Frame = +3

Query  147   AYPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
              +P P   H++SML L++LL L+ + VTF+T  H    LL F++V SRF  + GF F TI
Sbjct  24    VFPIPVQGHVNSMLKLSELLSLTGIHVTFLTFEHIHRRLLRFTNVTSRFARWPGFHFATI  83

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA--PQRCIIADGFA  494
             P  LP     DH +SG  +++   SL  T+ P L+E++V++  E     P  CIIADG  
Sbjct  84    PSDLPF----DHPNSGPQLMEFFDSLKITSIPPLREMLVSNRRESDVRPPVTCIIADGTL  139

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEK  671
             +F +DVA+E+ +P+I F  +SA + WAYFSIP L++AGELPF G  DMD PI  V GME 
Sbjct  140   SFTIDVAQELNIPVIYFRTISACSFWAYFSIPKLVEAGELPFGGDADMDCPITCVPGMES  199

Query  672   LLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
              LRRRDLP   R ++L D F +F+M E     R    I+N+F+ELEG  L Q+R      
Sbjct  200   FLRRRDLPNFLRTNNLSDRFLQFIMAETLNTTRASALILNTFEELEGPILSQIR-SHCPK  258

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             +Y IGPLH LL+ ++   + + + SSN L E+ K C+ WLD +P  SV+YV FG++T+++
Sbjct  259   LYTIGPLHALLQTQIA--DFSPSVSSNSLWEENKSCIRWLDSKPLRSVVYVSFGSITVMT  316

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E + EFWHGL+NSG+ FLW + P L+  K+ E  ++ TE++ G   R  +V WAPQ+EV
Sbjct  317   REEIMEFWHGLVNSGKWFLWVIRPDLLAGKEGE-DQILTELVEGTRERGYIVGWAPQEEV  375

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH AVGGFLTH GWNS +ESI AGVPMI WP++ADQQVNSRF+ EVWK+GLDMKDTCDR
Sbjct  376   LAHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQVNSRFVSEVWKLGLDMKDTCDR  435

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
               +E MV++LME + DE L+ A + A  A+    EGGSS  + + LI+DIK M
Sbjct  436   WKVELMVKELMEKKMDEMLKSADKMAKLARMSVSEGGSSSCNWDKLIKDIKSM  488



>ref|XP_009800319.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=479

 Score =   448 bits (1152),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 227/468 (49%), Positives = 303/468 (65%), Gaps = 12/468 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++S   LA+LLC S L +TF+ T +  N L+  +++ SRF  + GF+ +TI DGL
Sbjct  16    PLQGPVNSTFKLAELLCFSGLDITFLLTENIHNRLISHTNINSRFERFPGFQIKTISDGL  75

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR----CIIADGFANF  500
             P     DH   G   ++L  SL +  KP  K+++ TSG   S  +R    CIIADG   F
Sbjct  76    PQ----DHPRKGSKYMELFDSLKSKTKPLFKDML-TSGWLSSDGKRREVSCIIADGVLGF  130

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLR  680
               DVA E+G+PI S   +S    W +F +P LI++GE PF   D+DEPI SV G E  LR
Sbjct  131   TCDVANEIGIPIFSIRTISPCCLWIFFCLPQLIESGEYPFKDDDLDEPIKSVPGAETFLR  190

Query  681   RRDLPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
             RRDLP  CR  DL D   + +  E ++  R    I+N+F+EL+G+ L QMR     N+Y 
Sbjct  191   RRDLPDFCRTGDLTDSNVQLYKTEGQENSRAYGLILNTFEELDGNLLSQMR-NVCPNIYP  249

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IGPLH  L+NKL   N ++  SSN L E+ K C++WL+ Q PNSV+YV FG++  +++E 
Sbjct  250   IGPLHAHLKNKLSEENNSMPPSSNSLFEEDKSCINWLNNQLPNSVIYVSFGSIATMTKEQ  309

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L EFW+GL+NS QRFLW +    V      + ++P E+  G + R  +V WAPQ+EVLAH
Sbjct  310   LMEFWYGLVNSKQRFLWVIRLDSVAGDDW-KNKIPVELAEGTKERGYIVGWAPQEEVLAH  368

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              +VGGF THCGWNSI+E++  G PMI WP++ DQQVNSRF+   WK+GLDMKDTCDR I+
Sbjct  369   PSVGGFWTHCGWNSILETVYEGKPMICWPYFMDQQVNSRFVEAAWKLGLDMKDTCDREIV  428

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             EKMV+DLM VRKDEFL+RA Q +  AK+C  EGGSS S+ E L+ DIK
Sbjct  429   EKMVKDLMMVRKDEFLERANQMSKFAKKCLVEGGSSYSNFERLVNDIK  476



>ref|XP_011038346.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Populus 
euphratica]
Length=481

 Score =   448 bits (1152),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 230/470 (49%), Positives = 304/470 (65%), Gaps = 13/470 (3%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P   H++SML LA+LL L+ + +TF+ + H    L   +++  RF  Y GF+F+TI 
Sbjct  14    FPLPCQGHVNSMLKLAELLSLAGINITFLNSEHNHELLARHTNIEDRFTKYPGFQFQTIA  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  SG  +++L  ++   AKP  K+I++    E   P  CII DG   F 
Sbjct  74    DGLPV----DHPRSGDRLMELFDAMKVVAKPIFKKILL----ETKPPVNCIIGDGVLGFV  125

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLR  680
              DVA EVGVPII F  +SA + WAYFSI  +I+ G+LP  G +DMD  I  V GME  LR
Sbjct  126   GDVAIEVGVPIIYFRTISACSFWAYFSISDIIEGGQLPIRGNEDMDRLITKVPGMETFLR  185

Query  681   RRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
              RDLPG CRV D+  P    +M E R+  R K  I+N+F++LEG  L  +R      VY+
Sbjct  186   CRDLPGFCRVSDMTHPNLLLVMNETRQSPRAKALILNTFEDLEGPILSHIRT-QCPEVYS  244

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IGPLHE L+ KL + N     SSN L E  + CM WLD QP  SVLYV FG++T+++   
Sbjct  245   IGPLHEHLQAKLSAKNEKSCQSSNSLREIDRSCMTWLDNQPEKSVLYVSFGSITVMTRHQ  304

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L EFW+GL++S +RFLW + P  +  K  E  ++P E+  G   R  +  W PQ+EVLAH
Sbjct  305   LLEFWYGLVSSKKRFLWVIRPDSIATKNGEFEKIPVEVEEGTRDRGFIAGWVPQEEVLAH  364

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              A+ GFLTH GWNS +ESIVAGVPMI WP++ADQQVNSRF+GEVWK+GLDMKD CDR I+
Sbjct  365   KAIAGFLTHSGWNSTLESIVAGVPMICWPYFADQQVNSRFVGEVWKLGLDMKDQCDREIV  424

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             EKMV DLM  R++EF++ A + A  +++  +EGGSS  +L  LIEDI+ M
Sbjct  425   EKMVNDLMVERREEFVRSATRMAELSRKSVREGGSSYCNLNRLIEDIRSM  474



>ref|XP_010262685.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262687.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262688.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262689.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   447 bits (1150),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 230/468 (49%), Positives = 314/468 (67%), Gaps = 11/468 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI+SML L++L+ L+   VTF+ T H    LL F++V SRF  + GF F TIPDGL
Sbjct  17    PLQGHINSMLKLSELISLAGFHVTFLNTEHIHRLLLHFTNVTSRFARWPGFHFATIPDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS--GGEDSAPQRCIIADGFANFAV  506
             P     DH  SG G+V+L  SL  T+ P L+E++V++  G +   P  CIIADG  +F +
Sbjct  77    PF----DHPRSGPGLVELFDSLKITSIPLLREMLVSNRWGSDVRPPVTCIIADGIMSFTI  132

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
             DVA ++ +P I F  VSA + WAYF +P LI+AGE+PF   DMD PI  V GME  LRR 
Sbjct  133   DVARDLNIPTIFFRTVSACSFWAYFCVPKLIEAGEIPFRDADMDCPITCVPGMENFLRRA  192

Query  687   DLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLPG+CR ++L D   +F++ E     R    I+N+F++LEG  L Q+R      +Y IG
Sbjct  193   DLPGSCRTNNLGDRTLQFLVTETINTTRASALILNTFEDLEGPILCQIR-SHCPRLYTIG  251

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
             PLH LL+ ++     + + SSN L E+ K C+ WLD +P  SV+YV FG+L  ++ + + 
Sbjct  252   PLHALLKTQISD--SSPSVSSNSLWEENKSCIRWLDSKPLRSVVYVSFGSLATMTRDEVL  309

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EFWHGL+NSG+ FLW + P L+  K+ E  ++ TE++ G   R  +VEWAPQ+EVLAH A
Sbjct  310   EFWHGLVNSGKPFLWVIRPDLLARKEGE-DQILTELVEGTRERAYIVEWAPQEEVLAHPA  368

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             VGGFLTH GWNS +ESI AGVPMI WP++ADQQ+NSRF+ EVWK+GLDMKDTCDR  +E 
Sbjct  369   VGGFLTHSGWNSTLESIYAGVPMICWPYFADQQINSRFVSEVWKLGLDMKDTCDRLKVEL  428

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             MV+++ME ++DE ++ A+  A  A+    EGGSS  +L+ LI+DI+ M
Sbjct  429   MVKEVMERKRDEMIKSAENMAKLARMSVGEGGSSSCNLDKLIQDIRSM  476



>ref|XP_009590620.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=524

 Score =   449 bits (1154),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 224/467 (48%), Positives = 301/467 (64%), Gaps = 10/467 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++S   LA+LLC+S L +TF+ T +  N L+  +++ SRF  + GF+ +TI DGL
Sbjct  61    PLQGPVNSTFKLAELLCISGLHITFLLTENIHNRLVSHTNISSRFERFPGFQIKTISDGL  120

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT---SGGEDSAPQRCIIADGFANFA  503
             P     DH   G   ++L  SL    KP  K+++ +   S      P  CIIADG   F 
Sbjct  121   PQ----DHPRKGSKYMELFDSLKCKTKPLFKDMLTSGWLSSDGKRRPVSCIIADGVLGFT  176

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              DVA E+G+PI S   +S    W +F +P LI++GE PF G D+DEPI SV G E  LRR
Sbjct  177   CDVANEIGIPIFSIRTISPCCLWIFFCLPQLIESGEYPFKGDDLDEPIKSVPGAETFLRR  236

Query  684   RDLPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CR  DL D   + +  E ++  R    I+N+F+EL+G  L QMR     N+Y I
Sbjct  237   RDLPDFCRTGDLTDSNVQLYKTEGQENSRAYGLILNTFEELDGHLLSQMRTV-CPNIYPI  295

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L+ KL   N +L  SSN L E+ K C++WL+ Q PNSV+YV FG++  +++E L
Sbjct  296   GPLHAHLKKKLSEENNSLPPSSNSLFEEDKSCINWLNNQLPNSVIYVSFGSIATMTKEQL  355

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFW+GL+NS Q FLW +    V      + ++P E++ G + R  +V WAPQ+EVLAH 
Sbjct  356   MEFWYGLVNSKQNFLWVIRLDSVAGDDW-KNKIPLELVEGTKERGYIVGWAPQEEVLAHP  414

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             +VGGF THCGWNSI+E++  G PMI WP++ DQQVNSRF+   WK+GLDMKDTCDR I+E
Sbjct  415   SVGGFWTHCGWNSILETVYEGKPMICWPYFMDQQVNSRFVEAAWKLGLDMKDTCDRKIVE  474

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             KMV+DLM V+K+EFL+RA Q +N AK+C KEGGSS S+ E L+ DIK
Sbjct  475   KMVKDLMVVKKEEFLERANQMSNFAKKCLKEGGSSYSNFERLVNDIK  521



>ref|XP_004235055.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=468

 Score =   444 bits (1141),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 229/469 (49%), Positives = 311/469 (66%), Gaps = 20/469 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LAQLL LS+ +VTF+ TV   + LL  +DV+SRF    G  F   P
Sbjct  10    FPFPAQGHVNSMLKLAQLLSLSNFQVTFLVTVDTHDRLLNHTDVLSRF----GSEFHLQP  65

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
               LPHG++ D  ++  G+  L  SL+  AKPFL+E +  S         C+IADG  + A
Sbjct  66    --LPHGISMDVMNTRDGLSILYDSLNKIAKPFLREFIAYS-----PVTTCLIADGILSMA  118

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              DVAEE+ +PII F   SA++ W+YF +P LIQ GELP      D  +  VKGME  LR 
Sbjct  119   GDVAEEINLPIIYFRTASASSFWSYFCMPDLIQVGELPLKENAKDLTLTKVKGMEDFLRG  178

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  C+  D+  P F+ +M E R+  R +  I+N+F++LEG  L Q+R     NVY I
Sbjct  179   RDLPSFCQASDVTSPDFRIVMTETRQTPRARGLILNTFEDLEGPILSQIRTV-CPNVYTI  237

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP+H  L+ KL    VT +TSSN L ++ + CM WLD QPP SV+YV FG++  +++E L
Sbjct  238   GPVHAHLKAKL----VTKSTSSNSLWQEDESCMSWLDTQPPKSVIYVSFGSVAGLTKEEL  293

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFW+G++NS Q+FLW + P L++ ++  + E+P E+  G + R  + +W PQ++VLAH 
Sbjct  294   LEFWYGIVNSEQKFLWVMRPDLIIGQE-RKDEIPVELEQGTKARGYMADWVPQEKVLAHR  352

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS +ESIV GVPMI WP +ADQQVNSRF+GEVWK+GLD+KDTCDR II 
Sbjct  353   AIGGFLTHSGWNSTLESIVEGVPMICWPRFADQQVNSRFVGEVWKMGLDIKDTCDRDIIA  412

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             K + DLME R  EF QR +  A+ AK+   EGGSS  +L+ L++DI+ M
Sbjct  413   KSITDLMEKRNGEFSQRTENMASLAKKAVNEGGSSYINLDRLMQDIRSM  461



>ref|XP_006379615.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
 gb|ERP57412.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
Length=481

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 227/470 (48%), Positives = 303/470 (64%), Gaps = 13/470 (3%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P   H++SML LA+LL L+ + +TF+ + H    L  ++++  RF  Y GF+F+TI 
Sbjct  14    FPLPCQGHVNSMLKLAELLSLAGINITFLNSEHNHELLARYTNIEDRFTKYPGFQFQTIA  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  SG  +++L  ++    KP  K+I++    E   P  CII DG   F 
Sbjct  74    DGLPV----DHPRSGGKLMELFEAMKLVTKPVFKKILL----ETKPPVNCIIGDGILGFV  125

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLR  680
              DVA EVGVP I F  VSA + WAYFSI  +I+ G+LP  G +DMD  I  V GME  LR
Sbjct  126   GDVAIEVGVPFIYFRTVSACSFWAYFSIFDIIEGGQLPIRGNEDMDRLITKVPGMETFLR  185

Query  681   RRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
              RDLP  CRV D+  P    +M E R+  R K  I+N+F++LEG  + Q+R      +Y+
Sbjct  186   CRDLPSFCRVSDMTHPNLLLVMNETRQSPRAKALILNTFEDLEGPLMSQIRT-HCPEIYS  244

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IGPLHE L+ KL + N     SSN L E  + CM WLD QP  SVLYV FG+ T+++   
Sbjct  245   IGPLHEHLQAKLSAKNEKSCQSSNSLREIDRSCMTWLDNQPEKSVLYVSFGSFTVMTRHQ  304

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L EFW+GL++S +RFLW + P  +  K  E  ++P E+  G + R  +  W PQ+EVLAH
Sbjct  305   LLEFWYGLVSSKKRFLWVIRPDSIATKDGEFEKIPVEVEEGTKERGFIAGWVPQEEVLAH  364

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              A+ GFLTH GWNS +ESIVAGVPMI WP++ADQQVNSRF+GEVWK+GLDMKD CDR I+
Sbjct  365   KAIAGFLTHSGWNSTLESIVAGVPMICWPYFADQQVNSRFVGEVWKLGLDMKDQCDREIV  424

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             EKMV DLM  R++EF++ A + A  +++  +EGGSS  +L  LIEDI+ M
Sbjct  425   EKMVNDLMVERREEFVRSATRMAELSRKSVREGGSSYCNLNRLIEDIRTM  474



>gb|AGX93070.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Tabernaemontana 
elegans]
Length=482

 Score =   443 bits (1139),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 229/467 (49%), Positives = 312/467 (67%), Gaps = 10/467 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SML LA+LLCL+ L +TFI +  + + LL  ++V SRF  Y GF+F+ I DGL
Sbjct  18    PIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLLKHTNVASRFARYPGFQFQGISDGL  77

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR---CIIADGFANFA  503
             P    DDH  +G  ++ +L S      P  K+++V      SA +R   C+IADG  +F 
Sbjct  78    P----DDHPRAGERVMDILPSTKNVTGPLFKQMMVEKNFFASATRRPITCMIADGVLSFV  133

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D AE  G+ +I F  VSA + WA F +P LI+AG++P  G  MD  + SV GM+K LRR
Sbjct  134   GDFAEATGISLIYFRTVSACSFWACFCMPELIEAGDIPIKGNGMDLVVKSVPGMDKYLRR  193

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLPG CRV+D+ +P  + +  E R+  R +  I+N+F++LEG  L Q+R   M  ++ I
Sbjct  194   RDLPGFCRVNDINEPKLQILKNETRQSTRAQAAILNTFEDLEGPILSQIR-KHMPRLFTI  252

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP H  L  +L S N+  + SS    E+ + C+DWLD QPP SVLYV FG++T+V+ + L
Sbjct  253   GPSHSHLTYRLESKNIQSSISSGSFWEEDRSCVDWLDSQPPRSVLYVSFGSITVVTSDQL  312

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSGQRFLW + P  ++ K   +  +P E+  G + R  +V WAPQ+EVL H 
Sbjct  313   LEFWHGLVNSGQRFLWVMRPDSIMGKD-GKSRIPAELEEGTKARGYMVGWAPQEEVLNHP  371

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS +ESIVAGVPMI WP++ADQ +NSRF+ E+WKIGLDMKDTCDR  IE
Sbjct  372   AIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCDRDTIE  431

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             K+V++LM VRKDEFLQRA   A  A+   +EGGSS S+L+ L++ I+
Sbjct  432   KIVKELMVVRKDEFLQRADHMAKLARGAVREGGSSYSNLDGLVDYIR  478



>ref|XP_007009132.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17942.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=482

 Score =   443 bits (1139),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/470 (47%), Positives = 305/470 (65%), Gaps = 13/470 (3%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P    +++ML LA+L   + LKVTF+ + +  + L+ F+++ SRF  Y GF F TI 
Sbjct  16    FPLPIQGPVNAMLKLAELCATAGLKVTFLNSEYNHSRLVRFANIPSRFDKYPGFEFRTIS  75

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  SG   +++  +++   KP LK+++V    E   P  CII DG   F 
Sbjct  76    DGLP----GDHSRSGNRFMEIFEAMNIRTKPLLKDMLV----EMIPPVDCIIGDGILEFV  127

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLR  680
             +DVA E+G+PII+   + A   W+ +SIP +I+AGELP  G +DMD PI +V GMEK LR
Sbjct  128   LDVANELGIPIINCRTIGACFLWSNYSIPDMIEAGELPIKGSEDMDRPITAVPGMEKFLR  187

Query  681   RRDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
              RDLP  CR  ++ D    ++    RK F     I+N+F+ELEG  L Q+R     NVY 
Sbjct  188   CRDLPSFCRASNMSDSTLLRYGTVTRKSFTASGVILNTFEELEGPILSQIR-SKCPNVYT  246

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IGPL+E  + ++   N   + SSN   E  + CM WLDRQP  SV+YV FG++ ++S+E 
Sbjct  247   IGPLNEHFKTRMSLENGVSSQSSNYFWEVDRSCMSWLDRQPNQSVVYVSFGSIAVMSDEQ  306

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             + EFWHGL+NS +RFLW + P  V  K  +  + P E++ G + R  +V WA Q+EVL+H
Sbjct  307   IMEFWHGLVNSKRRFLWVVRPDSVAGKGFQGEDTPKELVEGTKDRGYIVGWAAQEEVLSH  366

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              AVGGFLTH GWNS MESIVAGVPM+ WP++ADQQ+NSRF+GEVWK+G+DMKD CDR ++
Sbjct  367   RAVGGFLTHSGWNSTMESIVAGVPMLCWPYFADQQLNSRFVGEVWKLGIDMKDVCDRKVV  426

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             EKMV DLM  RKDEF++ A   A+ AK+C   GG S  + + LIEDIK +
Sbjct  427   EKMVNDLMVERKDEFVKSAAAMASLAKDCVSVGGPSYCNFDRLIEDIKTI  476



>gb|AGX93066.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Lonicera 
japonica]
Length=489

 Score =   442 bits (1138),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 223/476 (47%), Positives = 313/476 (66%), Gaps = 17/476 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SML LA+LLCL+ L V+F+ +  +   LL  +++ SRF  Y GFRF+TI DGL
Sbjct  18    PIQGHVNSMLKLAELLCLADLDVSFMVSDFSHTRLLRHTNIESRFSKYPGFRFQTISDGL  77

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG---GEDSAPQRCIIADGFANFA  503
             P    DDH  +G  I+ ++ S+     P  K+++  SG    E   P  CIIADG  +FA
Sbjct  78    P----DDHPRAGEKIMDIMPSIKNVTGPLFKKMMEESGCLVAEGRRPVTCIIADGVLSFA  133

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D+AEE G+P+I F  VSA + WA + +  LI+A E+P  G  MD  + SV GM+  LRR
Sbjct  134   GDLAEEKGIPLIYFRTVSACSFWACYCMEELIEADEIPVKGNGMDLLVTSVPGMDGFLRR  193

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLPG CRV+D+ +P  + +  E R+  R +  I+NSF++LEG  +  +R   +  +Y +
Sbjct  194   RDLPGFCRVNDINEPKLQIIKSESRQTPRAQAAIVNSFEDLEGPIISHIRT-QIPRLYPL  252

Query  861   GPLHELLRNKLG-SCNVTLTTS------SNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLT  1019
             GPLH  L+++L    N  L T       +    E+ + C+DWL+ Q P SV+YV FG++T
Sbjct  253   GPLHAHLKSRLALKTNQPLKTDQSSSSSTGSFWEEDRTCVDWLNSQQPKSVIYVSFGSIT  312

Query  1020  LVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQ  1199
             +V+   L EFW+GL+NSGQ+FLW + P  +  K+ E  ++P E+  G + R  +V WAPQ
Sbjct  313   VVTRGQLLEFWYGLVNSGQKFLWVMRPDSIAGKEGE-SQIPVELEEGTKARGFMVGWAPQ  371

Query  1200  QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDT  1379
             +EVL H A+GGF TH GWNS +ES+ AGVPMI WP++ADQ +NSRF+GEVWK+GLDMKD+
Sbjct  372   EEVLDHPAIGGFFTHSGWNSTLESVYAGVPMICWPYFADQMINSRFVGEVWKLGLDMKDS  431

Query  1380  CDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             CDR  IEKMVR+LMEVRKDE+L+RA Q A  AK+   EGGSS  +L+ ++E I+ +
Sbjct  432   CDRITIEKMVRELMEVRKDEYLERAGQMAALAKKSVSEGGSSYCNLDRMVEYIRSL  487



>gb|EYU19962.1| hypothetical protein MIMGU_mgv1a005720mg [Erythranthe guttata]
Length=473

 Score =   441 bits (1135),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 224/467 (48%), Positives = 298/467 (64%), Gaps = 15/467 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++SML LA+LLCL+ L VTF+ T +    L   S++ +RF  Y GF   TI DGL
Sbjct  17    PLQGPVNSMLKLAELLCLADLHVTFLVTDYIYARLQRHSNIQTRFSSYPGFHIRTISDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDV  512
             P     ++   G   ++L  SL    KP  K+++  S G   +   CIIADG   F  DV
Sbjct  77    P-----ENHPRGDKFLELFESLMTNTKPLFKDML--SNGSLGSRVSCIIADGILGFTCDV  129

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDL  692
             A ++ VPI     +SAA  W +F +P LIQAG+LPF G D+D  + SV GME+ LRRRDL
Sbjct  130   ANQIRVPIFYVRTISAACLWVFFRLPELIQAGDLPFQGDDLDVAVKSVPGMERYLRRRDL  189

Query  693   PGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPL  869
             P  CR  D+ DP  + +  E  +  R    I+N+F++LEG  L++MR     N+Y IGPL
Sbjct  190   PSFCRSADISDPIIEMYKAESTENARAYGLILNTFEDLEGPILNEMRT-ICPNIYTIGPL  248

Query  870   HELLRNKLGSCNVTLTTS-SNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAE  1046
             H  L+ +L + + +   + SN L E+ + CM WLD QPP SV+YV FG+L +++ + L E
Sbjct  249   HAHLKAQLAANSTSAPPAFSNSLWEEDRTCMTWLDSQPPKSVIYVSFGSLAVMTNDQLME  308

Query  1047  FWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAV  1226
             FW+GL+NSGQ+FLW + P       +   E+P E+  G   R  +V WAPQ+EVLAH AV
Sbjct  309   FWYGLVNSGQKFLWVIRP-----DSISGYEIPVELSQGTRERGYIVGWAPQEEVLAHRAV  363

Query  1227  GGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKM  1406
             GGFLTH GWNS +ES+  GVPMI WP++ DQQVNSR + E WK+GLDMKDTCDR +IEK 
Sbjct  364   GGFLTHSGWNSTLESVYEGVPMICWPYFMDQQVNSRLVEEEWKLGLDMKDTCDRSLIEKT  423

Query  1407  VRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +++LMEVRKDEFL RA   A SAK    EGGSS S+L+ LI+DIK +
Sbjct  424   IKNLMEVRKDEFLLRADDMAKSAKTSLTEGGSSFSNLKRLIDDIKSL  470



>ref|XP_007009133.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17943.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=481

 Score =   441 bits (1134),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 220/467 (47%), Positives = 304/467 (65%), Gaps = 11/467 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SM  LA+LL L+  KVTF+ + H    L+ +++V + F  Y GF F T+PDGL
Sbjct  19    PLQGHVNSMFKLAELLALTGFKVTFLYSEHNHGRLVKYTNVSAHFASYPGFEFRTVPDGL  78

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDV  512
             P    DDH  SG   +++ +++   AK  L+E+++      + P  CII DGF  F +DV
Sbjct  79    P----DDHPRSGDWFLEMYYAMETKAKLSLREMLLNI----NPPVDCIIGDGFLGFVLDV  130

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLRRRD  689
             A+E+G+P+  F   SA   WAY+SIP +IQAGE+P  G +DM+  I +V GME  LR RD
Sbjct  131   AKELGIPVFYFRTSSACCFWAYYSIPDIIQAGEIPIRGIEDMNRLITTVPGMETFLRCRD  190

Query  690   LPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGP  866
             LP  CR  D+ +   + ++E  RK  +    I+N+F++L+   L  +R     +VY IGP
Sbjct  191   LPSFCRASDMANSTIQLVVEQTRKSPQAHALILNTFEDLDRPILSHIRT-KCPHVYTIGP  249

Query  867   LHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAE  1046
             +H LL  +L +     +  SN L E  + C+ WLD+QP  SV+YV FG++T+ S E L E
Sbjct  250   IHALLNTRLKAKRGASSQFSNSLWEVDRNCISWLDKQPKQSVVYVSFGSITIPSREQLTE  309

Query  1047  FWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAV  1226
              W+GL+NS +RFLW + P  V  K  +  +VP E+L G + R C+V WAPQ+EVL H AV
Sbjct  310   LWYGLVNSKRRFLWVVRPNSVTGKDGQGEDVPVELLEGTKERGCIVGWAPQEEVLNHPAV  369

Query  1227  GGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKM  1406
             GGFLTH GWNS +ES+VAGVPMI WP++ADQQVNSRF+ EVWK+GLDMKD CDR ++EKM
Sbjct  370   GGFLTHSGWNSTLESVVAGVPMICWPYFADQQVNSRFVSEVWKLGLDMKDVCDRKVVEKM  429

Query  1407  VRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             V DLM  R++EF++ A + A  AKE    GGSS  +L+ LIEDI+ M
Sbjct  430   VNDLMMDRREEFVKSAAEMAKLAKESVNVGGSSYCNLDRLIEDIRLM  476



>ref|XP_009802463.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=480

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 226/473 (48%), Positives = 306/473 (65%), Gaps = 17/473 (4%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   H++ ML LAQLLC   L VTF+ +      LL ++D+   ++ Y    FETIP
Sbjct  14    FPFPVQGHVNCMLKLAQLLCREGLHVTFLNSDFIHRRLLSYTDIHLSYKQYPNLYFETIP  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS--GGEDSAPQRCIIADGFAN  497
             DGL    +DDH  +G  +V L +S+    KP L E+++       D  P  CII DG   
Sbjct  74    DGL----SDDHPRTGDRVVDLFNSIDTITKPLLMEMLIARRFSTLDRPPLTCIITDGIMC  129

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKL  674
             F +D+  E+ +P I F  +SA+  WA+F +P LI+ GELP  G+ DMD  + +V GME  
Sbjct  130   FTIDIGRELNIPTILFRTISASCFWAFFCLPRLIEGGELPITGQSDMDTLLTNVAGMESF  189

Query  675   LRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHII-NSFQELEGSTLDQMRIGDMLNV  851
             LR RDLP  CR  DL D   + ++   +  ++ H +I N+F+ELEG  L Q+   ++  +
Sbjct  190   LRLRDLPSFCRASDLTDRGLQLVISATQHTKSAHGLILNTFEELEGPALAQI-TKNISKL  248

Query  852   YAIGPLHELLRNKLGSCNVTLT-TSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             Y IGPLH  L+ ++ + N+ LT TSS+ L E+ + C+DWLD+QP  SV+YV FG++T+++
Sbjct  249   YTIGPLHVQLKARVAT-NIGLTCTSSSSLWEEDRSCIDWLDQQPFKSVIYVSFGSMTVLT  307

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              +   EF HGL+NSG+ FLW + P+ V     E  ++P E+L G   R  +VEWAPQ+EV
Sbjct  308   RDQFMEFLHGLVNSGKPFLWVVRPKSV----AEDYQIPEELLEGTRQRGYIVEWAPQEEV  363

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             L H A+GGFLTH GWNS +ESI  GVPMI WPFYADQQVNSR  GEVWKIGLDMKDTCDR
Sbjct  364   LGHPAIGGFLTHSGWNSTLESIYEGVPMICWPFYADQQVNSRLAGEVWKIGLDMKDTCDR  423

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              IIEKMV+DL+E RKDEF +  +  A  A++ A E GSS  +L+ LI+DIK M
Sbjct  424   VIIEKMVKDLIETRKDEFAKSTRLMAKLARKSASENGSSYCNLDRLIKDIKLM  476



>dbj|BAP90373.1| UDP-glycose: glycosyltransferase UGT709H1 [Fagopyrum esculentum]
Length=482

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 219/469 (47%), Positives = 296/469 (63%), Gaps = 8/469 (2%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P   HI+ ML LAQLLCL+ L VTF+ T +    LL ++DV +R   + GFRFE IP
Sbjct  16    FPVPMLGHINPMLKLAQLLCLAKLNVTFLNTAYNHRRLLQYTDVEARLARFPGFRFEIIP  75

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP    DDH  SG    ++  SL  TA P LKEI++    + ++P  C IADG   +A
Sbjct  76    DGLP----DDHPRSGERANEVYRSLELTATPILKEILIRLRDDLNSPVTCFIADGMFGYA  131

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              DV EEVG+P+I+F  +S+   W YF++P+LI A ++PF   D+DE + ++ GME  LR 
Sbjct  132   YDVGEEVGIPVIAFRTISSCCFWIYFNMPNLIDAEQIPFQDDDLDELVNNIPGMEAFLRY  191

Query  684   RDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CRV D+ D  F+ +    R+  R    I+N+F+ELEG  ++ +R     N+Y+I
Sbjct  192   RDLPSFCRVKDVNDSHFRRVTNATRRTQRANSLILNTFEELEGPIVNLIRAHCSSNIYSI  251

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L  +LG       T +N L E  + C+ WLD +P  SV+YV FG++T +S+E L
Sbjct  252   GPLHTQLNYRLGRTESDKITLNNSLWEVDRSCIKWLDDKPKKSVVYVSFGSITTISKEQL  311

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              E W GL+ S + FLW + P  +      +   P EIL G E R  +V W PQ+EVLAH 
Sbjct  312   MEIWAGLVQSNKFFLWVMRPNSITGDNPTQAVDP-EILEGTEKRGYMVGWTPQEEVLAHQ  370

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS +ESI AGVPM+ WP++ADQQVNSR++  VWKIGLDMKD C R I+E
Sbjct  371   AIGGFLTHSGWNSTLESIEAGVPMVCWPYFADQQVNSRYVSHVWKIGLDMKDKCHRDIVE  430

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              MV D+ME  KD  L    +F+ + K    EGG+S  +L+ LI+DI+ M
Sbjct  431   NMVNDMMENMKDGLLSSVTEFSQAVKRSVAEGGTSSCNLDRLIDDIRAM  479



>ref|XP_009608691.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   439 bits (1128),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 226/473 (48%), Positives = 305/473 (64%), Gaps = 17/473 (4%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   H++ ML LAQLLC   L VTF+ +      LL ++++   ++ Y    FETIP
Sbjct  14    FPFPVQGHVNCMLKLAQLLCREGLHVTFLNSDFIHRRLLSYTNIHLSYKQYPNLYFETIP  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGE--DSAPQRCIIADGFAN  497
             DGLP    DDH  +G  +V L +S+    KP   E+++       D  P  CIIADG   
Sbjct  74    DGLP----DDHPRTGDRVVDLFNSIDTVTKPRFMEMLIARRFSILDRPPLTCIIADGIMC  129

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKL  674
             F +D+  E+ +P I F  VSA+  WA+F +P LI+AGELP  G+ DMD  + +V GME  
Sbjct  130   FTIDIGRELNIPTILFRTVSASCFWAFFCLPRLIEAGELPITGQSDMDTLLTNVVGMETF  189

Query  675   LRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHII-NSFQELEGSTLDQMRIGDMLNV  851
             LR RDLP  CR  DL D   + ++   +  ++ H +I N+F+ELEG  L Q+   ++  +
Sbjct  190   LRLRDLPSFCRASDLTDRGLQLVISATQLTKSAHGLILNTFEELEGPALAQI-TNNISKL  248

Query  852   YAIGPLHELLRNKLGSCNVTLT-TSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             Y IGPLH  L+ ++ + N+ LT TSS+ L E+ + C+DWLD+QP  SV+YV FG++T+++
Sbjct  249   YTIGPLHVQLKARVAT-NIKLTCTSSSSLWEEDRSCIDWLDQQPFKSVIYVSFGSMTVLT  307

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              +   EF HG +NSG+ FLW + P+ V     E  ++P E+L G   R  +VEWAPQ+EV
Sbjct  308   RDQFMEFLHGFVNSGKPFLWVVRPKSV----AEDYQIPEELLEGTRQRGYIVEWAPQEEV  363

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH A+GGFLTH GWNS +ESI  GVPMI WPFYADQQVNSR +GEVWKIGLDMKDTCDR
Sbjct  364   LAHPAIGGFLTHSGWNSTLESIYEGVPMICWPFYADQQVNSRLVGEVWKIGLDMKDTCDR  423

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              IIE MV+DL+E RKDEF + A+     A +   E GSS  +L+ LI+DIK M
Sbjct  424   VIIENMVKDLIETRKDEFAKSARLMTKLAMKSVSENGSSYCNLDRLIKDIKLM  476



>emb|CDP05607.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   437 bits (1125),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 235/487 (48%), Positives = 308/487 (63%), Gaps = 31/487 (6%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LA+LLCL+ + +TF+ + +  N LL  ++V+SRF  Y GF  +  P
Sbjct  14    FPFPAQGHVNSMLKLAELLCLAGINITFLVSNNIHNRLLRHTNVVSRFSKYPGFHLDHYP  73

Query  324   DGLPHGLTDDHRSSGVGIVQ----LLHSLSATAKPFLKEIVVTSGG----EDSAPQRCII  479
             D         +  S V I Q    L  +L +  KPFLKE++         +D  P  CII
Sbjct  74    DA--------YDESKVHIAQEIMDLCTALQSVVKPFLKELLSKDPAHGTRKDRPPFSCII  125

Query  480   ADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVK  659
              DGF + A+DVAEE+G+P+I F  +SA A W YF IP L++AGELPF G +M+ PI +VK
Sbjct  126   VDGFLSLALDVAEEIGLPLICFRTISAGAFWTYFCIPRLVEAGELPFPGDEMNLPIENVK  185

Query  660   GMEKLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIG  836
             GME  LRR DLP   RV DL +P F  ++ E  +  R K  I+N+F++LEG  L   R  
Sbjct  186   GMEGFLRRCDLPSFLRVGDLTNPDFNLLLKEALQTPRAKGLILNTFEDLEGCILSHFRT-  244

Query  837   DMLNVYAIGPLHELLRNKLGSCNVTLTTSSNG-LHEDGKKCMDWLDRQPPNSVLYVCFGT  1013
                N+Y IGPLH  LR +L         S++  L E+ K C+ WLD QPP SVLYV FG+
Sbjct  245   HCPNLYTIGPLHAHLRARLQLQEANSNNSNSNSLWEEDKSCIKWLDNQPPKSVLYVSFGS  304

Query  1014  LTLVSEETLAEFWHGLMNSGQRFLWALNPRLV----------LNKKVERGEVPTEILNGL  1163
             + +++ ETL EFWHG++NSG RFLW + P  V            K   +     E+    
Sbjct  305   IAIITRETLLEFWHGIVNSGVRFLWVIRPNSVNVGLGDDVLDSTKSKSKSTPEMELEEAT  364

Query  1164  EGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLG  1343
             + R C+V WAPQ++VLAH A+GGFLTH GWNS +ESI  GVPMI WP +ADQQ NSRF+G
Sbjct  365   KERGCMVGWAPQEDVLAHPAIGGFLTHSGWNSTLESIAEGVPMICWPCFADQQPNSRFVG  424

Query  1344  EVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLEN  1523
             E+WKIGLDMKDTCDR I+EKMVRDLM  RKDEFL RA + A  A++  +EGGSS  +L  
Sbjct  425   EIWKIGLDMKDTCDRVIVEKMVRDLMVERKDEFLHRADEMAKLARKSIEEGGSSFCNLVR  484

Query  1524  LIEDIKR  1544
             LI+DI +
Sbjct  485   LIDDIVK  491



>dbj|BAK55741.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=493

 Score =   437 bits (1124),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 236/477 (49%), Positives = 302/477 (63%), Gaps = 21/477 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSG-FRFETIPDG  329
             P    ++ ML LA+LLC +HL+VTF+ T H +  LL  +DV SRF+ Y+G FRFET+PDG
Sbjct  19    PLQGPVNCMLKLAELLCFNHLQVTFLNTDHVQRRLLSCTDVSSRFKRYAGHFRFETVPDG  78

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIV-----VTSGGEDSAPQRCIIADGFA  494
             LP G T     +G  I +LL S+ A + P  +EIV     V+ G ++  P  CIIADG  
Sbjct  79    LPAGKT----MTGEQIGELLDSMEAVSLPLFREIVRSSVHVSDGAQN--PLTCIIADGAF  132

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
              FAVD+A E GV ++ F  +S    W+  S   LIQAG+ PF   D+D P+ SV GME  
Sbjct  133   GFAVDIAAEFGVALMYFDTISPCGLWSILSANRLIQAGDFPFKDDDLDAPVTSVPGMEGF  192

Query  675   LRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHII-NSFQELEGSTLDQMRIGDMLNV  851
             LRRRDLP   R+ D  DP  + ++   +  +  H +I NSF++LEG  L Q++   +  V
Sbjct  193   LRRRDLPSFFRIPDQNDPIIQRVLREEQQMKKCHGLIFNSFEDLEGPILSQLKTL-VPRV  251

Query  852   YAIGPLHELLRNKL----GSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLT  1019
             Y IGPLH   +N+L    GS N     S+N L  + K C+ WLD QP  SV+YV  G+L 
Sbjct  252   YTIGPLHTHKKNRLVSEKGSKNDR--NSTNSLWTENKSCISWLDNQPAKSVIYVSIGSLA  309

Query  1020  LVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVER-GEVPTEILNGLEGRCCVVEWAP  1196
             L+ +E L E WHGL NS  RFLW   P  +     E  G VP  +      R C+V WAP
Sbjct  310   LMGKEQLLEIWHGLANSEVRFLWVQRPGSITGLDEENDGGVPLNLCRATIERGCIVSWAP  369

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q+EVLAH AVGGFLTH GWNS +ESIV GVPMI  P++ADQQ+NSR++GEVWK+GLDMKD
Sbjct  370   QEEVLAHPAVGGFLTHSGWNSTLESIVEGVPMICLPYFADQQINSRYVGEVWKVGLDMKD  429

Query  1377  TCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             TCDR I+E MVRDLME RKDEFL++A   A  AK    +GG+S ++L  LIEDIK M
Sbjct  430   TCDRDIVEMMVRDLMEKRKDEFLEKADHVAKLAKASVSKGGASYNALNCLIEDIKLM  486



>ref|XP_010674287.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=492

 Score =   437 bits (1123),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 222/480 (46%), Positives = 317/480 (66%), Gaps = 25/480 (5%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P+  H+  ML LA+LLC+++ KVTF+ T H    L   +D+ +RF  YSGF F+T+P
Sbjct  18    FPLPALGHLTPMLQLAELLCIANFKVTFLNTTHNHQRLTQHTDIEARFEQYSGFEFKTMP  77

Query  324   DGLPHGLTDDHRSSGVG-----IVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADG  488
             DGL    ++D+  +G G     ++  + SLS +A+P L+EI++  G  ++A   C+I DG
Sbjct  78    DGL----SEDNPRTGQGDVKGLMISAIESLSTSAEPLLREILL--GSSETAKITCLIVDG  131

Query  489   FANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGME  668
             + +FA DVA E  VP+I F   SA+  W+Y+ IP LI+AG+LP   + MDE + +  GM 
Sbjct  132   WMSFASDVANEAEVPVIIFRCSSASCNWSYYCIPKLIEAGDLPIKDEKMDELVDNAPGMS  191

Query  669   KLLRRRDLPGNCR------VDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMR  830
               LR RDLP  CR        DL+D F     E ++  +    I+N+F++LEG TL  +R
Sbjct  192   SFLRYRDLPTFCRNQNTSSCQDLQDWFNG---EIQQNKQAHSFILNTFEDLEGHTLSLIR  248

Query  831   IGDMLNVYAIGPLHELLRNKLGSCNVTLTTS-SNGLHEDGKKCMDWLDRQPPNSVLYVCF  1007
                   VY+IGP+H  L+ KLG    TL+ + S+ L E  + C+ WLDR+P  SV+YV F
Sbjct  249   -SQCSRVYSIGPIHAHLKYKLGQQKTTLSNNFSSNLWEVDRSCISWLDRKPNKSVVYVSF  307

Query  1008  GTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVE  1187
             G+LT+++++ L EFW GL+ S + FLW + P L++  +++  + P ++L G + R C+V+
Sbjct  308   GSLTVLTKDQLREFWAGLVQSNKYFLWVIRPNLIIGSELD-NQTPDDLLEGTKKRGCLVK  366

Query  1188  WAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLD  1367
             WAPQ+EVLAH A+GGFLTH GWNS +ESIVAGVPM+ WP+++DQQVNSRF+ EVW+IGLD
Sbjct  367   WAPQKEVLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWPYFSDQQVNSRFVSEVWRIGLD  426

Query  1368  MKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             MKDTCDR I+EKM+ DLM+  KDE  +   + +  AK+   EGGSS S+L  LIEDIK M
Sbjct  427   MKDTCDRTIVEKMINDLMDGNKDELQRSMDRMSYLAKKSISEGGSSYSNLNQLIEDIKAM  486



>ref|XP_010318075.1| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetic acid glucosyltransferase-like 
[Solanum lycopersicum]
Length=469

 Score =   436 bits (1120),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 227/467 (49%), Positives = 312/467 (67%), Gaps = 19/467 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LAQLL LS+  +TF+ TV   + LL  +DV+SRF   SGF  +   
Sbjct  10    FPFPAQGHVNSMLKLAQLLSLSNFHITFLVTVDTHDRLLNHTDVLSRFG--SGFHLQP--  65

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
               LPHG++ D  ++  G+  L +SL+  AK FL+E +V      ++P  C+IADG  + A
Sbjct  66    --LPHGISMDVMNTRDGLSILYNSLNKIAKLFLREFIVNM----NSPVTCLIADGILSMA  119

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              DVA+E+ +P+I F  +SA A W+YF IP LIQAG+LP     MD  +  VKGME  LR 
Sbjct  120   GDVAQEINLPLIYFRTISACAFWSYFCIPHLIQAGQLPLKENAMDLILTKVKGMENFLRG  179

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CR  D+  P F+ +M E  +  R +  I+N+ ++LEG  L Q++     NVY I
Sbjct  180   RDLPSVCRASDVTRPDFRILMTETLQTPRARGLILNTIEDLEGPILSQIQTV-CPNVYTI  238

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP+H  L+ KL     T +TSSN L ++ + CM WLD QPP SV+YV FG++  +++E L
Sbjct  239   GPVHAHLKAKLA----TTSTSSNSLWQEDESCMSWLDTQPPKSVIYVSFGSIAGLTKEEL  294

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EF +GL+NS Q+FLW +   L++ ++  + E+P E+  G + R  + +W PQ++VLAH 
Sbjct  295   LEFXYGLVNSEQKFLWVMRSDLIIGQE-RKDEIPVELEQGTKARGYMADWVPQEKVLAHK  353

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS +ESIV GVPMI WP +ADQQVNSRF+GEVWK+GLD+KDTCDR II 
Sbjct  354   AIGGFLTHSGWNSTLESIVEGVPMICWPRFADQQVNSRFIGEVWKMGLDIKDTCDRDIIA  413

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             K VR+LME R  EF QR +Q A+ AK+   EGGSS  +L+ LI+DI+
Sbjct  414   KSVRELMEKRNGEFSQRTEQMASLAKKAINEGGSSCINLDRLIQDIR  460



>ref|XP_009613526.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=498

 Score =   436 bits (1122),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 221/471 (47%), Positives = 302/471 (64%), Gaps = 13/471 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSH-LKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             P    ++ ML LA+L CL   + VTF+ + H +  LL  +DV  RF+ Y  F+  TIPDG
Sbjct  33    PLQGPVNCMLKLAELFCLHQDIHVTFLNSEHIQQRLLNCTDVQIRFKKYPNFKIMTIPDG  92

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGG---EDSAPQRCIIADGFANF  500
             LP    +D+  +G  +  L+  +   + P  +E+V TSG        P  C++ DG   F
Sbjct  93    LP----EDNPRTGDQVRNLVKGVEDVSSPLFREMV-TSGSLSPNSEKPVTCLLVDGIFPF  147

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLR  680
             AVD+AEE+G+P++ F  +S  A W Y  IP LI+AGE+PF G D+D  + +V GME ++R
Sbjct  148   AVDIAEEIGIPLLYFDTISPCALWTYLCIPKLIEAGEIPFKGNDLDALVNNVPGMEGVIR  207

Query  681   RRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
             RRDLP  CRV DL++P  +F + E +  F+ +  I N+F+ LEG  L Q R     N+Y+
Sbjct  208   RRDLPSFCRVPDLDNPTLQFFIKEGKHIFQAQGLIFNTFEGLEGPILSQFR-AVCPNIYS  266

Query  858   IGPLHELLRNKLGS-CNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
             +GPLH  L+  L S C+V  T+ SN + ++   CM WLD  P  SVL+V  G+L  +S+ 
Sbjct  267   VGPLHIHLKKSLSSKCSVPKTSLSNSIWKEDMSCMHWLDEHPKKSVLFVSIGSLATISKA  326

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
                E W+GL+NS  RFLW   P  V+  + E  +VP E+    + R C+V WAPQ+EVLA
Sbjct  327   QFLEIWYGLVNSKTRFLWVQRPGSVIGLE-ENNDVPVELSKSTKERGCIVSWAPQEEVLA  385

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H +VGGFLTH GWNS +ESIV GVPMI WP++ DQQVNSR++GEVWK+GLDMKD CDR I
Sbjct  386   HPSVGGFLTHSGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKDICDRAI  445

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKMVR++MEVRK EFL+R ++  N A E   EGGSS   L+ L+EDI+ M
Sbjct  446   VEKMVREMMEVRKIEFLERVREMRNLAIESVNEGGSSYKDLDRLVEDIRLM  496



>ref|XP_010650643.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=476

 Score =   435 bits (1119),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 220/469 (47%), Positives = 305/469 (65%), Gaps = 11/469 (2%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P   H++ ML LA+LL L+ L++TF+ + +  + LL +++++ R+  Y GFRF+TI 
Sbjct  13    FPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNILDRYTRYPGFRFQTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     D   +G G+  ++  + AT KP  +E+V+ S  + S P  CIIADG  +FA
Sbjct  73    DGLPL----DRPWTGAGLRDMMDGIKATTKPLFREMVI-SWCQSSDPVTCIIADGLMSFA  127

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             +DVA EVGVPIIS   VS     AYFS   LI+AGE+PF   DMD  +  V GME  LRR
Sbjct  128   IDVANEVGVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRLVTRVPGMEGFLRR  187

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CR  D  D   +F++ E ++  R    I+N+F++L+G  L Q+R      +Y I
Sbjct  188   RDLPSFCRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIR-NHCPKIYTI  246

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L+++L S   T +  SN   E+ + C+ WLDRQP  S +YV FG++T++++E +
Sbjct  247   GPLHAHLKSRLAS-ETTTSQFSNSFWEEDRSCLAWLDRQPSKSFIYVSFGSITVITKEQM  305

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSG RFLW + P  +  K  E  ++  ++    + R  +V+WAPQ+EVLAH 
Sbjct  306   MEFWHGLVNSGSRFLWVIRPDSLTEKDGE-FQLQAQLREVTKERGQIVDWAPQEEVLAHP  364

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             AVGGFLTH GWNS +ESI AGVPMI WP+++DQQ+NSRF+  VWKIG+DMKDTCDR  +E
Sbjct  365   AVGGFLTHGGWNSTLESIFAGVPMICWPYFSDQQLNSRFVSHVWKIGMDMKDTCDRVTVE  424

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVRD+ME R+ EF +     A  A+    EGG+S  +   LIEDI+ M
Sbjct  425   KMVRDVMEERRAEFTKSVDAMAKLARSSLSEGGTSYCNFNRLIEDIRLM  473



>ref|XP_007009131.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17941.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=479

 Score =   434 bits (1117),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 221/471 (47%), Positives = 303/471 (64%), Gaps = 18/471 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P+  H++SML LA+L  L+ L+VTF+ + H    L+  +DV  RF  Y  F+FETIP
Sbjct  16    FPLPAQGHVNSMLKLAELFALAGLEVTFLNSDHNHERLVRHTDVGFRFAKYPRFKFETIP  75

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGL     +DH   GV  ++L  S+    KP L+E++V    + + P  CII DG     
Sbjct  76    DGL----REDHPRLGVSFMELFESMELRTKPILREMLV----KINPPVDCIIGDGALGLV  127

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLR  680
             +DVA+E+G+PI  F  +SA+  WAYF+IP +I+AGELP  G +DMD  I  V GME  LR
Sbjct  128   LDVADELGIPIFQFRTISASGIWAYFAIPDMIEAGELPIRGNEDMDRLITRVPGMETFLR  187

Query  681   RRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
              RDLP  CR  D+ D   + +  E RK       I+N+F++LEG+ L  MR      +Y 
Sbjct  188   CRDLPSFCRDSDMTDSNLQLIAKETRKNLSAPGLILNTFEDLEGAILSHMR-SKCPKIYT  246

Query  858   IGPLHELLRNKLGSCNVTLT-TSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
             +GPLH  L  +L   N T+   S N L E  + C+ WLD QP  SV+YV FG++ ++S E
Sbjct  247   VGPLHLHLNTRLAETNGTMVHQSPNSLWEVDRSCLSWLDEQPKESVVYVSFGSIAVLSRE  306

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              + EFW GL+NS +RFLW   P  +     E+G +P E++ G + R  +V WAPQ+EVLA
Sbjct  307   QIMEFWFGLVNSRKRFLWVFRPDFM----PEKGSIPAELVEGTKQRGYMVGWAPQEEVLA  362

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H A+GGFLTH GWNS +ES+VAGVPMI WP++ADQQ+NSRF+ EVWK+GLDMKD CDR +
Sbjct  363   HCAIGGFLTHSGWNSTLESLVAGVPMICWPYFADQQLNSRFVSEVWKLGLDMKDVCDRRV  422

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKMV DL+  +++EF++ + + A  AK C   GGSS  +L+ LIEDI+ M
Sbjct  423   VEKMVNDLIVDKREEFVKSSAEIAKLAKACVNVGGSSYCNLDRLIEDIRSM  473



>ref|XP_010650608.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=487

 Score =   434 bits (1115),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 220/469 (47%), Positives = 304/469 (65%), Gaps = 11/469 (2%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P   H++ ML LA+LL L+ L++TF+ + +  + LL +++++ R+  Y GFRF+TI 
Sbjct  13    FPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNILDRYTRYPGFRFQTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     D   +G G+  ++  + AT KP  +E+V+ S    S P  CIIADG  +FA
Sbjct  73    DGLPL----DRPRTGAGLRDMMDGIKATTKPLFREMVI-SWCRSSDPVTCIIADGLMSFA  127

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             +DVA EVGVPIIS   VS     AYFS   LI+AGE+PF   DMD  +  V GME  LRR
Sbjct  128   IDVANEVGVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRLVTRVPGMEGFLRR  187

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CR  D  D   +F++ E ++  R    I+N+F++L+G  L Q+R      +Y I
Sbjct  188   RDLPSFCRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIR-NHCPKIYTI  246

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L+++L S   T +  SN    + + C+ WLDRQP  SV+YV FG++T++++E +
Sbjct  247   GPLHAHLKSRLAS-ETTTSQFSNSFWVEDRSCLAWLDRQPSKSVIYVSFGSITVITKEQM  305

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSG RFLW + P  +  K  E  ++  ++    + R  +V+WAPQ+EVLAH 
Sbjct  306   MEFWHGLVNSGSRFLWVIRPDSLTEKDGE-FQLQAQLWEVTKERGQIVDWAPQEEVLAHP  364

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             AVGGFLTH GWNS +ESI AGVPMI WP++ DQQ+NSRF+  VWK+G+DMKDTCDR  IE
Sbjct  365   AVGGFLTHGGWNSTLESIFAGVPMICWPYFTDQQLNSRFVSHVWKMGMDMKDTCDRVTIE  424

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVRD+ME R+ EF +     A  A+    EGG+S  + + LIEDI+ M
Sbjct  425   KMVRDVMEGRRAEFTKSVDAMAKLARRSLSEGGTSYCNFDRLIEDIRLM  473



>ref|XP_009795416.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=478

 Score =   433 bits (1114),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 220/475 (46%), Positives = 306/475 (64%), Gaps = 16/475 (3%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQLLCLSH--LKVTFITTVHARNNLLCFSDVISRFRCYSGFRFET  317
             +P P    ++ ML LA+L CL H  + VTF+ + H +  LL  +DV  RF+ Y  F+F T
Sbjct  9     FPLPIQGPVNCMLKLAELFCLHHQEIHVTFLNSEHIQQRLLNCTDVQIRFKKYPNFKFMT  68

Query  318   IPDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG---GEDSAPQRCIIADG  488
             IPDGL     +D+  +G  +  L+  +   + P L+E+V TSG        P  C++ DG
Sbjct  69    IPDGL----AEDNPRTGDQVRNLVKGVEDVSSPLLREMV-TSGLLSPNSEKPVTCLLVDG  123

Query  489   FANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGME  668
                FAVD+A+EVG+P++ F  +S  A W    +P LI+AGE+PF G D+D  + +V GME
Sbjct  124   IVTFAVDIAKEVGIPLLYFDTISPCALWTCLCVPKLIEAGEIPFKGNDLDALVNNVPGME  183

Query  669   KLLRRRDLPGNCRVDDLEDPFF-KFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
              ++RRRDLP  CR  DL +P   + + E +   + +  I N+F+ LEG  L Q R     
Sbjct  184   GVIRRRDLPSFCRAPDLNNPTIQRIVKEGKHIVQAQGLIFNTFEGLEGPILPQFRTL-CP  242

Query  846   NVYAIGPLHELLRNKLGS-CNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTL  1022
             N+Y+IGPLH  L+  L S C+V  T++SN + ++   CMDWLD QP  SVL+V  G++  
Sbjct  243   NIYSIGPLHIHLKKSLSSKCSVPKTSTSNSIWKEDMSCMDWLDEQPNKSVLFVSIGSVAT  302

Query  1023  VSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQ  1202
             +S+  L E W+GL+NS  RFLW   P  V+  + E  ++P E+    + R C+V WAPQ+
Sbjct  303   MSKAQLLEIWYGLVNSKTRFLWVQRPGSVIGLE-ENNDIPMELSKYTKERGCIVSWAPQE  361

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             EVLAH ++GGFLTHCGWNS +ESIV GVPMI WP++ DQQVNSR++GEVWK+GLDMKD C
Sbjct  362   EVLAHPSIGGFLTHCGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKDVC  421

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             DR I+EKMVR++MEVRK EFL+R ++    A E   EGGSS   L++L+EDI+ M
Sbjct  422   DRAIVEKMVREIMEVRKIEFLERGREMRKLAIESVNEGGSSYKDLDSLVEDIRLM  476



>ref|XP_006355163.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Solanum tuberosum]
Length=471

 Score =   433 bits (1113),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 212/467 (45%), Positives = 303/467 (65%), Gaps = 11/467 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCL-SHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             P    ++ ML LA+LLCL   + VTFI T +    LL ++DV+ RF  Y  F+F TIPDG
Sbjct  12    PLQGPVNCMLKLAELLCLHQEIHVTFINTEYIHQRLLNYTDVLIRFAKYPNFKFVTIPDG  71

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVD  509
             LP    +D+  +G  + +++  +   + P  +E+V+ +     AP  C+I DG   FAVD
Sbjct  72    LP----EDNPRNGEQVGKIIEGVEKVSSPLFREMVMMTTTNYCAPT-CLIVDGIFTFAVD  126

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRD  689
             +A++  +P++ F  +S  A W Y ++P LI+ GE+PF G D+D  + SV GME ++RRRD
Sbjct  127   IAKDAKIPLLYFDTISPCAIWTYLAVPKLIEDGEIPFKGNDLDALVNSVSGMEGVMRRRD  186

Query  690   LPGNCRVDDLEDPFFKFMMEFRK-CFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGP  866
             LP  CR  DL+ P  + +++  K   + +  I+N+F+ LEG  L Q R     N+YAIGP
Sbjct  187   LPSYCRATDLDIPIIQHIIKQGKHIVQAQALILNTFEALEGPILSQFR-ALCPNIYAIGP  245

Query  867   LHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAE  1046
             LH  ++ KL S ++    +SN L ++   C+DWL++QP  SVL+V  G+L  +S+    E
Sbjct  246   LHTQMKAKLASQSLP---TSNSLWKEDMSCIDWLNKQPNKSVLFVSIGSLATMSKAQFLE  302

Query  1047  FWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAV  1226
             FW+GL+NS  RFLW   P  ++  + +   VP E++   + R C+V WAPQ+EVLAH ++
Sbjct  303   FWYGLVNSKTRFLWVQRPGSIIGLEDDDINVPMELVESTKERGCIVSWAPQEEVLAHPSI  362

Query  1227  GGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKM  1406
             GGFLTHCGWNS +ESI  GVPMI WP++ DQQVNSR++GEVWK+GLDMKD CDR  IE+M
Sbjct  363   GGFLTHCGWNSTLESIAEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKDVCDRATIERM  422

Query  1407  VRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             V ++M+V+K EFL+RAKQ +N A     EGG+S   LE LIEDI+ M
Sbjct  423   VIEVMDVKKIEFLERAKQMSNLAIASVGEGGASYQDLERLIEDIRLM  469



>emb|CDP19643.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   432 bits (1111),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 303/462 (66%), Gaps = 13/462 (3%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDH  356
             ML LA+LLCL+ L VT+I +    N LL  ++V S F  Y GF F+TI DGLP    DDH
Sbjct  1     MLRLAELLCLAGLDVTYIVSDFCHNRLLTHTNVSSHFARYPGFSFQTISDGLP----DDH  56

Query  357   RSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA----PQRCIIADGFANFAVDVAEEV  524
               +G G V ++ ++     P  K +++  G   S+    P  CIIADG  +FA D AEE 
Sbjct  57    PRAGEGFVDIMPAIKMVTGPLFKRMMIEKGCFASSGTRSPVTCIIADGVLSFAGDFAEEN  116

Query  525   GVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDLPGNC  704
             G+ +I F  VSA + WA F +P +I+AGE+P  G  M+  + SV GME +LRRRDLPG  
Sbjct  117   GIALIYFRTVSACSFWACFCMPQVIEAGEIPLKGHGMELAVKSVPGMENILRRRDLPGFY  176

Query  705   RVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELL  881
             RVDDL+D  F+ +  E ++  R +  I+N+F++LEG  L  +R   M  +Y IGP H  L
Sbjct  177   RVDDLDDTTFQIIKTETQQTPRAQAVILNTFEDLEGPILSHIR-KHMPRLYTIGPNHFHL  235

Query  882   RNKLGSCNVTLTT--SSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWH  1055
               +LG+      T  SS  L E+ + C+DWLD QPP SV+YV FG++T+V  E L EFW+
Sbjct  236   TARLGAKATETETLISSASLWEEDRSCLDWLDSQPPKSVIYVSFGSITIVRREQLLEFWY  295

Query  1056  GLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGF  1235
             GL+NSGQRFLW + P  ++ +    G++P E+    + R  +V WAPQ EVL H +VGGF
Sbjct  296   GLVNSGQRFLWVVRPDSIMGE-AGGGKIPAELETATKARGYMVGWAPQLEVLNHPSVGGF  354

Query  1236  LTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRD  1415
             LTH GWNS +ES+ AGVPM+ WP++ADQ +NSRF+ E+WKIGLDMKDTCDR II+KMV +
Sbjct  355   LTHGGWNSTLESMAAGVPMLCWPYFADQTINSRFVSEIWKIGLDMKDTCDRVIIQKMVAE  414

Query  1416  LMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             LM  RKDEFL+RA   A  A++   +GG+S ++L++L+E I+
Sbjct  415   LMHARKDEFLRRADAMAKLARKAVTQGGTSYNNLDSLVEFIE  456



>ref|XP_009804549.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=487

 Score =   433 bits (1114),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 227/467 (49%), Positives = 303/467 (65%), Gaps = 8/467 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  S I+SML LA+L CL+ L+VTF+ T H +  LL  ++V SRFR Y  FRF TI DGL
Sbjct  14    PIQSPINSMLQLAELFCLAGLQVTFLNTNHNQKLLLQHTNVESRFRQYPRFRFRTISDGL  73

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG-GEDSAPQRCIIADGFANFAVD  509
             P    ++ RSS V   +L+ SL A A+PFL+EI+++S  G    P  C+I DG   +AVD
Sbjct  74    P---VENPRSS-VQFGELISSLQAVAEPFLREILLSSSDGVTEPPVTCVIPDGLFYYAVD  129

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRD  689
             V  E+GVP+I F  +S    W Y  IP LIQAGE+PF G D+D    +V GM+ LLRRRD
Sbjct  130   VGNEIGVPVIPFDTISPCCLWVYLCIPKLIQAGEVPFKGNDLDVLFENVAGMQGLLRRRD  189

Query  690   LPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGP  866
              P    +D   DP+ +  + E     ++   I+N+F++L+G  L  +R       YAIGP
Sbjct  190   FPFYRLIDYATDPYCQIALKEVESIPQSNGLILNTFEDLDGPLLSLIR-SHCPQTYAIGP  248

Query  867   LHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAE  1046
             LH  L+ KL    + ++ SSN L E+    + WLD QP  SV+YV FG++  +S+E + E
Sbjct  249   LHLHLKTKLAEKRMPISASSNSLWEEDHSSIQWLDAQPIESVIYVSFGSMATLSKEEILE  308

Query  1047  FWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAV  1226
             FWHGL+NSG RFLW +   L+  ++    +   E+  G + R  +V WAPQ+EVLAHSA+
Sbjct  309   FWHGLVNSGIRFLWVIRSNLLRGEEWNH-QFAKELAEGCKERAYIVSWAPQEEVLAHSAI  367

Query  1227  GGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKM  1406
             GGFLTH GWNS MESIV G PMI W  Y DQ+V SRF+ EVWKIG+DMKD CDR+IIEKM
Sbjct  368   GGFLTHSGWNSTMESIVQGKPMICWAVYVDQRVTSRFVSEVWKIGVDMKDICDRYIIEKM  427

Query  1407  VRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             V+DLM   +DEF + A++ +N AKE   EGGSS ++LE L++DIK +
Sbjct  428   VKDLMVTNRDEFKKSAEKLSNLAKESVGEGGSSYNALECLVDDIKNL  474



>emb|CDP05611.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   433 bits (1114),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 226/481 (47%), Positives = 308/481 (64%), Gaps = 21/481 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PF +  H++SML LA+LLCL+ + +TF+ + +  N LL  +DV+SRF  Y GF  +  P
Sbjct  14    FPFQAQGHVNSMLKLAELLCLAGINITFLVSYNIHNRLLRHTDVVSRFSKYPGFNLDHYP  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRC----IIADGF  491
             D       +    +   I++L  SL +  KPFL+E +       +   R     IIADG 
Sbjct  74    DAY----DESKIHTAQQIMELYSSLQSVVKPFLREFMSKDPAHGTGKNRSRFSSIIADGI  129

Query  492   ANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEK  671
              + A+DVAEE+G+P+I F  +SA A W YF IP L++AGELPF G DM+  I +VKGME 
Sbjct  130   LSLALDVAEEIGLPLIYFRTISAGAFWTYFCIPQLVEAGELPFPGDDMNIRIENVKGMEG  189

Query  672   LLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
              LRR DLP  CRV DL  P    ++ E  +  R K  I+N+F++LEGS L  +R     N
Sbjct  190   FLRRCDLPSFCRVSDLTSPDLSLLLRETLQTPRAKGLILNTFEDLEGSILSHVRTY-CPN  248

Query  849   VYAIGPLHELLRNKLG---SCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLT  1019
             +Y IGPLH  L+ +L    + +    ++SN L ++ K C+ WLD QPP SVLYV FG++T
Sbjct  249   LYTIGPLHAHLKTRLQLQVANSNNSNSNSNSLWQEDKSCIKWLDNQPPKSVLYVSFGSIT  308

Query  1020  LVSEETLAEFWHGLMNSGQRFLWALNPRLVLNK------KVERGEVPTEILNGLEGRCCV  1181
             +++ E L EFWHG++NSG +FLW + P  +  +      K  +     E+    + R C+
Sbjct  309   VITREKLHEFWHGIVNSGVKFLWVIRPDSIKAEAGDDVLKTTKSTPEMELEEATKERGCM  368

Query  1182  VEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIG  1361
             V WAPQ+EVLAH A+GGFLTH GWNS +ESI  GVPMI WP++ADQQ NSRF+GEVWKIG
Sbjct  369   VGWAPQEEVLAHPAIGGFLTHSGWNSTLESIAEGVPMICWPYFADQQPNSRFVGEVWKIG  428

Query  1362  LDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             LD+KDTCDR I+EK ++DLM  RKDEFL RA + A  A++  +EGGSS  +L  LI+DI 
Sbjct  429   LDIKDTCDRVIVEKAIKDLMVERKDEFLHRADEMAKMARKSVEEGGSSFCNLVRLIDDIV  488

Query  1542  R  1544
             +
Sbjct  489   K  489



>emb|CDP19644.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   433 bits (1113),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 300/474 (63%), Gaps = 15/474 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSG-FRFETIPDG  329
             P    ++ ML LA+L C SHL+VTF+ T H +  LL  +DV SRF+ Y+G FRFET+PDG
Sbjct  19    PLQGPVNCMLKLAELFCSSHLQVTFLNTDHIQRRLLSCTDVSSRFKRYAGHFRFETVPDG  78

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS---GGEDSAPQRCIIADGFANF  500
             LP     D   +G  I +LL S+ A + P  +EIV +S     +   P  CIIADG   F
Sbjct  79    LPA----DKTLTGEQIGELLDSMEAVSLPLFREIVRSSVLLSDDAQNPLTCIIADGAFGF  134

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLR  680
             AVDVA E GV ++ F  +S    W+  S   LIQAG+ PF   D+D P+ S+ GME  LR
Sbjct  135   AVDVAAEFGVALMYFDTISPCGLWSILSANRLIQAGDFPFKDDDLDAPVTSIPGMEGFLR  194

Query  681   RRDLPGNCRVDDLEDPFF-KFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
             RRDLP   R+ D  DP   + + E R+  R +  I NSF++LEG  L Q++   + +VY 
Sbjct  195   RRDLPSFFRIPDQNDPIIQRVLKEERQMKRCQGLIFNSFEDLEGPILSQLKTL-VPSVYT  253

Query  858   IGPLHELLRNKLGSCNVTLT--TSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             IGPLH     +L S   +     S+N L ++ K C+ WLD QP  SV+YV  G+L L+ +
Sbjct  254   IGPLHTHKETRLASERGSKNDRNSTNSLWKENKSCISWLDNQPAKSVIYVSIGSLALMGK  313

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLV--LNKKVERGEVPTEILNGLEGRCCVVEWAPQQE  1205
             + L E WHGL NSG RFLW   P  +  L+++ + G +P ++      R C+V WAPQ+E
Sbjct  314   KQLLEIWHGLANSGVRFLWVQRPGSITGLDEENDAG-IPLKLCRATTERGCIVSWAPQEE  372

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VLAH A+GGFLTH GWNS +ESIV GVPMI  P++ADQQ+NSR++GEVWK+GLDMKDTCD
Sbjct  373   VLAHPAIGGFLTHSGWNSTLESIVEGVPMICCPYFADQQINSRYVGEVWKLGLDMKDTCD  432

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R I+E MVRDLME RKDEF ++    A  AK     GGSS ++L  LIEDIK M
Sbjct  433   RDIVEMMVRDLMEERKDEFSKKVDHMARLAKASVSNGGSSYNALNRLIEDIKLM  486



>dbj|BAK55740.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=496

 Score =   432 bits (1110),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 236/480 (49%), Positives = 302/480 (63%), Gaps = 24/480 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSG-FRFETIPDG  329
             P    ++ ML LA+LLC +HL+VTF+ T H +  LL  +DV SRF+ Y+G FRFET+PDG
Sbjct  19    PLQGPVNCMLKLAELLCFNHLQVTFLNTDHVQRRLLSCTDVSSRFKRYAGHFRFETVPDG  78

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIV-----VTSGGEDSAPQRCIIADGFA  494
             LP G T     +G  I +LL S+ A + P  +EIV     V+ G ++  P  CIIADG  
Sbjct  79    LPAGKT----MTGEQIGELLDSMEAVSLPLFREIVRSSVHVSDGAQN--PLTCIIADGAF  132

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF---NGKDMDEPILSVKGM  665
              FAVD+A E GV ++ F  +S    W+  S   LIQAG+ PF      D+D P+ SV GM
Sbjct  133   GFAVDIAAEFGVALMYFDTISPCGLWSILSANRLIQAGDFPFKVYTDDDLDAPVTSVPGM  192

Query  666   EKLLRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHII-NSFQELEGSTLDQMRIGDM  842
             E  LRRRDLP   R+ D  DP  + ++   +  +  H +I NSF++LEG  L Q++   +
Sbjct  193   EGFLRRRDLPSFFRIPDQNDPIIQRVLREEQQMKKCHGLIFNSFEDLEGPILSQLKTL-V  251

Query  843   LNVYAIGPLHELLRNKL----GSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFG  1010
               VY IGPLH   +N+L    GS N     S+N L  + K C+ WLD QP  SV+YV  G
Sbjct  252   PRVYTIGPLHTHKKNRLVSEKGSKNDR--NSTNSLWTENKSCISWLDNQPAKSVIYVSIG  309

Query  1011  TLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVER-GEVPTEILNGLEGRCCVVE  1187
             +L L+ +E L E WHGL NS  RFLW   P  +     E  G VP  +      R C+V 
Sbjct  310   SLALMGKEQLLEIWHGLANSEVRFLWVQRPGSITGLDEENDGGVPLNLCRATIERGCIVS  369

Query  1188  WAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLD  1367
             WAPQ+EVLAH AVGGFLTH GWNS +ESIV GVPMI  P++ADQQ+NSR++GEVWK+GLD
Sbjct  370   WAPQEEVLAHPAVGGFLTHSGWNSTLESIVEGVPMICLPYFADQQINSRYVGEVWKVGLD  429

Query  1368  MKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             MKDTCDR I+E MVRDLME RKDEFL++A   A  AK    +GG+S ++L  LIEDIK M
Sbjct  430   MKDTCDRDIVEMMVRDLMEKRKDEFLEKADHVAKLAKASVSKGGASYNALNCLIEDIKLM  489



>ref|XP_006435571.1| hypothetical protein CICLE_v10031408mg [Citrus clementina]
 gb|ESR48811.1| hypothetical protein CICLE_v10031408mg [Citrus clementina]
Length=476

 Score =   431 bits (1108),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 223/473 (47%), Positives = 307/473 (65%), Gaps = 20/473 (4%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P  SH++SML LA++  L+ LKVTF+ + H    L+ ++D+  RF  YS F+F+TI 
Sbjct  13    FPLPCQSHVNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHDRFLQYSEFQFKTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  +G  ++++  SLS   +P LK++++ +    S P  CII D    F 
Sbjct  73    DGLPA----DHPRAGDRLMEIFDSLSLNTRPLLKQMLIDT----SPPVSCIIGDACMEFV  124

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG--KDMDEPILSVKGMEKLL  677
             VDVA E+ +P+I F  +SA + WAYFSIP +IQAGELP     +DMD  I  V GME  L
Sbjct  125   VDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETFL  184

Query  678   RRRDLPGNCRVDDLEDPFFKFMMEF-RKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R RDLP  CRV D+ D   + +    ++  RT   I+N+F++LE   L  +R      VY
Sbjct  185   RFRDLPSFCRVSDVTDRDLQVLKNVTQQSPRTHALILNTFEDLEEPILSHIRTK-CPKVY  243

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNG--LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
              IGPLH  L+ +L S  ++ ++  +   L E  + C++WL +QP  SVLYV FG++TL+ 
Sbjct  244   TIGPLHLQLKTRLASNVISSSSQKSLNSLWEVDRSCIEWLGKQPVRSVLYVSFGSITLLK  303

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E L EFWHGL++S QRFLW + P  V+ +    G+ P E++ G + R  +V W PQ+EV
Sbjct  304   REQLIEFWHGLVDSKQRFLWVIRPDSVIGE----GDAPAELVEGTKERGHLVSWVPQEEV  359

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH AV GFLTH GWNS +ESIVAGVPMI WP++ADQQ+NSRF+ EVW +GLDMKD CDR
Sbjct  360   LAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDR  419

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +++EKMV DLM  RK+EF++ A + A  A+  A EGG S  +L+ LI+DIK M
Sbjct  420   NVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDIKMM  472



>ref|XP_006486448.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Citrus sinensis]
Length=476

 Score =   431 bits (1108),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 223/473 (47%), Positives = 307/473 (65%), Gaps = 20/473 (4%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P  SH++SML LA++  L+ LKVTF+ + H    L+ ++D+  RF  YS F+F+TI 
Sbjct  13    FPLPCQSHVNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHDRFLQYSEFQFKTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  +G  ++++  SLS   +P LK++++ +    S P  CII D    F 
Sbjct  73    DGLPA----DHPRAGDRLMEIFDSLSLNTRPLLKQMLIDT----SPPVSCIIGDACMEFV  124

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG--KDMDEPILSVKGMEKLL  677
             VDVA E+ +P+I F  +SA + WAYFSIP +IQAGELP     +DMD  I  V GME  L
Sbjct  125   VDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETFL  184

Query  678   RRRDLPGNCRVDDLEDPFFKFMMEF-RKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R RDLP  CRV D+ D   + +    ++  RT   I+N+F++LE   L  +R      VY
Sbjct  185   RFRDLPSFCRVSDVTDRDLQVLKNVTQQSPRTHALILNTFEDLEEPILSHIRTK-CPKVY  243

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNG--LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
              IGPLH  L+ +L S  ++ ++  +   L E  + C++WL +QP  SVLYV FG++TL+ 
Sbjct  244   TIGPLHLQLKTRLASNVISSSSQKSLNSLWEVDRSCIEWLGKQPVRSVLYVSFGSITLLK  303

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E L EFWHGL++S QRFLW + P  V+ +    G+ P E++ G + R  +V W PQ+EV
Sbjct  304   REQLIEFWHGLVDSKQRFLWVIRPDSVIGE----GDAPAELVEGTKERGHLVSWVPQEEV  359

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH AV GFLTH GWNS +ESIVAGVPMI WP++ADQQ+NSRF+ EVW +GLDMKD CDR
Sbjct  360   LAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDR  419

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +++EKMV DLM  RK+EF++ A + A  A+  A EGG S  +L+ LI+DIK M
Sbjct  420   NVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDIKMM  472



>ref|XP_009589440.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=488

 Score =   430 bits (1106),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 222/468 (47%), Positives = 303/468 (65%), Gaps = 9/468 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  S I+SML+LA+L CL+ L+VTF+ T H +  LL  ++V SRFR Y  FRF TI DGL
Sbjct  14    PIQSPINSMLHLAELFCLAGLQVTFLNTNHNQKLLLRHTNVESRFRQYPRFRFRTISDGL  73

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG--GEDSAPQRCIIADGFANFAV  506
             P    +++  S V   +L+ SL A A+PFL+EI+++S   G    P  C+I DG   +AV
Sbjct  74    P----EENPRSSVQFGELISSLQAVAEPFLREILLSSSSDGVTEPPVTCVIPDGLFYYAV  129

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
             D+  E+GVP+I F  +S    W Y  IP LIQA E+PF G D+D    +V GM+ LLRRR
Sbjct  130   DIGNEIGVPVIPFDTISPCCLWVYLCIPKLIQAEEIPFKGNDLDALFENVAGMQGLLRRR  189

Query  687   DLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             D P    +D   DP+ +  + E     R+   I+N+F++L+G  L  +R       YAIG
Sbjct  190   DFPFYRLIDYATDPYCQIALKEVESIPRSNGLILNTFEDLDGPLLSLIR-SHCQQTYAIG  248

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
             PLH  L+ KL    + ++ SSN L E+    + WLD QP  SV+YV FG++  +S+E + 
Sbjct  249   PLHLHLKTKLAEKRMPISASSNSLWEEDHSSIQWLDAQPIESVIYVSFGSMATLSKEEIL  308

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EFWHGL+NSG RFLW +   L+  ++     V  E+  G   R  +V WAPQ++VLAHSA
Sbjct  309   EFWHGLVNSGIRFLWVMRSNLLRGEESNHQFV-KELAEGCIERAYIVSWAPQEKVLAHSA  367

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             +GGFLTH GWNS MESIV G PMI W  Y DQ+V SRF+GEVWKIG+DMKD CDR+IIEK
Sbjct  368   IGGFLTHSGWNSTMESIVQGKPMICWAVYVDQRVTSRFVGEVWKIGVDMKDICDRYIIEK  427

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             MV+DLM   +DEF + A++ +N AKE   +GGSS ++L+ L++D+K++
Sbjct  428   MVKDLMVTNRDEFKKSAEKLSNLAKESVGDGGSSYNALQCLVDDVKKL  475



>gb|AIS39472.1| flavonoid UDP-glucosyltransferase 3 [Citrus x paradisi]
Length=476

 Score =   429 bits (1104),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 222/473 (47%), Positives = 306/473 (65%), Gaps = 20/473 (4%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P  SH++SML LA++  L+ LKVTF+ + H    L+ ++D+  RF  YS F+F+TI 
Sbjct  13    FPLPCQSHVNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHDRFLQYSEFQFKTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  +G  ++++  SLS   +P LK++++ +    S P  CII D    F 
Sbjct  73    DGLPA----DHPRAGDRLMEIFDSLSLNTRPLLKQMLIDT----SPPVSCIIGDACMEFV  124

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG--KDMDEPILSVKGMEKLL  677
             VDVA E+ +P+I F  +SA + WAYFSIP +IQAGELP     +DMD  I  V GME  L
Sbjct  125   VDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETFL  184

Query  678   RRRDLPGNCRVDDLEDPFFKFMMEF-RKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R RDLP  CRV D+ D   + +    ++  RT   I+N+F++LE   L  +R      VY
Sbjct  185   RFRDLPSFCRVSDVTDRDLQVLKNVTQQSPRTHALILNTFEDLEEPILSHIRTK-CPKVY  243

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNG--LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
              IGPLH  L+ +L S  ++ ++  +   L E  + C++W  +QP  SVLYV FG++TL+ 
Sbjct  244   TIGPLHLQLKTRLASNVISSSSQKSLNSLWEVDRSCIEWFGKQPVRSVLYVSFGSITLLK  303

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E L EFWHGL++S QRFLW + P  V+ +    G+ P E++ G + R  +V W PQ+EV
Sbjct  304   REQLIEFWHGLVDSKQRFLWVIRPDSVIGE----GDAPAELVEGTKERGHLVSWVPQEEV  359

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH AV GFLTH GWNS +ESIVAGVPMI WP++ADQQ+NSRF+ EVW +GLDMKD CDR
Sbjct  360   LAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDR  419

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +++EKMV DLM  RK+EF++ A + A  A+  A EGG S  +L+ LI+DIK M
Sbjct  420   NVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDIKMM  472



>gb|KDP44850.1| hypothetical protein JCGZ_01350 [Jatropha curcas]
Length=490

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 222/474 (47%), Positives = 311/474 (66%), Gaps = 22/474 (5%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LA+LL LS L +TF+ T H++  L  F+D+ +RF  Y GFRF T+P
Sbjct  15    FPFPAQGHVNSMLKLAELLSLSGLTITFLNTQHSQECLARFTDIKARFLKYPGFRFVTVP  74

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQ-RCIIADGFANF  500
             D LP         SG  + ++L +L   +KP ++++++     +S P+  C I DG   F
Sbjct  75    DSLP-------IDSG-NVAKVLDALKLESKPVIEKLLI-----ESNPRINCFIVDGILGF  121

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD-MDEPILSVKGMEKLL  677
               D+A E+ +PII F  +SA A W+YF IP +I+AGELP  G++ MD  I  V GME  L
Sbjct  122   VTDLASELAIPIIYFRTISACAFWSYFCIPDMIEAGELPIKGEEEMDRLITKVPGMETFL  181

Query  678   RRRDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R+RDLP  CR + + +P F+  M E ++  R +  I+N+F++LE   L Q+R       Y
Sbjct  182   RKRDLPSFCRANGMTEPTFYMIMNETQQTTRAQALIMNTFEDLESPILSQIR-NHCPKTY  240

Query  855   AIGPLHELLRN-KLGSCNVT-LTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
              IGPLHELL++ K+ S N   L  SSN L E  + C+ WLD QP  SV+YV FG+   ++
Sbjct  241   TIGPLHELLKSIKIRSTNKQELHQSSNSLWEVDRTCIAWLDNQPSQSVIYVSFGSFANLT  300

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKK-VERGEVPTEILNGLEGRCCVVEWAPQQE  1205
              + L EFWHGL+NS +RFLW + P  V +K+ +   + P E+  G +    +V+WAPQ+E
Sbjct  301   LDQLIEFWHGLINSNRRFLWVIRPSSVTDKEGIVVEKFPEELQEGCKENGYIVKWAPQEE  360

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VLAH A+GGFLTH GWNS +ESIVAGVPMI WP++ADQQ NSRF+ EVWK+GLDMKD C+
Sbjct  361   VLAHKAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQQTNSRFVSEVWKLGLDMKDVCN  420

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R ++EKMV DLM  +++EF++ A + A  A++   EGGSS  +L  LIEDI+ M
Sbjct  421   RKVVEKMVNDLMVNKREEFVRSAARMAELARKSISEGGSSFCNLNRLIEDIRLM  474



>ref|XP_006355679.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=482

 Score =   429 bits (1102),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 215/472 (46%), Positives = 299/472 (63%), Gaps = 17/472 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++SM  LA+LLC S L +T + T +  N L+  +D+ SRF    GF+ +TI DGL
Sbjct  17    PLQGPVNSMFKLAELLCFSGLHITILLTENIHNRLVLHTDITSRFDQCPGFQIKTISDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS------GGEDSAPQRCIIADGFA  494
             P    DDH   G   +++  SL    K   K+++ +        G++     CIIADG  
Sbjct  77    P----DDHPRDGGKFMEVFESLRTKTKTLFKDMLTSDLLCFDLDGKERRRVSCIIADGIL  132

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
              F  DVA+E+ VPI     +S    W +F +P LI++GE PF   ++DEP+ SV G E  
Sbjct  133   GFTCDVADEISVPIFCVRTISPCCLWIFFCLPKLIESGEYPFKDDNLDEPLKSVPGTETF  192

Query  675   LRRRDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             LRRRDLP  CR  DL D + + +  E ++  R    I+N+F+EL+   L+Q+R     N+
Sbjct  193   LRRRDLPSFCRSGDLTDSYIQLLKTEGQENSRAHGLILNTFEELDEPILNQLRTI-CPNL  251

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y IGPLH  L+ K      TL  SSN L  + + C+DWL+ Q PNSV+YV FG++  ++ 
Sbjct  252   YPIGPLHAHLKKK----QTTLQPSSNSLWAEDRTCIDWLNDQLPNSVIYVSFGSIATMTN  307

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVL  1211
             + L EFW+GL+NSGQ+FLW + P  +  ++  R ++P ++  G + R  +VEWAPQ+EVL
Sbjct  308   DQLIEFWYGLVNSGQKFLWVIRPDSIAGEEW-RSKIPVDLATGTKERGYIVEWAPQEEVL  366

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
             AH AVGGF THCGWNSI+ES+  G PMI WP++ DQQVNSRF+ +VW IGLDMKDTCDR 
Sbjct  367   AHPAVGGFWTHCGWNSILESVYEGKPMICWPYFYDQQVNSRFVEKVWGIGLDMKDTCDRE  426

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             I+EKMV+DLM +RK+EFL+RA   +  AK C  EGGSS S+ + L++DIK +
Sbjct  427   IVEKMVKDLMVLRKEEFLERANHMSKLAKNCLMEGGSSYSNFDRLVKDIKSL  478



>ref|XP_004239922.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=487

 Score =   428 bits (1101),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 220/472 (47%), Positives = 298/472 (63%), Gaps = 17/472 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++SM  LA+LLC S L +T + T +  N L+  +D+ SRF    GF+ +TI DGL
Sbjct  17    PLQGPVNSMFKLAELLCFSGLHITILLTENIHNRLVLHTDISSRFDQCPGFQIKTISDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG------GEDSAPQRCIIADGFA  494
             P    DDH   G   +++  SL    K   K+++ +        G+      CIIADG  
Sbjct  77    P----DDHPRDGGKFLEVFDSLRTKTKTLFKDMLTSDSLCVDVDGKVRGRVSCIIADGVL  132

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
              F  DVA+EV VPI     +S+   W +F +P LI++GE PF   ++DEPI SV G E  
Sbjct  133   GFTCDVADEVNVPIFCVRTISSCCLWIFFCLPELIESGEYPFKDDNLDEPIKSVPGTETF  192

Query  675   LRRRDLPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             LRRRDLP  CR  DL DP  + F  E R+  R    I+N+F+EL+   L+QMR     N+
Sbjct  193   LRRRDLPEFCRSGDLTDPNIQLFKTEGRENSRAYGLILNTFEELDQPILNQMRTI-CPNL  251

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y IGPLH  L+ K      TL +SSN L  + + C+DWLD Q PNSV+YV FG++  ++ 
Sbjct  252   YPIGPLHAHLKKK----QTTLRSSSNSLWAEDRTCIDWLDDQLPNSVIYVSFGSIATMTN  307

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVL  1211
             + L EFW+GL+NS Q FLW + P  + +++  R ++P +++ G + R  +VEWAPQ+EVL
Sbjct  308   DQLIEFWYGLVNSKQNFLWVIRPNSIGDEEW-RSKMPVDLVKGTKERGYIVEWAPQEEVL  366

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
             AH AVGGF THCGWNSI+ES+  G PMI WP++ DQQVNSRF+ +VW +GLDMKDTCDR 
Sbjct  367   AHPAVGGFWTHCGWNSILESVYEGKPMICWPYFFDQQVNSRFVEKVWGLGLDMKDTCDRE  426

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             I+EKMV+DLM +RK EFL RA   +  AK C  EGGSS S+ + L++DIK +
Sbjct  427   IVEKMVKDLMVLRKQEFLGRANHMSKLAKNCLMEGGSSYSNFDRLVKDIKSL  478



>ref|XP_010674283.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   427 bits (1098),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 221/474 (47%), Positives = 305/474 (64%), Gaps = 17/474 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI  MLNLA+LLCL++LKVTF+ T      L   +++ +RF  Y GF F  +PDGL
Sbjct  16    PIQGHITPMLNLAELLCLANLKVTFLNTTQNHKLLTRNTNIEARFARYPGFVFSIVPDGL  75

Query  333   PHGLTDDHRSSGVGIV-----QLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFAN  497
                  D+H  +GV        +L+  L+ + +P L+E++V S G D     C+I DG+ +
Sbjct  76    ----ADEHPRAGVSKFKDWSSELVEKLALSGEPLLREMLVGSTGIDKV--TCLIIDGWIS  129

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             FA +VA EV VP+I+F   S    W YF IP LIQAG++PF  + MDE + S  GM+  L
Sbjct  130   FANEVANEVEVPVIAFRCSSPCYMWTYFCIPKLIQAGDIPFKDEAMDELVKSSPGMDSFL  189

Query  678   RRRDLPGNCRVDDL---EDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
             R RDLP  CR  D    +D    F  E ++  +    I+N+F++LE  TL  +R  +   
Sbjct  190   RYRDLPSFCRNQDTSSCQDLLHLFNGEIQRNKQAHAFILNTFEDLEDPTLSLIR-SECSK  248

Query  849   VYAIGPLHELLRNKLGSCNVTL-TTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
             VY++GPLH  L+ KL     TL   SS+ L E  + C+ WLD++P  SV+YV FG+LT++
Sbjct  249   VYSLGPLHAHLKYKLSQKETTLCNNSSSNLWEVDQSCISWLDQKPNKSVVYVSFGSLTIL  308

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQE  1205
             +++ L EFW GL++S + FLW + P L++  +++    P ++L G + R C+V+WAPQQE
Sbjct  309   TKDQLREFWAGLVHSKKYFLWVIRPNLIIGSELD-NPTPDDLLEGTKKRGCLVKWAPQQE  367

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VLAH A+GGFLTH GWNS +ESIVAGVPM+ WP++ADQQVNSRF+ EVW+IGLDMKD CD
Sbjct  368   VLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWPYFADQQVNSRFVSEVWRIGLDMKDVCD  427

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R I+EKM+ DLM+V+KDE  +   + +  AK    EGGSS S+   LIEDIK M
Sbjct  428   RTIVEKMINDLMDVKKDELQRSMDKISQLAKTSISEGGSSYSNFNQLIEDIKAM  481



>ref|XP_006355680.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=482

 Score =   426 bits (1095),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 215/472 (46%), Positives = 298/472 (63%), Gaps = 17/472 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++SM  LA+LLC S L +T + T +  N L+  +D+ SRF    GF+ +TI DGL
Sbjct  17    PLQGPVNSMFKLAELLCFSGLHITILLTENIHNRLVLHTDITSRFDQCPGFQIKTISDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS------GGEDSAPQRCIIADGFA  494
             P    DDH   G   +++  SL    K   K+++ +        G++     CIIADG  
Sbjct  77    P----DDHPRDGGKFIEVFDSLRTKTKTLFKDMLTSDMLCFDLDGKERRRVSCIIADGVW  132

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
              F  DVA+E+ VPI     +S    W +F +P LI++GE PF   ++DEP+ SV G E  
Sbjct  133   GFTCDVADEISVPIFCVRTISPCCLWIFFCLPKLIESGEYPFEDDNLDEPLKSVPGTETF  192

Query  675   LRRRDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             LRRRDLP  CR  DL D + + +  E ++  R    I+N+F+EL+   L+Q+R     N+
Sbjct  193   LRRRDLPSFCRSGDLTDSYIQLLKTEGQENSRAHGLILNTFEELDEPILNQLRTI-CPNL  251

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y IGPLH  L+ K      TL  SSN L  + + C+DWL+ Q PNSV+YV FG++  ++ 
Sbjct  252   YPIGPLHAHLKKK----QTTLRPSSNSLWAEDRTCIDWLNDQLPNSVIYVSFGSIATMTN  307

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVL  1211
             + L EFW+GL+NSGQ+FLW + P  +  ++  R ++P ++  G + R  +VEWAPQ+EVL
Sbjct  308   DQLIEFWYGLVNSGQKFLWVIRPDSIAGEEW-RSKIPVDLATGTKERGYIVEWAPQEEVL  366

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
             AH AVGGF THCGWNSI+ES+  G PMI WP++ DQQVNSRF+ +VW IGLDMKDTCDR 
Sbjct  367   AHPAVGGFWTHCGWNSILESVYEGKPMICWPYFFDQQVNSRFVEKVWGIGLDMKDTCDRE  426

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             I+EKMV+DLM +RK+EFL RA   +  AK C  EGGSS S+ + L++DIK +
Sbjct  427   IVEKMVKDLMVLRKEEFLGRANHMSKLAKNCLMEGGSSYSNFDRLVKDIKSL  478



>gb|KDO69251.1| hypothetical protein CISIN_1g011832mg [Citrus sinensis]
Length=476

 Score =   424 bits (1091),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 220/473 (47%), Positives = 304/473 (64%), Gaps = 20/473 (4%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P  SH++SML LA++  L+ LKVTF+ + H    L+ ++D+  RF  YS F+F+TI 
Sbjct  13    FPLPCQSHMNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHDRFLQYSEFQFKTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  +G  ++++  SLS   +P LK++++ +    S P  CII D    F 
Sbjct  73    DGLPA----DHPRAGDQLMEMFDSLSLNTRPLLKQMLIDT----SPPVSCIIGDACMEFV  124

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG--KDMDEPILSVKGMEKLL  677
             VDVA E+ +P+I F  +SA + WAYFSIP +IQAGELP     +DMD  I  V GME  L
Sbjct  125   VDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETFL  184

Query  678   RRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R RDLP  CRV D+ D   + +    ++  R    I+N+F++LE   L  +R      VY
Sbjct  185   RFRDLPSFCRVSDVTDRDLQVLKNATQQSPRAHALILNTFEDLEEPILSHIRTK-CPKVY  243

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNG--LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
              IGPLH  L+ +  S  ++ ++  +   L E  + C++WL +QP  SVLYV FG++TL+ 
Sbjct  244   TIGPLHLQLKTRFASNMISSSSQKSLNSLWEVDRSCIEWLGKQPVRSVLYVSFGSITLLK  303

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E L EFWHGL++S QRFLW + P  V+ +    G+   E++ G + R  +V W PQ+EV
Sbjct  304   REQLIEFWHGLVDSKQRFLWVIRPDSVIGE----GDALAELVEGTKERGLLVSWVPQEEV  359

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH AV GFLTH GWNS +ESIVAGVPMI WP++ADQQ+NSRF+ EVW +GLDMKD CDR
Sbjct  360   LAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDR  419

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +++EKMV DLM  RK+EF++ A + A  A+  A EGG S  +L+ LI+DIK M
Sbjct  420   NVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDIKMM  472



>ref|XP_006367215.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=472

 Score =   424 bits (1089),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/467 (44%), Positives = 301/467 (64%), Gaps = 10/467 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCL-SHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             P    ++ ML LA+LLCL   + +TFI T +    L+ +++V+ RF  Y  F+F T+PDG
Sbjct  12    PLQGPVNCMLKLAELLCLHQEIHITFINTEYIHQRLMNYTNVLVRFEKYPNFKFVTVPDG  71

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVD  509
             LP    +D+  +G  + +++  +   + P  +E+V+ S     AP  C+I DG   FAVD
Sbjct  72    LP----EDNLRNGEQVEKIIEGVEKVSSPLFREMVMMS--TTCAPT-CLIVDGIFTFAVD  124

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRD  689
             +A+E  +P++ F  +S  + W Y ++P LI+ GE+PF G D+D  +  V GME ++RRRD
Sbjct  125   IAKEAKIPLLYFDTISPCSLWTYLAVPKLIEDGEIPFKGNDLDVLVNGVAGMEGVMRRRD  184

Query  690   LPGNCRVDDLEDPFFKFMMEFRK-CFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGP  866
             LP  CR  D++ P  K +++  K   + +  I N+F++LEG  L Q R     N+YAIGP
Sbjct  185   LPSFCRTPDIDIPVIKLVIKQGKHIVQAQGLIFNTFEDLEGPILSQFR-ALCPNIYAIGP  243

Query  867   LHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAE  1046
             LH  ++ KL S  +  T +SN + ++   C+DWLD+QP  SV++V  G+L  +S+    E
Sbjct  244   LHTQMKAKLSSQYLPNTPTSNSIWKEDMSCIDWLDKQPNKSVIFVSIGSLATMSKAQFLE  303

Query  1047  FWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAV  1226
             FW+GL+NS  RFLW   P  ++  + +   VP E++   + R C++ WAPQ+EVLAH ++
Sbjct  304   FWYGLVNSKTRFLWVQRPGSIIGLEDDNNNVPMELVKSTKERGCIISWAPQEEVLAHPSI  363

Query  1227  GGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKM  1406
             GGFLTH GWNS +ESIV GVPMI  P++ DQQVNSR++GEVWK+GLDMKD CDR  IE+M
Sbjct  364   GGFLTHSGWNSTLESIVEGVPMICVPYFVDQQVNSRYVGEVWKLGLDMKDVCDRATIERM  423

Query  1407  VRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             VRD+M+V+K EFL+RAK  ++ A     EGGSS   L+ LIEDI+ M
Sbjct  424   VRDVMDVKKIEFLERAKHMSDLAIASVGEGGSSYQDLDRLIEDIRLM  470



>ref|XP_006435572.1| hypothetical protein CICLE_v10031404mg [Citrus clementina]
 ref|XP_006486449.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
 gb|ESR48812.1| hypothetical protein CICLE_v10031404mg [Citrus clementina]
Length=476

 Score =   423 bits (1088),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 223/470 (47%), Positives = 306/470 (65%), Gaps = 18/470 (4%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFS-DVISRFRCYSGFRFETIP  323
             P P+  H++SMLNLA+LL  + +K+TF+ T H  + ++  S D  SR+    GF+F+T+ 
Sbjct  13    PLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPGFQFKTLT  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  +     +L+ SL+    P LKE+V  S     +P  CII DG+ + A
Sbjct  73    DGLPR----DHPRTPDKFPELVDSLNCATPPLLKEMVSDS----KSPVNCIITDGYMSRA  124

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLR  680
             +D A EVGV II F  +SA A W++  IP +I AGELP  G +DMD  I +V GME  LR
Sbjct  125   IDAAREVGVSIIYFRTISACAFWSFHCIPDIIDAGELPIKGTEDMDRLITTVPGMEGFLR  184

Query  681   RRDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
              RDLP  CRV+D  DP    F  E R        I+N+F++LEG  L Q+R     N+Y+
Sbjct  185   CRDLPSFCRVNDPMDPHLLLFARETRLSAHADGLILNTFEDLEGPILSQIRNHSCPNIYS  244

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IGPL+  L+ ++       T SS+ L +  + CM WLD+QP  SV+YV FG++ ++S + 
Sbjct  245   IGPLNAHLKVRIPE----KTYSSSSLWKIDRSCMAWLDKQPKQSVIYVSFGSIAVMSRDQ  300

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L EF++GL++S + FLW + P L+  K  E  ++P E+L   + R C+  W PQ+EVLAH
Sbjct  301   LIEFYYGLVHSKKNFLWVIRPDLISGKDGE-NQIPEELLEATKERGCIAGWVPQEEVLAH  359

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
             SAVGGFLTHCGWNS +ESIVAG+PMI WP +ADQQ+NSRF+GEVWK+GLD+KD CDR+I+
Sbjct  360   SAVGGFLTHCGWNSTLESIVAGMPMICWPSFADQQINSRFVGEVWKLGLDIKDLCDRNIV  419

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             EK V DLM  RK+EF++ A + AN AK+   +GGSS  +L+ L+ DIK M
Sbjct  420   EKTVNDLMVERKEEFMESADRMANLAKKSVNKGGSSYCNLDRLVNDIKMM  469



>ref|XP_010262684.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   424 bits (1089),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 226/470 (48%), Positives = 308/470 (66%), Gaps = 12/470 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDV-ISRFRCYSGFRFETIPDG  329
             P   HI+ M+ L++LL L+   VTF+T+ H    LL F+++  SRF    GF F TIPDG
Sbjct  16    PVQGHINPMIKLSELLSLAGFHVTFLTSEHIHRRLLRFTNLNSSRFARCPGFHFATIPDG  75

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS--GGEDSAPQRCIIADGFANFA  503
             LP     DH  SG  +V+L  SL  T+ P L+E++V++  G +   P  CIIADG  +F 
Sbjct  76    LPF----DHPRSGPQLVELFDSLKLTSIPLLREMLVSNRWGSDVRPPVTCIIADGLLSFT  131

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLR  680
             +DVAEE+ +PIISF   SA + WAYF IP L++AGELPF G  DMD P+  V GME  LR
Sbjct  132   IDVAEELNIPIISFRTTSACSFWAYFCIPKLVEAGELPFGGDADMDCPVTCVPGMESFLR  191

Query  681   RRDLPGNCRVDDL-EDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
             RRDLP  CR ++L E PF   + E     R    I+N++++LEG  L ++R      +Y 
Sbjct  192   RRDLPSFCRTNNLGERPFQFLVTENLNATRASALILNTYEDLEGPILSRIR-SHCPKLYT  250

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IGPLH LL+++L   +    +SS+ L E+ K C+ WLD +   SV+YV FG+L  ++ + 
Sbjct  251   IGPLHALLKSQLAD-SSHSVSSSSSLWEENKSCITWLDSKALRSVVYVSFGSLATMTRDE  309

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             + EFWHGL+NSG+ FLW +   L+  K+ E  E+ TE++ G   R  +V WAPQ+EVLAH
Sbjct  310   VLEFWHGLVNSGKPFLWVIRSDLLSVKEGE-DEILTELVKGTRERGYIVGWAPQEEVLAH  368

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              AVGGFLTH GWNS +ES+ AGVPMI WP  ADQQVNSRF+ E+W++GLDMKDTCDR  +
Sbjct  369   PAVGGFLTHSGWNSTLESVYAGVPMICWPKLADQQVNSRFVSEMWRLGLDMKDTCDRLKV  428

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             E MV+++ME ++DE ++ A+  A  A+    EGGSS  + + LI+DIK M
Sbjct  429   ELMVKEVMEQKRDEMMKSAENMAKLARMSVSEGGSSSCNFDKLIQDIKSM  478



>gb|KDO69253.1| hypothetical protein CISIN_1g011848mg [Citrus sinensis]
Length=476

 Score =   423 bits (1087),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 223/470 (47%), Positives = 306/470 (65%), Gaps = 18/470 (4%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFS-DVISRFRCYSGFRFETIP  323
             P P+  H++SMLNLA+LL  + +K+TF+ T H  + ++  S D  SR+    GF+F+T+ 
Sbjct  13    PLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPGFQFKTLT  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  +     +L+ SL+    P LKE+V  S     +P  CII DG+ + A
Sbjct  73    DGLPR----DHPRTPDKFPELVDSLNCATPPLLKEMVSDS----KSPVNCIITDGYMSRA  124

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLR  680
             +D A EVGV II F  +SA A W++  IP +I AGELP  G +DMD  I +V GME  LR
Sbjct  125   IDAAREVGVSIIYFRTISACAFWSFHCIPDIIDAGELPIKGTEDMDRLITTVPGMEGFLR  184

Query  681   RRDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
              RDLP  CRV+D  DP    F  E R        I+N+F++LEG  L Q+R     N+Y+
Sbjct  185   CRDLPSFCRVNDPMDPHLLLFARETRLSAHADGLILNTFEDLEGPILSQIRNHSCPNIYS  244

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IGPL+  L+ ++       T SS+ L +  + CM WLD+QP  SV+YV FG++ ++S + 
Sbjct  245   IGPLNAHLKVRIPE----KTYSSSSLWKIDRSCMAWLDKQPKQSVIYVSFGSIAVMSRDQ  300

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L EF++GL++S + FLW + P L+  K  E  ++P E+L   + R C+  W PQ+EVLAH
Sbjct  301   LIEFYYGLVHSKKSFLWVIRPDLISGKDGE-NQIPEELLEATKERGCIAGWVPQEEVLAH  359

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
             SAVGGFLTHCGWNS +ESIVAG+PMI WP +ADQQ+NSRF+GEVWK+GLD+KD CDR+I+
Sbjct  360   SAVGGFLTHCGWNSTLESIVAGMPMICWPSFADQQINSRFVGEVWKLGLDIKDLCDRNIV  419

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             EK V DLM  RK+EF++ A + AN AK+   +GGSS  +L+ L+ DIK M
Sbjct  420   EKAVNDLMVERKEEFMESADRMANLAKKSVNKGGSSYCNLDRLVNDIKMM  469



>ref|XP_006367216.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=474

 Score =   421 bits (1082),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 202/467 (43%), Positives = 298/467 (64%), Gaps = 8/467 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCL-SHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             P    ++ ML LA+LLCL   + +TFI T +    L+ ++DV+ RF  Y  F+F T+PDG
Sbjct  12    PLQGTVNCMLKLAELLCLHQEIHITFINTEYIHQRLMNYTDVLVRFEKYPNFKFVTVPDG  71

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVD  509
             LP    +D+  +G  I +++  +   + P  +E+V+ +      P  C+I DG  +FAVD
Sbjct  72    LP----EDNPRNGDQIGKIIEGVEKVSSPLFREMVMMTTTNYCTPT-CLIVDGIFSFAVD  126

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRD  689
             +A+E  +P++ F  +S  + W Y ++P LI+ GE+PF G D+D  +  V GME ++RRRD
Sbjct  127   IAKEAKIPLLYFDTISPCSLWTYLAVPKLIEDGEIPFKGNDLDALVNGVAGMEGVMRRRD  186

Query  690   LPGNCRVDDLEDPFFKFMMEFRK-CFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGP  866
             LP  CR  DL+ P  K +++  K   + +  I N+F++LEG  L Q R     N+YAIGP
Sbjct  187   LPSFCRTPDLDIPIIKLVIKQGKHIVQAQGLIFNTFEDLEGPILSQFR-ALCPNIYAIGP  245

Query  867   LHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAE  1046
             LH  ++  L S  +  T +SN + ++   C+DWL++QP  SVL+V  G+L  +S+    E
Sbjct  246   LHTQMKANLSSQYLPNTPTSNSIWKEDMSCIDWLNKQPNKSVLFVSIGSLATMSKAQFLE  305

Query  1047  FWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAV  1226
             FW+GL+NS  RFLW   P  ++  + +   VP E++   + R C++ WAPQ++VLAH ++
Sbjct  306   FWYGLVNSKTRFLWVQRPGSIIGLEDDNNNVPMELVKSTKERGCIISWAPQEKVLAHPSI  365

Query  1227  GGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKM  1406
             GGFLTH GWNS +ESIV GVPMI WP++ DQQVNSR++GEVWK+G+DMKD CDR  IE+M
Sbjct  366   GGFLTHSGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGIDMKDVCDRATIERM  425

Query  1407  VRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             V  +M+V K EFL++AK  ++ A     EGGSS   L+ LIEDI+ M
Sbjct  426   VIQVMDVEKIEFLEKAKHMSDLAIASVGEGGSSYQDLDRLIEDIRLM  472



>ref|XP_011076757.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=489

 Score =   421 bits (1082),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 212/471 (45%), Positives = 293/471 (62%), Gaps = 11/471 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++ ML LA+LLCL  ++VTF+ T+H +  L   +     F+ YS FRF+T+PDGL
Sbjct  17    PLQGPVNCMLKLAELLCLGQIQVTFLNTLHIQERLRNCTGAEVYFKRYSNFRFDTVPDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS--GGEDSAPQRCIIADGFANFAV  506
             P    +++  +   I  LL S+ A A P  + +V +   G     P  CIIADG   FA 
Sbjct  77    P----EENPRTADEIWNLLQSIDAVAVPIFRCMVTSGVYGPGSENPVTCIIADGIFTFAA  132

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
              +A E+GVP++ F  +S    W Y  +P LI+AGE PF   ++DE I +  GME ++RRR
Sbjct  133   GIAGEIGVPLLYFDTISPCGLWTYLCLPKLIEAGEFPFKDDNLDEIIRNAPGMEGIIRRR  192

Query  687   DLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHII-NSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLP   R +D+     + +++  K       +I N+F+ELE   L QM +    N+YA+G
Sbjct  193   DLPSFYRTNDVNHVTIQLVLKEDKHIPLAQGLIFNTFEELEAPILSQM-LNVCPNIYAVG  251

Query  864   PLHELLRNKLGS---CNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
             PLH  L+ +L +        T +SN +  +   C+ WLD QP  SV+YV  G+L +++++
Sbjct  252   PLHAHLKTRLAAETGPEAQPTITSNSIWREDSSCISWLDTQPSKSVIYVSIGSLAVITKD  311

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              L E WHGL+NSG RFLW   P  V     E  E+P+E+  G + R  +V WAPQ EVL 
Sbjct  312   QLFEIWHGLVNSGSRFLWVRRPGSVTGLDSETEEIPSELSRGTKERGYIVTWAPQDEVLG  371

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H A+GGFLTH GWNS +ESIV G PMI WP++ DQQVNSR++GEVWK+GLDMKDTCDR +
Sbjct  372   HPAIGGFLTHSGWNSTLESIVEGKPMICWPYFVDQQVNSRYVGEVWKLGLDMKDTCDRVV  431

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKM+R+LME RK+EFL+RA + A  AK    EGGSS + L+ LI+DIK M
Sbjct  432   VEKMIRELMESRKNEFLERADEMAKLAKASVSEGGSSYADLDRLIDDIKFM  482



>emb|CBI31575.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   420 bits (1079),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 217/471 (46%), Positives = 303/471 (64%), Gaps = 32/471 (7%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LA+LL ++ L VTF+ + + ++ LL  +D+ +RF  Y GFRF+TI 
Sbjct  13    FPFPAQGHVNSMLKLAELLSVAGLHVTFLNSEYNQHRLLLHTDIQTRFSGYPGFRFQTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG-GEDSAPQ-RCIIADGFAN  497
             DGL    T DH  +G  ++ L   L ATAKP  +E+V++ G G D+ P   CIIADG  +
Sbjct  73    DGL----TTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIMS  128

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             F +D+A EVG+PIISF  +SA + WAYFS   LI++GELP  G DMD+ + S+ GME  L
Sbjct  129   FTIDIANEVGIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQLVTSIPGMEGFL  188

Query  678   RRRDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R+RDLP   RV +L+D      M E ++  R    I+N+F++LEG  L Q+R      +Y
Sbjct  189   RKRDLPSLIRVSNLDDEGLLLVMKETQQTPRAHALILNTFEDLEGPILGQIR-NHCPKIY  247

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPLH  L+ +L S + T + SSN   ++ + C+ WLD QP  SV+YV FG+LT++S +
Sbjct  248   TIGPLHAHLKTRLASESTT-SQSSNSFRQEDRSCIAWLDHQPSKSVIYVSFGSLTVISRK  306

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              L EF HGL+NSG RFLW +    +  +  E  + P E++ G + R  +V+         
Sbjct  307   QLIEFCHGLVNSGSRFLWVIRTDSLAEEDGEH-QTPAELMEGAKERSYIVD---------  356

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
                        GWNS +ESI AGVPMI WP++ADQQ+NSRF+  VWK+G DMKDTCDR I
Sbjct  357   -----------GWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSDMKDTCDRLI  405

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKMVRDLME RKDE L+ A + A  A++C  EGGSS  +L +L+++I+ M
Sbjct  406   VEKMVRDLMEERKDELLKTADKMATRARKCVSEGGSSYCNLSSLVDEIRLM  456



>ref|XP_010318076.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=471

 Score =   419 bits (1076),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/467 (44%), Positives = 299/467 (64%), Gaps = 11/467 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCL-SHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             P    ++ ML LA+LLCL   +++TFI T +    L+ ++DV  RF  Y  F+F T+PDG
Sbjct  12    PLQGPVNCMLKLAELLCLDKEIQITFINTEYIHQRLMNYTDVEVRFGKYPNFKFVTVPDG  71

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVD  509
             LP    +D+   G  I  ++  +   + P  KE+V+T+   +SAP  C+I DG   FA+ 
Sbjct  72    LP----EDNPRIGDQIRLIIEGVEEVSSPLFKEMVMTT---NSAPT-CLIVDGIFTFALP  123

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRD  689
             +A+E  +P++ F  +S  + W Y ++P LI+ GE+PF G D+D  +  + GME ++RRRD
Sbjct  124   IAKEAKIPLLYFDTISPCSLWTYLALPKLIEDGEIPFKGNDLDVLVNGMPGMEGVMRRRD  183

Query  690   LPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGP  866
             LP  CR  D++ P  K ++ E +   + +  I N+F+ LEG  L Q R     N+YAIGP
Sbjct  184   LPSFCRTPDVDIPIIKHVIKEGKHIVQAQGLIFNTFEALEGPILSQFR-ALCPNIYAIGP  242

Query  867   LHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAE  1046
             LH  ++ KL S  +  T +SN + ++   C+DWLD+QP  SVL+V  G+L  +S+    E
Sbjct  243   LHTQMKAKLSSQRLPNTPTSNSIWKEDVSCIDWLDKQPNKSVLFVSIGSLATMSKAQFFE  302

Query  1047  FWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAV  1226
             FW+GL+NS  RFLW   P  ++  + +   VP E++   + R C++ WAPQ+EVLA  ++
Sbjct  303   FWYGLVNSDTRFLWVQRPGSIIGLEDDNNNVPMELVESTKERGCIISWAPQEEVLARPSI  362

Query  1227  GGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKM  1406
             G FLTH GWNS +ESIV GVPMI WP++ DQQVNSR++GEVWK+GLDMKD CDR  IE+M
Sbjct  363   GAFLTHSGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKDVCDRITIERM  422

Query  1407  VRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             VR++M+V+K EFL+RAK  ++ A     EGGSS   L+ LIEDI+ M
Sbjct  423   VREVMDVKKIEFLERAKYMSDLAIASVGEGGSSYQDLDRLIEDIRLM  469



>ref|XP_010674284.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   418 bits (1075),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 218/474 (46%), Positives = 303/474 (64%), Gaps = 17/474 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI  MLNLA+LLCL++LKVTF+ T      L   +++ +RF  Y GF F  +PDGL
Sbjct  16    PIQGHITPMLNLAELLCLANLKVTFLNTTQNHKLLTRNTNIEARFARYPGFVFSIVPDGL  75

Query  333   PHGLTDDHRSSGVGIV-----QLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFAN  497
                  D+H  +GV        +L+  L+ + +P L+E++V S G D     C+I DG+ +
Sbjct  76    ----ADEHPRAGVSKFKDWSSELVEKLALSGEPLLREMLVGSTGIDKV--TCLIIDGWIS  129

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             FA +VA EV VP+I+F   S    W YF IP LIQAG++PF    MDE + +  GM   L
Sbjct  130   FANEVANEVEVPVIAFRCSSPCYMWTYFCIPKLIQAGDIPFKDDKMDELVENAPGMSSFL  189

Query  678   RRRDLPGNCRVDDL---EDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
             R R LP  CR  D    +D     + E ++  +    I+N+F++LEG TL  +R      
Sbjct  190   RYRGLPTFCRNHDTSSCQDLKDWLIGEIQRNKQAHSFILNTFEDLEGPTLSLIR-SQCSR  248

Query  849   VYAIGPLHELLRNKLGSCNVTLTTS-SNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
             VY+IGPLH  L+ KL     TL+ + S+ L E  + C+ WLD++P  SV+YV FG+LT++
Sbjct  249   VYSIGPLHAHLKYKLDQQKTTLSNNFSSNLWEVDRSCISWLDQKPNKSVVYVSFGSLTVL  308

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQE  1205
             +++ L EFW GL+ S + FLW + P L++  +++    P ++L G E R C+V+WAPQ+E
Sbjct  309   TKDQLREFWAGLVQSNKYFLWVIRPNLIIGSELDNS-TPDDLLEGTEKRGCLVKWAPQKE  367

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VLAH A+GGFLTH GWNS +ESIVAGVPM+ WP++ADQQVNSRF+ EVW+IGLDMKDTCD
Sbjct  368   VLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWPYFADQQVNSRFVSEVWRIGLDMKDTCD  427

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R I+EKM+ DLM+ + DE  +   + +  AK+   EGGSS S+L  LIEDIK +
Sbjct  428   RTIVEKMINDLMDGKNDELQRSMDRMSYLAKKSISEGGSSYSNLNQLIEDIKAL  481



>gb|EYU19963.1| hypothetical protein MIMGU_mgv1a005336mg [Erythranthe guttata]
Length=488

 Score =   417 bits (1072),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/472 (44%), Positives = 298/472 (63%), Gaps = 13/472 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++ ML LA+L  L  ++ TF+ T H  + LL  +D  + F  Y   RF+T+PDGL
Sbjct  18    PLQGPVNCMLKLAELFSLRRIRTTFLNTHHIHHRLLDCTDNHTYFTRYPLLRFDTVPDGL  77

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG--GEDSA-PQRCIIADGFANFA  503
             P G    +  +G  I  LL+S+ A A P  +++V + G  G DS  P  CIIADG   FA
Sbjct  78    PEG----NPRTGDQIPNLLNSMDAVAVPIFRQMVTSGGPYGPDSENPVTCIIADGIFTFA  133

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              ++A E+GVP++ F  +S    W Y  +P LI+AGE+PF   ++DE I++  GME ++RR
Sbjct  134   AEIAAEIGVPLLYFDTISPCGLWTYLCLPKLIEAGEVPFKDDNLDEIIINAPGMEGIIRR  193

Query  684   RDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHII-NSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CR  DL D   + +++  K       +I N+FQELE   L Q+ +    N+YA+
Sbjct  194   RDLPSFCRTKDLNDRIIQLVLKEDKHIPLAQGLIFNTFQELESPILSQL-LNISPNIYAV  252

Query  861   GPLHELLRNKLGSCN---VTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             GPLH  L+ ++ S         TS+N + ++ K C+ WLD Q   SV++V  G+L ++++
Sbjct  253   GPLHAHLKARVESLTGPEFRPETSTNSIWKEDKSCISWLDAQASKSVIFVSIGSLAVMTK  312

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVL  1211
             E L E W+GL+NSG +FLW   P  V+    E  E+P E+  G + R  +V+WAPQ+EVL
Sbjct  313   EQLFEIWYGLVNSGSKFLWVRRPGSVIGADAEL-EIPLELSEGTKERGFIVKWAPQEEVL  371

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
              H A+GGFLTH GWNS +ESIV G PMI WP++ DQQVNSR++GEVWK+GLDMKDTCDR 
Sbjct  372   GHPAIGGFLTHSGWNSTLESIVEGKPMICWPYFVDQQVNSRYVGEVWKLGLDMKDTCDRA  431

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             ++EKM+R++M ++KDEFL+ A + A  AK    EGGSS    + L+ED+K M
Sbjct  432   VVEKMIREVMVLKKDEFLETAAKMAELAKSSVAEGGSSFLDFDRLVEDVKTM  483



>ref|XP_009589441.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=477

 Score =   416 bits (1070),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 218/468 (47%), Positives = 297/468 (63%), Gaps = 20/468 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  S I+SML+LA+L CL+ L+VTF+ T H +  LL  ++V SRFR Y  FRF TI DGL
Sbjct  14    PIQSPINSMLHLAELFCLAGLQVTFLNTNHNQKLLLRHTNVESRFRQYPRFRFRTISDGL  73

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG--GEDSAPQRCIIADGFANFAV  506
             P    +++  S V   +L+ SL A A+PFL+EI+++S   G    P  C+I DG   +AV
Sbjct  74    P----EENPRSSVQFGELISSLQAVAEPFLREILLSSSSDGVTEPPVTCVIPDGLFYYAV  129

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
             D+  E+GVP+I F  +S    W Y  IP LIQA E+PF             GM+ LLRRR
Sbjct  130   DIGNEIGVPVIPFDTISPCCLWVYLCIPKLIQAEEIPFKA-----------GMQGLLRRR  178

Query  687   DLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             D P    +D   DP+ +  + E     R+   I+N+F++L+G  L  +R       YAIG
Sbjct  179   DFPFYRLIDYATDPYCQIALKEVESIPRSNGLILNTFEDLDGPLLSLIR-SHCQQTYAIG  237

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
             PLH  L+ KL    + ++ SSN L E+    + WLD QP  SV+YV FG++  +S+E + 
Sbjct  238   PLHLHLKTKLAEKRMPISASSNSLWEEDHSSIQWLDAQPIESVIYVSFGSMATLSKEEIL  297

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EFWHGL+NSG RFLW +   L+  ++     V  E+  G   R  +V WAPQ++VLAHSA
Sbjct  298   EFWHGLVNSGIRFLWVMRSNLLRGEESNHQFV-KELAEGCIERAYIVSWAPQEKVLAHSA  356

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             +GGFLTH GWNS MESIV G PMI W  Y DQ+V SRF+GEVWKIG+DMKD CDR+IIEK
Sbjct  357   IGGFLTHSGWNSTMESIVQGKPMICWAVYVDQRVTSRFVGEVWKIGVDMKDICDRYIIEK  416

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             MV+DLM   +DEF + A++ +N AKE   +GGSS ++L+ L++D+K++
Sbjct  417   MVKDLMVTNRDEFKKSAEKLSNLAKESVGDGGSSYNALQCLVDDVKKL  464



>gb|EYU19961.1| hypothetical protein MIMGU_mgv1a005050mg [Erythranthe guttata]
Length=499

 Score =   416 bits (1069),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 215/479 (45%), Positives = 300/479 (63%), Gaps = 24/479 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI+SML LA+LLCLS + V+ + + ++ + L   + + SRF  Y GFR  T+ DGL
Sbjct  26    PMQGHINSMLKLAELLCLSDIHVSMLISDYSHSRLRRHASIESRFSRYPGFRVATMTDGL  85

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGG-EDSAPQR---CIIADGFANF  500
             P    DDH  +G   + ++ SL        + ++ T+    D   +R   C+I DG  +F
Sbjct  86    P----DDHPRAGERSMDIVMSLVRVGGTEFRRVMETTDALSDGGARRRVSCLIMDGVFSF  141

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDE-----------PI  647
             AV V EE+G+P + F  +SA A WA F    +I+AGE+P  GKD D+           P+
Sbjct  142   AVPVVEEMGIPFLYFRTISACAFWANFCFKEVIEAGEIPLKGKDEDKYAYWKREDFDLPV  201

Query  648   LSVKGMEKLLRRRDLPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQ  824
              SV GME  LRRRDLP  CRV+D+ +P F+  + E ++  R+   I+NSF++LEG  LDQ
Sbjct  202   TSVPGMEGYLRRRDLPAFCRVNDVNNPVFQTIITESKRTARSNGLILNSFEDLEGPILDQ  261

Query  825   MRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVC  1004
             +R   + N+Y IGP+H  L+ +L S    L   S+   E+ +  + WL+ QP  SV+YV 
Sbjct  262   IR-NHIPNLYPIGPIHTHLQARLVSKKTELPLPSSSFWEEDRSSITWLNNQPTKSVIYVS  320

Query  1005  FGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVV  1184
             FG++TL++   + EFW+GL+NSG RFLW + P  +     E   VP E+  G + R  +V
Sbjct  321   FGSITLLTRSEVFEFWYGLVNSGHRFLWVMRPDSITG---EEYSVPEELDTGTKERGYLV  377

Query  1185  EWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGL  1364
              W PQ EVLAH +VG F TH GWNS MES+ AGVPMI WP++ADQ +NSRF+ +VWK+GL
Sbjct  378   GWVPQNEVLAHPSVGAFFTHSGWNSTMESVAAGVPMICWPYFADQTINSRFVSDVWKVGL  437

Query  1365  DMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             DMKD+CDR I+EKMVR++ME ++DEF +R  +FA  AK+   EGGSS SSL  LI+ IK
Sbjct  438   DMKDSCDRVIVEKMVREVMEDKRDEFSERGVRFAELAKKAVSEGGSSYSSLNRLIDFIK  496



>ref|XP_006435573.1| hypothetical protein CICLE_v10031368mg [Citrus clementina]
 ref|XP_006486447.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
 gb|ESR48813.1| hypothetical protein CICLE_v10031368mg [Citrus clementina]
Length=484

 Score =   413 bits (1061),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 218/471 (46%), Positives = 303/471 (64%), Gaps = 19/471 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFS-DVISRFRCYSGFRFETI  320
             +P P+  H++SML LA+LL  + +K+TF+ + H    L+  S DV SR+    GF+F+TI
Sbjct  21    WPLPALGHVNSMLKLAELLSHAGIKITFLNSEHYHERLVRHSSDVFSRYMNLPGFQFKTI  80

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANF  500
              DGLP     DH  +     +LL+SL++   P LK+++  +     +P  CII+DG  +F
Sbjct  81    TDGLP----KDHPQTVDNFHELLNSLASVTPPLLKDMLTDA----KSPVHCIISDGLMSF  132

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLL  677
             A+DVA++VG+PII F  VSA A WAYF IP +I AGELP  G +DMD  I  V GMEK L
Sbjct  133   AIDVAKQVGIPIIYFRTVSACAFWAYFCIPEIIDAGELPIKGNEDMDRLIKHVPGMEKFL  192

Query  678   RRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R RDLP  CR +D  D   + ++ E R   R    ++N+F++LEG  L Q+R      +Y
Sbjct  193   RCRDLPSFCRAEDPMDMNLQLVVSETRSSVRADGLVLNTFEDLEGPVLSQIR-AHCPKIY  251

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPL+  L+ ++       T SSN L E  + C+ WLD QP  SV++V FG++ ++  +
Sbjct  252   TIGPLNAHLKARIPEN----THSSNSLWEVDRSCIAWLDNQPSKSVIFVSFGSVAVMQRD  307

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              L EFW+GL+NS +RFLW + P L+  K  E  ++P E+    + R  +  W PQ+EVL 
Sbjct  308   QLIEFWYGLVNSHKRFLWVIRPDLISGKDGE-NQIPKELDKATKERGYIAGWVPQEEVLG  366

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H AVGGFLTHCGWNS +ESIVA +PMI WP +ADQQ+NSRF+ EVWK+GLDMKD CDR I
Sbjct  367   HKAVGGFLTHCGWNSTLESIVARMPMICWPSFADQQINSRFVDEVWKLGLDMKDLCDRKI  426

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKMV +L+  R+  F++ A + AN A +   EGGSS  +L++LI DI+ M
Sbjct  427   VEKMVNELLVERRAAFMKSADRMANLAIKSVNEGGSSYCNLDHLINDIRMM  477



>ref|XP_011100060.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=493

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 218/480 (45%), Positives = 300/480 (63%), Gaps = 23/480 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI+SML LA+L CLS+L VT + + +    L   +++ SRF  Y GFR  TIPDGL
Sbjct  17    PMQGHINSMLKLAELFCLSNLHVTMLLSEYTHGRLRRHANIESRFSRYPGFRVATIPDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSL-SATAKPFLKEIVVTSGGEDSAPQR---CIIADGFANF  500
             P    +DH   G   ++++ SL       F K +  T    D   +R   C+I DG  +F
Sbjct  77    P----EDHPRVGERTMEIVMSLLKVGGAEFRKLMETTDALSDGGARRRVTCLIMDGVLSF  132

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD-----------MDEPI  647
             AV VAEE+G+P I F  V A + WA F    +I+AGE P  GKD           +D  +
Sbjct  133   AVPVAEEMGIPFIYFRTVGACSFWANFCFKDVIEAGEAPLKGKDEGKHEYWKKEELDLMV  192

Query  648   LSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQ  824
              SV GME  LRRRDLP  CRV+D+ DP F+ ++ E R+   ++  I+NSF++LEG  LDQ
Sbjct  193   TSVPGMEGYLRRRDLPAFCRVNDVNDPGFQTIIRETRRTALSRGLILNSFEDLEGPILDQ  252

Query  825   MRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNG-LHEDGKKCMDWLDRQPPNSVLYV  1001
             +R   + N+Y+IGPLH  L+ +L S     ++  +   +E+ +  M WLD QPP SVLYV
Sbjct  253   IR-KPIPNLYSIGPLHTHLKARLESQKSEESSLPSSSFYEEDRSSMSWLDSQPPKSVLYV  311

Query  1002  CFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCV  1181
              FG++TL++ + L EFW+GL+NSG +FLW + P  ++    +   +P E+    + R  +
Sbjct  312   SFGSVTLLTRDELLEFWYGLVNSGHKFLWVMRPDSIVGDNKD-NPIPAELEEATKERGYL  370

Query  1182  VEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIG  1361
             V W PQ EVLAH +VG F TH GWNS +E I A +PMI WP++ADQ +NSRF+ EVWK+G
Sbjct  371   VGWVPQNEVLAHPSVGAFFTHSGWNSTLEGIAAVMPMICWPYFADQTINSRFVSEVWKVG  430

Query  1362  LDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             LDMKD+CDR I+EK VRD+MEVR+DEFL+RA   A  AK+   EGG+S ++L  LIE I+
Sbjct  431   LDMKDSCDRVIVEKTVRDIMEVRRDEFLERALHMAELAKKSISEGGTSYTNLNRLIEFIR  490



>gb|ACS87994.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis]
Length=484

 Score =   410 bits (1055),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 217/471 (46%), Positives = 302/471 (64%), Gaps = 19/471 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFS-DVISRFRCYSGFRFETI  320
             +P P+  H++SML LA+LL  + +K+TF+ + H    L+  S DV SR+    GF+F+TI
Sbjct  21    WPLPALGHVNSMLKLAELLSHAGIKITFLNSEHYHERLVRHSSDVFSRYMNLPGFQFKTI  80

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANF  500
              DGLP     DH  +     +LL+SL++   P LK+++  +     +P  CII+DG  +F
Sbjct  81    TDGLP----KDHPQTVDNFHELLNSLASVTPPLLKDMLTDA----KSPVHCIISDGLMSF  132

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLL  677
             A+DVA++VG+PII F  VSA A WAYF IP +I AGELP  G +DMD  I  V GMEK L
Sbjct  133   AIDVAKQVGIPIIYFRTVSACAFWAYFCIPEIIDAGELPIKGNEDMDRLIKHVPGMEKFL  192

Query  678   RRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R RDLP  CR +D  +   + ++ E R   R    ++N+F++LEG  L Q+R      +Y
Sbjct  193   RCRDLPSFCRAEDPMNMNLQLVVSETRSSVRADGLVLNTFEDLEGPVLSQIR-AHCPKIY  251

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPL+  L+ ++       T SSN L E  + C+ WLD QP  SV++V FG++ ++  +
Sbjct  252   TIGPLNAHLKARIPEN----THSSNSLWEVDRGCIAWLDNQPSKSVIFVSFGSVAVMQRD  307

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              L EFW+GL+NS +RFLW + P L+  K  E  ++P E+    + R  +  W PQ+EVL 
Sbjct  308   QLIEFWYGLVNSHKRFLWVIRPDLISGKDGE-NQIPKELDKATKERGYIAGWVPQEEVLG  366

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H AVGGFLTHCGWNS +ESIVA +PMI WP +ADQQ+NSRF+ EVWK+GLDMKD CDR I
Sbjct  367   HKAVGGFLTHCGWNSTLESIVARMPMICWPSFADQQINSRFVDEVWKLGLDMKDLCDRKI  426

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKMV +L+  R+  F++ A + AN A +   EGGSS  +L+ LI DI+ M
Sbjct  427   VEKMVNELLVERRAAFMKSADRMANLAIKSVNEGGSSYCNLDRLINDIRMM  477



>ref|XP_011084978.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=499

 Score =   410 bits (1054),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 216/481 (45%), Positives = 303/481 (63%), Gaps = 23/481 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SMLNLA+LLCLS L VT + + +  N LL  + + SRF  +SGFR  TI DGL
Sbjct  20    PLQGHVNSMLNLAELLCLSGLHVTILLSDYTHNRLLRHASLQSRFSRHSGFRVVTISDGL  79

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATA-KPFLKEIVVTSGGEDSAPQR---CIIADGFANF  500
             P     DH   G  IV ++ SL     + F   +  T G  D   +R   C+I DG   F
Sbjct  80    PA----DHPRVGERIVDIVLSLKEVGGQQFRHLMESTDGLSDGGARRRVSCLIVDGVFRF  135

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-----------DMDEPI  647
             A+ V EE+G+P I F  +SA + W YF +  +I AGE+P  GK           +MD  +
Sbjct  136   AIPVVEEMGIPYIYFRTISACSFWPYFCLQEIIDAGEVPLKGKNEDKLTYWKKKEMDLMV  195

Query  648   LSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQ  824
              SV GME++LRRRD+P  C+V+D+  P  + M  E R+       I+N+F++LEG  LD+
Sbjct  196   TSVPGMERVLRRRDIPRFCQVEDINHPGLQTMKTETRRTIDASGLILNTFEDLEGPILDE  255

Query  825   MRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTS-SNGLHEDGKKCMDWLDRQPPNSVLYV  1001
             +R   + N+Y+IGPLH LL+  L S  +  + + S+   E+ + C+ WLD QP +SV+YV
Sbjct  256   IR-KHIPNLYSIGPLHALLKAGLESEGMESSRNRSSSFWEEDQNCIAWLDSQPASSVIYV  314

Query  1002  CFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERG-EVPTEILNGLEGRCC  1178
              FG++T+++ + L EFW+GL+NSG RFLW + P  ++      G E+P E+  G + R  
Sbjct  315   SFGSVTILTRDELLEFWYGLVNSGHRFLWVIRPDSIIGNDNGNGNEIPVELEEGTKSRGY  374

Query  1179  VVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKI  1358
             +V W PQQ+VLAH A+G F TH GWNS +ESI  G+PM+ W ++ADQ  NSRF+ EVWK+
Sbjct  375   MVGWVPQQQVLAHPAIGAFFTHSGWNSTLESITLGLPMLCWAYFADQITNSRFVSEVWKV  434

Query  1359  GLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             GLDMKDTCDR I+EKMV+++MEVR++EFL+RA   A  A++   EGGSS  +L  LIE +
Sbjct  435   GLDMKDTCDRIIVEKMVKEVMEVRREEFLERADSMATLARKAISEGGSSYLNLNGLIEFL  494

Query  1539  K  1541
             K
Sbjct  495   K  495



>ref|XP_004150246.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Cucumis sativus]
 gb|KGN50613.1| hypothetical protein Csa_5G196560 [Cucumis sativus]
Length=476

 Score =   405 bits (1041),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 215/466 (46%), Positives = 291/466 (62%), Gaps = 14/466 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             PF  HI+SML LA+LL ++ + VTF+ T H ++ L   SDV+SRF  +  FRF TI DGL
Sbjct  16    PFQGHINSMLKLAELLSIAGITVTFLNTPHFQSQLTRHSDVLSRFSRFPTFRFHTIIDGL  75

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGF-ANFAVD  509
             P     DH  +     Q++ SL +  KP  +  +V+  G   +   C++ DGF  NF   
Sbjct  76    P----PDHPRTIEFFAQIISSLDSITKPIFRNWLVS--GHFGSNLTCVVLDGFLKNFIDG  129

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLLRRR  686
               +EV  PI  F  VSA + W Y   P LI+ G+LP  G+ DMD  I ++ GME LLR R
Sbjct  130   DEDEVKQPIFGFRTVSACSVWTYLCAPHLIEDGQLPIRGEEDMDRMITNLPGMENLLRCR  189

Query  687   DLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLPG CRV D  D   ++ + + +  ++    I+NSF++LEG  L ++R     N+Y IG
Sbjct  190   DLPGLCRVTDTNDSVLQYTLKQTQGSYQFHALILNSFEDLEGPILSKIRTNLCPNLYTIG  249

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
             PLH LL+ KL       T S N L E  + C+ WLD QPP SV+YV FG++T++  E L 
Sbjct  250   PLHSLLKTKLSH----ETESLNNLWEVDRTCLAWLDNQPPGSVIYVSFGSITVMGNEGLM  305

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EFWHGL+NSG+ FLW + P LV  K  E  E+P ++  G + R  VV WAPQ++VL+H A
Sbjct  306   EFWHGLVNSGRNFLWVIRPDLVSGKNGEI-EIPADLEEGTKQRGYVVGWAPQEKVLSHEA  364

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             VGGFLTH GWNS +ESIVAG  M+ WP+ ADQQVNSRF+  VWK+G+DMKD CDR I+ K
Sbjct  365   VGGFLTHSGWNSTLESIVAGKAMVCWPYTADQQVNSRFVSNVWKLGVDMKDMCDREIVAK  424

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             MV ++M  RK+EF + A + AN A+     GGSS +  + L+ +I+
Sbjct  425   MVNEVMVNRKEEFKRSAIEMANLARRSVSLGGSSYADFDRLVNEIR  470



>ref|XP_008811497.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=499

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 223/482 (46%), Positives = 298/482 (62%), Gaps = 25/482 (5%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++ ML L +LL  + L VTF+ T +  + L  +S   +       FRFE+IP
Sbjct  20    FPFPAQGHVNCMLKLGELLTKTGLHVTFLNTDYNHHRLSRYSAAYALLAESPRFRFESIP  79

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA---PQRCIIADGFA  494
             DGL     D+   S + ++ L  SL   +    +E+++  G  D     P  C+IADG  
Sbjct  80    DGL----ADEDPRSVLHLMDLEESLRVRSAVLYRELLIKRGRRDDGKWPPVTCVIADGIM  135

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEK  671
              FAVD+AEE+G+P I+F  VSA + WAYF +P L+Q+GELPF +  D+DEP+ SV GME 
Sbjct  136   TFAVDIAEELGIPAIAFRTVSACSFWAYFRLPQLLQSGELPFPDEADLDEPVRSVPGMEA  195

Query  672   LLRRRDLPGNCRV-DDLEDPFFKFMMEFR-KCFRTKHHIINSFQELEGSTLDQMRIGDML  845
              LRRRDLP  CR+  D  D  F+F+        R +  I+N+F+ LE + L  +R     
Sbjct  196   FLRRRDLPSFCRLAGDRTDRTFEFVTTVTANTNRARALILNTFESLEATALSHVR-SHFP  254

Query  846   NVYAIGPLHELLRNKLGSCNV------TLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCF  1007
               +A+GPL  LLR+    C          +  S  L E+ + CM WLD QP  SV+YV F
Sbjct  255   VTFAVGPLPALLRSYRSRCPSDPAVPPASSMPSATLWEEDRTCMTWLDSQPHKSVVYVSF  314

Query  1008  GTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGE----VPTEILNGLEGRC  1175
             G+LTLVS+E   EFW GL+NSGQRFLW + P LV  ++  R E    V  E+  G + R 
Sbjct  315   GSLTLVSQEAFLEFWVGLVNSGQRFLWVVRPDLV-GEEGRRWEEMLPVTEEVKVGTKERG  373

Query  1176  CVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWK  1355
             C+V+W PQ+EVLAH AVG FLTH GWNS +ESIVAGVPM+ WPF+ADQQ+NSRF+ EVWK
Sbjct  374   CLVKWVPQEEVLAHPAVGCFLTHSGWNSTLESIVAGVPMLCWPFFADQQINSRFVSEVWK  433

Query  1356  IGLDMKDTCDRHIIEKMVRDLME-VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIE  1532
             +GLDMKD C R I+EKMVR++ME  R +E+ + AK+ A  A+E   EGGSS +    LI 
Sbjct  434   VGLDMKDLCSRSIVEKMVREMMEGPRAEEWRRSAKEMAKMARESVAEGGSSYTDFRRLIS  493

Query  1533  DI  1538
              I
Sbjct  494   LI  495



>emb|CDP04614.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 215/473 (45%), Positives = 296/473 (63%), Gaps = 14/473 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSG-FRFETIPDG  329
             P  S ++SML LA+LLCL+  +VTF+ T H  N LL  +++ SR   Y G F  E + DG
Sbjct  17    PIQSPVNSMLKLAELLCLAGHRVTFLNTKHNHNRLLRCTNIQSRLDQYQGRFLLEKVDDG  76

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVV----TSGGEDSAPQRCIIADGFAN  497
             LP    D+   +     ++L SL + A+PFL+E++     +       P  CIIADG   
Sbjct  77    LP----DEDPRTAEQFTEILDSLQSVAEPFLREVLCGERFSCNSSKRPPITCIIADGSYY  132

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             + +DVAEE+G+P+I F  +S    W Y  +P LI+AGELPF G D+D  + S+ GME LL
Sbjct  133   YVLDVAEEMGIPLIFFETISPCCLWVYMCVPKLIEAGELPFKGNDLDAEVRSIPGMEGLL  192

Query  678   RRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R RDLP  CR D   D   + +M E R   R    I+N+F++LEG  L  +      N+Y
Sbjct  193   RCRDLPDFCRRDCTADRNAQLVMAEIRNIPRAAGLILNTFEDLEGPFLSHIH-SQARNLY  251

Query  855   AIGPLHELLRNKLGSCNVTLTTS-SNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             AIGPL   L+ KL + +  L T+ SN    +   C+ WLD QP  SV+Y+ FG+L  +++
Sbjct  252   AIGPLQLHLKTKLAAQSRELPTAVSNSFWVEDTSCLCWLDSQPLKSVIYISFGSLKNITK  311

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILN-GLEGRCCVVEWAPQQEV  1208
             +   EFWHG+MNSGQRFLW + P  +  +K+E+ +   + LN G +G+  ++ W PQ+EV
Sbjct  312   DEFLEFWHGIMNSGQRFLWVIRPGSIKGQKLEQHDDFLKELNRGTKGKGLILSWVPQEEV  371

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             + HSA+GGFL+H GWNS +ESI+AGVPMI WP Y DQQV SRF+ E W +GLDMKDTC R
Sbjct  372   IGHSAIGGFLSHSGWNSTLESIIAGVPMICWPCYVDQQVTSRFVSETWTLGLDMKDTCSR  431

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              IIEKMVRD++E R D F Q A +F+  A++    GGSS   L+ LI DIK++
Sbjct  432   SIIEKMVRDIIERRCD-FDQSADKFSKLARQSVAAGGSSHIDLDRLIGDIKKL  483



>gb|KDO69252.1| hypothetical protein CISIN_1g011848mg [Citrus sinensis]
Length=460

 Score =   403 bits (1035),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 215/469 (46%), Positives = 296/469 (63%), Gaps = 32/469 (7%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFS-DVISRFRCYSGFRFETIP  323
             P P+  H++SMLNLA+LL  + +K+TF+ T H  + ++  S D  SR+    GF+F+T+ 
Sbjct  13    PLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPGFQFKTLT  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  +     +L+ SL+    P LKE+V  S     +P  CII DG+ + A
Sbjct  73    DGLPR----DHPRTPDKFPELVDSLNCATPPLLKEMVSDS----KSPVNCIITDGYMSRA  124

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             +D A EVGV II F  +SA A W++  IP +I AGELP  G                LR 
Sbjct  125   IDAAREVGVSIIYFRTISACAFWSFHCIPDIIDAGELPIKG---------------FLRC  169

Query  684   RDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CRV+D  DP    F  E R        I+N+F++LEG  L Q+R     N+Y+I
Sbjct  170   RDLPSFCRVNDPMDPHLLLFARETRLSAHADGLILNTFEDLEGPILSQIRNHSCPNIYSI  229

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPL+  L+ ++       T SS+ L +  + CM WLD+QP  SV+YV FG++ ++S + L
Sbjct  230   GPLNAHLKVRIPE----KTYSSSSLWKIDRSCMAWLDKQPKQSVIYVSFGSIAVMSRDQL  285

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EF++GL++S + FLW + P L+  K  E  ++P E+L   + R C+  W PQ+EVLAHS
Sbjct  286   IEFYYGLVHSKKSFLWVIRPDLISGKDGE-NQIPEELLEATKERGCIAGWVPQEEVLAHS  344

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             AVGGFLTHCGWNS +ESIVAG+PMI WP +ADQQ+NSRF+GEVWK+GLD+KD CDR+I+E
Sbjct  345   AVGGFLTHCGWNSTLESIVAGMPMICWPSFADQQINSRFVGEVWKLGLDIKDLCDRNIVE  404

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             K V DLM  RK+EF++ A + AN AK+   +GGSS  +L+ L+ DIK M
Sbjct  405   KAVNDLMVERKEEFMESADRMANLAKKSVNKGGSSYCNLDRLVNDIKMM  453



>ref|XP_008464906.1| PREDICTED: UDP-glycosyltransferase 85A3-like isoform X1 [Cucumis 
melo]
Length=483

 Score =   404 bits (1037),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 218/473 (46%), Positives = 298/473 (63%), Gaps = 19/473 (4%)
 Frame = +3

Query  147   AYPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             + P   +I+ ML LAQLL LS ++VTF+TT H+   L   SDV+ RF  +  F+F TI D
Sbjct  15    SAPAQGNINVMLKLAQLLSLSSVRVTFLTTEHSYRQLTLHSDVLRRFSLFPSFQFRTISD  74

Query  327   GLP--HGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANF  500
             GLP  H  T  H      + ++ HS  +  KP  ++++V+     S+   C+I DGF ++
Sbjct  75    GLPLSHPRTFSHH-----LPEMFHSFVSVTKPLFRDMLVSP--HFSSDLSCLILDGFFSY  127

Query  501   AVDVAEE-VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKL  674
              +D+ ++ V VPI  F   SA +TW  FSIP+LI+ G+LP  G+ DMD  + +V GME L
Sbjct  128   LLDIDDDFVKVPIFCFRTFSACSTWTIFSIPNLIKQGQLPIKGEEDMDRILDNVPGMENL  187

Query  675   LRRRDLPGNCR-VDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
             LR RDLPG CR  D   DP  +F++  F +  +    I+N+F++LEG  L  +R     N
Sbjct  188   LRCRDLPGFCRPTDPNNDPILQFIVSAFIRSTKFNALIMNTFEDLEGPILSNIRTL-CPN  246

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             +Y+IGPLH LL+ K+       T S N L E  + C+ WLD QP  SV+YV FG++T++ 
Sbjct  247   LYSIGPLHALLKTKVSH----ETESLNNLWEVDRSCLTWLDNQPAGSVIYVSFGSITVMG  302

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
                L EFWHGL+NSG+ FLW + P LV  K  E  E+P E+  G + R  +V W PQ++V
Sbjct  303   NRELMEFWHGLVNSGRNFLWVIRPDLVKGKNGEI-EIPAELEEGTKQRGYMVGWTPQEKV  361

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             L H AVGGFLTH GWNS +ESIVAG PMI WPF  DQQVNSRF+  +W +GLDMKD CDR
Sbjct  362   LCHEAVGGFLTHSGWNSTLESIVAGKPMICWPFGFDQQVNSRFVSNMWNLGLDMKDLCDR  421

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
               + KMV D+M  RK+EF++ A + AN A+   K GGSS ++ + LIEDI+ +
Sbjct  422   ETVAKMVNDVMVNRKEEFVRSATEIANLARRSVKPGGSSYANFDRLIEDIRNL  474



>ref|XP_008464907.1| PREDICTED: UDP-glycosyltransferase 85A3-like isoform X2 [Cucumis 
melo]
Length=483

 Score =   402 bits (1033),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 216/472 (46%), Positives = 298/472 (63%), Gaps = 17/472 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P+  HI+ ML LA+LL LS ++VTF+TT H+   L   SDV+ RF  +  F+F TI 
Sbjct  14    FPAPAQGHINVMLKLAELLSLSSVRVTFLTTEHSYRQLTLHSDVLHRFSLFPSFQFRTIS  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP       R+    + ++LHS  +  KP  ++++V+     S+   C+I DGF ++ 
Sbjct  74    DGLP---VSHPRTFSCHLPEMLHSFVSVTKPLFRDMLVSH--HFSSDLSCLILDGFFSYL  128

Query  504   VDVAEE-VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLL  677
             +D+ ++ V VPI  F    A +TW   SIP+LI+ G+LP  G+ DMD  + +V GME LL
Sbjct  129   LDIDDDFVKVPIFCFRTFGACSTWTILSIPNLIKQGQLPIKGEEDMDRILDNVPGMENLL  188

Query  678   RRRDLPGNCR-VDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             R RDLPG CR  D   DP  +F++  F +  +    I+N+F++LEG  L  +R     N+
Sbjct  189   RCRDLPGFCRPTDPNNDPILQFIVSAFIRSTKFNALIMNTFEDLEGPILSNIRTL-CPNL  247

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y+IGPLH LL+ K+       T S N L E  + C+ WLD QP  SV+YV FG++T++  
Sbjct  248   YSIGPLHALLKTKVSH----ETESLNNLWEVDRSCLTWLDNQPAGSVIYVSFGSITVMGN  303

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVL  1211
               L EFWHGL+NSG+ FLW + P LV  K  E  E+P E+  G + R  +V W PQ++VL
Sbjct  304   RELMEFWHGLVNSGRNFLWVIRPDLVKGKNGEI-EIPAELEEGTKQRGYMVGWTPQEKVL  362

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
              H AVGGFLTH GWNS +ESIVAG PMI WPF  DQQVNSRF+  +W +GLDMKD CDR 
Sbjct  363   CHEAVGGFLTHSGWNSTLESIVAGKPMICWPFGFDQQVNSRFVSNMWNLGLDMKDLCDRE  422

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              + KMV D+M  RK+EF++ A + AN A+   K GGSS ++ + LIEDI+ +
Sbjct  423   TVAKMVNDVMVNRKEEFVRSATEIANLARRSVKPGGSSYANFDRLIEDIRNL  474



>ref|XP_006362115.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=489

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 212/464 (46%), Positives = 289/464 (62%), Gaps = 10/464 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  S I+S L LA+LLCL+ L+VTF+ T H +  L+  S+V SRF+ Y GFRF T+ DGL
Sbjct  17    PLQSTINSNLQLAELLCLAGLRVTFLNTNHNQQRLVGNSNVESRFKQYPGFRFLTLSDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDV  512
             P    DDH  S      +L SL   A+P LK+++     E   P  C+I DG   + VD+
Sbjct  77    P----DDHPRSVEQFGDILSSLQTMAEPLLKQMLSALVKE---PVTCVILDGLFYYGVDI  129

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDL  692
               E+GVP+I+F  +S +  W Y S+P LI+AG LPF G D+D  +  +  ME LLRRRDL
Sbjct  130   GNEMGVPVITFDTISPSCFWIYLSLPKLIEAGVLPFKGNDLDALVTHLPAMEGLLRRRDL  189

Query  693   PGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPL  869
             P  C +D   D   + +  E  +  +    I+NSF++L+G  L  +R       YAIGPL
Sbjct  190   PHFCLLDYKTDQNSQAVFKEIERLPKAHGLILNSFEDLDGPFLSSVR-SYFPKTYAIGPL  248

Query  870   HELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEF  1049
                L+++L +    L +SSN L E+    + WL+ Q   SV+YV FG+L +VS + + EF
Sbjct  249   PLNLKSRLAAKATPLLSSSNSLWEEDHTSIKWLNAQSNGSVIYVSFGSLLVVSRDEMMEF  308

Query  1050  WHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVG  1229
             WHGLMNS  +FLW + P + L   V R +   E++ G +G   +V WAPQ+ VLAH +VG
Sbjct  309   WHGLMNSKVKFLWVMRPNM-LKGDVSRDQFMKELVEGSKGIGYIVSWAPQKMVLAHPSVG  367

Query  1230  GFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMV  1409
             GFLTH GWNS +ESI+ G PMI WP Y DQ+V SR + E WKIGLDMKD CDR ++EKMV
Sbjct  368   GFLTHSGWNSTLESIIEGKPMICWPQYVDQRVTSRLVNEFWKIGLDMKDICDRFVVEKMV  427

Query  1410  RDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             +DLME +KDE+ +  ++ +  AK   +EGG S S+L+ LI DIK
Sbjct  428   KDLMETKKDEYKKSVEKLSKLAKLSVQEGGLSYSNLDCLINDIK  471



>ref|XP_008464643.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
 ref|XP_008464644.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
Length=509

 Score =   402 bits (1032),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 215/469 (46%), Positives = 297/469 (63%), Gaps = 17/469 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LA+LL LS L++TF+      + L   ++  SRF  +  F+F+TI 
Sbjct  42    FPFPAQGHVNSMLKLAELLSLSGLRITFLNIHRIHHKLTLHTNFQSRFSRFPNFQFQTIT  101

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     ++R  G     L++SL +  KP LK+++++  GE      CII DG  NF 
Sbjct  102   DGLPL----ENRPIG-NFSDLINSLKSITKPLLKQMLLS--GELGPTPTCIILDGLFNFI  154

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLLR  680
              DV     +P+ SF  +SA +  AY  +P LI+ G+LP  G+ DMD  I  V GME +LR
Sbjct  155   FDVDAHPNIPVFSFRTISACSFSAYSFVPKLIEDGQLPIEGEEDMDRIINGVVGMENVLR  214

Query  681   RRDLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
              RDLP  CR++D  DP  ++ + +  + F++   I N+F++LEG  L  +R     N+YA
Sbjct  215   CRDLPSFCRLEDPFDPRLQYGVTQTIQSFKSHALIFNTFEDLEGPILSCLR-SRCSNIYA  273

Query  858   IGPLHELLRNKLGS-CNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
             IGPLH  L+ KL S  + T + S+NGL E  + C+ WLD QPP SV+YV FG++ ++ ++
Sbjct  274   IGPLHAHLKTKLSSEISPTASESNNGLWEVDRSCLAWLDAQPPKSVIYVSFGSVVVIDDD  333

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              L EFWHGL+NSG+RFLW L P  V  K      VP E+    + R  +V WAPQ+EVLA
Sbjct  334   QLREFWHGLVNSGKRFLWVLRPNSVAGKD----GVPAELEEETKERGYIVGWAPQEEVLA  389

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H A+G FLTH GWNS +ESIVAGVPMI WP +ADQQ NSR++ E+WKIGLDMKD C+R  
Sbjct  390   HKAIGAFLTHSGWNSTLESIVAGVPMICWPQFADQQTNSRYVSEIWKIGLDMKDVCNRET  449

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             + KMV D+ME RK+E +    + A  A    +EGGSS   LE +I+DI+
Sbjct  450   VAKMVNDVMENRKNELMGSVIEIAKLAITSVEEGGSSYCDLERMIKDIR  498



>ref|XP_004149949.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
 gb|KGN50608.1| hypothetical protein Csa_5G190520 [Cucumis sativus]
Length=478

 Score =   400 bits (1028),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 209/469 (45%), Positives = 291/469 (62%), Gaps = 19/469 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LA+LL LS L++TF+  +     L   +D+ SRF  +  F+F+TI 
Sbjct  13    FPFPAQGHVNSMLKLAELLTLSGLRITFLNILRIHQKLTLHTDIQSRFSRFPNFQFQTIT  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGL + L D           L+ SL +   P LK+++++  GE      CII DG  NF 
Sbjct  73    DGLDNRLIDKFS-------DLIDSLKSITMPLLKQMLLS--GEFGPTPTCIILDGLFNFI  123

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLLR  680
             VDV     +P+ SF  +SA +  AY  +P LI+ G+LP  G+ DMD  I  + GME +LR
Sbjct  124   VDVDAHPNIPVFSFRTISACSFSAYSFVPKLIEDGQLPIKGEEDMDRIISGMGGMENVLR  183

Query  681   RRDLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
              RDLP  CR++D  DP  +  + +  + F+++  I N+F +LEG  L  +R     N+YA
Sbjct  184   CRDLPSFCRLEDPFDPGLQHGVTQTIQSFKSRALIFNTFNDLEGPILSSLR-SRCSNIYA  242

Query  858   IGPLHELLRNKL-GSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
             IGPLH  L+ +L G  +   + SSNGL E  + C+ WLD  PP SV+YV FG++ ++ ++
Sbjct  243   IGPLHAHLKTRLSGEISPASSVSSNGLWEVDRSCLAWLDDHPPKSVIYVSFGSVVVIGDD  302

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
                EFWHGL+NSG+RFLW + P    N    +  VP ++      R  +V+WAPQ+EVLA
Sbjct  303   QFREFWHGLVNSGKRFLWVMRP----NSLAGKDGVPADLKEKTNERGYIVDWAPQEEVLA  358

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H A+G FLTH GWNS +ESIVAGVPMI WP +ADQQ NSR++ +VWKIGLDMKD C+R  
Sbjct  359   HKAIGAFLTHSGWNSTLESIVAGVPMICWPQFADQQTNSRYVSDVWKIGLDMKDVCNRET  418

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             + KMV D+ME RK+E +    + A SA    +EGGSS   LE +I DI+
Sbjct  419   VTKMVNDVMENRKNELMGSVIEMAESAITSVEEGGSSYCDLERMINDIR  467



>ref|XP_011084983.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=524

 Score =   400 bits (1028),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 218/481 (45%), Positives = 300/481 (62%), Gaps = 23/481 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SMLNLA+LLCLS L VT + + +  N LL  + + SRF  +SGFR  TI DGL
Sbjct  45    PLQGHVNSMLNLAELLCLSGLHVTILLSDYTHNRLLRHATLRSRFSRHSGFRVATISDGL  104

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGG--EDSAPQR--CIIADGFANF  500
             P     DH   G  IV +  SL        + ++ ++ G  E  A +R  C+I DG  +F
Sbjct  105   P----PDHPRVGERIVDMALSLKQIGGSQFRRLMESTDGLSEGGAMRRVSCLIMDGVLSF  160

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-----------DMDEPI  647
             A+ V EE+G+P I F  +SA A W YF I  ++ AGE+P  GK           +MD  +
Sbjct  161   AISVVEEMGIPYIYFRTISACAFWPYFCIQEIMDAGEVPLRGKNEDKLTYWKKKEMDMMV  220

Query  648   LSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMMEFRKC-FRTKHHIINSFQELEGSTLDQ  824
              SV GME+ LRRRD+P    V + +DP FK M    K        I+N+F++LEG  LD+
Sbjct  221   TSVPGMERFLRRRDIPRFFGVANADDPTFKTMKTDTKKTVEACGLILNTFEDLEGPILDE  280

Query  825   MRIGDMLNVYAIGPLHELLRNKLGSCNVTLT-TSSNGLHEDGKKCMDWLDRQPPNSVLYV  1001
             +R   + N+Y+IGPLH LL+ +L S  +  +   S+   E+ + C+ WLD QP  SV+YV
Sbjct  281   IR-KHIPNLYSIGPLHALLKAQLESKGMESSHNHSSSFWEEDRSCIAWLDSQPTCSVIYV  339

Query  1002  CFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVER-GEVPTEILNGLEGRCC  1178
              FG++T+++ + L EFW+GL+NSG RFLW + P  ++    E   E+P E+  G + R C
Sbjct  340   SFGSITILTRDELLEFWYGLVNSGHRFLWVIRPDSIVGNNSENWNEIPVELEEGTKSRGC  399

Query  1179  VVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKI  1358
             +V W PQQEVLAH A+G F TH GWNS +ESI  G+PMI W ++ADQ  NSRF+ +VWKI
Sbjct  400   MVGWVPQQEVLAHPAIGAFFTHSGWNSTLESIAIGLPMICWAYFADQTTNSRFVSKVWKI  459

Query  1359  GLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             GLDMKDTCDR I+EKMV+D+M+VR+DEFL+RA   A  + +   EGGSS  +L  L+E +
Sbjct  460   GLDMKDTCDRIIVEKMVKDVMDVRRDEFLERAHSMAVLSGKAISEGGSSYLNLNRLVEFL  519

Query  1539  K  1541
             K
Sbjct  520   K  520



>ref|XP_004231996.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Solanum lycopersicum]
Length=477

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 216/469 (46%), Positives = 288/469 (61%), Gaps = 22/469 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  S I+SML LA+L CL+ L+VTF+ T H +  L   +DV SRFR Y  F+F TI DGL
Sbjct  11    PIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTDVESRFRQYPKFQFRTISDGL  70

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDV  512
             P    DDH  S +    L+ SL A A+PFL+EIV  SG        C+I DG   +AVD+
Sbjct  71    P----DDHPRSSLLFGDLITSLQAVAEPFLREIVTESG------VTCVIPDGLFYYAVDI  120

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDL  692
               E+GV +ISF  +S    W Y   P LIQ+G++PF G D+D  I +V GME LLRRRD 
Sbjct  121   CNELGVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKGNDLDVLIENVPGMEDLLRRRDF  180

Query  693   P----GNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             P     NC  D       K   E +   R+   I+N+F++L+G  L  +R       YA+
Sbjct  181   PFYRLTNCATDLYCQLALK---EIQSIPRSHGLILNTFEDLDGPLLSNIRT-HCPQTYAV  236

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPL   L+ +L   +++   SSN L E+    + WLD QP  SV+YV FG+L  +++E +
Sbjct  237   GPLQLQLKTRLADKSMS---SSNSLREEDGSSIQWLDAQPVESVIYVSFGSLATLTKEEM  293

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSG RFLW +   L+  ++     V  E+ +G + R  +V WAPQ++VL+H 
Sbjct  294   LEFWHGLVNSGIRFLWVMRSDLLREEEFSHQFV-KELADGCKERAYIVSWAPQEKVLSHP  352

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS MESIV   PMI W  Y DQ+V SRF+GEVWKIGLDMKD CDR+IIE
Sbjct  353   AIGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDRYIIE  412

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             K V+DLM   KD+  +   + +  AK    EGGSS ++ E+L+ DIK++
Sbjct  413   KAVKDLMVTNKDKLKKSVDKLSMLAKISVGEGGSSYNAFESLVIDIKKL  461



>ref|XP_004171873.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
Length=478

 Score =   398 bits (1022),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 209/469 (45%), Positives = 291/469 (62%), Gaps = 19/469 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LA+LL LS L++TF+  +     L   +D+ SRF  +  F+F+TI 
Sbjct  13    FPFPAQGHVNSMLKLAELLTLSGLRITFLNILRIHQKLTLHTDIQSRFSRFPNFQFQTIT  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGL + L D           L+ SL +   P LK+++++  GE      CII DG  NF 
Sbjct  73    DGLDNRLIDKFS-------DLIDSLKSITMPLLKQMLLS--GEFGPTPTCIILDGLFNFI  123

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLLR  680
             VDV     +P+ SF  +SA +  AY  +P LI+ G+LP  G+ DMD  I  + GME +LR
Sbjct  124   VDVDAHPNIPVFSFRTISACSFSAYSFVPKLIEDGQLPIKGEEDMDRIISGMGGMENVLR  183

Query  681   RRDLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
              RDLP  CR++D  DP  +  + +  + F+++  I N+F +LEG  L  +R     N+YA
Sbjct  184   CRDLPSFCRLEDPFDPGLQHGVTQTIQSFKSRALIFNTFNDLEGPILSCLR-SRCSNIYA  242

Query  858   IGPLHELLRNKL-GSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
             IGPLH  L+ +L G  +   + SSNGL E  + C+ WLD  PP SV+YV FG++ ++ ++
Sbjct  243   IGPLHAHLKTRLSGEISPASSGSSNGLWEVNRSCLAWLDDHPPKSVIYVSFGSVVVIGDD  302

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
                EFWHGL+NSG+RFLW + P    N    +  VP ++      R  +V+WAPQ+EVLA
Sbjct  303   QFREFWHGLVNSGKRFLWVVRP----NSLAGKDGVPADLKEKTNERGYIVDWAPQEEVLA  358

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H A+G FLTH GWNS +ESIVAGVPMI WP +ADQQ NSR++ +VWKIGLDMKD C+R  
Sbjct  359   HKAIGAFLTHSGWNSTLESIVAGVPMICWPQFADQQTNSRYVSDVWKIGLDMKDVCNRET  418

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             + KMV D+ME RK+E +    + A SA    +EGGSS   LE +I DI+
Sbjct  419   VTKMVNDVMENRKNELMGSVIEMAESAITSVEEGGSSYCDLERMINDIR  467



>gb|KGN50614.1| hypothetical protein Csa_5G196570 [Cucumis sativus]
Length=485

 Score =   398 bits (1022),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 214/474 (45%), Positives = 297/474 (63%), Gaps = 21/474 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P+  H++ ML LA+LL LS ++VTF+TT H+   L   SDV+ RF  +  F+F TI 
Sbjct  14    FPAPAQGHLNVMLKLAELLSLSSIRVTFLTTEHSYRQLTLHSDVLPRFSLFPSFQFRTIS  73

Query  324   DGLP--HGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFAN  497
             DGLP  H  T  H      + ++LHS  +  KP  ++++++     S+   C+I DGF +
Sbjct  74    DGLPLSHPRTFSHH-----LPEMLHSFVSVTKPLFRDMLLSP--HFSSDLTCLILDGFFS  126

Query  498   FAVDVAEE-VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD-MDEPILSVKGMEK  671
             + +D+ ++ V VP+  F    A +TW   SIP+LI+  +L   G+D MD  + +V GME 
Sbjct  127   YLLDIDDDFVKVPVFCFRTFGACSTWTILSIPNLIKQEQLTIKGEDDMDRILDNVPGMEN  186

Query  672   LLRRRDLPGNCRVDDLE-DPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
             LLRRRDLPG CR  D   DP  +F+M  F +  +    I+N+F++LEG  L  +R     
Sbjct  187   LLRRRDLPGFCRATDPNNDPILQFIMSTFIRSTKFSALIMNTFEDLEGPILSNIRTL-CP  245

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
             N+Y+IGPLH LL+ KL       T S N L E  + C+ WLD Q   SV+YV FG++T++
Sbjct  246   NLYSIGPLHALLKTKLNHE----TESLNNLWEVDRSCLTWLDNQAAGSVIYVSFGSITVM  301

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQE  1205
                 L EFWHGL NSG+RFLW + P LV  K  E  E+P E+  G + R  +V W PQ++
Sbjct  302   GNRELLEFWHGLFNSGRRFLWVIRPDLVKGKNGEI-EIPAELEEGTKQRGYMVGWTPQEK  360

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VL H AVGGFLTH GWNS +ESIVAG PMI WP+  DQQVNSRF+  VW +GLDMKD CD
Sbjct  361   VLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQQVNSRFVSNVWNLGLDMKDLCD  420

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R  + KMV D+M  RK+EF++ A + AN A++    GGSS ++ + L+EDI+ +
Sbjct  421   RETVAKMVNDVMVNRKEEFVRSATEIANLARQSVNPGGSSYANFDRLVEDIRNL  474



>ref|XP_010032068.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51453.1| hypothetical protein EUGRSUZ_J00977 [Eucalyptus grandis]
Length=479

 Score =   397 bits (1020),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 214/471 (45%), Positives = 297/471 (63%), Gaps = 26/471 (6%)
 Frame = +3

Query  165   HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGL  344
             H++SML LA+LL LS L++TFI + H  + LL  +D+ +RF  Y  FRF+ I DG P   
Sbjct  21    HVNSMLKLAELLALSGLRITFINSEHIHHRLLQHADIQARFAAYPDFRFKIISDGFPI--  78

Query  345   TDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR---CIIADGFANFAVDVA  515
               DH  +G   +   + + +  K  L+E+V       SAP R   CIIADG  +F +D A
Sbjct  79    --DHPRAGDHALTTFNYVKSITKQLLEELV-------SAPDRPVTCIIADGILSFTIDFA  129

Query  516   EEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLRRRDL  692
              ++GVP+I+F  +SA+  WAYF IP +I++G+LP  G +DMD  + SV GME +LR RDL
Sbjct  130   GDLGVPVIAFRTISASCFWAYFCIPRMIESGDLPIKGDEDMDRDVTSVPGMEDILRCRDL  189

Query  693   PGNCRVDDLEDPFFKFMMEFRKCFRT---KHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             P  CRV DL D   +++    +  RT   +  I+NSF +LEG  L Q+R     N+Y IG
Sbjct  190   PSFCRVADLSDWNLQYVTT--QTLRTTGARALILNSFDQLEGPALSQIRT-HFPNLYTIG  246

Query  864   PLHELLRNKLGSCNVTLTTSSNGLH---EDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
             PLH  L+++L S + +   SS+  +   E  + C+ WLD+QPP SV+YV FG++T ++  
Sbjct  247   PLHSHLKSRLSSSSPSSPPSSSASNSLWEVDRSCIAWLDKQPPKSVVYVSFGSITTLNRH  306

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
                EFW+GL+NSG+RFLW L    +   +   G VP E+      R C+V WAPQ+EVL 
Sbjct  307   DFTEFWYGLVNSGRRFLWVLRSDSL--PEGSSGAVPEELREAAAERGCIVGWAPQEEVLH  364

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H A+  FLTH GWNS +ES+VAG PM+ WPF+ADQQ+NSR +   WK GLDMKD CDR +
Sbjct  365   HGAIAAFLTHSGWNSTLESVVAGKPMVCWPFFADQQLNSRLVSHAWKAGLDMKDVCDREV  424

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +E+MV ++M  RK+EF   A   A  A++ A EGGSS  +L+ LIEDI+ M
Sbjct  425   VERMVNEVMGERKEEFAAAAGDLARRARDAASEGGSSWDNLDRLIEDIRSM  475



>ref|XP_004235101.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 207/467 (44%), Positives = 287/467 (61%), Gaps = 16/467 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  S I+S L LA+LLCL+ L+V+F+ T H +  L+  S+V SRF+ Y+GF+F TI DGL
Sbjct  16    PLQSTINSNLQLAELLCLAGLRVSFLNTNHNQQRLVANSNVESRFKQYTGFQFLTISDGL  75

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDV  512
             P    +D+  SG     ++ SL   A+P+LK+++    G    P  C+I DG   + VD+
Sbjct  76    P----EDNPRSGEQFGDIISSLQTMAEPYLKQML---SGLVKEPITCVILDGLFYYGVDI  128

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDL  692
               E+GVP++ F  +S +  W Y S+P LI+AG LPF G D+D  +  V  ME  LRRRDL
Sbjct  129   GNEMGVPVVIFDTISPSCFWIYLSLPKLIEAGVLPFKGNDIDALVTHVPAMEGFLRRRDL  188

Query  693   PGNC----RVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             P  C    ++D      FK   E  +  +    I+NSF+EL+G  L  +R       YAI
Sbjct  189   PHFCLLDYKIDQNSQAVFK---EIERIPKAHGLILNSFEELDGPFLYNIR-SYFPKTYAI  244

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPL   L+ +L +    L +SSN + E+    + WLD Q   SV+YV FG+L +VS + +
Sbjct  245   GPLPLNLKTRLAAKATPLLSSSNSMWEEDHTSIKWLDAQSKGSVIYVSFGSLVVVSRDEI  304

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGLMNS  +FLW + P + L       +   E++ G +G   +V WAPQ+ VLAH 
Sbjct  305   MEFWHGLMNSKVKFLWVMRPNM-LKGDASHDQFMKELVEGCKGIGYIVSWAPQEMVLAHP  363

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             +VGGFLTH GWNS +ESI+ G PMI WP Y DQ+V SR + E WKIGLDMKD CDR ++E
Sbjct  364   SVGGFLTHSGWNSTLESIIEGKPMICWPQYVDQRVTSRLVNEFWKIGLDMKDICDRFVVE  423

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             K+V+DLME +KDE+ +  ++ +  AK   +EGG S S+L+ LI DIK
Sbjct  424   KLVKDLMETKKDEYTKSVEKLSELAKLSVEEGGLSYSNLDCLINDIK  470



>ref|XP_007158356.1| hypothetical protein PHAVU_002G145900g [Phaseolus vulgaris]
 gb|ESW30350.1| hypothetical protein PHAVU_002G145900g [Phaseolus vulgaris]
Length=484

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 210/468 (45%), Positives = 291/468 (62%), Gaps = 14/468 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   +++SM+ LAQLL L H  VTF+TT      L  F+D+ +  + Y     +TI DGL
Sbjct  19    PLQGNVNSMMKLAQLLALHHFHVTFLTTDFIHRRLHRFADIQALSQTYPNLELKTISDGL  78

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQ-RCIIADGF-ANFAV  506
             P    DDH  S   +  L   L++ AKP +++I+V+     + P+  C+I DGF      
Sbjct  79    P----DDHPRSDNALADLYSFLNSHAKPLIRDILVSQTA--AKPKVTCLIGDGFLGGLTA  132

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLLRR  683
             DVA+EVG+P+I F  +SA+  WA F  P+L ++ +LP  G+ DMD  I ++ GME +LR 
Sbjct  133   DVADEVGIPLIHFRAISASCFWALFCAPNLFESNQLPIRGEEDMDRVITTLPGMENILRC  192

Query  684   RDLPGNCR--VDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
             RDLP   R    +L +P    + +  +  R +  I+N+F++L+G  L QMR+     V+A
Sbjct  193   RDLPSFYRGTESNLVEPLKSTVFDCHQTLRARGVILNTFEDLDGPLLSQMRL-KFPRVFA  251

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             +GPLH  L N     +   T S +   E  + C+ WLD QP  SVLYV FG++T ++ E 
Sbjct  252   VGPLHAHL-NSERVFDAKPTPSMSSFWEVDRSCLTWLDSQPLKSVLYVSFGSITTITRER  310

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L EFW+GL+NS +RFLW + P +V  +      VP E+  G + R  +V WAPQ+EVL H
Sbjct  311   LMEFWYGLVNSKKRFLWVIRPDMVAGED-NNDRVPAELEEGTKERGFIVGWAPQEEVLEH  369

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              A+GGFLTH GWNS +ES+VAGVPMI WP++ADQQ+NSRF+ EVWK+GLDMKD CDR ++
Sbjct  370   KAIGGFLTHSGWNSTLESVVAGVPMICWPYFADQQINSRFVSEVWKVGLDMKDVCDRDVV  429

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             EKMV DLM  R++EFL  AK  A  A +    GGSS SSL +LI+ IK
Sbjct  430   EKMVNDLMVHRREEFLNSAKAMAKLAHKSVSPGGSSYSSLLDLIQYIK  477



>ref|XP_011085130.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=472

 Score =   396 bits (1017),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 205/473 (43%), Positives = 289/473 (61%), Gaps = 26/473 (5%)
 Frame = +3

Query  147   AYPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
              +PFP  SH++ MLNLA++  +S  ++TF+   H +     F  +  RF  Y  F F+ I
Sbjct  14    VFPFPVQSHVNVMLNLAEIFSISGFQITFLIPDHIQTGPR-FDQISLRFARYPAFYFQAI  72

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG--GEDSAPQRCIIADGFA  494
              DGLP     DH  +G  + +L  S++ T KP  + ++ +        AP  CIIADG  
Sbjct  73    SDGLPL----DHPRTGDRVKELFDSINVTTKPQFRNVLKSRALSSNSRAPLTCIIADGIM  128

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-GKDMDEPILSVKGMEK  671
             +F +D+A+  G+P + F P SA   W  F +P LIQAGELP     DMD  + ++ GME+
Sbjct  129   SFTIDIAQNFGIPTVLFRPFSATCFWTLFCVPKLIQAGELPLKEDSDMDRLVENIPGMER  188

Query  672   LLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
             +LR RDLP  CRV+D  DP  + ++ E  +       I+N+ ++LE   L ++R  +   
Sbjct  189   VLRVRDLPSFCRVEDAADPQLQHVVSETHRATGAHSLILNTLEDLEEPALARIR-ANFPK  247

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             +Y IGPLH   R            S N L+E  + C++WLD QP  SV++V FG +T++ 
Sbjct  248   LYVIGPLHGYFRP---------LWSPNSLNEQHRSCIEWLDDQPLKSVVFVSFGNMTVLK  298

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              + L EFW+GL+NSG+ FLW +   L    ++     PTE++ G      VV+WAPQ+EV
Sbjct  299   SQQLVEFWYGLVNSGKPFLWVVPANLTAGCRI-----PTELIEGSGKSGKVVDWAPQEEV  353

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             L+H A GGFLTH GWNS +ESI  GVPMI WPFYADQQVNSR + EVW++G+DMKD CDR
Sbjct  354   LSHPATGGFLTHGGWNSTLESIYEGVPMICWPFYADQQVNSRLVEEVWRVGVDMKDICDR  413

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
               +EK VR+LMEVR++EFL+ +K  A  A++   EGGSS ++L+ LI+DIK M
Sbjct  414   KTVEKAVRELMEVRREEFLKSSKDIARLARKSISEGGSSYANLDCLIKDIKHM  466



>gb|AFJ53009.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=485

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 217/477 (45%), Positives = 302/477 (63%), Gaps = 21/477 (4%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSG-FRFETIPD  326
             YP   H+ SMLNLA+LLCLS+++VTF  + H +  LL F+ V SRF  Y   F F+TI D
Sbjct  16    YPLQGHVTSMLNLAELLCLSNIRVTFFNSDHIQRRLLQFTSVQSRFAKYPYLFHFQTISD  75

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAV  506
             GLP     DH  SG  ++ L  S+S+  +P  KE++++    +  P  C+I+DG   F V
Sbjct  76    GLP----PDHSRSGKDVLDLFLSMSSITRPLFKELLIS----NQPPIDCVISDGGLEFTV  127

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF---NGKDMDEPILSVKGMEKLL  677
             +VA+EVG+P++ F  + A+  W YF IP +I+AGELP      +DM+  I  V G E  L
Sbjct  128   EVADEVGIPLVYFRTIGASCFWVYFCIPDIIEAGELPIRVEEEEDMERVITKVPGAEGFL  187

Query  678   RRRDLPGNCRVDDLEDPFFKFMMEF-RKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R RDLP  CRV DL DPF + ++   RK  +    I+N+F++LEG  L ++R       Y
Sbjct  188   RCRDLPSLCRVGDLSDPFLQAIVSTTRKSPKAYALILNTFEDLEGPILGRIRT-RCPKTY  246

Query  855   AIGPLHELLRNKLGSCNV---TLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
              IGP+HE LR KL +      + ++SS+ L E+ + CM WLD QPP SVLYV FG++T++
Sbjct  247   PIGPIHEQLRLKLVNLKTPQESSSSSSSSLWEEDRSCMKWLDLQPPKSVLYVNFGSITVM  306

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNG-LEGRCCVV--EWAP  1196
               E L E WHGL+NS Q+FLW +    + + +    E P E++ G  +G   +V   W  
Sbjct  307   KPEELVEIWHGLINSKQKFLWVIRQGTITSIE-NTSEFPEELVKGGSKGDEFMVLSGWVA  365

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q+EVL H ++GGFLTH GWNS +E+IVAGVPMI  P++ADQQVNSRF  EVWK+GLDMKD
Sbjct  366   QKEVLDHESIGGFLTHSGWNSTLETIVAGVPMICLPYFADQQVNSRFTSEVWKLGLDMKD  425

Query  1377  TCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +C+R ++E+MV +LM  RK+EF + A + A  A       G S  +LE+LIE+I+ M
Sbjct  426   SCERGVVERMVNELMVERKEEFGRCAAKMAELAGMSVSSDGCSSRNLEDLIEEIRSM  482



>ref|XP_006373896.1| hypothetical protein POPTR_0016s10010g [Populus trichocarpa]
 gb|ERP51693.1| hypothetical protein POPTR_0016s10010g [Populus trichocarpa]
Length=486

 Score =   396 bits (1017),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 213/473 (45%), Positives = 293/473 (62%), Gaps = 19/473 (4%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  H+  ML LA+LL  +  + TFI + H ++ L   +D+ + +  +  F+F +IPD
Sbjct  13    PFPAQGHVKPMLMLAELLSHAGFEATFINSNHIQHRLEHSTDIATMYCRFPKFQFRSIPD  72

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS--APQRCIIADGFANF  500
             GLP     DH  SG  I QLL +     +   + ++V  G ++    P  CIIADG  +F
Sbjct  73    GLP----SDHPRSGSSISQLLIASRDETRTEFRNLLVNLGQKNGRWEPPTCIIADGIMSF  128

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLL  677
             A+D+AEE+ +P+I+F   SA  TW YF +  LI+ GE+PF G  DMD+ I  + G+E  L
Sbjct  129   AIDIAEELTIPVITFRTFSACCTWTYFHLTKLIEEGEVPFQGDVDMDKTITCIPGLEGTL  188

Query  678   RRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN-V  851
             R RDLP  CR  +  DP F+F + E     R    I+N+F  LE S +   ++G   + +
Sbjct  189   RYRDLPSICRRKEANDPLFQFFIKETAAMPRASGLILNTFDRLEASMVS--KLGSFFSKI  246

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGL-HEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             Y +GPL  L      S +    TSSNGL  ++ + CM WLD  P  SV+YV FG+L  + 
Sbjct  247   YTLGPLQGLFDTFAESPSAR--TSSNGLLWKEDRGCMTWLDSHPSRSVIYVSFGSLVGLF  304

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              + L EFWHGL+NSG+ FLW +    ++ +     EVP ++    E R C+V+WAPQ+EV
Sbjct  305   RDQLLEFWHGLVNSGKPFLWVIRSDSIMEED-GVSEVPLQLKAATEERGCIVDWAPQEEV  363

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH A+GGFLTH GWNS +ESI AGVPMI WP  ADQQVNSR + E+WKIG DMKD C+R
Sbjct  364   LAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMIADQQVNSRCVSELWKIGFDMKDKCER  423

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              +IEK+VRDLME   DE ++   +FA  A++  KEGGSS S+L+ L+EDIK M
Sbjct  424   AVIEKLVRDLME--SDEIVKSTDEFAGMARDSVKEGGSSYSNLQKLVEDIKSM  474



>ref|XP_010032069.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51454.1| hypothetical protein EUGRSUZ_J00979 [Eucalyptus grandis]
Length=479

 Score =   395 bits (1015),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 209/473 (44%), Positives = 291/473 (62%), Gaps = 30/473 (6%)
 Frame = +3

Query  165   HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLP--H  338
             H++SML LA+LL LS L++TFI + H  + LL  +D+ +RF  Y  F+F+ I DG P  H
Sbjct  21    HVNSMLKLAELLALSGLRITFINSEHIHHRLLQHADIPARFAAYPDFQFKIISDGFPIHH  80

Query  339   GLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR---CIIADGFANFAVD  509
                 DH       +     + +  K   +E+V       SAP R   CIIADG   F +D
Sbjct  81    PRPSDH------FLTTFDYVKSITKQLFEELV-------SAPDRPVTCIIADGILTFTID  127

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLRRR  686
              A ++GVP+I+F  +SA+  W YF IP +I++G+LP  G +DMD  + SV GME +LR R
Sbjct  128   FAGDLGVPVIAFRTISASCFWTYFCIPRMIESGDLPIKGDEDMDRDVTSVPGMEDILRCR  187

Query  687   DLPGNCRVDDLEDPFFKFMMEFRKCFRT---KHHIINSFQELEGSTLDQMRIGDMLNVYA  857
             DLP  CRV DL D   +++    +  RT   +  I+NSF  LEG  + Q+R     N+Y 
Sbjct  188   DLPSFCRVADLSDWLLQYVTT--QTLRTTGARALILNSFDHLEGPAISQIRT-HFPNLYT  244

Query  858   IGPLHELLRNKLGSCNVTLTTSSNG---LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             IGPLH   +++L S + +    S+    L E  + C+ WLD+QPP SV+YV FG++T ++
Sbjct  245   IGPLHLHHKSRLSSSSPSSPPPSSASNSLWEVDRSCISWLDKQPPKSVIYVSFGSITTLT  304

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
                  EFW+GL+NSG+RFLW + P  + +     G VP E+      R C+V WAPQ+EV
Sbjct  305   RHDFTEFWYGLVNSGRRFLWVIRPDSLADGG--NGAVPEELREAAAERGCIVGWAPQEEV  362

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             L H AV  FLTH GWNS +ES+VAG PM+ WPF ADQQ+NSR +  +WK+GLDMKD CDR
Sbjct  363   LDHGAVAAFLTHSGWNSTLESVVAGKPMVCWPFSADQQLNSRLVSHLWKVGLDMKDVCDR  422

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              ++E+MV ++M  RK+EF   A   A  A++ A EGGSS  +L+ LIED++ M
Sbjct  423   EVMERMVNEVMGERKEEFAAAAGDLARRARDAASEGGSSWDNLDRLIEDVRSM  475



>gb|KHG01935.1| UDP-glycosyltransferase 85A1 [Gossypium arboreum]
Length=948

 Score =   407 bits (1047),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 218/473 (46%), Positives = 298/473 (63%), Gaps = 15/473 (3%)
 Frame = +3

Query  147   AYPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
              +PFP   HI+SM+ LA+LL L+  K+TF+ + +    L+ F+++ + F  Y GF F+TI
Sbjct  16    VFPFPLQGHINSMIKLAELLALAGFKLTFLNSHYNHERLVKFNNIAAHFERYQGFEFKTI  75

Query  321   PDGLPHGLTDDHRSSGVGIVQLLH-SLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFAN  497
              DGLP     DH  SG   + +   +L    KP L+E++       S P  CIIADGF  
Sbjct  76    TDGLPL----DHPRSGNWFLDMYEEALEMKMKPGLREMLENI----SPPVDCIIADGFLG  127

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKL  674
             FA+DVA+E+ +PII F   S  + W Y+SIP +IQAGELP  G +DMD  + +V GME  
Sbjct  128   FAIDVAKELEIPIIYFRTSSPCSFWVYYSIPDIIQAGELPIKGSEDMDRLLTTVPGMETY  187

Query  675   LRRRDLPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
              R RDLP  CR  D+ED   K ++ + +K  +    I+N+ +EL+G  L Q+R      V
Sbjct  188   FRCRDLPSFCRETDIEDSIIKLYVKQTQKSSQADALILNTAEELDGPILSQIRT-KCPRV  246

Query  852   YAIGPLHELLRNKLGSCN-VTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             YAIGPLH  L  +L + +  +    SN L E  K C+ WLD+QP  SV+YV FG++T  S
Sbjct  247   YAIGPLHAQLNTRLKAKHGESYDHFSNTLWEVDKSCIFWLDKQPNRSVIYVSFGSITSTS  306

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E L E W+GL+NS  +FL  + P  V+ K  E  +V  E++   + +  +V WAPQ+ V
Sbjct  307   REQLVELWYGLLNSKTKFLLVVRPNSVIGKDGEGEDVVVELMEKSKDQGYIVNWAPQEAV  366

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             L H  VGGF TH GWNS +ESIVAGVPMI WP++ADQQVNSR + EVWKIGLDMKD CD+
Sbjct  367   LNHPTVGGFFTHNGWNSTLESIVAGVPMICWPYFADQQVNSRVVSEVWKIGLDMKDVCDK  426

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              I+EKMV+D+M  +K+EF+Q A + A    +    GGSS S+L++LIEDI+ M
Sbjct  427   KIVEKMVKDVMVDQKEEFVQSAAETAKVTNQSVNVGGSSYSNLDHLIEDIRIM  479


 Score =   379 bits (974),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 201/456 (44%), Positives = 282/456 (62%), Gaps = 14/456 (3%)
 Frame = +3

Query  186   LAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDHRSS  365
             LA+LL L+  K+TF+ + H    L+ F+ +++ F+ Y GF  +TI DGLP     DH  S
Sbjct  489   LAELLALAGFKLTFLNSHHNHERLIKFTSIVAYFKRYPGFELKTITDGLPL----DHPRS  544

Query  366   GVGIVQLLH-SLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEVGVPIIS  542
             G   ++    ++    K   +E+++ S    + P  C+IADGF+ +A+DVA E+G+PII 
Sbjct  545   GNWFLETYEEAILMKIKQSFREMMINS----NPPVDCVIADGFSGYAIDVANELGIPIIG  600

Query  543   FHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLRRRDLPGNCRVDDL  719
             F   S  + W Y+SI  +I+AGELP  G +DMD  I +V GME  LR RDLP  CR  D+
Sbjct  601   FRTSSPRSFWVYYSITDIIKAGELPIRGSEDMDRLITTVPGMETYLRCRDLPSFCRKPDI  660

Query  720   EDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLG  896
             ED   + ++ + RK  +    I N+  EL+   L Q+R     N+Y IGPLH  L  +L 
Sbjct  661   EDSTVQLIVKQTRKSTQADALIFNTTDELDEPILSQIRT-KCANIYPIGPLHAQLNTRLK  719

Query  897   SCN-VTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSG  1073
             + +  +    SN L E+ K C+ WLD+QP  SV+YV FG++T  S + L E W+GL+NS 
Sbjct  720   AKHGESFDQFSNTLREEDKSCIPWLDKQPNRSVIYVSFGSITSTSRDQLVELWYGLLNSK  779

Query  1074  QRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGW  1253
              +FL+ + P  V+ K  E  +   E++   + R  +V+WAPQ+ VL H AVGGFLTH GW
Sbjct  780   TKFLFVVRPDSVIGKDGEGEDFVKELMEKSKDRGYIVDWAPQEVVLNHEAVGGFLTHSGW  839

Query  1254  NSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRK  1433
             NS +ESIVAGVPM+ WP++ADQQV SR +  VWKIGLDMKD  DR I+EKMV D+M V +
Sbjct  840   NSTLESIVAGVPMVCWPYFADQQVTSRVVSTVWKIGLDMKDVSDRKIVEKMVNDVM-VDQ  898

Query  1434  DEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
              EF+  A   A    +C   GGSS ++L+ LIEDI+
Sbjct  899   KEFVNSATDMAKVINQCVSIGGSSSNNLDRLIEDIR  934



>ref|XP_011014019.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Populus euphratica]
Length=496

 Score =   394 bits (1011),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 213/473 (45%), Positives = 293/473 (62%), Gaps = 19/473 (4%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  H+  ML LA+LL  +  + TFI + H ++ L    ++ + +R +  F+F ++ D
Sbjct  23    PFPAQGHVKPMLMLAELLSQAGFEATFINSNHIQHRLEHSINIATMYRRFPKFQFRSVTD  82

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS--APQRCIIADGFANF  500
             GLP     DH  S   IVQLL S     +   + ++V  G ++    P  CIIADG  +F
Sbjct  83    GLP----SDHPRSSSSIVQLLISARDETRTEFRNLLVNLGQKNGRWEPPTCIIADGIMSF  138

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLL  677
             A+D+AEE+ +P+I+F   SA  TW YF +  LI+ GE+PF G  DMD+ I  + G+E  L
Sbjct  139   AIDIAEELTIPVITFRTFSACCTWTYFHLTKLIEQGEVPFQGDVDMDKTITCIPGLEGTL  198

Query  678   RRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN-V  851
             R RDLPG CR+ +  DP  +F + E     R    I+N+F  LE S +   ++G   + +
Sbjct  199   RCRDLPGICRLKEANDPLLQFFIKETAAMPRAYGVILNTFDGLEASMVS--KLGSFFSKI  256

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGL-HEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             Y +GPL  L      S +    TS NGL  ++ + C+ WLD  P  SV+YV FG+L  + 
Sbjct  257   YTLGPLQGLFDTFAKSPSAR--TSFNGLLWKEDRGCISWLDFHPSRSVIYVSFGSLVCLV  314

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              + L EFWHGL+NSG+ FLW L    +L +     EVP E+    E R C+V+WAPQ+EV
Sbjct  315   RDQLLEFWHGLVNSGKPFLWVLRSDSILGED-GVSEVPLELKAATEERGCIVDWAPQEEV  373

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH A+GGFLTH GWNS +ESI AGVPMI WP +ADQQVNSR + E+WKIG DMKD C+R
Sbjct  374   LAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMFADQQVNSRCVSELWKIGFDMKDKCER  433

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              +IEK+VRDLME   DE ++   +FA  A++  KEGGSS S+L+ LIEDIK +
Sbjct  434   AVIEKLVRDLME--SDEIVKSTDEFARMARDSVKEGGSSYSNLQKLIEDIKSI  484



>gb|KDO38335.1| hypothetical protein CISIN_1g044936mg [Citrus sinensis]
Length=455

 Score =   392 bits (1007),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 199/461 (43%), Positives = 285/461 (62%), Gaps = 14/461 (3%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDH  356
             ML LA+L   +  +VTF+ T    + LL  +DV   ++ +  FRF +IPDGLP     D+
Sbjct  1     MLTLAELFSHAGFRVTFVNTEQYHDRLLGNTDVTGFYKRFPNFRFTSIPDGLPP----DN  56

Query  357   RSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEVGVPI  536
                G+ I     S    +K   + +++T G   +    CII+D   +F +DVAEE+ +PI
Sbjct  57    PRFGIYIKDWFCSDKPVSKLAFRRLLMTPGRLPT----CIISDSIMSFTIDVAEELNIPI  112

Query  537   ISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDLPGNCRVDD  716
             I+F P SA  +W+ F    L + GELP   +D D+P+  + G+E + R RDLP  CR   
Sbjct  113   ITFRPYSAHCSWSDFHFSKLAEEGELPVTNEDFDKPVTCIPGLENIFRNRDLPSICRDGG  172

Query  717   LEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKL  893
              +DP  + F+ +     RT   +IN+F E+EG  + ++    +  +Y +GPLH LL++++
Sbjct  173   PDDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKLG-SRLTKIYTVGPLHALLKSRI  231

Query  894   --GSCNVTLTTSSNG-LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLM  1064
                S   +   S+N  L ++ + CM WLD QP  +VLYV FG+   +  E + EFWHG++
Sbjct  232   QEDSAESSPPESNNCVLSKEDRSCMTWLDSQPSGTVLYVSFGSFIKLGREQILEFWHGMV  291

Query  1065  NSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTH  1244
             NSG+RFLW +   L+ + +   G VP E+  G + R C+V WAPQ+EVLAH A+GGFLTH
Sbjct  292   NSGKRFLWVIRSDLI-DGEPGVGPVPVELDQGTKERGCIVSWAPQEEVLAHQAIGGFLTH  350

Query  1245  CGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLME  1424
              GWNS +ES+VAGVPMI WP   DQQVNSR + E+WKIGLDMKDTCDR  IE +VRDLM+
Sbjct  351   SGWNSTLESMVAGVPMICWPQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTIENLVRDLMD  410

Query  1425  VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              ++DE ++   + A  A++  KEGGSS  +LE LIEDI+ M
Sbjct  411   NKRDEIMESTVKIAKMARDAVKEGGSSYRNLEKLIEDIRSM  451



>ref|XP_004150245.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   393 bits (1009),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 212/474 (45%), Positives = 295/474 (62%), Gaps = 21/474 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P+  H++ ML  A+LL LS ++VTF+TT H+   L   SDV+ RF  +  F+F TI 
Sbjct  14    FPAPAQGHLNVMLKFAELLSLSSIRVTFLTTEHSYRQLTLHSDVLPRFSLFPSFQFRTIS  73

Query  324   DGLP--HGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFAN  497
             DGLP  H  T  H      + ++LHS  +  KP  ++++++     S+   C+I DGF +
Sbjct  74    DGLPLSHPRTFSHH-----LPEMLHSFVSVTKPLFRDMLLSP--HFSSDLTCLILDGFFS  126

Query  498   FAVDVAEE-VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEK  671
             + +D+ ++ V VP+  F    A +TW   SIP+LI+ G+L   G+ DMD  + +V GME 
Sbjct  127   YLLDIDDDFVKVPVFCFRTFGACSTWTILSIPNLIKQGQLTIKGEEDMDRILDNVPGMEN  186

Query  672   LLRRRDLPGNCRVDDLE-DPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
             LLR RDLPG CR  D   DP  +F+M  F +  +    I+N+F++LEG  L  +R     
Sbjct  187   LLRCRDLPGFCRATDPNNDPILQFIMSTFIRSTKFSALIMNTFEDLEGPILSNIRTL-CP  245

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
             N+Y+IGPLH LL+ KL       T S N L E  + C+ WLD Q   SV+YV FG++T++
Sbjct  246   NLYSIGPLHALLKTKLNH----ETESLNNLWEVDRSCLTWLDNQAAGSVIYVSFGSITVM  301

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQE  1205
                 L EFWHGL+NSG+RFLW + P LV  K  E  E+P E+  G + R  +V W PQ++
Sbjct  302   GNRELLEFWHGLVNSGRRFLWVIRPDLVKGKNGEI-EIPAELEEGTKQRGYMVGWTPQEK  360

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VL H AVGGFLTH GWNS +ESIVAG PMI WP+  DQ VNSRF+  VW +GLDMKD CD
Sbjct  361   VLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQLVNSRFVSNVWNLGLDMKDLCD  420

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R  + KMV D+M  RK+EF++ A + AN A+     GGSS ++ + L+EDI+ +
Sbjct  421   RETVAKMVNDVMVNRKEEFVRSATEIANLARRSVNPGGSSYANFDRLVEDIRNL  474



>ref|XP_011084985.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=495

 Score =   392 bits (1008),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 209/480 (44%), Positives = 297/480 (62%), Gaps = 25/480 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SMLNLA+LLCLS L VT + + +A N LL  + + S F  +SGFR  T  DGL
Sbjct  20    PLQGHVNSMLNLAELLCLSGLHVTILLSNYAHNRLLRHASLRSLFSRHSGFRVATFSDGL  79

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATA-KPFLKEIVVTSGGEDSAPQR---CIIADGFANF  500
             P     DH  +G  ++ L  SL       F + +  T G  D   +R   C+I DG  +F
Sbjct  80    PA----DHPRAGERLMDLAFSLKELGGSQFRRLMESTDGLSDGGARRGVSCLIIDGLLSF  135

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-----------DMDEPI  647
              + V EE+G+P I F  + A + W +F I  +I AGE+P  GK           +MD  +
Sbjct  136   IISVVEEMGIPYIYFRTIGACSFWPHFCIQEIIDAGEVPLKGKNEDKLTYWKKKEMDMMV  195

Query  648   LSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQ  824
              SV GMEK+LRRRD+P +  V + +DP FK M  + ++       I+N+F++LE   LDQ
Sbjct  196   TSVPGMEKVLRRRDIPRSFGVANGDDPTFKTMKTDTKRTVEACGLILNTFEDLEAPILDQ  255

Query  825   MRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTS-SNGLHEDGKKCMDWLDRQPPNSVLYV  1001
             +R   + N+Y+IGP+H LL+++L S  +  + + S+ L E+ + C+ WLD QP  SV+YV
Sbjct  256   IR-KHIPNLYSIGPIHALLKDRLESEGMESSHNYSSSLWEEDRSCIAWLDSQPTCSVIYV  314

Query  1002  CFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCV  1181
              FG++T ++ + L EFW+GL+NSG +FLW + P  +        E+P E+  G + R  +
Sbjct  315   SFGSITTLTRDELLEFWYGLVNSGHKFLWVMRPDSISGNG---NEIPVELEEGTKSRGWM  371

Query  1182  VEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIG  1361
             V W PQQEVLAH A+G F TH GWNS +ESI  G+PM+ WP++ADQ  NSRF+ EVWK+G
Sbjct  372   VGWVPQQEVLAHPAIGAFFTHSGWNSTIESIAIGLPMLCWPYFADQMTNSRFVSEVWKVG  431

Query  1362  LDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             LDMKDTCDR  +EKMV++ M+VR+DEF +RA   A  A++   EGG+S  +L  LIE +K
Sbjct  432   LDMKDTCDRITVEKMVKEAMDVRRDEFSKRAHNMAMLARKAISEGGTSYLNLNRLIEFLK  491



>ref|XP_004172562.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   392 bits (1007),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 212/474 (45%), Positives = 296/474 (62%), Gaps = 21/474 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P+  H++ ML LA+LL LS ++VTF+TT H+   L   SDV+ RF  +  F+F TI 
Sbjct  14    FPAPAQGHLNVMLKLAELLSLSSIRVTFLTTEHSYRQLTLHSDVLPRFSLFPSFQFRTIS  73

Query  324   DGLP--HGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFAN  497
             DGLP  H  T  H      + ++LHS  +  KP  ++++++     S+   C+I DGF +
Sbjct  74    DGLPLSHPRTFSHH-----LPEMLHSFVSVTKPLFRDMLLSP--HFSSDLTCLILDGFFS  126

Query  498   FAVDVAEE-VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEK  671
             + +D+ ++ V VP+  F    A +TW   SIP+LI+  +L   G+ DMD  + +V GME 
Sbjct  127   YLLDIDDDFVKVPVFCFRTFGACSTWTILSIPNLIKQEQLTIKGEEDMDRILDNVPGMEN  186

Query  672   LLRRRDLPGNCRVDDLE-DPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
             LLRRRDLPG CR  D   D   +F++  F +  +    I+N+F++LEG  L  +R     
Sbjct  187   LLRRRDLPGFCRATDPNNDLILQFIVSAFIRSTKFSALIMNTFEDLEGPILSNIRTL-CP  245

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
             N+Y+IGPLH LL+ KL       T S N L E  + C+ WLD Q   SV+YV FG++T++
Sbjct  246   NLYSIGPLHALLKTKLNHE----TESLNNLWEVDRSCLTWLDNQAAGSVIYVSFGSITVM  301

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQE  1205
                 L EFWHGL+NSG+RFLW + P LV  K  E  E+P E+  G + R  +V W PQ++
Sbjct  302   GNRELLEFWHGLVNSGRRFLWVIRPDLVKGKNGEI-EIPAELEEGTKQRGYMVGWTPQEK  360

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VL H AVGGFLTH GWNS +ESIVAG PMI WP+  DQQVNSRF+  VW +GLDMKD CD
Sbjct  361   VLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQQVNSRFVSNVWNLGLDMKDLCD  420

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R  + KMV D+M  RK+EF++ A + AN A+     GGSS ++ + L+EDI+ +
Sbjct  421   RETVAKMVNDVMVNRKEEFVRSATEIANLARRSVNPGGSSYANFDRLVEDIRNL  474



>ref|XP_011014018.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Populus euphratica]
Length=498

 Score =   392 bits (1008),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 213/475 (45%), Positives = 293/475 (62%), Gaps = 21/475 (4%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  H+  ML LA+LL  +  + TFI + H ++ L    ++ + +R +  F+F ++ D
Sbjct  23    PFPAQGHVKPMLMLAELLSQAGFEATFINSNHIQHRLEHSINIATMYRRFPKFQFRSVTD  82

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS--APQRCIIADGFANF  500
             GLP     DH  S   IVQLL S     +   + ++V  G ++    P  CIIADG  +F
Sbjct  83    GLP----SDHPRSSSSIVQLLISARDETRTEFRNLLVNLGQKNGRWEPPTCIIADGIMSF  138

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK---DMDEPILSVKGMEK  671
             A+D+AEE+ +P+I+F   SA  TW YF +  LI+ GE+PF G    DMD+ I  + G+E 
Sbjct  139   AIDIAEELTIPVITFRTFSACCTWTYFHLTKLIEQGEVPFQGPGDVDMDKTITCIPGLEG  198

Query  672   LLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
              LR RDLPG CR+ +  DP  +F + E     R    I+N+F  LE S +   ++G   +
Sbjct  199   TLRCRDLPGICRLKEANDPLLQFFIKETAAMPRAYGVILNTFDGLEASMVS--KLGSFFS  256

Query  849   -VYAIGPLHELLRNKLGSCNVTLTTSSNGL-HEDGKKCMDWLDRQPPNSVLYVCFGTLTL  1022
              +Y +GPL  L      S +    TS NGL  ++ + C+ WLD  P  SV+YV FG+L  
Sbjct  257   KIYTLGPLQGLFDTFAKSPSAR--TSFNGLLWKEDRGCISWLDFHPSRSVIYVSFGSLVC  314

Query  1023  VSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQ  1202
             +  + L EFWHGL+NSG+ FLW L    +L +     EVP E+    E R C+V+WAPQ+
Sbjct  315   LVRDQLLEFWHGLVNSGKPFLWVLRSDSILGED-GVSEVPLELKAATEERGCIVDWAPQE  373

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             EVLAH A+GGFLTH GWNS +ESI AGVPMI WP +ADQQVNSR + E+WKIG DMKD C
Sbjct  374   EVLAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMFADQQVNSRCVSELWKIGFDMKDKC  433

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +R +IEK+VRDLME   DE ++   +FA  A++  KEGGSS S+L+ LIEDIK +
Sbjct  434   ERAVIEKLVRDLME--SDEIVKSTDEFARMARDSVKEGGSSYSNLQKLIEDIKSI  486



>ref|XP_006429244.1| hypothetical protein CICLE_v10013877mg [Citrus clementina]
 gb|ESR42484.1| hypothetical protein CICLE_v10013877mg [Citrus clementina]
Length=477

 Score =   391 bits (1005),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/470 (43%), Positives = 286/470 (61%), Gaps = 14/470 (3%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             YP   HI  ML LA+L   +  +VTF+ T    + LL  +DV   ++ +  FRF +IPDG
Sbjct  14    YPAYGHIKPMLTLAELFSHAGFRVTFVNTEQYHDRLLGNNDVTGFYKRFPNFRFTSIPDG  73

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVD  509
             LP     D+   G+ I     S    +K    +++++ G   +    CII+D   +F +D
Sbjct  74    LP----PDNPRFGIYIKDWFCSDKPVSKLAFLQLLMSPGLLPT----CIISDSIMSFTID  125

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRD  689
             VAEE+ +PII+F P SA  +W+ F    L + GELP   ++ D+P+  + G+E   R RD
Sbjct  126   VAEELNIPIITFRPYSAHCSWSDFHFSKLAEEGELPVTNENFDKPVKCIPGLENFFRNRD  185

Query  690   LPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGP  866
             LP  CR    +DP  + F+ +     R    +IN+F E+EG  + ++    +  +Y +GP
Sbjct  186   LPSICRDGGPDDPILQTFIRDTSATTRASALVINTFNEIEGPIISKLG-SRLTKIYTVGP  244

Query  867   LHELLRNKL--GSCNVTLTTSSNG-LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             LH LL++++   S   +   S+N  L ++ + CM WLD QP  SVLYV FG+   +  E 
Sbjct  245   LHALLKSRIQEDSAESSPPESNNCVLSKEDRSCMTWLDSQPSRSVLYVSFGSFIKLGREQ  304

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             + EFWHG++NSG+RFLW +   L+ + +   G VP E+  G + R C+V WAPQ+EVLAH
Sbjct  305   ILEFWHGMVNSGKRFLWVIRSDLI-DGEPGVGPVPVELDQGTKERGCIVSWAPQEEVLAH  363

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              A+GGFLTH GWNS +ES+VAGVPMI WP   DQQVNSR + E+WKIGLDMKDTCDR  I
Sbjct  364   QAIGGFLTHSGWNSTLESLVAGVPMICWPQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTI  423

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             E + RDLM+ ++D+ ++   Q A  A++  KEGGSS  +LE LIEDI+ M
Sbjct  424   ENLARDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLEKLIEDIRSM  473



>ref|XP_006361975.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Solanum tuberosum]
Length=470

 Score =   391 bits (1004),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 209/468 (45%), Positives = 287/468 (61%), Gaps = 68/468 (15%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LAQLL LS+  +TF+ T+   ++LL  +DVISRF   SGF  +   
Sbjct  10    FPFPAQGHVNSMLKLAQLLSLSNFDITFLVTLDTHDHLLNHTDVISRFG--SGFLLQ---  64

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
               LPHG++ D  ++  GI  L  SL+  AKPFL+E +  S      P  C+IADG  + A
Sbjct  65    -ALPHGISMDVMNTRDGISMLYDSLNKIAKPFLREFITYS------PVTCLIADGLLSLA  117

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              DVA+E+ +PII F   SA++ W+YF +P LIQ GELP   + +                
Sbjct  118   GDVAKEINLPIIYFRTASASSFWSYFCMPDLIQVGELPLKARGL----------------  161

Query  684   RDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
                                             I+N+F++LEG  L Q+R     NVY IG
Sbjct  162   --------------------------------ILNTFEDLEGPILSQIRTV-CPNVYTIG  188

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
              +H  L+ KL     T +TSSN L ++ +  M WLD QPP SV+YV FG++  +++E L 
Sbjct  189   AVHAHLKAKLA----TKSTSSNSLWQEDESWMSWLDTQPPKSVIYVSFGSVAGLTKEELL  244

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EFW+GL+NS Q+FLW + P L++ ++ ++ E+P E+  G + R  + +W PQ++VLAH A
Sbjct  245   EFWYGLVNSEQKFLWVMRPDLIIGRE-KKDEIPVELEQGTKARGYMADWVPQEKVLAHRA  303

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             +GGFLTH GWNS +ESIV GVPMI WP +ADQQVNSRF+GEVWK+GLD+KDTCDR II K
Sbjct  304   IGGFLTHSGWNSTLESIVEGVPMICWPRFADQQVNSRFVGEVWKMGLDIKDTCDRDIIAK  363

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              +RDLME R  EF QR +  A+ AK+   EGGSS  +L+ LI+DI+ M
Sbjct  364   SIRDLMEKRNGEFSQRTEHMASLAKKAVNEGGSSYINLDRLIQDIRSM  411



>gb|AFJ53008.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=487

 Score =   391 bits (1004),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 217/480 (45%), Positives = 303/480 (63%), Gaps = 26/480 (5%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSH---LKVTFITTVHARNNLLCFSDVISRFRCYSGFRFE  314
             +PFP   H++SML LA+LL L+    +++TF+ +    N LL FSD  SRF  Y GF+F+
Sbjct  15    FPFPVQGHVNSMLKLAELLSLAAGGGIRITFLNSDCTHNRLLQFSDAESRFSVYPGFQFK  74

Query  315   TIPDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFA  494
             TI D   H +  +  + G  ++ L+ ++ +  KP  ++++         P  C+I DG  
Sbjct  75    TIDD---HRIPMEKLTKGDKVLDLVGAMESEMKPDFRDML----SRMDPPVTCVIGDGLL  127

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
              F  +V+ E+G+P+I F  +S    W  + +P LI+AGELP   +DMD  I  V GME  
Sbjct  128   GFIREVSMELGIPVIRFRTISPCCFWVNYCLPDLIEAGELPI--QDMDRKISKVPGMESF  185

Query  675   LRRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             LR RDLPG CRV  L+DP    ++   R+       I+N+F++L+ S L Q+R       
Sbjct  186   LRSRDLPGMCRVSGLDDPTLVMLINATRESPPLSPLILNTFEDLDSSVLSQIR-RHFPQT  244

Query  852   YAIGPLHELLRNKL-----GSCNV--TLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFG  1010
             YAIGPLH+ L ++L     GS N   T ++SSN L ++   C+ WLD+QP  SVLYV FG
Sbjct  245   YAIGPLHQHLESRLRTMSFGSQNNINTQSSSSNSLWKEEASCLKWLDQQPEGSVLYVNFG  304

Query  1011  TLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEG-RCCVVE  1187
             ++T+++ + + EFW GL +S  RFLW + P L+ +K++E+  +P EILN  EG    VV 
Sbjct  305   SITVMTADRIVEFWEGLSSSKHRFLWVMRPGLIPDKELEK--IPQEILNQKEGFYKVVVG  362

Query  1188  WAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLD  1367
             WAPQ+EVL H+AVGGFLTH GWNS +ES+ AGVPMI WPF+ADQ VNSR + EV+ +GLD
Sbjct  363   WAPQEEVLNHAAVGGFLTHSGWNSTLESVAAGVPMICWPFFADQLVNSRVVSEVYNLGLD  422

Query  1368  MKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             MKD CDR ++E+MV DLM+ RKDEF   A + A  AK    EGGSS  +LE LI+DI+ M
Sbjct  423   MKDVCDRKVVERMVNDLMDERKDEFQSLAAKMAALAKGSVSEGGSSCRNLEVLIQDIRLM  482



>ref|XP_010316061.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   390 bits (1003),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 210/466 (45%), Positives = 286/466 (61%), Gaps = 16/466 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  S I+SML LA+L CL+ L+VTF+ T H +  L   ++V SRFR Y  FRF TI DGL
Sbjct  19    PIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTNVESRFRQYPKFRFRTISDGL  78

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDV  512
             P    DDH  S      L++SL A A+P L+EIV  SG        C+I DG   +AVD+
Sbjct  79    P----DDHPRSFPMFEDLINSLQAVAEPSLREIVTESG------VTCVIPDGLFYYAVDI  128

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDL  692
               EVGV +ISF  +S    W Y   P LIQ G++PF G D+D  I +V GME LLRRRD 
Sbjct  129   CNEVGVSVISFDTISPCCLWVYLCFPKLIQTGDIPFKGNDLDMLIENVPGMEDLLRRRDF  188

Query  693   PGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPL  869
             P     D   D + +  + E +   R+   I+N+F++L+G  L  +R       YA+GPL
Sbjct  189   PFYRLTDCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLSNIR-SHCPQTYAVGPL  247

Query  870   HELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEF  1049
             H  L+ +L    ++   SSN L E+    + WLD QP  SV+YV FG+L  +++E + EF
Sbjct  248   HLQLKTRLADKTMS---SSNSLWEEDHSSIQWLDAQPIESVIYVSFGSLATLTKEEMLEF  304

Query  1050  WHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVG  1229
             WHGL+NSG RFLW +   L+  ++    ++  E+ +G + R  +V WAPQ++VL+H A+G
Sbjct  305   WHGLVNSGIRFLWVMRSDLLREEEFSH-QLVKELADGCKERAYIVSWAPQEKVLSHPAIG  363

Query  1230  GFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMV  1409
             GFLTH GWNS MESIV   PMI W  Y DQ+V SRF+ EVWKIGLDMKD CDR  IEK+V
Sbjct  364   GFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVSEVWKIGLDMKDICDRDNIEKVV  423

Query  1410  RDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +DLM   K++  +   + +  A+    EGGSS ++ E L++DIK++
Sbjct  424   KDLMVTNKEKLKKSVDKLSMLAEISVGEGGSSYNAFEYLVDDIKKL  469



>ref|XP_006357780.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=489

 Score =   390 bits (1003),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 211/469 (45%), Positives = 286/469 (61%), Gaps = 19/469 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  S I+SML LA+L CL+ L+VTF+ T H +  L   ++V SRF+ Y  F+F TI DGL
Sbjct  23    PIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTNVESRFKQYPKFQFRTISDGL  82

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDV  512
             P     DH  S +    L+ SL A A+PFL+EI++   G    P  C+I DG   +AVD+
Sbjct  83    P----KDHPRSSLLFGDLITSLQAVAEPFLREILL---GVTEPPVTCVIPDGLFYYAVDI  135

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDL  692
               EVGV +ISF  +S    W Y   P LIQ+G++PF G D+D  I +V GME LLRRRD 
Sbjct  136   CNEVGVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKGNDLDVLIENVPGMEDLLRRRDF  195

Query  693   P----GNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             P     NC  D       K   E +   R+   I+N+F++L+G  L  +R       YA+
Sbjct  196   PFYRLTNCATDLYCQLALK---EIQSIPRSHGLILNTFEDLDGPLLSLIR-SHCPQTYAV  251

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L+ +L    ++   SSN L E+    + WLD  P  SV+YV FG+L  ++++ +
Sbjct  252   GPLHLQLKTRLADKTMS---SSNSLWEEDHSSIQWLDAHPTESVIYVSFGSLATLTKKEI  308

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSG RFLW +   L+  ++     V  E+ +G E R  +V WAPQ++VL+H 
Sbjct  309   LEFWHGLVNSGIRFLWVMRSDLLREEEFSHQFV-KELTDGCEERAYIVSWAPQEKVLSHP  367

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS MESIV   PMI W  Y DQ+V SRF+GEVWKIGLDMKD CDR+IIE
Sbjct  368   AIGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDRYIIE  427

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             K V++LM   KD+  +   + +  A+    EGGSS ++ E L+ DIK++
Sbjct  428   KAVKELMVTNKDKLKKSVDKLSMLAEISVGEGGSSYNAFEYLVNDIKKL  476



>ref|XP_004162780.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   390 bits (1002),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 212/472 (45%), Positives = 293/472 (62%), Gaps = 21/472 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P+  HI+ ML  A+LL LS ++VTF+TT H+   L   SDV+ RF  +  F+F TI 
Sbjct  14    FPVPAQGHINVMLKFAELLSLSSIRVTFLTTEHSYRQLTLHSDVLPRFSLFPSFQFRTIS  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP       R     + ++LHS  +  KP  ++++++     S+   C+I DGF ++ 
Sbjct  74    DGLP---LSHPRIFAHHLTEMLHSFVSVTKPLFRDMLLSP--HFSSDLTCLILDGFFSYL  128

Query  504   VDVAEE-VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD-MDEPILSVKGMEKLL  677
             +D+ ++ V VP   F    A +TW   SIP+LI+ G+LP  G+D MD  + +V GME LL
Sbjct  129   LDIDDDFVKVPTFCFRTSGACSTWTILSIPNLIKQGQLPIKGEDDMDRILDNVPGMENLL  188

Query  678   RRRDLPGNCRVDDLE-DPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             R RDLPG CR  D   DP  +F+M  F +  +    I+N+F++LEG  L  +R     N+
Sbjct  189   RCRDLPGFCRATDPNNDPILQFIMSTFIRSTKFSALIMNTFEDLEGPILSNIRTL-CPNL  247

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y+IGPLH LL+ KL       T S N L E  + C+ WLD Q   SV+YV FG++T++  
Sbjct  248   YSIGPLHALLKTKL----THETESLNNLWEVDRSCLTWLDNQAAGSVIYVSFGSITVMGN  303

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEV--PTEILNGLEGRCCVVEWAPQQE  1205
               L EFWHGL+NSG+ FLW + P L+   K E GE+  P E+  G + R  +V W PQ++
Sbjct  304   RELMEFWHGLVNSGRSFLWVIRPDLL---KGENGEIEIPAELEEGTKQRGYMVGWTPQEK  360

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VL H AVGGFLTH GWNS +ES+VAG PMI WP+  DQ VNSRF+  VW +GLDMKD CD
Sbjct  361   VLCHEAVGGFLTHSGWNSTLESMVAGKPMICWPYGFDQLVNSRFVSNVWNLGLDMKDLCD  420

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             R  + KMV D+M  RK+EF++ A + AN A++    GGSS ++ + LIEDIK
Sbjct  421   RETVAKMVNDVMVNRKEEFVRSATEIANLARQSVNPGGSSYANFDRLIEDIK  472



>ref|XP_003517688.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Glycine max]
Length=481

 Score =   389 bits (1000),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 208/468 (44%), Positives = 284/468 (61%), Gaps = 10/468 (2%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P P H+ SML LA+LL L ++ VTF+ T +    L  F D+     CY    F+TIPD  
Sbjct  12    PLPGHLGSMLKLAELLALDNIHVTFVDTENIHIRLTRFGDIQELSECYPTLHFKTIPDC-  70

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADG-FANFAVD  509
              +    +H   G  +   + S +  AKPFL++I+V+          CII DG F   + D
Sbjct  71    -YDEEGEHPGFGDRVGDFITSTAQHAKPFLRDILVSQHSPGIPKVSCIIQDGIFGALSSD  129

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLLRRR  686
              A E+ +P+I F  VS+   WAYF +P L+   ELP  G+ DMD  I ++ GME LLR R
Sbjct  130   FAAELRIPLIHFRTVSSCCFWAYFCVPKLLDCKELPIKGEEDMDRIIRNMPGMENLLRCR  189

Query  687   DLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLP  CR  + E  F ++ +   R+       ++N+F++LEGS L QM       +Y IG
Sbjct  190   DLPSFCR-PNTEGNFLEWAVFRTRQSLAADALMLNTFEDLEGSVLSQMG-QHFPKLYTIG  247

Query  864   PLHELLRNKLGSCNVT--LTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             P+H  L+ +    N    + T  N L +  + CM WL+ QP  SV+YV FG+ T+V  E 
Sbjct  248   PIHHHLKIRKAESNKAKDIPTFKNSLFQVDRSCMAWLEAQPQGSVIYVSFGSSTIVKRED  307

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L E WHGL+NS +RFLW + P +V  K  +   +P E+  G   R  +V WAPQ++VLAH
Sbjct  308   LMEIWHGLVNSKKRFLWVMRPDIVAAKDND-DRIPAEVEEGTRERGLIVGWAPQEDVLAH  366

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              AVGGF TH GWNS ++S+VAGVPMI WP++ADQQ+NSRF+ EVWK+GLDMKD CDRH++
Sbjct  367   KAVGGFFTHNGWNSTLDSVVAGVPMICWPYFADQQINSRFVSEVWKLGLDMKDVCDRHVV  426

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             EKMV DLM  RK+EFL+ A++ A  A +    GGSS SS ++LI+ IK
Sbjct  427   EKMVNDLMVHRKEEFLKSAQEMAMLAHKSVTPGGSSYSSFDDLIQYIK  474



>ref|XP_011000049.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Populus 
euphratica]
Length=486

 Score =   389 bits (1000),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 212/473 (45%), Positives = 290/473 (61%), Gaps = 19/473 (4%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  H+  ML LA+LL  +  + TFI + H ++ L   +++ + +  +  F+F +IPD
Sbjct  13    PFPAQGHVKPMLMLAELLSQAGFEATFINSNHIQDRLEHSTNIATMYGRFPKFQFRSIPD  72

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS--APQRCIIADGFANF  500
             GLP     DH  SG  I QLL S     +   + ++V  G ++    P  CIIADG  +F
Sbjct  73    GLP----SDHPRSGSSISQLLISNRDETRTEFRNLLVNLGQKNGRWEPPTCIIADGIMSF  128

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLL  677
             A+D+AEE+ +P+I+F   SA  TW YF +  LI+ GE PF G  DMD+ I  + G+E  L
Sbjct  129   AIDIAEELTIPVITFRTFSACCTWTYFHLTKLIEEGEFPFQGDVDMDKTITCIPGLEGTL  188

Query  678   RRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN-V  851
             R RDLPG CR+ +  DP  +F + E     R    I+N+F  LE S +   ++G   + +
Sbjct  189   RCRDLPGICRLKEANDPLLQFFIKETAAMPRASGLILNTFDGLEASMVS--KLGSFFSKI  246

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGL-HEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             Y +GPL  L      S +    TS NGL  ++ + C+ WLD  P  SV+YV FG+L  + 
Sbjct  247   YTLGPLQGLFDTFAKSPSAR--TSFNGLLWKEDRGCITWLDSHPSRSVIYVSFGSLVGLF  304

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              + L EFWHGL+NSG+ FLW L    ++ +     EVP E+    E R C+V+WAPQ+EV
Sbjct  305   RDQLLEFWHGLVNSGKPFLWVLRSDSIIGED-GVSEVPLELKAATEERGCIVDWAPQEEV  363

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH A+GGFLTH GWNS +ESI AGVPMI WP  ADQQVNSR + E+WK G DMKD C+R
Sbjct  364   LAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMLADQQVNSRCVSELWKTGFDMKDKCER  423

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              +IEK+VRDLME   DE ++   + A  A++  KEGGSS S+L+ LIEDIK M
Sbjct  424   AVIEKLVRDLME--SDEIVKATDEIAGMARDSVKEGGSSYSNLQKLIEDIKSM  474



>ref|XP_006357782.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=484

 Score =   389 bits (999),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 212/469 (45%), Positives = 285/469 (61%), Gaps = 22/469 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  S I+SML LA+L CL+ L+VTF+ T H +  L   ++V SRF+ Y  F+F TI DGL
Sbjct  21    PIQSPINSMLQLAELFCLADLQVTFLNTNHNQQLLYRHTNVESRFKQYPKFQFRTISDGL  80

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDV  512
             P    DDH  S      L++SL A A+PFL++I+  SG        C+I DG   +AVD+
Sbjct  81    P----DDHPRSFPMFEDLINSLQAVAEPFLRKILTESG------VTCVIPDGLFYYAVDI  130

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDL  692
               EVGV +ISF  +S    W Y   P LIQ G++PF G D+D  I +V GME LLRRRD 
Sbjct  131   CNEVGVSVISFDTISPCCLWVYLCFPKLIQTGDIPFKGNDLDMLIENVPGMEDLLRRRDF  190

Query  693   P----GNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             P     NC  D       K   E +   R+   I+N+F++L+G  L  +R       YA+
Sbjct  191   PFYRLTNCATDLYCQLALK---EIQSIPRSHGLILNTFEDLDGPLLSHIR-SHCPQTYAV  246

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L+ +L    ++   SSN L E+    + WLD QP  SV+YV FG+L  +++E +
Sbjct  247   GPLHLQLKTRLADKRMS---SSNSLWEEDHSSIQWLDAQPIESVIYVSFGSLATLTKEEM  303

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSG RFLW +   L+  ++     V  E+  G + R  +V WAPQ++VL+H 
Sbjct  304   LEFWHGLVNSGIRFLWVMRSDLLREEEFSHQFV-KELAAGCKERAYIVSWAPQEKVLSHP  362

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS MESIV   PMI W  Y DQ+V SRF+GEVWKIGLDMKD CDR  IE
Sbjct  363   AIGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDRDNIE  422

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             K+V+DLM   KD+  +   + +  A+    EGGSS ++ E L++DIK++
Sbjct  423   KVVKDLMVTNKDKLKKSVDKLSMLAEISVGEGGSSYNAFEYLVDDIKKL  471



>gb|KGN50615.1| UDP-glucosyltransferase family 1 protein [Cucumis sativus]
Length=485

 Score =   388 bits (996),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 212/472 (45%), Positives = 292/472 (62%), Gaps = 21/472 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P+  HI+ ML  A+LL LS ++VTF+TT H+   L   SDV+ RF  +  F+F TI 
Sbjct  14    FPVPAQGHINVMLKFAELLSLSSIRVTFLTTEHSYRQLTLHSDVLPRFSLFPSFQFRTIS  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP       R     + ++LHS  +  KP  ++++++     S+   C+I DGF ++ 
Sbjct  74    DGLP---LSHPRIFAHHLTEMLHSFVSVTKPLFRDMLLSP--HFSSDLTCLILDGFFSYL  128

Query  504   VDVAEE-VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD-MDEPILSVKGMEKLL  677
             +D+ ++ V VP   F    A +TW   SIP+LI+ G+LP  G+D MD  + +V GME LL
Sbjct  129   LDIDDDFVKVPTFCFRTSGACSTWTILSIPNLIKQGQLPIKGEDDMDRILDNVPGMENLL  188

Query  678   RRRDLPGNCRVDDLE-DPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             R RDLPG CR  D   DP  +F+M  F +  +    I+N+F++LEG  L  +R     N+
Sbjct  189   RCRDLPGFCRATDPNNDPILQFIMSTFIRSTKFSALIMNTFEDLEGPILSNIRTL-CPNL  247

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y+IGPLH LL+ KL       T S N L E  + C+ WL  Q   SV+YV FG++T++  
Sbjct  248   YSIGPLHALLKTKL----THETESLNNLWEVDRSCLTWLGNQAAGSVIYVSFGSITVMGN  303

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEV--PTEILNGLEGRCCVVEWAPQQE  1205
               L EFWHGL+NSG+ FLW + P L+   K E GE+  P E+  G + R  +V W PQ++
Sbjct  304   RELMEFWHGLVNSGRSFLWVIRPDLL---KGENGEIEIPAELEEGTKQRGYMVGWTPQEK  360

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VL H AVGGFLTH GWNS +ESIVAG PMI WP+  DQ VNSRF+  VW +GLDMKD CD
Sbjct  361   VLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQLVNSRFVSNVWNLGLDMKDLCD  420

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             R  + KMV D+M  RK+EF++ A + AN A++    GGSS ++ + LIEDIK
Sbjct  421   RETVAKMVNDVMVNRKEEFVRSATEIANLARQSVNPGGSSYANFDRLIEDIK  472



>ref|XP_007158358.1| hypothetical protein PHAVU_002G146100g [Phaseolus vulgaris]
 gb|ESW30352.1| hypothetical protein PHAVU_002G146100g [Phaseolus vulgaris]
Length=482

 Score =   388 bits (996),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 215/474 (45%), Positives = 282/474 (59%), Gaps = 21/474 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P P+H+ SML LA+LL L +L VTF+TT      L  F D+    + Y    F+TI D  
Sbjct  12    PLPAHVVSMLKLAELLVLENLHVTFLTTDTIHGRLTRFGDIQFLSKSYPKLHFKTISDCY  71

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQ----RCIIADG-FAN  497
               G   DH   G  +  L+ S +  AKPFL++I+++       PQ     C+I DG F +
Sbjct  72    DEG---DHPGFGDRLWDLISSTTLHAKPFLRDILLSH-----TPQIPKLSCVIQDGIFGS  123

Query  498   FAVDVAEE--VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGME  668
              + DVA E  V +PII F  VSA   WAY S  +L+Q  ELP  G +DMD  I  + GME
Sbjct  124   LSADVASEFNVSIPIIQFRTVSACCFWAYMSATNLLQCQELPIRGDEDMDRIIKDIPGME  183

Query  669   KLLRRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
              LLR RDLP   R D   +  F+  ++  R+       I+NSF++LEG  L Q+R     
Sbjct  184   NLLRCRDLPSFFRPDKKGNSTFESHVDRSRQSLAADAIIVNSFEDLEGPVLSQIR-HHFP  242

Query  846   NVYAIGPLHELLRNKLGSCNV--TLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLT  1019
              VY +GPLH  L  +    N    +    N + +  + CM WLD QP  SV+YV FG+ T
Sbjct  243   KVYTVGPLHCHLNTRKAESNEGEDIPKFKNAIFQVDRTCMTWLDAQPEGSVMYVSFGSST  302

Query  1020  LVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQ  1199
             +V  E L E WHGL+NS  RFLW + P +V  K+ +   +P E+  G + R  +VEWAPQ
Sbjct  303   IVKREDLTEIWHGLVNSKNRFLWVMRPDIVAGKQ-DDDRIPAEVEEGTKERGFIVEWAPQ  361

Query  1200  QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDT  1379
             +EVL H A+GGFLTH GWNS +ES+VAGVPMI WP++ADQQ+NSRF+ EVWK+GLDMKD 
Sbjct  362   EEVLEHKAIGGFLTHSGWNSTLESVVAGVPMICWPYFADQQINSRFVSEVWKVGLDMKDV  421

Query  1380  CDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             CDR ++EKMV DLM  R++EFL  AK  A  A +    GGSS SS ++ I  IK
Sbjct  422   CDRDVVEKMVNDLMVHRREEFLNSAKAMATLAHKSVSPGGSSYSSFQDFIHYIK  475



>gb|AIE12478.1| UGT5 [Panax ginseng]
Length=477

 Score =   387 bits (995),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 198/470 (42%), Positives = 286/470 (61%), Gaps = 11/470 (2%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  HI  ML L +LLC + L VT + T    NN+L   D  S +  Y GF+F+++  
Sbjct  13    PFPAVGHIKPMLMLGKLLCQAGLSVTLLNTDQNHNNILNPIDQSSFYSRYPGFQFKSLAV  72

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQ--RCIIADGFANF  500
             GLP     +H  +G  + +LL+ +++      KE ++    E   P+   CIIADG  +F
Sbjct  73    GLP----PEHLRTGPVVAELLYWITSACSTKFKEYLMVEENEKGQPEPVTCIIADGIMSF  128

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-GKDMDEPILSVKGMEKLL  677
              +D+AEE  +P+I+F   ++ +TW YF +  L+Q GE+P    +DMD+ I S+ G+E +L
Sbjct  129   TIDIAEEFHIPVITFRTYNSTSTWVYFHLHQLLQNGEIPVQRDEDMDQQITSIPGLETIL  188

Query  678   RRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
             RRRDLP  C++D  +     +M +  K  R    I+N+F+ELEG  +  +       VY 
Sbjct  189   RRRDLPPFCKLDSTDHLLQFYMGQTSKMKRASALILNTFEELEGPIVSHLH-SIFPTVYT  247

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IGPLH LL++ +        +S   +    + C+ WLD QP  SV+YV FG++ +++++ 
Sbjct  248   IGPLHGLLQSHINHNAPPSDSSETSVRPQDRTCIRWLDSQPSKSVVYVSFGSVVVLTQDQ  307

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L EFWHGL+NSG  FLW + P LVL +     E P+E+      R C+V W PQ+EVLAH
Sbjct  308   LLEFWHGLVNSGSPFLWVIRPGLVLAEN-NVAETPSELTIATNERGCIVGWGPQEEVLAH  366

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              AVGGFL+H GWNS +ESI AG+PMI WP  ADQ +NSR +GE+W+ GLDMKDTCDR  +
Sbjct  367   RAVGGFLSHSGWNSTLESIWAGMPMICWPQIADQWINSRCVGEMWRTGLDMKDTCDRSTV  426

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             EKMVR LME + +E  +    +++ A+    +GGSS  S+  LIEDIK +
Sbjct  427   EKMVRGLMEDKNEEIRKSTAIYSSMARNSVAKGGSSYHSMSKLIEDIKSI  476



>ref|XP_007158359.1| hypothetical protein PHAVU_002G146200g [Phaseolus vulgaris]
 gb|ESW30353.1| hypothetical protein PHAVU_002G146200g [Phaseolus vulgaris]
Length=482

 Score =   387 bits (994),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 212/474 (45%), Positives = 281/474 (59%), Gaps = 21/474 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  +H+ SML LA+LL L +L +TF+TT      L  F D+    + Y    F+T+ D  
Sbjct  12    PVSAHVASMLKLAELLTLENLHITFLTTDTIHGRLTRFGDIQVLSKSYPTLHFKTLSDSY  71

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQ----RCIIADG-FAN  497
               G   DH   G  I  L+ S +  AKPFL++I+++       PQ     C+I DG F +
Sbjct  72    DEG---DHPGFGDRIWDLISSTTLHAKPFLRDILLSH-----TPQIPKLSCVIQDGIFGS  123

Query  498   FAVDVAEE--VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGME  668
              + DVA E  V +PII F  VSA   WAY S  +L+ + ELP  G +DMD  I  + GME
Sbjct  124   LSADVASEFNVSIPIIQFRTVSACCFWAYISATNLLHSQELPIRGDEDMDRIIKDIPGME  183

Query  669   KLLRRRDLPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
              LLR RDLP   R D   +  F+ ++   R+       I+NSF++LEG  L Q+R     
Sbjct  184   NLLRCRDLPSFFRPDKKGNSTFESYVDRSRQSLAADAIIVNSFEDLEGPVLSQIR-HHFP  242

Query  846   NVYAIGPLHELLRNKLGSCNV--TLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLT  1019
              VY +GPLH  L  +    N    +    N + +    CM WLD QP  SV+YV FG+ T
Sbjct  243   KVYTVGPLHHHLNTRKAESNKGEDIPKFKNAIFQVDGTCMTWLDAQPEGSVMYVSFGSST  302

Query  1020  LVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQ  1199
             +V  E L E WHGL+NS +RFLW + P +V  K+ +   +P E+  G + R  +VEWAPQ
Sbjct  303   IVKREDLMEIWHGLVNSKKRFLWVMRPDIVAGKQ-DDDRIPAEVEEGTKERGFIVEWAPQ  361

Query  1200  QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDT  1379
             +EVL H A+GGFLTH GWNS +ES+VAGVPMI WP++ADQQ+NSRF+ EVWK+GLDMKD 
Sbjct  362   EEVLEHKAIGGFLTHSGWNSTLESVVAGVPMICWPYFADQQINSRFVSEVWKVGLDMKDV  421

Query  1380  CDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             CDR ++EKMV DLM  R++EFL  AK  A  A +    GGSS SS ++ I  IK
Sbjct  422   CDRDVVEKMVNDLMVHRREEFLNSAKAMATLAHKSVSPGGSSYSSFQDFIHYIK  475



>ref|XP_002530397.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF31967.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=479

 Score =   387 bits (993),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 218/471 (46%), Positives = 296/471 (63%), Gaps = 14/471 (3%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P   H++SML LA+LL L+ LK+TF+   +   NL   SDV +RF  Y GF+F+TIP
Sbjct  16    FPAPGQGHVNSMLKLAELLALAGLKITFLNFEYIHENLFRCSDVQARFDKYPGFQFKTIP  75

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             +  P G    + S  +   +LL ++   +KP  K+I+V      +AP  CII D    F 
Sbjct  76    NCWPEGRRIGNTSDTLR--ELLEAMKMQSKPIFKKILVECN--ITAPINCIIGDMLMGFV  131

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLLR  680
              DVA EVG+P I FH +SA +   + SIP ++ A ELP  GK DMD  I  V GME  LR
Sbjct  132   YDVASEVGIPAIQFHTISACSVLTFLSIPDVLAAQELPVKGKEDMDRLITKVPGMENFLR  191

Query  681   RRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RRDLP  C+  +  DP    ++  ++   ++  I+N+F+EL+   L Q+R       Y I
Sbjct  192   RRDLPDFCQ--EASDP--SLLIITKEMRESQALILNTFEELDKEILAQIRT-HYPKTYTI  246

Query  861   GPLHELLRNKLGSCNVT-LTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             GPLH LL+++L S     L T+SN + E  + C++WLD+QP  SVL+V FG+ TL++ + 
Sbjct  247   GPLHMLLKSRLTSIKKQELYTTSNSIVEVDRSCINWLDKQPKRSVLFVSFGSTTLMTRDQ  306

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGE-VPTEILNGLEGRCCVVEWAPQQEVLA  1214
             + EFWHG++NS  RFLW L P+ +  K  +  E    E   G +    +V WAPQ+EVL 
Sbjct  307   MMEFWHGIVNSKIRFLWVLRPQSITAKDGDDLERFLDEFEVGPKESGYIVRWAPQEEVLG  366

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H A GGFLTH GWNS +ESI AGVPMI WP+Y DQQVNSRF+  VWK+GLDMKD CDR I
Sbjct  367   HKATGGFLTHSGWNSTLESIAAGVPMICWPYYGDQQVNSRFVSAVWKVGLDMKDVCDREI  426

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKMV DLM  RK+EF+  + + A +AK   K+GGSS  +LE+LI+DI+ M
Sbjct  427   VEKMVIDLMVNRKEEFVGSSTRMAEAAKNSVKDGGSSFCNLESLIKDIRLM  477



>ref|XP_006429243.1| hypothetical protein CICLE_v10011602mg [Citrus clementina]
 gb|ESR42483.1| hypothetical protein CICLE_v10011602mg [Citrus clementina]
Length=486

 Score =   386 bits (992),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 203/472 (43%), Positives = 290/472 (61%), Gaps = 13/472 (3%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             YP   HI  M++LA+LL  ++ +VTF+ T H  + LL  +D+ S    +  F+F +IP G
Sbjct  18    YPLQGHIKPMMSLAELLGSANFQVTFVNTNHNHDLLLRNTDITSFCNRFPNFQFRSIPSG  77

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR--CIIADGFANF-  500
             LP  +      SG+    +  ++ A +KP  ++++++ G E    QR  C+IADG   F 
Sbjct  78    LPANVI----RSGLTAKDVFDAMKAMSKPAFRDLLISLGEETEQRQRPTCVIADGILCFL  133

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLR  680
              +DV+EE+ +P+++    +A+ +W YF +P LI+ G +PF  ++MD+P+  + G E  LR
Sbjct  134   TLDVSEELQIPLLALRTHNASYSWIYFHLPKLIEDGHIPFLDENMDKPVAGIPGFENFLR  193

Query  681   RRDLPGNCRVDDLEDPFFK--FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
              RDLPG CRV   +D +    F+ E     R    I+N+F E+E   +  +       +Y
Sbjct  194   NRDLPGTCRVKTSDDDYLLQFFIGETFAMTRASALILNTF-EIEAPVVSLLG-SHFTKIY  251

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPLH+L ++++   N    +SS  L ++   CM WL+ QPP SVLYV FG+L  ++ E
Sbjct  252   TIGPLHKLRKSRMKDINSPSVSSSGILQKEDTSCMTWLNSQPPKSVLYVSFGSLVGLTRE  311

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRC-CVVEWAPQQEVL  1211
              ++E WHGL+NSGQRFL  + P L+L +    G  P     G E R   +V WAPQ+EVL
Sbjct  312   QMSELWHGLVNSGQRFLLVVRPDLILGEP-GAGATPLAQNKGTEERNRFIVSWAPQEEVL  370

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
             AH AVGGFLTH GWNS +E IVAGVPMI WP ++DQ VNSR + EVWKIG DMKDTCD  
Sbjct  371   AHPAVGGFLTHGGWNSTLEGIVAGVPMICWPQFSDQFVNSRCVSEVWKIGFDMKDTCDGS  430

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             IIEK+VRDLME +++E +    + A  A +   EGGSS  +L+ LIEDI+ M
Sbjct  431   IIEKLVRDLMENKREEIMGSTDRVATMAHDAVNEGGSSYRNLDGLIEDIRLM  482



>ref|XP_006481394.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Citrus sinensis]
Length=469

 Score =   385 bits (990),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/467 (42%), Positives = 287/467 (61%), Gaps = 16/467 (3%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P+P+  HI  ML LA+L   +  +VTF+ T    + LL  +DV   ++ +  FRF +IP
Sbjct  12    FPYPAYGHIKPMLTLAELFSHAGFRVTFVNTEQYHDRLLGNNDVTGFYKRFPNFRFTSIP  71

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     D+   G+ I     S    +K    +++++ G   +    CII+D   +F 
Sbjct  72    DGLP----PDNPRFGIYIKDWFCSDKPVSKLAFLQLLMSPGLLPT----CIISDSIMSFT  123

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             +DVAEE+ +PII+F P SA  +W+ F    L + GELP   ++ D+P+  + G+E   R 
Sbjct  124   IDVAEELNIPIITFRPYSAHCSWSDFHFSKLAEEGELPVTNENFDKPVKCIPGLENFFRN  183

Query  684   RDLPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CR    +DP  + F+ +     RT   +IN+F E+EG  + ++    +  +Y +
Sbjct  184   RDLPSICRDGGPDDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKLG-SRLTKIYTV  242

Query  861   GPLHELLRNKL--GSCNVTLTTSSNG-LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             GPLH LL++++   S   +   S+N  L ++ + CM WLD QP  SVLYV FG+   +  
Sbjct  243   GPLHALLKSRIQEDSAESSPPESNNCVLSKEDRSCMTWLDSQPSRSVLYVSFGSFIKLGR  302

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVL  1211
             E + EFWHG++NSG+RFLW +   L+ + +   G VP E+  G + R C+V WAPQ+EVL
Sbjct  303   EQILEFWHGMVNSGKRFLWVIRSDLI-DGEPGVGPVPVELEQGTKERGCIVSWAPQEEVL  361

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
             AH A+GGFLTH GWNS +ES+VAGVPMI WP   DQQVNSR + E+WKIGLDMKDTCDR 
Sbjct  362   AHQAIGGFLTHSGWNSTLESLVAGVPMICWPQIGDQQVNSRCVSEIWKIGLDMKDTCDRS  421

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIE  1532
              IE +VRDLM+ ++D+ ++   Q A  A++  KEGGSS  +L+ LI+
Sbjct  422   TIENLVRDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLDKLIK  468



>ref|XP_008359771.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
 ref|XP_008368325.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   386 bits (992),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 211/477 (44%), Positives = 290/477 (61%), Gaps = 28/477 (6%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  HI  ML+ AQLLC + + VTF++T H    L     + +RF       FE+IPD
Sbjct  18    PFPAQGHITPMLSFAQLLCHAGIHVTFLSTEHNHRLLTQRRALSARF---PTLHFESIPD  74

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS----------APQRCI  476
             GLP     DH  +   +  ++ SL +  KP L+++++T   +D+           P  C+
Sbjct  75    GLP----PDHPRTIPPLDDIVSSLRSVTKPLLRDLLITLTKKDNESXGATTTPRPPLSCV  130

Query  477   IADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSV  656
             I DG   FA+D+AEEVG+P+ +   VSA + W Y  IP LIQ G+LPF  +DMD PI  +
Sbjct  131   IIDGIMCFAIDMAEEVGIPVFALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMDHPIRDI  190

Query  657   KGMEKLLRRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRI  833
              GME LLR RDLP  CR+  ++ P FKF ME      R    I+N+F +LE   L Q+  
Sbjct  191   PGMEALLRLRDLPSFCRMP-IDHPSFKFFMEQIEAITRVSAIILNTFDDLEPLILSQIAT  249

Query  834   GDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGT  1013
                  +Y +GP H LL++++G     L++S + L  + ++CM WLD Q   SV++V FG+
Sbjct  250   -RFPKIYTLGPFHALLKSRVGD---DLSSSVSSLRHEDRRCMAWLDSQQSGSVIFVSFGS  305

Query  1014  LTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWA  1193
             L  +S   L EFWHGL+NSG+ FLW +   ++ + + ER   P E+ +G + R  + EW 
Sbjct  306   LAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLSSGQEERA-TPVELEDGTKERGYIAEWV  364

Query  1194  PQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMK  1373
             PQ+EVLAH AVGGF TH GWNS +E I AGVPM+ WP  ADQQVNSR++GE WKIGLDMK
Sbjct  365   PQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNSRWVGEGWKIGLDMK  424

Query  1374  DTCDRHIIEKMVRDLMEV--RKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             DTCDR  +EKMVR LME   ++++  +    FA  A+    E GSS  +LE LIED+
Sbjct  425   DTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSSYKNLEKLIEDL  481



>ref|XP_008388093.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   386 bits (991),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 211/477 (44%), Positives = 290/477 (61%), Gaps = 28/477 (6%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  HI  ML+ AQLLC + + VTF++T H    L     + +RF       FE+IPD
Sbjct  18    PFPAQGHITPMLSFAQLLCHAGIHVTFLSTEHNHRLLTQRRALSARF---PTLHFESIPD  74

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS----------APQRCI  476
             GLP     DH  +   +  ++ SL +  KP L+++++T   +D+           P  C+
Sbjct  75    GLP----PDHPRTIPPLDDIVSSLRSVTKPLLRDLLITLTKKDNESCGATTTPRPPLSCV  130

Query  477   IADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSV  656
             I DG   FA+D+AEEVG+P+ +   VSA + W Y  IP LIQ G+LPF  +DMD PI  +
Sbjct  131   IIDGIMCFAIDMAEEVGIPVFALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMDHPIRDI  190

Query  657   KGMEKLLRRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRI  833
              GME LLR RDLP  CR+  ++ P FKF ME      R    I+N+F +LE   L Q+  
Sbjct  191   PGMEALLRLRDLPSFCRMP-IDHPSFKFFMEQIEAITRVSAIILNTFDDLEPLILSQIAT  249

Query  834   GDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGT  1013
                  +Y +GP H LL++++G     L++S + L  + ++CM WLD Q   SV++V FG+
Sbjct  250   -RFPKIYTLGPFHALLKSRVGD---DLSSSVSSLRHEDRRCMAWLDSQQSGSVIFVSFGS  305

Query  1014  LTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWA  1193
             L  +S   L EFWHGL+NSG+ FLW +   ++ + + ER   P E+ +G + R  + EW 
Sbjct  306   LAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLSSGQEERA-TPVELEDGTKERGYIAEWV  364

Query  1194  PQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMK  1373
             PQ+EVLAH AVGGF TH GWNS +E I AGVPM+ WP  ADQQVNSR++GE WKIGLDMK
Sbjct  365   PQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNSRWVGEGWKIGLDMK  424

Query  1374  DTCDRHIIEKMVRDLMEV--RKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             DTCDR  +EKMVR LME   ++++  +    FA  A+    E GSS  +LE LIED+
Sbjct  425   DTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSSYKNLEKLIEDL  481



>ref|XP_008370121.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score =   385 bits (989),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 210/483 (43%), Positives = 294/483 (61%), Gaps = 31/483 (6%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             P PS  H   ML+LAQLLC + + VTF+ T H+ ++L    D +S    +    FE+IPD
Sbjct  14    PLPSQGHFTPMLSLAQLLCHAGIHVTFLITKHS-HSLFTQRDALSAR--FPTLHFESIPD  70

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS------------APQR  470
             GLP     DH      + ++  SL +T KPFL+E++++   +D              P R
Sbjct  71    GLP----PDHGRKFSALHEVGASLRSTIKPFLRELLISLTKKDDETSNDGSTRRRLPPLR  126

Query  471   CIIADG-FANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPI  647
             C++ DG F  FA+DVAEEVG+PI +    SA + W Y  IP LIQ G+LPF  +DMD+PI
Sbjct  127   CMVIDGIFMCFAIDVAEEVGIPIFALRTTSACSFWCYTCIPDLIQQGQLPFQDEDMDQPI  186

Query  648   LSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQ  824
               + GME LLRRRDLP  C++  ++ P FKF +E F    R    I+N+F +LE   L  
Sbjct  187   RDIPGMESLLRRRDLPSFCKMP-IDHPTFKFFVEEFEAITRVSALILNTFDDLESPILSH  245

Query  825   MRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVC  1004
             +       +Y +GP H LL++++G+    L++S++ L    ++CM WLD Q   SV++V 
Sbjct  246   IAT-RFPKIYTLGPFHALLKSRIGN---DLSSSASSLRHQDRRCMTWLDSQQLRSVIFVS  301

Query  1005  FGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVV  1184
             FG+L  ++   L EFWHGL++SG+ FLW +   ++ N++ E      ++  G + +  + 
Sbjct  302   FGSLVKLTRVQLLEFWHGLIDSGKPFLWVIRSDMLWNEQ-EAHATSVKLEVGTKEKGFIA  360

Query  1185  EWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGL  1364
             EW PQ+EVLAH A+GGFLTH GWNS +E I AGVPM+ WP  ADQ VNSR++GE WKIGL
Sbjct  361   EWVPQEEVLAHKAIGGFLTHSGWNSTIEGIWAGVPMLCWPQIADQPVNSRWVGEGWKIGL  420

Query  1365  DMKDTCDRHIIEKMVRDLMEV--RKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             DMKDTCDR  +EKMVR LME   R  +  +    FA  A+    E GSS  +LE LIED+
Sbjct  421   DMKDTCDRSTVEKMVRALMEEGDRSAQIFKSVDTFAKLARHAVNEDGSSYKNLEKLIEDV  480

Query  1539  KRM  1547
             K++
Sbjct  481   KKL  483



>ref|XP_010316060.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Solanum lycopersicum]
Length=469

 Score =   384 bits (987),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 212/469 (45%), Positives = 283/469 (60%), Gaps = 30/469 (6%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  S I+SML LA+L CL+ L+VTF+ T H +  L   +DV SRFR Y  F+F TI DGL
Sbjct  11    PIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTDVESRFRQYPKFQFRTISDGL  70

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDV  512
             P    DDH  S +    L+ SL A A+PFL+EIV  SG        C+I DG   +AVD+
Sbjct  71    P----DDHPRSSLLFGDLITSLQAVAEPFLREIVTESG------VTCVIPDGLFYYAVDI  120

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDL  692
               E+GV +ISF  +S    W Y   P LIQ+G++PF          +V GME LLRRRD 
Sbjct  121   CNELGVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKE--------NVPGMEDLLRRRDF  172

Query  693   P----GNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             P     NC  D       K   E +   R+   I+N+F++L+G  L  +R       YA+
Sbjct  173   PFYRLTNCATDLYCQLALK---EIQSIPRSHGLILNTFEDLDGPLLSNIRT-HCPQTYAV  228

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPL   L+ +L   +++   SSN L E+    + WLD QP  SV+YV FG+L  +++E +
Sbjct  229   GPLQLQLKTRLADKSMS---SSNSLREEDGSSIQWLDAQPVESVIYVSFGSLATLTKEEM  285

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSG RFLW +   L+  ++     V  E+ +G + R  +V WAPQ++VL+H 
Sbjct  286   LEFWHGLVNSGIRFLWVMRSDLLREEEFSHQFV-KELADGCKERAYIVSWAPQEKVLSHP  344

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+GGFLTH GWNS MESIV   PMI W  Y DQ+V SRF+GEVWKIGLDMKD CDR+IIE
Sbjct  345   AIGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDRYIIE  404

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             K V+DLM   KD+  +   + +  AK    EGGSS ++ E+L+ DIK++
Sbjct  405   KAVKDLMVTNKDKLKKSVDKLSMLAKISVGEGGSSYNAFESLVIDIKKL  453



>ref|XP_010688868.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=509

 Score =   385 bits (990),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 214/485 (44%), Positives = 295/485 (61%), Gaps = 25/485 (5%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQL-LCLSH--LKVTFITTVHARNNLLCFSDVISRFR-CYSGFRF  311
             +P P    ++ ML LA L L LSH  + VTF+TT    + LL  S   +R       FRF
Sbjct  20    FPLPIQGPVNCMLKLADLILTLSHATISVTFLTTEFIHSRLLLHSTAAARLSDTAPHFRF  79

Query  312   ETIPDGLPHGLTDDHRSSGVGIVQLLHSLSATAKP---FLKEIVVTSGGEDSAPQ--RCI  476
             ET+PDGL  GL ++ R S   +  L  +L   A+     L+E++     E  + +   CI
Sbjct  80    ETVPDGL--GLDENPRGSS-QLADLTMTLEGQAQAKGSRLREVLAYGSVEPESKKVVTCI  136

Query  477   IADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILS  653
             IADGF    VDVA+E+ VP++ F  +S    W Y  +P++I+A +LPF G+ D+D  + S
Sbjct  137   IADGFFGCMVDVAKELKVPLVYFETISPCGLWTYLCVPNMIRACDLPFQGEEDLDAAVTS  196

Query  654   VKGMEKLLRRRDLPGNCRVDDLEDPFFKFMMEFRKCF-RTKHHIINSFQELEGSTLDQMR  830
             V GME  LRRRDLP  CR  +   P  + +++  + F R + HI+N+F +LEG     M+
Sbjct  197   VPGMETYLRRRDLPSFCRAYNPNSPVIQLVLKEAQTFSRAQGHILNTFDKLEGEFFTHMQ  256

Query  831   IGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFG  1010
                  N+Y IGPLH  L+ ++     +  + SN L ++ + C+ WLD QP  SVL+V  G
Sbjct  257   -ALCPNLYNIGPLHLNLKCRIK--QESAKSFSNSLWQEDRSCLGWLDAQPQKSVLFVSIG  313

Query  1011  TLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERG------EVPTEILNGLEGR  1172
             +L +++++ L E W GL+NS  RFLW      ++    E        EVP+E++ G++ R
Sbjct  314   SLAVMTKDQLMEIWCGLINSKTRFLWVRRADSIIKSNNEEADQSQYSEVPSEVIEGIKDR  373

Query  1173  CCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVW  1352
              C+V WAPQ+EVLAH A+GGFLTH GWNS +ESIVAGVPMI WPF+ DQQVNSR + EVW
Sbjct  374   GCIVRWAPQEEVLAHKAIGGFLTHSGWNSTLESIVAGVPMICWPFFVDQQVNSRVVSEVW  433

Query  1353  KIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIE  1532
             KIGLDMKD C+R +IEKM++DLM  RKDEFL RA +    A +   E GSS +SL  LI+
Sbjct  434   KIGLDMKDNCNRVVIEKMIKDLMGTRKDEFLARADEMGKLAAQAVVEDGSSYNSLNRLID  493

Query  1533  DIKRM  1547
             DI  M
Sbjct  494   DIMFM  498



>ref|XP_010905381.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=491

 Score =   384 bits (987),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 214/478 (45%), Positives = 290/478 (61%), Gaps = 23/478 (5%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP    ++ ML LA+LL  + L VTF+ + +  + L   S   +       FRF++I 
Sbjct  14    FPFPGQGMVNCMLKLAELLSKTGLHVTFLNSDYNHDRLSRSSSAYALLAQSPRFRFDSIS  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA---PQRCIIADGFA  494
             DGL     D++  S   +++L  SL   +    +E++   G  D     P  C+IADG  
Sbjct  74    DGL----ADENPRSAFRLMELEESLRTRSAVQYRELLTNRGRGDDGKWPPVTCVIADGAM  129

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEK  671
              FAVD+AEE+G+P I+F  +SA + WAYF IP L+Q GELPF +  D+DEP+ SV GME 
Sbjct  130   TFAVDIAEELGIPAIAFRTISACSFWAYFCIPRLLQNGELPFPDEADLDEPVRSVPGMEA  189

Query  672   LLRRRDLPGNCR-VDDLEDPFFKFMMEFR-KCFRTKHHIINSFQELEGSTLDQMRIGDML  845
              LRRRDLP  CR   D  D  F+F+        R +  I+N+F+ LE + L  +R     
Sbjct  190   FLRRRDLPSFCRQAGDEADQTFEFVTTVTANTNRARALILNTFESLEATALSHVR-SHFP  248

Query  846   NVYAIGPLHELLRNKLGSC------NVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCF  1007
               YA+GPL  LLR+    C      + T +  S  L E+ + CM WLD QP  SV+YV F
Sbjct  249   VTYAVGPLPALLRSYGSHCPSNPAVSPTSSMPSASLWEEDRTCMTWLDSQPHKSVVYVSF  308

Query  1008  GTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVE  1187
             G+LT+VS+E   EFW GL+NSGQRFLW + P LV  + +       E+  G + R C+V+
Sbjct  309   GSLTVVSQEAFLEFWIGLVNSGQRFLWVVRPDLVEEEMLPLP---EEVKVGTKERGCLVD  365

Query  1188  WAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLD  1367
             W PQ++VLAH AVG FLTH GWNS +ES+VAGVPM+ WPF+ADQQ+NSRF+ EVWK+GLD
Sbjct  366   WVPQEQVLAHPAVGCFLTHSGWNSTLESLVAGVPMLCWPFFADQQINSRFVSEVWKVGLD  425

Query  1368  MKDTCDRHIIEKMVRDLME-VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             MKD C R I+E MVR++ME  R D + + A++ A  A E   EGGSS +    LI+ I
Sbjct  426   MKDLCSRSIVEMMVREVMEGQRTDGWRRSAREMAKMAWESVAEGGSSHADFRRLIQRI  483



>gb|KDO43669.1| hypothetical protein CISIN_1g011792mg [Citrus sinensis]
Length=477

 Score =   383 bits (984),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/471 (42%), Positives = 290/471 (62%), Gaps = 16/471 (3%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  HI  ML+LA+L   +  ++TF+ T    + L   +DV + ++ +  F   +IPD
Sbjct  13    PFPAYGHIKPMLSLAKLFSHAGFRITFVNTDQYHDRLFGNTDVTAFYKHFPNFLCTSIPD  72

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAV  506
             GLP     D+   G+       S    +K   +++++T G   +    CII+D   +FA+
Sbjct  73    GLP----PDNPRFGIYTKDWFCSNKPVSKLAFRQLLMTPGRLPT----CIISDSIMSFAI  124

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
             DVAEE+ +PII+F P SA  +W+ F    L + GELP   ++ D+P+  +  +E + R R
Sbjct  125   DVAEELNIPIITFRPYSAYCSWSDFHFSKLAEEGELPVTDENFDKPVTCIPELENIFRNR  184

Query  687   DLPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLP  CR    +DP  + F+ +     RT   +IN+F E+EG  + ++    +  +Y +G
Sbjct  185   DLPSICRHGGPDDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKLG-SRLTKIYTVG  243

Query  864   PLHELLRNKLGSCNV---TLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
             PLH LL++++   +V    L +++  L ++ + CM WL  QP  SVLYV FG+   +S +
Sbjct  244   PLHALLKSRIQEDSVESSPLESNNCVLSKEDRSCMTWLGSQPSRSVLYVSFGSFIKLSGD  303

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              + EFWHG++NSG+ FLW +   L+ + +   G VP E+  G + R C+V WAPQ+EVLA
Sbjct  304   QILEFWHGIVNSGKGFLWVIRSDLI-DGESGVGPVPAELDQGTKERGCIVSWAPQEEVLA  362

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H A+GGFLTH GWNS +ES+VAGVPMI WP   DQQVNSR + E+WKIG DMKDTCDR  
Sbjct  363   HQAIGGFLTHSGWNSTLESMVAGVPMICWPQVGDQQVNSRCVSEIWKIGFDMKDTCDRST  422

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             IEK+VRDLM+ ++D+ ++   Q A  A++  KEGGSS  +LE LIEDI+ M
Sbjct  423   IEKLVRDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLEKLIEDIRLM  473



>ref|XP_006423294.1| hypothetical protein CICLE_v10030404mg [Citrus clementina]
 ref|XP_006469143.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Citrus sinensis]
 gb|ESR36534.1| hypothetical protein CICLE_v10030404mg [Citrus clementina]
Length=477

 Score =   383 bits (984),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/471 (42%), Positives = 290/471 (62%), Gaps = 16/471 (3%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  HI  ML+LA+L   +  ++TF+ T    + L   +DV + ++ +  F   +IPD
Sbjct  13    PFPAYGHIKPMLSLAKLFSHAGFRITFVNTEQYHDRLFGNTDVTAFYKHFPNFLCTSIPD  72

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAV  506
             GLP     D+   G+ I     S    +K   +++++T G   +    CII+D   +FA+
Sbjct  73    GLP----PDNPRFGIYIKDWFCSNKPVSKLAFRQLLMTPGRLPT----CIISDSIMSFAI  124

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
             DVAEE+ +PII+F P SA  +W+ F    L + GELP   ++ D+ +  +  +E + R R
Sbjct  125   DVAEELNIPIITFRPYSAYCSWSDFHFSKLAEEGELPVTDENFDKSVTCIPELENIFRNR  184

Query  687   DLPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLP  CR    +DP  + F+ +     RT   +IN+F E+EG  + ++    +  +Y IG
Sbjct  185   DLPSICRHGGPDDPILQTFIRDTSATTRTSALVINTFNEIEGPIMSKLG-SRLTKIYTIG  243

Query  864   PLHELLRNKLGSCNV---TLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
             PLH LL++++   +V    L +++  L ++ + CM WL  QP  SVLYV FG+   +S +
Sbjct  244   PLHALLKSRIQEDSVESSPLESNNCVLSKEDRSCMTWLGSQPSRSVLYVSFGSFIKLSGD  303

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              + EFWHG++NSG+ FLW +   L+ + +   G VP E+  G + R C+V WAPQ+EVLA
Sbjct  304   QILEFWHGIVNSGKGFLWVIRSDLI-DGESGVGPVPAELDQGTKERGCIVSWAPQEEVLA  362

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H A+GGFLTH GWNS +ES+VAGVPMI WP   DQQVNSR + E+WKIG DMKDTCDR  
Sbjct  363   HQAIGGFLTHSGWNSTLESMVAGVPMICWPQVGDQQVNSRCVSEIWKIGFDMKDTCDRST  422

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             IEK+VRDLM+ ++D+ ++   Q A  A++  KEGGSS  +LE LIEDI+ M
Sbjct  423   IEKLVRDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLEKLIEDIRLM  473



>ref|XP_010923184.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   383 bits (983),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 208/475 (44%), Positives = 285/475 (60%), Gaps = 21/475 (4%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  H+  ML  A+LL  + L+VTF+ T +     L  S  + R      FRF TIPD
Sbjct  13    PFPAQGHVPPMLKFAELLAHAGLRVTFVNTDNIHRRFLASSPALQRLAGLPRFRFRTIPD  72

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA--PQRCIIADGFANF  500
             G P    +DH    +  + L  SL   ++   +E++V +  +     P  C++ADG    
Sbjct  73    GFP----EDHPRPFLEFLDLEESLRTRSREHYRELLVPTDPDPDGWPPVSCVVADGMLRL  128

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD---MDEPILSVKGMEK  671
             A +VA E+ +P+I F    A A WAY  +P LI+ G +PF  ++   +DE I  V GME 
Sbjct  129   ASEVAAEMEIPLIFFRTSGAGAVWAYLCVPDLIEGGVIPFPAEEEDGLDETIRGVPGMEG  188

Query  672   LLRRRDLPGNCR--VDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
              LRRRDLP  CR      + P            R +  I+N+F+ LEG  L  +R   + 
Sbjct  189   FLRRRDLPSFCRNAKSTSDRPLLFVTNANANVRRGRGLILNTFESLEGPVLSHIRSA-IP  247

Query  846   NVYAIGPLHELLRNKLGSC--NVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLT  1019
             N+YA+GPLH LL    G C  NV  +++S  L ++ + C+ WLD QP  SV+Y+ FG++T
Sbjct  248   NIYALGPLH-LLSRAFGDCGANVPFSSNSTSLWQEDRSCLKWLDSQPQRSVVYISFGSVT  306

Query  1020  LVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQ  1199
             ++S + L EFWHGL++SG+RFLW + P LV   K+E  E   E+      R CVV WAPQ
Sbjct  307   VMSRDELMEFWHGLVDSGKRFLWVVRPDLV-EGKIE--EAMQELEKETRERGCVVGWAPQ  363

Query  1200  QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDT  1379
             +EVLAH AVG FLTH GWNS +ES+ AGVPMI WPF+ADQQVNSR +GEVW+IGLDMKD 
Sbjct  364   EEVLAHPAVGCFLTHSGWNSTLESVAAGVPMICWPFFADQQVNSRLVGEVWRIGLDMKDK  423

Query  1380  CDRHIIEKMVRDLMEVRKDEFLQR-AKQFANSAKECAKEGGSSISSLENLIEDIK  1541
              +R ++E+MVR++ME  + E L+R A + A  A+   +EGGSS    ENL+E IK
Sbjct  424   HERSVVERMVREVMEGDRAEELRRSAGEMAEHARRSIEEGGSSYRGFENLVEHIK  478



>emb|CDO99846.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   379 bits (973),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 208/470 (44%), Positives = 280/470 (60%), Gaps = 63/470 (13%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   HI+ ML LA+LLC   L VTF+ + H    LLC +D+   F  Y  F FETI 
Sbjct  10    FPFPVQGHINCMLKLAELLCCRGLHVTFLNSHHIHERLLCCTDIHYHFSQYPSFHFETIS  69

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     DH  +G  I+  L   S   +P L                CIIADG  +F 
Sbjct  70    DGLP----ADHPRTGDHILTGLQFHSPNGRPALT---------------CIIADGIMSFT  110

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLLR  680
             VDVA+E+ +P I F  VSA+  WA+  +P L++AGELPFNG+ DMD+ + SV G+E+  R
Sbjct  111   VDVAKELHIPTILFRTVSASCFWAFLCVPKLLEAGELPFNGENDMDKLLSSVPGLER-FR  169

Query  681   RRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
              RDLP  CR  +L DP F+ ++ E  +  +    ++N+F++LE S L  +R   +  +Y 
Sbjct  170   MRDLPSFCRTSNLADPGFQVVISETLQNLKADGLLLNTFEDLEESALSHIRT-HIPKLYT  228

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             +GPLH  L+ +  S       SS+ L ++ + CM WLDR+P NSV+YV FG++T+++   
Sbjct  229   VGPLHAHLKAREASSPALQQPSSSSLWKEDRSCMAWLDRKPRNSVIYVSFGSMTVLTRNQ  288

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L EFWHGL+NSG+ FLW                                      EVLAH
Sbjct  289   LFEFWHGLVNSGKPFLW--------------------------------------EVLAH  310

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              AVGGFLTH GWNS +ESI  GVPMI WPFYADQQVNSR +GEVWK+GLDMKDTC+R  +
Sbjct  311   PAVGGFLTHSGWNSTLESIYEGVPMICWPFYADQQVNSRLVGEVWKVGLDMKDTCERATV  370

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             EKM++DLM+V++DEF+  AK+ A  A+   ++ GSS  +L+ LI+DI  M
Sbjct  371   EKMIKDLMDVKRDEFMLCAKEKAKLARRSVEQAGSSHCNLDRLIDDINMM  420



>ref|XP_008785471.1| PREDICTED: UDP-glycosyltransferase 85A4-like [Phoenix dactylifera]
Length=481

 Score =   381 bits (978),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 206/472 (44%), Positives = 281/472 (60%), Gaps = 23/472 (5%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP    ++ ML LA LL  + L VTF+ T H   +L  FS   +R      FRF +IP
Sbjct  14    FPFPGQGMVNCMLKLADLLSGAGLLVTFLNTHHNHRHLSRFSGAHTRLAQRPKFRFASIP  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA---PQRCIIADGFA  494
             DGL    +++   S      L  S+   A    +++++    +DS    P  C+IADG  
Sbjct  74    DGL----SEEETRSVFNFFDLEESMRTRAAASFRDLLIAYRDKDSGGWPPVTCVIADGLM  129

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEK  671
              FAVDV+EEVG+P I F  +SA   WA+  +P L++ GE+PF  G D+DEP+  V GME 
Sbjct  130   PFAVDVSEEVGIPAIIFRTISACCVWAFLCVPKLLENGEIPFPEGADLDEPVRGVPGMES  189

Query  672   LLRRRDLPGNCR-VDDLEDPFFKFMMEFR-KCFRTKHHIINSFQELEGSTLDQMRIGDML  845
              LRRRDLP  CR   D  D   + +        R +  I+N+F+ LEGS L  +R    +
Sbjct  190   FLRRRDLPSFCRQARDHTDRELQVVSSVTASANRARALILNTFESLEGSALSHIRNNSPV  249

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
               YA+GPL+ L R          ++ S  L ++ + CM WLD QP  SV+YV FG+L +V
Sbjct  250   T-YAVGPLNALART---------SSDSGSLWQEDRDCMTWLDSQPDRSVVYVSFGSLAVV  299

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQE  1205
             + E   EFWHGL++SGQRFLW +   L+  +      +P E+  G   R C+V WAPQ+E
Sbjct  300   TREEFMEFWHGLVDSGQRFLWVVRSDLINRRGGGTEVLPAEVEEGTRERGCMVGWAPQEE  359

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VL+H AVG FLTH GWNS +ESI AG PM+ WPF+ADQQ+NSRF+  VW IGLDMKD C 
Sbjct  360   VLSHPAVGCFLTHSGWNSTLESIAAGKPMLCWPFFADQQINSRFVSAVWGIGLDMKDLCG  419

Query  1386  RHIIEKMVRDLMEVRKDEFLQR-AKQFANSAKECAKEGGSSISSLENLIEDI  1538
             R I+EKMVR++ME  + E L+R A++ A  AK+   EGG+S +  ++LI  I
Sbjct  420   RSIVEKMVREVMEGERSEELRRNAREMAEMAKKSVAEGGTSFNEFQSLIRLI  471



>ref|XP_010032067.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51452.1| hypothetical protein EUGRSUZ_J00976 [Eucalyptus grandis]
Length=513

 Score =   381 bits (979),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 205/468 (44%), Positives = 290/468 (62%), Gaps = 23/468 (5%)
 Frame = +3

Query  165   HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLP--H  338
             H++SML L +LL +S L++TFI + H  + LL  + + + F  +  FRF+ I DG P  H
Sbjct  58    HVNSMLKLTELLAISGLRITFINSEHIHHRLLRHAHIQAHFAAFPDFRFKIISDGFPIDH  117

Query  339   GLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR---CIIADGFANFAVD  509
                 DH       +   + + +  K   +E+V       SAP R   CIIADG   F +D
Sbjct  118   PRPPDH------FMTTFNYVKSITKQLFEELV-------SAPDRPVTCIIADGILTFTID  164

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLRRR  686
              A ++GVP+I+F  +SA++ WA F IP +I++G+LP  G +DMD  + SV GME +LR R
Sbjct  165   FAGDLGVPVIAFRTISASSFWACFCIPRMIESGDLPLKGDEDMDRDVTSVPGMEDILRCR  224

Query  687   DLPGNCRVDDLEDPFFKFMMEFRKCFRT-KHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLP  CRV DL D F +++          +  I+N+F +LEG  + Q+R     N+Y IG
Sbjct  225   DLPSFCRVADLSDQFLQYVTTQTLQTTAARALILNTFDQLEGPAISQIRT-QFPNLYTIG  283

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
             PLH  LR++L S + + +++SN L +  + C+ WLD+QPP SV+YV FG++  ++     
Sbjct  284   PLHSHLRSRLSSSSPSPSSASNSLWKVDRSCIAWLDKQPPKSVIYVSFGSIATLNRHDFT  343

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EFW+GL+NSG+RFLW + P  +       G VP E+      R C+V WAPQ+EVL H A
Sbjct  344   EFWYGLVNSGRRFLWVVRPDSLAEGS--SGAVPEELREAAAERGCIVGWAPQEEVLHHGA  401

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             V  FLTH GWNS +ES+VAG PM+ WPF+ADQQVNSR +   WK+GLDMKD CDR ++E+
Sbjct  402   VAAFLTHSGWNSTLESVVAGKPMVCWPFFADQQVNSRLVSHAWKVGLDMKDVCDREVVER  461

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             MV ++M  R++EF   A   A  A+  A EGGSS  +L+ LIEDI+ M
Sbjct  462   MVNEVMGERQEEFAAAAGDLARRARNAASEGGSSWDNLDRLIEDIRSM  509



>gb|KDO58004.1| hypothetical protein CISIN_1g037999mg [Citrus sinensis]
Length=447

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/456 (42%), Positives = 280/456 (61%), Gaps = 14/456 (3%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDH  356
             ML LA+L   +  +VTF+ T    + LL  +DV   ++ +  FRF +IPDGLP     D+
Sbjct  1     MLTLAELFSHAGFRVTFVNTEQYHDRLLGNNDVTGFYKRFPNFRFTSIPDGLPP----DN  56

Query  357   RSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEVGVPI  536
                G+ I     S    +K    +++++ G   +    CII+D   +F +DVAEE+ +PI
Sbjct  57    PRFGIYIKDWFCSDKPVSKLAFLQLLMSPGLLPT----CIISDSIMSFTIDVAEELNIPI  112

Query  537   ISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDLPGNCRVDD  716
             I+F P SA  +W+ F    L + GELP   ++ D+P+  + G+E   R RDLP  CR   
Sbjct  113   ITFRPYSAHCSWSDFHFSKLAEEGELPVTNENFDKPVKCIPGLENFFRNRDLPSICRDGG  172

Query  717   LEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKL  893
              +DP  + F+ +     RT   +IN+F E+EG  + ++    +  +Y +GPLH LL++++
Sbjct  173   PDDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKLG-SRLTKIYTVGPLHALLKSRI  231

Query  894   --GSCNVTLTTSSNG-LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLM  1064
                S   +   S+N  L ++ + CM WLD QP  SVLYV FG+   +  E + EFWHG++
Sbjct  232   QEDSAESSPPESNNCVLSKEDRSCMTWLDSQPSRSVLYVSFGSFIKLGREQILEFWHGMV  291

Query  1065  NSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTH  1244
             NSG+RFLW +   L+ + +   G VP E+  G + R C+V WAPQ+EVLAH A+GGFLTH
Sbjct  292   NSGKRFLWVIRSDLI-DGEPGVGPVPVELEQGTKERGCIVSWAPQEEVLAHQAIGGFLTH  350

Query  1245  CGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLME  1424
              GWNS +ES+VAGVPMI WP   DQQVNSR + E+WKIGLDMKDTCDR  IE +VRDLM+
Sbjct  351   SGWNSTLESLVAGVPMICWPQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTIENLVRDLMD  410

Query  1425  VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIE  1532
              ++D+ ++   Q A  A++  KEGGSS  +L+ LI+
Sbjct  411   NKRDKIMESTVQIAKMARDAVKEGGSSYRNLDKLIK  446



>ref|XP_009346996.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=485

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 207/485 (43%), Positives = 297/485 (61%), Gaps = 39/485 (8%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  HI  ML+ AQLL  + + VTF+ T H    L     + +RF       FE++PD
Sbjct  16    PFPAQGHITPMLSFAQLLGHAGIHVTFLNTEHNHRLLTQRHALSARF---PTLHFESLPD  72

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS----------APQRCI  476
             GLP     D   S   I+ ++ SL +  KP L+++++T   +D            P  C+
Sbjct  73    GLP----PDCPRSIPHIIDMVSSLKSVTKPLLRDLLITLTKKDEESYGSTSTRRPPLSCV  128

Query  477   IADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSV  656
             I D    FA+DVAE+VGVP ++   +S    W+Y  IP+LIQ G +PF  +DMD+    +
Sbjct  129   IMDEIMCFAIDVAEKVGVPAMAITVISGCGYWSYSCIPNLIQQGHVPFTDEDMDKQSSDI  188

Query  657   KGMEKLLRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIG  836
              GME LLRRRDLPG CR   ++ P  K  ME  K  R    IIN+F  LE S L    I 
Sbjct  189   PGMEGLLRRRDLPGFCRFS-IDHPVTKIFMEVIKATRASALIINTFDGLEASILSH--IA  245

Query  837   DML-NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGT  1013
              +   VYAIGP+H L+++++G       +SS  L ++ ++CM WLD +P  SV+YV FG+
Sbjct  246   TLFPQVYAIGPVHALVKSRVGDG----LSSSASLRQEDRRCMAWLDSKPVGSVIYVSFGS  301

Query  1014  LTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGE-------VPTEILNGLEGR  1172
             L  ++ + L EFWHGL++ G++FLW +   ++     E+GE       +PTE+  G + R
Sbjct  302   LVELTHDQLFEFWHGLVSCGKQFLWVVRSDMISG---EQGEHVIPTELIPTELKMGTKER  358

Query  1173  CCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVW  1352
               +VEWAPQ+EVLAH AVGGFLT CGWNSI+E I AGVPM+ WP  A+Q V SR++GEVW
Sbjct  359   GLIVEWAPQEEVLAHKAVGGFLTQCGWNSILEGIWAGVPMLCWPRLAEQLVTSRWIGEVW  418

Query  1353  KIGLDMKDTCDRHIIEKMVRDLMEV--RKDEFLQRAKQFANSAKECAKEGGSSISSLENL  1526
             +IG+DMKDTC+R ++EKM+R LME    +++ L+  ++F+  A+    EGGSS ++L+ L
Sbjct  419   RIGIDMKDTCERSMVEKMIRRLMEEGDEREQILRSVERFSKLARGAVTEGGSSYNNLDKL  478

Query  1527  IEDIK  1541
             I+D++
Sbjct  479   IQDLR  483



>gb|KDO38337.1| hypothetical protein CISIN_1g011531mg [Citrus sinensis]
Length=483

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 198/472 (42%), Positives = 286/472 (61%), Gaps = 13/472 (3%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             YP   HI  M++LA+LL  ++ +VTF+ T H  + LL  +D+ S    +  F+F +IP G
Sbjct  15    YPLQGHIKPMMSLAELLGSANFQVTFVNTDHNHDLLLRNTDITSFCNRFPNFQFRSIPSG  74

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR--CIIADGFANF-  500
             LP  +      SG+    +  ++ A +KP  ++++++   E    Q   C+IADG   F 
Sbjct  75    LPANVI----RSGLTAKDVFDAMKAVSKPAFRDLLISLREETEQRQSPTCVIADGILCFL  130

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLR  680
              +DV+EE+ +P+++    +A+ +W YF +P L++ G +PF  ++M++P+  + G E  LR
Sbjct  131   TLDVSEELQIPLLALRTHNASYSWIYFLLPKLVEDGHIPFPDENMEKPVAGIPGFENFLR  190

Query  681   RRDLPGNCRVDDLEDPFFK--FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
              RDLPG CRV   +D +    F+ E     R    I+N+F E+E   +  +       +Y
Sbjct  191   NRDLPGTCRVKTSDDDYLLQFFIGETFAMTRASALILNTF-EIEAPVVSLLG-SHFTKIY  248

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPLHEL ++++   N    +SS  L  +   CM WL+ QPP SVLYV FG+L  ++ E
Sbjct  249   TIGPLHELRKSRMKDINSPSVSSSGILQTEDTSCMTWLNSQPPKSVLYVSFGSLVGLTRE  308

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRC-CVVEWAPQQEVL  1211
              ++E WHGL+N GQRFL  + P L+L +     E P     G E R   +V WAPQ+EVL
Sbjct  309   QMSELWHGLVNRGQRFLLVVRPDLILGEP-GAAETPLAQNEGTEERNRFIVSWAPQEEVL  367

Query  1212  AHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRH  1391
             AH AVGGFLTH GWNS +E I AGVPMI WP ++DQ VNSR + EVWKIG DMKDTCD  
Sbjct  368   AHPAVGGFLTHGGWNSTLEGIAAGVPMICWPQFSDQLVNSRCVSEVWKIGFDMKDTCDGS  427

Query  1392  IIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             IIEK+VRDLME +++E +    + A  A++   EGGSS  +L+ LIEDI+ M
Sbjct  428   IIEKLVRDLMENKREEIMGSTDRVATMARDAVNEGGSSYRNLDGLIEDIRLM  479



>gb|KDO61155.1| hypothetical protein CISIN_1g037374mg [Citrus sinensis]
Length=463

 Score =   377 bits (967),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 208/471 (44%), Positives = 292/471 (62%), Gaps = 31/471 (7%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFS-DVISRFRCYSGFRFETI  320
             +P P   H++SML LA+LL  + +K+TF+ T +  + ++  S D  SR+    G + +T+
Sbjct  12    FPLPGVGHVNSMLKLAELLSHAGIKITFLNTEYYYDRVIRHSSDGFSRYMQIPGLQLKTV  71

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANF  500
              DGLP     DH  +     +L+ SL+    P LKE+V  S    ++P   IIADG+ + 
Sbjct  72    TDGLPK----DHPRTPDKFTELIDSLNLAIPPLLKEMVTDS----NSPVNYIIADGYMSH  123

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLL  677
             A+DVA EVG+ II F  VSA A W++  IP++I AGELP  G +DMD  I +V GME  L
Sbjct  124   AIDVAREVGISIIYFCTVSACAFWSFHCIPNIIIAGELPIKGTEDMDRLITNVTGMEGFL  183

Query  678   RRRDLPGNCRVDDLED-PFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R RDLP  CRV++  D     F  E R   R    I+N+F++LEG               
Sbjct  184   RCRDLPSFCRVNNPMDLQLLLFARETRLSVRAGGLILNTFEDLEGPIF------------  231

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPL+  L+ ++       T SS+GL +  + C+ WLD+QP  SV+YV FG++ ++S +
Sbjct  232   -IGPLNAHLKVRIPE----KTHSSSGLWKVDRSCIAWLDKQPKQSVIYVSFGSVAVMSRD  286

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              L  F++GL+NS   FLW + P L+  K  E  ++P E++   + R  +  W PQ+EVLA
Sbjct  287   QLIVFYYGLVNSKNGFLWVIRPDLISGKDGE-SQIPEEVVEATKERGYIAGWVPQEEVLA  345

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H AVGGFL HCGWNS +ESI+AG+PMI WP +ADQQ+NSRF+ EVWK+GLD+KD  DR+I
Sbjct  346   HKAVGGFLIHCGWNSTLESIMAGMPMICWPSFADQQINSRFVDEVWKLGLDIKDLFDRNI  405

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EK V DLM  RK+EF++ A Q AN AK+   EGGS   +L+ L++DIK M
Sbjct  406   VEKAVNDLMVKRKEEFMESADQMANLAKKSVNEGGSLYCNLDRLVKDIKMM  456



>ref|XP_008388092.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   377 bits (969),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 208/477 (44%), Positives = 284/477 (60%), Gaps = 28/477 (6%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  HI  ML+LAQLLC + + VTF++T      L     + +RF       FE+IPD
Sbjct  18    PFPAQGHITPMLSLAQLLCHAGIHVTFLSTEXNHRXLTQRRALSARF---PTLHFESIPD  74

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS----------APQRCI  476
              LP     D   +   +  +  SL +  KP L+++++T   +D            P  C+
Sbjct  75    ALP----PDQPPAIHSLHDISSSLRSVTKPLLRDLLITLAKKDDESYRSTTIRCPPLSCV  130

Query  477   IADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSV  656
             I DG   FA+DVAEEVG+P+++   VSA + W Y  IP LIQ G+LPF  +DMD PI  +
Sbjct  131   IIDGIMCFAIDVAEEVGIPVLALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMDHPIRDI  190

Query  657   KGMEKLLRRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRI  833
              GME LLR RDLP  CR+  ++ P FKF ME      R    I N+F +L    L Q+  
Sbjct  191   PGMEALLRXRDLPSFCRMP-IDHPSFKFFMEQIEAITRVSAIIXNTFDDLXPXILXQIAT  249

Query  834   GDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGT  1013
                  +Y +GP H LL++++G     L++S + L  + ++CM WLD Q   SV++V FG+
Sbjct  250   R-FXKIYTLGPXHALLKSRVGD---DLSSSVSSLRHEDRRCMAWLDSQQSGSVIFVSFGS  305

Query  1014  LTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWA  1193
             L  +S   L EFWHGL+NSG+ FLW +   ++ + + E    P E+ +G + R  + EW 
Sbjct  306   LAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLXSGQ-EEXATPVELEDGTKERGYIAEWV  364

Query  1194  PQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMK  1373
             PQ+EVLAH AVGGF TH GWNS +E I AGVPM+ WP  ADQQVNSR++GE WKIGLDMK
Sbjct  365   PQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNSRWVGEGWKIGLDMK  424

Query  1374  DTCDRHIIEKMVRDLMEV--RKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             DTCDR  +EKMVR LME   ++++  +    FA  A+    E GSS  +LE LIED+
Sbjct  425   DTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSSYKNLEKLIEDL  481



>ref|XP_007026849.1| UDP-glucosyl transferase 85A3, putative [Theobroma cacao]
 gb|EOY07351.1| UDP-glucosyl transferase 85A3, putative [Theobroma cacao]
Length=468

 Score =   376 bits (965),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 210/468 (45%), Positives = 291/468 (62%), Gaps = 15/468 (3%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  HI  ML LA+LLC + L+VTF+ T H+   L    D+ +RF       FE++ D
Sbjct  10    PFPAQGHIKPMLCLAELLCQAGLRVTFLNTHHSHRRLNNLQDLSTRF---PTLHFESVSD  66

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT-SGGEDSAPQRCIIADGFANFA  503
             GLP    +DH  + V  + L+HS+    KP L++++ + S   D  P  CIIADG  +FA
Sbjct  67    GLP----EDHPRNLVHFMHLVHSIKNVTKPLLRDLLTSLSLKTDIPPVSCIIADGILSFA  122

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             +DVAEE+ + +I F  +S+   W+Y  +P LIQ GEL F+  DM + + SV  M+  LR 
Sbjct  123   IDVAEELQIKVIIFRTISSCCLWSYLCVPKLIQQGELQFSDSDMGQKVSSVPEMKGSLRL  182

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
              D P +  +  LEDP F+F + E +   R    I N+F  LE   L QM I  +  VY I
Sbjct  183   HDRPYSFGLKQLEDPNFQFFVSETQAMTRASAVIFNTFDSLEAPVLSQM-IPLLPKVYTI  241

Query  861   GPLHELLRNKLGSCNVTLTTSSNG-LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             GPLH L + +LG  +++  +S NG L E    C+ WLD QP  SV+YV FG+  +++ E 
Sbjct  242   GPLHALRKARLG--DLSQHSSFNGNLREADHNCITWLDSQPLRSVVYVSFGSHVVLTSEE  299

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L EFWHGL+NSG+RFLW L P ++  +K     +  E   G + +  +V+WAPQ+EVLAH
Sbjct  300   LLEFWHGLVNSGKRFLWVLRPDIIAGEKDHNQIIAREPDLGTKEKGLLVDWAPQEEVLAH  359

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              +VGGFLTHCGWNS +ES+VAGVPM+ WP   DQ VNS  + EVWKIGLD+KD CDR  +
Sbjct  360   PSVGGFLTHCGWNSTLESMVAGVPMLCWPKLPDQLVNSSCVSEVWKIGLDLKDMCDRSTV  419

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             EKMVR LME R++E ++     +  A+E    GGSS S+LE LI++++
Sbjct  420   EKMVRALMEDRREEVMRSVDGISKLARESVSHGGSSSSNLEMLIQELE  467



>ref|XP_008353149.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   377 bits (967),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 208/477 (44%), Positives = 283/477 (59%), Gaps = 28/477 (6%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  HI  ML+LAQLLC + + VTF++T H    L     + +RF       FE+IPD
Sbjct  18    PFPAQGHITPMLSLAQLLCHAGIHVTFLSTEHNHRLLTQRRALSARF---PTLHFESIPD  74

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS----------APQRCI  476
              LP     D   +   +  +  SL +  KP L+++++T   +D            P  C+
Sbjct  75    ALP----PDQPPAIHSLHDISSSLRSVTKPLLRDLLITLAKKDDESYRSTTIRCPPLSCV  130

Query  477   IADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSV  656
             I DG   FA+D AEEVG+P+ +   VSA + W Y  IP LIQ G+LPF  +DMD PI  +
Sbjct  131   IIDGIMCFAIDXAEEVGIPVXALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMDHPIRDI  190

Query  657   KGMEKLLRRRDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRI  833
              GME LLR RDLP  CR+  ++ P FKF ME      R    I N+F +L    L Q+  
Sbjct  191   PGMEALLRXRDLPSFCRMP-IDHPSFKFFMEQIEAITRVSAIIXNTFDDLXPXILXQIAT  249

Query  834   GDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGT  1013
                  +Y +GP H LL++++G     L++S + L  + ++CM WLD Q   SV++V FG+
Sbjct  250   R-FXKIYTLGPXHALLKSRVGD---DLSSSVSSLRHEDRRCMAWLDSQQSGSVIFVSFGS  305

Query  1014  LTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWA  1193
             L  +S   L EFWHGL+NSG+ FLW +   ++ + + E    P E+ +G + R  + EW 
Sbjct  306   LAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLXSGQ-EEXATPVELEDGTKERGYIAEWV  364

Query  1194  PQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMK  1373
             PQ+EVLAH AVGGF TH GWNS +E I AGVPM+ WP  ADQQVNSR++GE WKIGLDMK
Sbjct  365   PQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNSRWVGEGWKIGLDMK  424

Query  1374  DTCDRHIIEKMVRDLMEV--RKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             DTCDR  +EKMVR LME   ++++  +    FA  A+    E GSS  +LE LIED+
Sbjct  425   DTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSSYKNLEKLIEDL  481



>emb|CAN77812.1| hypothetical protein VITISV_010344 [Vitis vinifera]
Length=642

 Score =   382 bits (980),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 199/456 (44%), Positives = 281/456 (62%), Gaps = 30/456 (7%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P   H++ ML LA+LL L+ L++TF+ + +  + LL +++++ R+  Y GFRF+TI 
Sbjct  13    FPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNILDRYTRYPGFRFQTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             +GLP     D   +G G+  ++  + AT KP  +E+V+ S  + S P  CIIADG  +FA
Sbjct  73    NGLPL----DRPWTGAGLRDMMDGIKATTKPLFREMVI-SWCQSSDPVTCIIADGLMSFA  127

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             +DVA EVGVPIIS   VS     AYFS   LI+AGE+PF   DMD  +  V GME  LRR
Sbjct  128   IDVANEVGVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRLVTRVPGMEGFLRR  187

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP   R  D  D   +F++ E ++  R    I+N+F++L+G  L Q+R      +Y I
Sbjct  188   RDLPSFXRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIR-NHCPKIYTI  246

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L+++L S   T +  SN   E+ + C+ WLDRQP  S +YV FG++T++++E +
Sbjct  247   GPLHAHLKSRLAS-ETTTSQFSNSFWEEDRSCLAWLDRQPSKSXIYVSFGSITVITKEQM  305

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWH                    +K    ++  ++    + R  +V+WAPQ+EVLAH 
Sbjct  306   MEFWH--------------------EKDGEFQLQAQLREVTKERGQIVDWAPQEEVLAHP  345

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             AVGGFLTH GWNS +ESIVAGVPMI WP+++DQQ+NSRF+  VWK G+DMKDTCDR  +E
Sbjct  346   AVGGFLTHGGWNSTLESIVAGVPMICWPYFSDQQLNSRFVSHVWKXGMDMKDTCDRITVE  405

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSI  1508
             KMVRD+ME R+ EF +     A  A+    E   +I
Sbjct  406   KMVRDVMEERRAEFTKSVDAMAKLARSSLSEERKTI  441



>ref|XP_010923186.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 204/475 (43%), Positives = 281/475 (59%), Gaps = 26/475 (5%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP    ++ ML LA LL  + L VTF+ T H    L  FS  +SR      FRF +IP
Sbjct  14    FPFPGQGMVNCMLKLADLLSGAGLHVTFLNTHHNHRRLSQFSGALSRLAQRPKFRFASIP  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS---APQRCIIADGFA  494
             DGL    +++   S      L  S+   A    +++++    +D+    P  C+IADG  
Sbjct  74    DGL----SEEETRSVFNFFDLEESMRTRAATSFRDLLLAYRDKDTDGWPPVTCVIADGLM  129

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEK  671
              F +DV+EEVG+P I F  +SA   WAY  IP+L+++GE+PF  G D+DEP+  V GME 
Sbjct  130   PFTIDVSEEVGIPAIMFRTISACCVWAYLCIPNLLESGEIPFPEGADLDEPVRGVAGMES  189

Query  672   LLRRRDLPGNCR-VDDLEDPFFKFMMEFRKCF-RTKHHIINSFQELEGSTLDQMRIGDML  845
              LRRRDLP  CR   D  D   + M        R +  I+N+ + LEGS L  +R    +
Sbjct  190   FLRRRDLPSFCRQARDQMDRELQVMSSVTASTNRARALILNTLESLEGSALSHIRKHSPV  249

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
               YA+GPL+              ++ S  L ++ + CM WL  QP  SV+YV FG+LT+V
Sbjct  250   T-YAVGPLN---------AQAGTSSDSGSLWQEDRDCMTWLHAQPDRSVVYVSFGSLTVV  299

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNK---KVERGEVPTEILNGLEGRCCVVEWAP  1196
             + E   EFWHGL++SGQRFLW +   L+  +     E+  VP E+      R C+V WAP
Sbjct  300   TREEYMEFWHGLVDSGQRFLWVVRSDLINMRGGGTEEKPAVPAEVEEWTRDRGCIVGWAP  359

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q+EVLAH +VG F+TH GWNS +E I AG PM+ WPF+ADQQ+NSRF+  VW+IGLDMKD
Sbjct  360   QEEVLAHPSVGCFVTHSGWNSTLECIAAGKPMLCWPFFADQQINSRFVSAVWEIGLDMKD  419

Query  1377  TCDRHIIEKMVRDLMEVRKDEFLQR-AKQFANSAKECAKEGGSSISSLENLIEDI  1538
              C R I+EKMVR++ME  + E L+R A++ A  AK+   EGG+S + L+ LI+ I
Sbjct  420   LCGRSIVEKMVREVMEGERSEELRRNAREMAEMAKKSVAEGGTSYNDLQRLIQHI  474



>gb|AGZ84549.1| glycosyltransferase KGT31 [Pueraria montana var. lobata]
Length=479

 Score =   374 bits (961),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 206/473 (44%), Positives = 294/473 (62%), Gaps = 19/473 (4%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   +++SML LAQLL L    VTF+ T +  +    F  + +  + Y   +F+TIPDGL
Sbjct  12    PVKGNVNSMLKLAQLLALHDFHVTFLNTENNHHRFHRFGHIEALSQTYPTLQFKTIPDGL  71

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR----CIIADGFANF  500
             PH      RS    +V L  S+++ AKP L+EI+++       PQ+    C+I DGF   
Sbjct  72    PH---HHPRSGDHALVDLYASMNSHAKPLLREILLSQ-----TPQKPRVTCLIGDGFLAA  123

Query  501   AVDVAE-EVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKL  674
                    EVG+P+I F  +  ++ WA F  P+L Q+ ELP  G+ DMD  I ++ GME L
Sbjct  124   LAADVADEVGIPLIHFFAIGVSSFWALFCAPNLFQSNELPIRGEEDMDRIITTLPGMENL  183

Query  675   LRRRDLPGNCRVDD--LEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
             LR RDLP   R  +  + DP    + E  +    +  I+N+F++++G  L Q+R+  +  
Sbjct  184   LRCRDLPSFYRGAESHMVDPLKSKVFESHQTLGARGLILNTFEDIDGPVLSQIRL-KIPQ  242

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             V+A+GPLH  L ++  S +   T S++   E  + C+ WLD QP  SV+YV FG++T ++
Sbjct  243   VFAVGPLHAHLNSRRVS-DAKTTPSTSSFWEVDRGCLTWLDSQPLKSVIYVSFGSITTLT  301

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E L EFW+GL++S +RFLW + P +V  K+ + G +P E+  G + R  +V WAPQ+E 
Sbjct  302   RERLLEFWYGLVDSKKRFLWVVRPDMVAGKEND-GRIPEELEEGTKERGLMVGWAPQEEA  360

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH A+GGFLTH GWNS +ES+VAGVPMI WP++ADQQVNSRF+ EVWK+GLDMKD CDR
Sbjct  361   LAHKAIGGFLTHSGWNSTLESLVAGVPMICWPYFADQQVNSRFVNEVWKLGLDMKDVCDR  420

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             H++E MV DLM  R+DEFL+ A+  A  A +     GSS SSL+ LI+ IK +
Sbjct  421   HVVENMVNDLMVHRRDEFLRSAQAMAMLAHKSVSPSGSSYSSLDQLIQYIKSI  473



>emb|CAN68538.1| hypothetical protein VITISV_039646 [Vitis vinifera]
Length=450

 Score =   372 bits (954),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 204/471 (43%), Positives = 286/471 (61%), Gaps = 42/471 (9%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LA+LL ++ L VTF+ + + ++ LL  +D+ +RF  Y GFRF+TI 
Sbjct  13    FPFPAQGHVNSMLKLAELLSVAGLHVTFLNSEYNQHRLLLHTDIQTRFSXYPGFRFQTIS  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSG-GEDSAPQ-RCIIADGFAN  497
             DGL    T DH  +G  ++ L   L ATAKP  +E+V++ G G D+ P   CIIADG  +
Sbjct  73    DGL----TTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIMS  128

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             F +D+A EVG+PIISF  +SA + WAYFS   LI++GELP  G DMD+ + S+ GME  L
Sbjct  129   FTIDIANEVGIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQLVTSIPGMEGFL  188

Query  678   RRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             R+RDLP   RV +L+D     +  E ++  R    I+N+F++LEG  L Q+R       Y
Sbjct  189   RKRDLPSLIRVSNLDDEXLLLVTKETQQTPRAHALILNTFEDLEGPILGQIR-NHCPKTY  247

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPLH  L  +L S + T + SSN L ++ + C+ WL+RQP  SV+YV FG++T+++ +
Sbjct  248   TIGPLHAHLETRLASESTT-SQSSNSLRQEDRSCIAWLNRQPSKSVIYVSFGSVTVITRK  306

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLA  1214
              L EF +GL NSG RFLW +    +  +  ER + P E+L G + R              
Sbjct  307   QLIEFCYGLENSGSRFLWVIRTDSLAEEDGER-QTPAELLEGAKER--------------  351

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
              S + G                G    G     +QQ+NSRF+  VWK+G DMKDTCDR I
Sbjct  352   -SYIRG---------------VGSTRRGSSAPGNQQINSRFVSHVWKLGSDMKDTCDRLI  395

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +EKMVRDLME RKDE L+ A + A  A++C  EGGSS  +L +LIE+I+ M
Sbjct  396   VEKMVRDLMEERKDELLKTADKMATRARKCVSEGGSSXCNLSSLIEEIRLM  446



>gb|KHG01936.1| UDP-glycosyltransferase 85A1 [Gossypium arboreum]
Length=913

 Score =   385 bits (989),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 205/444 (46%), Positives = 280/444 (63%), Gaps = 15/444 (3%)
 Frame = +3

Query  147   AYPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
              +PFP   HI+SM+ LA+LL L+  K+TF+ + +    L+ F+++ + F  Y GF F+TI
Sbjct  16    VFPFPLQGHINSMIKLAELLALAGFKLTFLNSHYNHERLVKFNNIAAHFERYQGFEFKTI  75

Query  321   PDGLPHGLTDDHRSSGVGIVQLLH-SLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFAN  497
              DGLP     DH  SG   + +   +L    KP L+E++       S P  CIIADGF  
Sbjct  76    TDGLPL----DHPRSGNWFLDMYEEALEMKMKPGLREMLENI----SPPVDCIIADGFLG  127

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKL  674
             FA+DVA+E+ +PII F   S  + W Y+SIP +IQAGELP  G +DMD  + +V GME  
Sbjct  128   FAIDVAKELEIPIIYFRTSSPCSFWVYYSIPDIIQAGELPIKGSEDMDRLLTTVPGMETY  187

Query  675   LRRRDLPGNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
              R RDLP  CR  D+ED   K ++ + +K  +    I+N+ +EL+G  L Q+R      V
Sbjct  188   FRCRDLPSFCRETDIEDSIIKLYVKQTQKSSQADALILNTAEELDGPILSQIRT-KCPRV  246

Query  852   YAIGPLHELLRNKLGSCN-VTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             YAIGPLH  L  +L + +  +    SN L E  K C+ WLD+QP  SV+YV FG++T  S
Sbjct  247   YAIGPLHAQLNTRLKAKHGESYDHFSNTLWEVDKSCIFWLDKQPNRSVIYVSFGSITSTS  306

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E L E W+GL+NS  +FL  + P  V+ K  E  +V  E++   + +  +V WAPQ+ V
Sbjct  307   REQLVELWYGLLNSKTKFLLVVRPNSVIGKDGEGEDVVVELMEKSKDQGYIVNWAPQEAV  366

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             L H  VGGF TH GWNS +ESIVAGVPMI WP++ADQQVNSR + EVWKIGLDMKD CD+
Sbjct  367   LNHPTVGGFFTHNGWNSTLESIVAGVPMICWPYFADQQVNSRVVSEVWKIGLDMKDVCDK  426

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQ  1460
              I+EKMV+D+M  +K+EF+Q A +
Sbjct  427   KIVEKMVKDVMVDQKEEFVQSAAE  450


 Score =   370 bits (951),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 196/447 (44%), Positives = 275/447 (62%), Gaps = 14/447 (3%)
 Frame = +3

Query  213   LKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDHRSSGVGIVQLLH  392
              K+TF+ + H    L+ F+ +++ F+ Y GF  +TI DGLP     DH  SG   ++   
Sbjct  463   FKLTFLNSHHNHERLIKFTSIVAYFKRYPGFELKTITDGLPL----DHPRSGNWFLETYE  518

Query  393   -SLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEVGVPIISFHPVSAAAT  569
              ++    K   +E+++ S    + P  C+IADGF+ +A+DVA E+G+PII F   S  + 
Sbjct  519   EAILMKIKQSFREMMINS----NPPVDCVIADGFSGYAIDVANELGIPIIGFRTSSPRSF  574

Query  570   WAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMM  746
             W Y+SI  +I+AGELP  G +DMD  I +V GME  LR RDLP  CR  D+ED   + ++
Sbjct  575   WVYYSITDIIKAGELPIRGSEDMDRLITTVPGMETYLRCRDLPSFCRKPDIEDSTVQLIV  634

Query  747   -EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCN-VTLTT  920
              + RK  +    I N+  EL+   L Q+R     N+Y IGPLH  L  +L + +  +   
Sbjct  635   KQTRKSTQADALIFNTTDELDEPILSQIRT-KCANIYPIGPLHAQLNTRLKAKHGESFDQ  693

Query  921   SSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNP  1100
              SN L E+ K C+ WLD+QP  SV+YV FG++T  S + L E W+GL+NS  +FL+ + P
Sbjct  694   FSNTLREEDKSCIPWLDKQPNRSVIYVSFGSITSTSRDQLVELWYGLLNSKTKFLFVVRP  753

Query  1101  RLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVA  1280
               V+ K  E  +   E++   + R  +V+WAPQ+ VL H AVGGFLTH GWNS +ESIVA
Sbjct  754   DSVIGKDGEGEDFVKELMEKSKDRGYIVDWAPQEVVLNHEAVGGFLTHSGWNSTLESIVA  813

Query  1281  GVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQ  1460
             GVPM+ WP++ADQQV SR +  VWKIGLDMKD  DR I+EKMV D+M V + EF+  A  
Sbjct  814   GVPMVCWPYFADQQVTSRVVSTVWKIGLDMKDVSDRKIVEKMVNDVM-VDQKEFVNSATD  872

Query  1461  FANSAKECAKEGGSSISSLENLIEDIK  1541
              A    +C   GGSS ++L+ LIEDI+
Sbjct  873   MAKVINQCVSIGGSSSNNLDRLIEDIR  899



>ref|XP_010923185.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   372 bits (956),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 284/472 (60%), Gaps = 17/472 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H+ +ML LA+L  L+ L++TFI T      LL  S  +        FRF TIP
Sbjct  13    FPFPAQGHVPTMLKLAELFLLAGLRITFINTERIHRRLLLNSPTLPPLARLPRFRFRTIP  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGE-DSAPQ-RCIIADGFAN  497
             DGLP    +D R + V + +L  S+   ++   ++++  +G + D  P   C++ADG   
Sbjct  73    DGLP----EDDRRASVPLQELEESIRTRSREPYRDLLAPAGRDPDEWPSVTCVVADGSLP  128

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEKL  674
              + +VAEEVG+P+I F   SA A WAY+ IP LI+ GE+PF    D DE +  V GME  
Sbjct  129   LSWEVAEEVGIPVIFFRTSSACAFWAYYRIPDLIKGGEIPFPEEADWDEKVRGVPGMESF  188

Query  675   LRRRDLPGNCR-VDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
             LRRRDLP  CR      D   + +        R +  I+N+F+ LEG  L  +R    + 
Sbjct  189   LRRRDLPSFCRNAKTTSDRGLQSVDNATASTRRARALILNTFESLEGPVLSHIRSAIPIT  248

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
              YA+GPLH LL     +    +T +S  L ++ + CM WLD QPP SV+YV FG++ ++S
Sbjct  249   -YALGPLH-LLVKTFENGGSFVTINSVRLSQEDRSCMTWLDSQPPRSVVYVSFGSVAVMS  306

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E L EFWHGL++SG+RFLW L   LV  K  E   VP E   G   R C+V WAPQ+EV
Sbjct  307   REELMEFWHGLVDSGERFLWVLRSDLVEGKTGE--AVPAEA-EGTRERGCIVGWAPQEEV  363

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             L+H AVG FLTH GWNS +ES+ AGVPMI WP +ADQQ+NSRF+ +VW+IG DMKD C+R
Sbjct  364   LSHPAVGCFLTHSGWNSTLESVSAGVPMICWPCFADQQINSRFVSDVWRIGADMKDKCER  423

Query  1389  HIIEKMVRDLMEVRKDEFLQ-RAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
              I+EKMVRD+M   + E L+  A + A  A+    +GGSS     +L+E I+
Sbjct  424   SIVEKMVRDVMVRERAERLRTSAMEMAELARRSVAKGGSSYRDYWSLVEHIR  475



>ref|XP_010674282.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   372 bits (955),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 211/520 (41%), Positives = 299/520 (58%), Gaps = 65/520 (13%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI  ML+LA+L CL++LKVTF+ T      L   +D+ +RF  Y  FRFETI    
Sbjct  17    PLQGHITPMLHLAELFCLANLKVTFLNTNKNHKLLTQHTDIQARFARYPSFRFETI----  72

Query  333   PHGLTDDH-------------------------------------------------RSS  365
             P   + D                                                  RS+
Sbjct  73    PDSPSKDQPQAQAQAQAQAQEQEQKRAQKQAQAQAQEQEQKQAQEQAQAQALALAVKRSN  132

Query  366   GVGIVQLLH-SLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEVGVPIIS  542
                 ++ LH +L+ +A+P L+E++   G  D     C I DG+  FA ++A E  VP+I+
Sbjct  133   LKDALEALHEALAPSAEPLLRELLF--GTRDKI--TCFIIDGWLRFAYEIASEAEVPVIA  188

Query  543   FHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEKLLRRRDLPGNCRVDDL  719
             F   SA   WAYF IP +I+AGE+PF + ++MD+ + +V GM+  LR RDLP  CR  D+
Sbjct  189   FRCPSACCIWAYFCIPHIIEAGEVPFKDNEEMDQLVKNVPGMDSFLRCRDLPSFCREQDM  248

Query  720   E---DPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNK  890
                 +    F+ E ++       I+N+F++LEG  L Q+R      VY+IGPLH  L+ +
Sbjct  249   SSCCELQEYFVGEIQRTKYAHSFILNTFEDLEGPILSQIR-SQCSTVYSIGPLHAHLKYR  307

Query  891   LGSCNVTLTTSSNGLH-EDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMN  1067
             LG     L+ +S+    E  K C+ WLD++P  SV+YV  G+ T ++++ L E W GL+ 
Sbjct  308   LGKGETPLSNNSSSSLWEVDKSCISWLDQKPDKSVIYVSLGSTTTLTKDQLTELWTGLVQ  367

Query  1068  SGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHC  1247
             S + FLW ++P +++   ++    P ++L G E R C+V+W+PQ EVL H A+GGFLTH 
Sbjct  368   SKRYFLWVVSPNVIIEGGLD-SPTPNDLLEGTEKRGCIVKWSPQDEVLTHRAIGGFLTHS  426

Query  1248  GWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEV  1427
             GWNS +ESIVAGVPM+ WP +ADQQ+NSRF  EVW+IGLDMKDTCDR I+EKM+ DLM+ 
Sbjct  427   GWNSTLESIVAGVPMLCWPHFADQQLNSRFASEVWRIGLDMKDTCDRTIVEKMINDLMDG  486

Query  1428  RKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +KDE  + AK+ +  AK+   EGGSS S+L  LIEDI  M
Sbjct  487   KKDELQRSAKRVSQEAKKSISEGGSSYSNLNRLIEDIIAM  526



>ref|XP_004302685.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Fragaria vesca 
subsp. vesca]
Length=465

 Score =   369 bits (948),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 203/474 (43%), Positives = 288/474 (61%), Gaps = 26/474 (5%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDH  356
             ML LAQLLC + + VTF+ T H   +L     + +RF      RF +I DGLP   +D  
Sbjct  1     MLTLAQLLCHAGIHVTFVNTEHNHRHLTQRESLSARF---PTLRFRSIFDGLP---SDHP  54

Query  357   RSSGVGIVQLLHSLSATAKPFLKEIVVT-----------SGGEDSAPQRCIIADGFANFA  503
             RS     + ++ SL +T  P L +++V+           + G+   P  C+I DG   FA
Sbjct  55    RSISPYFLDIVTSLRSTTAPLLHQLLVSLASKTNDDIGAAAGDQLPPLSCVITDGLMCFA  114

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             +D AEEVG+P+I+    SA + W Y  +P LI+  ELPF  +DMD+ +  V G E LLRR
Sbjct  115   IDAAEEVGLPVIAVRTSSACSVWCYLCLPKLIEEAELPFGDEDMDKTVSGVPGKECLLRR  174

Query  684   RDLPGNCRVDDLEDPFFKFMMEFRKCF-RTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDL   CR+  ++ P FKF ME      R    I+N+F++LE S L  +       +Y I
Sbjct  175   RDLLSICRMP-VDHPVFKFFMEEHIAITRASGLILNTFEDLESSVLSHI-ASKFSKIYPI  232

Query  861   GPLHELLRNKLGSCNVTLTTSSNG--LHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
             GPLH LL++++   +++ ++++    LH + + CM WLD Q P SV++V +G+L  ++  
Sbjct  233   GPLHALLKSRVDDHDLSSSSTAMAASLHREDRSCMTWLDSQRPGSVIFVSYGSLVKLTRV  292

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNKKVE--RGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              L EFWHGL+NSG  FLW +    VL+ + E  R   PTE+  G + R  +V+WAPQ+EV
Sbjct  293   QLLEFWHGLVNSGSHFLWVMRSD-VLSDEGEHMRHVTPTELEMGTKERGFIVDWAPQEEV  351

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH AVGGFLTH GWNS +E+I AGVPM+ WP  ADQQVNSR++GEVWKIG+DMKD CDR
Sbjct  352   LAHDAVGGFLTHSGWNSTLEAIWAGVPMLCWPQVADQQVNSRWVGEVWKIGIDMKDMCDR  411

Query  1389  HIIEKMVRDLMEVRKDEFLQRA-KQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
               +EKM++ LM   + E   R+  +F+  A+    E GSS  +LE LI+D++ +
Sbjct  412   TTVEKMIKALMGGEEREVFTRSVDRFSKLARASVSESGSSYHNLEKLIQDLRNL  465



>ref|XP_009759439.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=483

 Score =   369 bits (946),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 200/469 (43%), Positives = 285/469 (61%), Gaps = 15/469 (3%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P    I+  L LA+L CLS LKVTF+ T+H +  LL  ++V SRF  Y GFRF TIP
Sbjct  16    FPLPIQGPINCKLQLAELFCLSGLKVTFLNTIHNQERLLRHTNVQSRFEKYPGFRFLTIP  75

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP    D+H  S      ++ S+   A+PFL+E++ +   E      C++ D  + + 
Sbjct  76    DGLP----DEHPRSFEQFGDIISSVQTVAEPFLREMLRSGAKELVT---CVVPDALSYYV  128

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D+  E+GVP+I F  +S +  W Y  +P LI++GELPF   D+D  +  +  +E LLRR
Sbjct  129   ADIGNEMGVPVIPFDTLSPSCVWVYMCLPKLIESGELPFKDNDLDASVTHIPALEGLLRR  188

Query  684   RDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  C +D   DP F   + +  +  ++   I+N+F++L+   L  +        YAI
Sbjct  189   RDLPPFCLMDYKTDPDFLAALKQVERIPQSHGLILNTFEDLDRPFLSCIH-SYSPKTYAI  247

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L+ KL S N     SSN L E+    + WLD QP  SVLYV FG++ +VS+E +
Sbjct  248   GPLHLHLKAKLSSKN---APSSNSLWEEDHSSIKWLDAQPMGSVLYVSFGSVVVVSKEEI  304

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EF HGL+NS  +FLW + P  +L       +   E+  G +G   +V WAPQ+ VLAH 
Sbjct  305   LEFQHGLLNSKVKFLWVMRPN-ILKGGESDVQFMKELAEGCKGNGYIVSWAPQKMVLAHP  363

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             A+ GFLTH GWNS +ES+  G PMI WP Y DQ+VNSR + E+W+IGLDMK  CDR  IE
Sbjct  364   AIAGFLTHSGWNSTLESVSEGKPMICWPHYVDQRVNSRLVNELWQIGLDMKGICDRSTIE  423

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +M++DLME+++DE  +  ++ +  AK   +EGGSS ++L+ LI+DIK +
Sbjct  424   RMIKDLMEIKRDELKKSIEELSKLAKLSVEEGGSSYNNLDCLIDDIKEL  472



>gb|AFK79038.1| glycosyltransferase UGT6 [Bupleurum chinense]
Length=489

 Score =   367 bits (941),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 199/471 (42%), Positives = 286/471 (61%), Gaps = 12/471 (3%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    ++ ML LA+LL L++L VTF+ T H +N+L+  + V SRF  Y  FRFETIPDGL
Sbjct  19    PLQGPVNCMLKLAELLALNNLHVTFLNTTHIQNSLIKHTHVESRFTKYPDFRFETIPDGL  78

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRC--IIADGFANFAV  506
                 ++DH  +G   + + H +    KP  +E++ +      + +    +IADGF NF V
Sbjct  79    ----SEDHPRTGDKFLDITHGIEKVMKPLFREMLSSGKLSSKSSKPVSLVIADGFYNFGV  134

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
              +A+E G+P++ F  +S  A W +FS+P+LI+ GE+PF  +D D+ +  + G EK LR R
Sbjct  135   GIAKEAGIPLVYFDTISPCAVWTFFSLPTLIKLGEVPFTEEDYDKKVTCIPGTEKYLRPR  194

Query  687   DLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLP   R  DL DP    ++ E     +++  I+N+ + ++G  + Q+      NVY IG
Sbjct  195   DLPSFFRTSDLSDPIVHLILQEIEAIPKSQGIILNTSEHIDGQIISQLSTY-CSNVYTIG  253

Query  864   PLHELLRNKLGSCNVT--LTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             PLH L ++ + S +       SSN L E+   CM WLD QP  SV+YV  G+L ++S   
Sbjct  254   PLHALHKSIMLSKDKASPQANSSNSLWEEDNSCMTWLDAQPRKSVIYVSIGSLAVMSIAQ  313

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L E  HG++NSG+RFLW   P   L+ K E   + TE+ +    R C+V W  Q+EVLAH
Sbjct  314   LMELRHGIVNSGKRFLWVQRPG-SLSGKDEDYAISTELSDATTERGCIVSWVFQEEVLAH  372

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              A+G FLTH GWNS +E I+ GVPM+ WP++ DQQVNSRF+ EVW +G+D+KD CDR  I
Sbjct  373   PAIGLFLTHSGWNSTLEGIIEGVPMLCWPYFVDQQVNSRFVQEVWSVGIDIKDKCDRVTI  432

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECA-KEGGSSISSLENLIEDIKRM  1547
             EK VR++ME RKDEF + A   A  A++    +GGSS  +   L+ DI+ M
Sbjct  433   EKAVREIMEERKDEFEKSASMMAKLARQSVCDQGGSSHHNFNRLVNDIRLM  483



>ref|XP_010666049.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=516

 Score =   366 bits (940),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 192/498 (39%), Positives = 298/498 (60%), Gaps = 36/498 (7%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQLLCLS--HLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFET  317
             +P P    ++SML LA+LL LS  ++  TF+TT    + L+  +    RF     F F T
Sbjct  19    FPLPMQGPVNSMLKLAELLILSADNIHATFLTTDVVYHQLIVSARAKERFDRNPRFSFRT  78

Query  318   IPDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQR---------  470
               DGLP    +DH   G   +++L ++ A + P ++EIV +     S+ +          
Sbjct  79    FSDGLP----NDHPRGGDKFLEMLDAVKAVSHPIVREIVSSGDTHTSSSETNQTLEVVLS  134

Query  471   ----CIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-GKDM  635
                 CI++DG  NFA+DV  EVG+P+  F  +S +  W Y  +P L++AGE+PF    D+
Sbjct  135   PLVTCIVSDGLYNFALDVGNEVGIPVFYFETMSPSCLWVYLCLPKLVEAGEVPFTENSDL  194

Query  636   DEPILSVKGMEKLLRRRDLPGNCRVDDLEDPFF--KFMMEFRKCFRTKHHIINSFQELEG  809
             D  +++V GM+  LRRRDLP  CR  D  D     + + + ++  R +  I+N+F++L+ 
Sbjct  195   DALLVNVPGMDGYLRRRDLPDFCRARDATDDIMLQRVLGQVQQMQRAQGIILNTFEDLDS  254

Query  810   STLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVT------LTTSSNGLHEDGKKCMDWLD  971
               L  MR    + +Y IGPLH  L+ +L +  ++       +  SN L ++ + CM WLD
Sbjct  255   HLLSYMRSHCSIPIYTIGPLHSSLKERLQANALSSNQPFVYSDHSNSLWQEDRNCMAWLD  314

Query  972   RQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVL----NKKVERGEV  1139
             +QP  SV++  FG+  ++++E L EF HGL++S   FLW   P  V+    N ++   +V
Sbjct  315   KQPLRSVIFCSFGSQVVITKEQLTEFLHGLVDSKTLFLWMNRPGSVIGLEENYEMLEKQV  374

Query  1140  PT--EILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYA  1313
                 ++L G++   C+V W PQ EVL+H A+GGFLTH GWNS++ES+VAGVPM+ WP Y 
Sbjct  375   LMHGDLLKGIKKNGCIVSWVPQVEVLSHPAIGGFLTHGGWNSVIESVVAGVPMVCWPHYV  434

Query  1314  DQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKE  1493
             DQ VNSR   EVWK+G+D+KD+C+R I+EK+VRD+M +R+DE L+ A + AN A    ++
Sbjct  435   DQLVNSRLATEVWKLGVDIKDSCNRAIVEKVVRDIMCLRRDELLENATKMANLASTSVQK  494

Query  1494  GGSSISSLENLIEDIKRM  1547
             GG+S  S++NLI+D++ +
Sbjct  495   GGTSYESMKNLIKDMESL  512



>ref|XP_008785470.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=489

 Score =   365 bits (937),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 202/481 (42%), Positives = 281/481 (58%), Gaps = 24/481 (5%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  H+  ML LA++L  + L VTF+ T +     L  S  + R      FRF TIPD
Sbjct  13    PFPAQGHVPPMLKLAEILSHAGLHVTFVNTDNIHRRFLASSPALQRLAGLPRFRFRTIPD  72

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA--PQRCIIADGFANF  500
             GLP    +DH    +  + L  SL   ++   +E++V +G +     P  C +ADG    
Sbjct  73    GLP----EDHPRPFLQFLDLEESLRTRSREHYRELLVPTGKDPDGWPPVTCAVADGILRL  128

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-------NGKDMDEPILSVK  659
             A +VA E+ +P+I      A A WAY  IP LI+ GE+PF           +DE I  V 
Sbjct  129   ASEVAAEMEIPVIFVRTSGACAVWAYLCIPDLIKGGEIPFPEEEEEKEEDGLDETIRGVP  188

Query  660   GMEKLLRRRDLPGNCR-VDDLEDPFFKFMMEFR-KCFRTKHHIINSFQELEGSTLDQMRI  833
             GME  LRRRDLP  CR      D   +F+        R +  I+N+F+ LEG  L  +R 
Sbjct  189   GMEGFLRRRDLPSFCRNAKSTSDRSLQFVTNANANVRRGRGLILNTFEALEGPVLSHIRS  248

Query  834   GDMLNVYAIGPLHELLRNKLGSC--NVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCF  1007
                ++ YA+GPLH LL      C  +  L+++S  L ++ + C+ WLD QP  SV+Y+ F
Sbjct  249   AIPIS-YALGPLH-LLSRTFDDCGADAPLSSNSASLWQEDRSCLKWLDSQPQRSVVYISF  306

Query  1008  GTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVE  1187
             G++T++S + L EFWHGL++SG+RFLW + P L   K  E   +  ++    + R C+V 
Sbjct  307   GSVTMMSRDELMEFWHGLVDSGKRFLWVVRPDLAEGKIEE--AIQEDLEKETKERGCLVG  364

Query  1188  WAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLD  1367
             WAPQ+EVLAH AV  FLTH GWNS +ES+ AGVPMI WPF+ADQ VNSRF+G+VW+ G+D
Sbjct  365   WAPQEEVLAHPAVACFLTHSGWNSTLESVAAGVPMICWPFFADQPVNSRFVGDVWRFGVD  424

Query  1368  MKDTCDRHIIEKMVRDLMEVRKDEFLQR-AKQFANSAKECAKEGGSSISSLENLIEDIKR  1544
             MKD   R ++E+MVR++ME  + E L+R A + A  A+    EGGSS    ENL++DIK 
Sbjct  425   MKDKRGRSVVERMVREVMEGERAEELRRSAGEMAELARRSVGEGGSSYRDFENLVKDIKA  484

Query  1545  M  1547
             M
Sbjct  485   M  485



>dbj|BAB86929.1| glucosyltransferase-11 [Vigna angularis]
Length=462

 Score =   364 bits (935),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 205/464 (44%), Positives = 278/464 (60%), Gaps = 21/464 (5%)
 Frame = +3

Query  180   LNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDHR  359
             L LA+LL L +L+VTF+TT    + L  F ++      Y    F+T  D    G   +H 
Sbjct  1     LKLAELLVLQNLRVTFLTTNTIHSRLARFGEIQVLSESYPTLHFKTFSDCYDEG---NHP  57

Query  360   SSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQ----RCIIADG-FANFAVDVAEE-  521
               G  I  L+ S++  AKPFL++I+++       PQ     C+I DG F + +  VA E 
Sbjct  58    GFGDRIWDLISSVTLHAKPFLRDILLSH-----TPQIPKLSCVIQDGIFGSLSSGVASEL  112

Query  522   -VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD-MDEPILSVKGMEKLLRRRDLP  695
              + +PII F  VS+   WAY S   L+Q  ELP  G D MD  I ++ GME LLR RDLP
Sbjct  113   NISIPIIHFRTVSSCCFWAYMSATKLLQCQELPIRGDDDMDRIIKNLPGMENLLRCRDLP  172

Query  696   GNCRVDDLEDPFFK-FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLH  872
                R +   +  F+ +    R+       I+NSF++LEG  L Q+R  +   VY +GPLH
Sbjct  173   SFFRPNQEGNSTFESYADRSRQSLAADAVILNSFEDLEGPVLSQIR-HNFSKVYTVGPLH  231

Query  873   ELLRNKLGSCNV--TLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAE  1046
               L  +    N    +    N + +  + CM WLD QP  SV+YV FG+ T++++E L E
Sbjct  232   HHLNMRKAESNKGKEIPRFKNSIFQVDRSCMTWLDAQPDGSVMYVSFGSSTIMNKEDLME  291

Query  1047  FWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAV  1226
              WHGL+NS +RFLW   P +V  K  E   VPTE+  G + R  +VEWAPQ+EVL H A+
Sbjct  292   IWHGLVNSKKRFLWVKLPDIVAGKHNEE-HVPTEVKEGTKERGFIVEWAPQEEVLTHKAI  350

Query  1227  GGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKM  1406
             GGFLTH GWNS +ES+VAGVPMI WP++ADQQ+NSRF+ EVWK+GLDMKD CDR ++EKM
Sbjct  351   GGFLTHSGWNSTLESLVAGVPMICWPYFADQQINSRFVSEVWKVGLDMKDVCDRDVVEKM  410

Query  1407  VRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             V D+M  R++EFL+ A+  A  A +    GGSS +SL +LIE I
Sbjct  411   VNDVMVHRREEFLKSAQTMAMLAHQSVSPGGSSYTSLHDLIEYI  454



>ref|XP_010666054.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=495

 Score =   364 bits (935),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 196/481 (41%), Positives = 283/481 (59%), Gaps = 23/481 (5%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQLLCLS---HLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFE  314
             +P P    ++SML LA+L+ L+    + +TF+TT      L+  ++  SRF  Y GF   
Sbjct  13    FPLPIQGPVNSMLKLAELILLASDAQIHITFLTTELVHRRLMLHANAASRFESYPGFSLR  72

Query  315   TIPDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT--SGGEDSAPQRCIIADG  488
             T  DGLP    +DH        +++ ++ A ++P L+E++VT  +      P  CII DG
Sbjct  73    TFSDGLP----EDHPRGSDKFGEMVDAVEAVSRPLLREMLVTDRANSPQEIPITCIIPDG  128

Query  489   FANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGME  668
               NFA+DV +EVG+P+I F  +S +  W Y  +P LI+ GE+PF      E I+ V G+ 
Sbjct  129   SYNFALDVGKEVGIPVIYFDTISPSCLWVYLCLPKLIEDGEVPFQENWEMEAIVGVPGIG  188

Query  669   KLLRRRDLPGNCRVDD-LEDPFFKFMMEFRKCFRTKH-HIINSFQELEGSTLDQMRIGDM  842
              LLRRRD P  CR ++   D   + + +  K FR     I+N+F++LE   L  MR    
Sbjct  189   TLLRRRDFPDFCRANNPASDVMIQRISKQAKQFRKASGFILNTFEDLEAPLLSYMR-SHF  247

Query  843   LNVYAIGPLH-----ELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCF  1007
              N+Y +GPLH      +LR +  +    L+  SN L  + K C++WLD QP  SV++  F
Sbjct  248   PNMYVVGPLHLHLKERILRKETTTSTTLLSYCSNSLWHEDKSCIEWLDAQPLRSVIFCSF  307

Query  1008  GTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLV--LNKKVER--GEVPTEILNGLEGRC  1175
             G+   +++E L EFW GL+NSG RFLW    R V  ++  V +   ++P+ +L G++   
Sbjct  308   GSHVCLTKEQLMEFWQGLVNSGTRFLWIKRQRSVTGMDDDVHKWQEQIPSGLLKGMKENG  367

Query  1176  CVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWK  1355
              V  WAPQ+EVL+H ++GGFLTH GWNS +ESIV G PM+ WP+Y DQ + SR++  VWK
Sbjct  368   YVTSWAPQEEVLSHPSIGGFLTHSGWNSTLESIVEGKPMLCWPYYVDQLIISRYVSHVWK  427

Query  1356  IGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIED  1535
             +GLDMKD CDR IIE MVRDLM+ R+ E+ Q     A  A++   E GSS  SL  L++D
Sbjct  428   VGLDMKDICDRDIIENMVRDLMDRRRGEYSQNVNALAYLARQSVHEDGSSYCSLNKLVDD  487

Query  1536  I  1538
             I
Sbjct  488   I  488



>ref|XP_003517692.2| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=505

 Score =   361 bits (927),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 206/475 (43%), Positives = 289/475 (61%), Gaps = 19/475 (4%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P+  H+ +ML LAQLL L    +TF+ T    + L  F D+ +  + Y   +F+T P
Sbjct  36    FPCPAQGHVSTMLKLAQLLALHGFHITFLNTDFIHHRLHRFGDLEALLQTYPSLQFKTFP  95

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQ-RCIIADG-FAN  497
             DGLPH     H  SG   V L   ++  AKP ++ I+++   +   P+  C IADG F  
Sbjct  96    DGLPH----HHPRSGQSAVDLFQYINLHAKPHIRHILLSQ--DPGKPKINCFIADGVFGA  149

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKL  674
               +DVA +VG+PII F  +SA+  W YF +P+L Q+ +LP  G +DMD  I  + GME +
Sbjct  150   LTIDVAHQVGIPIIHFRTISASCFWTYFCVPNLFQSNQLPITGDEDMDRVITCIPGMENM  209

Query  675   LRRRDLPGNCRVDDLEDPFF--KFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
              R RDLP   R    E  +      +E R+  + +  I+N+F++LEGS L QMR+     
Sbjct  210   FRCRDLPSFSRGTGSEIVYALNSLALETRESLQARALILNTFEDLEGSVLSQMRL-QFPR  268

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             V+ IGPLH  L  +  S N   T S++ + E  ++CM WLD QP  SV+YV FG++  ++
Sbjct  269   VFTIGPLHAHLNTRKES-NTETTPSTSCVGEVDRRCMTWLDSQPLKSVIYVSFGSIATMT  327

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGE-VPTEILNGLEGRCCVVEWAPQQE  1205
              E L E W+GL+NS +RFLW + P +V  K  E G+ VP E+  G + R  +V WAPQ+E
Sbjct  328   REKLIEIWYGLVNSKKRFLWVVRPDMVGPK--ENGDRVPAELEEGTKERGFIVGWAPQEE  385

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD-TC  1382
             VLAH A+GGFLTH GWNS +ES+ AGVPMI  P + DQ VNSRF+ EV K+GLDMKD  C
Sbjct  386   VLAHKAIGGFLTHSGWNSTLESLAAGVPMICCPSFGDQHVNSRFVSEVCKVGLDMKDVAC  445

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             DR+++E MV DLM+ R + FL  A++ A  A      GGSS S+L+ LI+ I+ +
Sbjct  446   DRNLVENMVNDLMDHRNEVFLNSAREVALLANRSVSSGGSSYSNLDGLIQYIRSI  500



>gb|KHN04919.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   360 bits (924),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 207/478 (43%), Positives = 291/478 (61%), Gaps = 22/478 (5%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P+  H+ +ML LAQLL L    +TF+ T    + L  F D+ +  + Y   +F+T P
Sbjct  14    FPCPAQGHVSTMLKLAQLLALHGFHITFLNTDFIHHRLHRFGDLEALLQTYPALQFKTFP  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQ-RCIIADG-FAN  497
             DGLPH     H  SG   V L  S++  AKP ++ I+++   +   P+  C IADG F  
Sbjct  74    DGLPH----HHPRSGQSAVDLFQSINLHAKPHIRHILLSQ--DPGKPKINCFIADGVFGA  127

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKL  674
               +DVA +VG+PII F  +SA+  W YF +P+L Q+ +LP  G +DMD  I  + GME +
Sbjct  128   LTIDVAHQVGIPIIHFRTISASCFWTYFCVPNLFQSNQLPITGDEDMDRVITCIPGMENM  187

Query  675   LRRRDLPGNCRVDDLEDPFF--KFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
              R RDLP   R    E  +      +E R+  + +  I+N+F++LEGS L QMR+     
Sbjct  188   FRCRDLPSFSRGTGSEIVYALNSLALETRESLQARALILNTFEDLEGSVLSQMRL-QFPR  246

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             V+ IGPLH  L  +  S N   T S++ + E  ++CM WLD QP  SV+YV FG++  ++
Sbjct  247   VFTIGPLHAHLNTRKES-NTETTPSTSCVGEVDQRCMTWLDSQPLKSVIYVSFGSIATMT  305

Query  1029  EETLAEFWHGLMNSGQR---FLWALNPRLVLNKKVERGE-VPTEILNGLEGRCCVVEWAP  1196
              E L E W+GL+NS +R   FLW + P LV+ K  E G+ +P E+  G + R  +V WAP
Sbjct  306   REKLIEIWYGLVNSKKRKNRFLWVMRPDLVVGK--ENGDWIPAELEEGTKERGFIVGWAP  363

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q+EVLAH A+GGFLTH GWNS +ES+ AGVPMI  P + DQ VNSRF+ EV K+GLDMKD
Sbjct  364   QEEVLAHKAIGGFLTHSGWNSTLESLAAGVPMICCPSFGDQHVNSRFVSEVCKVGLDMKD  423

Query  1377  -TCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
               CDR+++E MV DLM+ R + FL  A++ A  A      GGSS S+L+ LI+ I+ +
Sbjct  424   VACDRNLVENMVNDLMDHRNEVFLNSAREVALLANRSVSSGGSSYSNLDGLIQYIRSI  481



>dbj|BAB86920.1| glucosyltransferase-2 [Vigna angularis]
Length=485

 Score =   360 bits (923),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 189/406 (47%), Positives = 263/406 (65%), Gaps = 11/406 (3%)
 Frame = +3

Query  342   LTDDH-RSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQ-RCIIADGF-ANFAVDV  512
             L DDH RS    +  L  S+++ AKP +++I+++     + P+  C+I DGF      DV
Sbjct  78    LPDDHPRSDRNALADLYSSMNSHAKPLIRDIILSQTA--AKPKITCLIGDGFFGGLTADV  135

Query  513   AEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLLRRRD  689
             A+EVG+P+I F  +SA+  WA F  P+L ++ ELP  G+ DMD  I ++ GME +LR RD
Sbjct  136   ADEVGIPVIHFRAISASCFWALFCAPNLFESNELPIRGEEDMDRIIATLPGMENILRCRD  195

Query  690   LPGNCR--VDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             LPG  R    +L DP    + +  +  R +  I+N+F++L+G  L QMR+   L V+A+G
Sbjct  196   LPGFFRGTETNLVDPLKSTVFDCHQTLRARGVILNTFEDLDGPLLTQMRL-KFLRVFAVG  254

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
              LH  L  +  S +   T S++   E+ + C+ WLD QP  SVLYV FG++T V+ E L 
Sbjct  255   SLHAHLNYRRVS-DAKTTPSTSSFWEEDRSCLTWLDSQPLKSVLYVSFGSITTVTRERLM  313

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EFW+GL+NS +RFLW + P +V     +   V  E+  G + R  +V WAPQ+EVLAH A
Sbjct  314   EFWYGLVNSKKRFLWVIRPDMVAGADNDE-RVAAELEEGTKERGFIVGWAPQEEVLAHKA  372

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             +GGFLTH GWNS +ES+VAGVPMI WP +ADQQ+NSRF+ EVWK+GLDMKD CDR ++EK
Sbjct  373   IGGFLTHSGWNSTLESLVAGVPMICWPCFADQQINSRFVSEVWKLGLDMKDLCDRDVVEK  432

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             MV DLM  R++EFL+ A+  A  A +    GGSS SSL +L+E IK
Sbjct  433   MVNDLMVHRREEFLKSAQAMATLADKSVSPGGSSYSSLHDLVEFIK  478



>ref|XP_004512576.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cicer arietinum]
Length=473

 Score =   358 bits (920),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 196/471 (42%), Positives = 283/471 (60%), Gaps = 24/471 (5%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFR-CYSGFRFETI  320
             +P P+  H++SML LA+LL L ++ +TF+ T +  N L+ F+D I      Y  F+F+TI
Sbjct  16    FPCPAQGHVNSMLKLAELLALQNMNITFLNTEYIHNRLIRFNDSIQALSLTYPKFQFKTI  75

Query  321   PDGLPHGLTDDHRSSGVG--IVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADG-F  491
             PD       D+ +  G G  I  ++ SLS   KP+L++++V+   + S    CII DG F
Sbjct  76    PD-----FHDEEKHPGFGEKIGDVIMSLSLNGKPYLRDMIVSEVPKIS----CIILDGVF  126

Query  492   ANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGME  668
              +   D+A E G+ +I F  +SA   WAY  +P L+++ E+P  G +DMD  I +  GME
Sbjct  127   GDLVTDLASEFGIQLIHFRTISACCFWAYLCVPKLLESNEIPIRGDEDMDRIIRNAPGME  186

Query  669   KLLRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
              +LR RDLP   R +       K ++  ++ F+    I+N+F++LE   L Q+R+     
Sbjct  187   NVLRCRDLPSFFRENKHNLSLDKLVVRTQQSFKANALILNTFEDLESPILSQIRL-HFPK  245

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             +Y IGPLH    +   +   T T  ++ L +  + CM WLD QP  SV+YV FG+ T + 
Sbjct  246   LYTIGPLH---HHLNNTKKTTTTLINSNLFQVDRTCMTWLDSQPLKSVIYVSFGSTTPMK  302

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E + E WHGLMNS +RFLW + P +V  K+V    +  E+    + R  +V W PQ+EV
Sbjct  303   SEEVIEIWHGLMNSEKRFLWVIRPNMVQGKEV----LLKELEEKTKERGLIVGWVPQEEV  358

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH A+G FLTH GWNS +ES+V GVPMI WPF+ADQQ+NSRF+ EVWKIGLDMKD CDR
Sbjct  359   LAHKAIGAFLTHSGWNSTLESVVCGVPMICWPFFADQQINSRFVSEVWKIGLDMKDVCDR  418

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
              ++E MV DLM  RK+EFL+ A + +  + +     GSS  + + LI  I+
Sbjct  419   KVVENMVNDLMVNRKEEFLKSAMEMSKLSCKSVSPSGSSYDNFQALIWYIR  469



>gb|KHN04913.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=457

 Score =   357 bits (916),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 197/468 (42%), Positives = 274/468 (59%), Gaps = 34/468 (7%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P P H+ SML LA+LL L ++ VTF+  +                 CY    F+TIPD  
Sbjct  12    PLPGHLGSMLKLAELLALDNIHVTFVDELS---------------ECYPTLHFKTIPDC-  55

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADG-FANFAVD  509
              +    +H   G  +   + S +  AKPFL++I+++          CII DG F   + D
Sbjct  56    -YDEEGEHPGFGDRVGDFITSTAQHAKPFLRDILLSQHSPGIPKVSCIIQDGIFGALSSD  114

Query  510   VAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKLLRRR  686
              A E+ +P+I F  VS+   WAYF +P L+   ELP  G+ DMD  I ++ GME LLR R
Sbjct  115   FAAELRIPLIHFRTVSSCCFWAYFCVPKLLDCKELPIKGEEDMDRIIRNMPGMENLLRCR  174

Query  687   DLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLP  CR  + E  F ++ +   R+       ++N+F++LEGS L QM       +Y IG
Sbjct  175   DLPSFCR-PNTEGNFLEWAVFRTRQSLAADALMLNTFEDLEGSVLSQMG-QHFPKLYTIG  232

Query  864   PLHELLRNKLGSCNVT--LTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             P+H  L+ +    N    + T  N L +  + CM WL+ QP  SV+YV FG+ T+V  E 
Sbjct  233   PIHHHLKIRKAESNKAKDIPTFKNSLFQVDRSCMAWLEAQPQGSVIYVSFGSSTIVKRED  292

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L E WHGL+NS +RFLW + P +V   ++     P E+  G   R  +V WAPQ++VLAH
Sbjct  293   LMEIWHGLVNSKKRFLWVMRPDIVAADRI-----PAEVEEGTRERGLIVGWAPQEDVLAH  347

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              A+GGFLT       ++S+VAGVPMI WP++ADQQ+NSRF+ EVWK+GLDMKD CDRH++
Sbjct  348   KAIGGFLT-----PTLDSVVAGVPMICWPYFADQQINSRFVSEVWKLGLDMKDVCDRHVV  402

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             EKMV DLM  RK+EFL+ A++ A  A +    GGSS SS ++LI+ IK
Sbjct  403   EKMVNDLMVHRKEEFLKSAQEMAMLAHKSVTPGGSSYSSFDDLIQYIK  450



>ref|XP_003613025.1| UDP-glucuronosyltransferase 1-1 [Medicago truncatula]
 gb|AES95983.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=475

 Score =   356 bits (914),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 198/478 (41%), Positives = 284/478 (59%), Gaps = 36/478 (8%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVI-SRFRCYSGFRFETI  320
             +P P+  H++SML LA+LL + ++ +TF+ T +  N L+ F+D I +   CY   +F+TI
Sbjct  16    FPCPAQGHVNSMLKLAELLAIQNIYITFLNTKYIHNRLIQFNDDIQALLECYPKLQFKTI  75

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADG-FAN  497
              D       + H   G  I  ++ SLS   KP LK+I+V      S    CII DG F +
Sbjct  76    SD---FHSEEKHPGFGERIGDVITSLSLYGKPLLKDIIV------SEKISCIILDGIFGD  126

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKL  674
              A D+A E G+ +I F  +S+   WAYF +P L++  ELP  G +DMD  I ++ GME +
Sbjct  127   LATDLAAEFGIQLIHFRTISSCCFWAYFCVPKLLECNELPIRGDEDMDRIITNIPGMENI  186

Query  675   LRRRDLPGNCRVDD-----LEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGD  839
             LR RDLP  CR +      L+D      +  ++  +    I+N+F++LE S L Q+RI  
Sbjct  187   LRCRDLPSFCRENKKDHIRLDD----VALRTKQSLKANAFILNTFEDLEASVLSQIRI-H  241

Query  840   MLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLT  1019
                +Y IGPLH LL     S   +   S +   +  + CM WLD QP  SV+YV FG+ T
Sbjct  242   FPKLYTIGPLHHLLNTTKKSSFPSSFFSKSNFFKVDRTCMAWLDSQPLKSVIYVSFGSTT  301

Query  1020  LVSEETLAEFWHGLMNSGQRFLWALNPRLVLNK----KVERGEVPTEILNGLEGRCCVVE  1187
              +  E + E WHGL+NS ++FLW + P +V  K    ++E G   T    GL     +V 
Sbjct  302   PMKREEIIEIWHGLLNSKKQFLWVIRPNMVQEKGLLSELEEG---TRKEKGL-----IVG  353

Query  1188  WAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLD  1367
             W PQ+EVL+H A+G FLTH GWNS +ES+V GVPMI WP++ADQQ+NSRF+ +VWK+GLD
Sbjct  354   WVPQEEVLSHKAIGAFLTHNGWNSTLESVVCGVPMICWPYFADQQINSRFVSDVWKLGLD  413

Query  1368  MKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             MKD CDR ++E MV D+M  RK+EF++ A   A  A +    GGSS ++ ++LI+ I+
Sbjct  414   MKDVCDRKVVENMVNDVMVNRKEEFVRSAMDIAKLASKSVSPGGSSYNNFQDLIQYIR  471



>ref|XP_003613028.1| Cis-zeatin O-glucosyltransferase [Medicago truncatula]
 gb|AES95986.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=474

 Score =   353 bits (906),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 192/473 (41%), Positives = 283/473 (60%), Gaps = 27/473 (6%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVI-SRFRCYSGFRFETI  320
             +P P+  H++ ML LA+LL + ++ +TF+ T +  N L+ F+D I +   CY   +F+TI
Sbjct  16    FPCPAQGHVNPMLKLAELLAIQNIYITFLNTKYIHNRLIQFNDDIQALLECYPKLQFKTI  75

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADG-FAN  497
              D       + H   G  +  ++ SLS   KP LK+I+V      S    CII DG F +
Sbjct  76    SD---FHSEEKHPGFGEKVGDVILSLSLYGKPLLKDIIV------SEKISCIILDGIFGD  126

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKL  674
              A D+A E G+ +I F  +SA   WAY S+P L++  ELP  G +DMD  I +V GME L
Sbjct  127   LATDLAAEFGIQLIHFRTISACCFWAYLSVPKLLECNELPIKGDEDMDRIIRNVPGMENL  186

Query  675   LRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             LR RDLP   ++DD +    K  +  ++  +    I+N+F+ LE   L Q+R+     +Y
Sbjct  187   LRCRDLPSFRKMDDSDTILDKAALLTQQSLKGNALILNTFENLESPALSQIRL-HAPKLY  245

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              IGPLH  L     + + + ++S +   E  + CM WL+ QP  SV+YV FG++T +  E
Sbjct  246   TIGPLHHHLNTTKKTSSSSSSSSKSNFFEVDRTCMTWLESQPLKSVVYVSFGSITPMKGE  305

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLV----LNKKVERGEVPTEILNGLEGRCCVVEWAPQQ  1202
              + E WHGL+NS + FLW + P +V    L K++E G          + +  +V W PQ+
Sbjct  306   EIIEIWHGLLNSKKPFLWVIRPNMVQEKGLLKELEEGTT--------KEKGMIVGWVPQE  357

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             EVL+H A+G FLTH GWNS +ES+V GVPMI WP++ADQQ+NSRF+ +VWK+GLDMKD C
Sbjct  358   EVLSHKAIGAFLTHSGWNSTLESVVCGVPMICWPYFADQQINSRFVSDVWKLGLDMKDVC  417

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             DR ++E MV D+M  RK+EF++ A   A  A +    GGSS ++ ++LI+ I+
Sbjct  418   DRKVVENMVNDVMVNRKEEFVRSAMDIAKLASKSVSPGGSSYNNFQDLIQYIR  470



>emb|CAN67315.1| hypothetical protein VITISV_036458 [Vitis vinifera]
Length=479

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 240/377 (64%), Gaps = 27/377 (7%)
 Frame = +3

Query  375   IVQLLHSLSATAKPFLKEIVVTSG-GEDSAPQ-RCIIADGFANFAVDVAEEVGVPIISFH  548
             ++ L   L ATAKP  +E+V++ G G D+ P   CIIADG  +F +D+A EVG+PIISF 
Sbjct  78    VMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGMMSFTIDIANEVGIPIISFR  137

Query  549   PVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDLPGNCRVDDLEDP  728
              +SA + WAYFS   LI++GEL   G DMD+ + S+ GME  LR+RDLP   RV +L++ 
Sbjct  138   TISACSFWAYFSALKLIESGELXLKGNDMDQLVTSIPGMEGFLRKRDLPSLIRVSNLDBE  197

Query  729   FFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCN  905
                 +  E ++  R    I+N+F++LEG  L Q+R       Y IGPLH  L  +L S  
Sbjct  198   XLLLVXKETQQTPRAHALILNTFEDLEGPILGQIR-NHCPKTYTIGPLHAHLXTRLAS--  254

Query  906   VTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFL  1085
                  S+N                P  SV+YV FG+LT+++ + L EF +GL+NSG RFL
Sbjct  255   ----ESTN----------------PSKSVIYVSFGSLTVITRKQLIEFCYGLVNSGXRFL  294

Query  1086  WALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIM  1265
             W +    +  +  ER + P E+L G + R  +VEWAPQ+EVLAH AVGGFLTH GWNS +
Sbjct  295   WVIRTDSLAEEDGER-QTPAELLEGAKERSYIVEWAPQEEVLAHPAVGGFLTHSGWNSTL  353

Query  1266  ESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFL  1445
             ESI AGVPMI WP++ADQQ+NSRF   VWK+G DMKDTCDR I+EKMVRDLME R+DE L
Sbjct  354   ESICAGVPMICWPYFADQQINSRFASHVWKLGSDMKDTCDRLIVEKMVRDLMEXRRDELL  413

Query  1446  QRAKQFANSAKECAKEG  1496
             + A   A  A++C   G
Sbjct  414   KTADMMATRARKCLDRG  430



>dbj|BAB86930.1| glucosyltransferase-12 [Vigna angularis]
Length=463

 Score =   352 bits (902),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 199/449 (44%), Positives = 267/449 (59%), Gaps = 15/449 (3%)
 Frame = +3

Query  219   VTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDHRSSGVGIVQLLHSL  398
             VTFI T    N L  + D+ S    Y    F TI D   HG   +H  SG     ++ S 
Sbjct  15    VTFINTHSIHNRLTRYGDIQSLSASYPTLHFNTIADCYSHG---NHTGSGDTSGDIILST  71

Query  399   SATAKPFLKEIVVTSGGEDSAPQ-RCIIADG-FANFAVDVAEEVGV--PIISFHPVSAAA  566
             +  AKP L+ I++    E   P+  CII DG   + + D+A E+G+   II F   S   
Sbjct  72    ALHAKPLLRNILLAQSPE--IPKVTCIIQDGILGSLSNDLASELGIRITIIHFRTSSPCC  129

Query  567   TWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFM  743
              W YF +P+L +  ELP  G +DMD  I ++ GME LLR RDLP  CR     +    ++
Sbjct  130   FWPYFWLPNLFKTNELPIRGDEDMDRIITNMPGMENLLRCRDLPSFCRPGAKGNMSIDWV  189

Query  744   -MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTT  920
               + ++       I+N+F+EL+   L Q+R+     VY +GPLH  L  +    N     
Sbjct  190   SFQTQQSLAADALILNTFEELDRLVLSQIRL-HFPKVYTLGPLHHHLNVRKAETNGANDA  248

Query  921   SS--NGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWAL  1094
              S  +   E  + CM WLD Q   SVLYV FGT T+V+ E L EFWHGL++S +RFLW +
Sbjct  249   PSFRSSFFEVDRSCMAWLDAQAQGSVLYVSFGTSTIVTREELMEFWHGLVDSKKRFLWVM  308

Query  1095  NPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESI  1274
              P LV+ ++ +   +P E+  G + R  +VEWAPQ+EVLAH A+GGFLTH GWNS +ES+
Sbjct  309   RPDLVVGREND-DRIPEEVEEGTKERGLMVEWAPQEEVLAHKAIGGFLTHSGWNSTLESL  367

Query  1275  VAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRA  1454
             VAGVPMI WP++ADQQVNSRF+ EVWK+GLDMKD CDR ++EKMV DLM  R+DEFL+ A
Sbjct  368   VAGVPMICWPYFADQQVNSRFVSEVWKVGLDMKDVCDRDVVEKMVNDLMVHRRDEFLKSA  427

Query  1455  KQFANSAKECAKEGGSSISSLENLIEDIK  1541
             +  A  A +    GGSS SS+++LI  IK
Sbjct  428   QAMAMLAHQSVSPGGSSHSSMQDLIHYIK  456



>gb|AFJ53007.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=480

 Score =   349 bits (896),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 275/475 (58%), Gaps = 23/475 (5%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLC-LSHLKVTFITTVHARNNLLCFSDVISR--FRCYSGFRFET  317
             PFP+  HI  M  LA+LL  ++  ++T + T H    L    D  +      +  F F +
Sbjct  18    PFPAQGHIKPMFTLAKLLSHVAKFRITLVNTHHNHALLQRSLDTAAADFGDSFPDFHFAS  77

Query  318   IPDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFAN  497
             +PD + H    D +S+   I QLL ++   +KP    +++    +  +   CII DG  +
Sbjct  78    LPDVVAH---QDGQSNLANIAQLLPAIR-NSKPDFHRLML----DLPSAATCIIVDGVMS  129

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGK-DMDEPILSVKGMEKL  674
             + ++VAEE+G+P I+F   SA   W YF++  L + G +P  G  DMDE I S+ G+E +
Sbjct  130   YGIEVAEEIGIPAITFRTFSAVGLWVYFNLDKLTEDGSIPIPGNADMDELITSIPGLEGV  189

Query  675   LRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVY  854
             LR RDLP  CR          F+ E +   R    I+N+F ELEGS + ++        Y
Sbjct  190   LRLRDLPSMCRPGPSSQVLKFFIDETKSMKRASGLILNTFDELEGSIISKLSSTIFPKTY  249

Query  855   AIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEE  1034
              +GPLH LL N +   +     S  GL  + K CM WL+  P  SV+YV FG+L   +E 
Sbjct  250   PVGPLHGLLNNVVKEHH-----SDGGLWREDKGCMTWLESHPSKSVVYVSFGSLVAFTEA  304

Query  1035  TLAEFWHGLMNSGQRFLWALNPRLVLNK--KVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
                EFWHGL+N+G+ FLW + P  V  +   ++ G + + +      +CCVV+WAPQ EV
Sbjct  305   QFMEFWHGLVNTGKPFLWVIRPDSVSGEDGSIQSGRIISGLKEAHGNKCCVVDWAPQLEV  364

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH AVGGFLTH GWNS +E+I+ GVPMI WP ++DQQVNSR + ++W +GLDMKDTCDR
Sbjct  365   LAHEAVGGFLTHSGWNSTLEAILEGVPMICWPRFSDQQVNSRAVSDIWNVGLDMKDTCDR  424

Query  1389  HIIEKMVRDLME--VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
               +EKMVR+LM+   ++DE ++   + A  A++  KEGGSS  +LE LI D+  M
Sbjct  425   WTVEKMVRELMDDSCKRDEIVKSTAEIARLARDSIKEGGSSYCNLEKLIADVGAM  479



>ref|XP_007026845.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07347.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
Length=488

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 199/479 (42%), Positives = 280/479 (58%), Gaps = 29/479 (6%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             P P   HI  ML LA+LL     +VTFI T    + LL  +D+++R   Y  F+F TIPD
Sbjct  15    PIPGLGHIKPMLKLAELLSRPSFQVTFINTQRIHDRLLS-TDLLAR---YPEFQFLTIPD  70

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS--APQRCIIADG-FAN  497
              +P    D  RS  +     L +     KP L+++ ++   +     P  CII DG  ++
Sbjct  71    VVPR---DRPRSGTMSPGDFLLAAGPVIKPALRQLFISLCKKKGRWQPATCIIEDGILSS  127

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEKL  674
               +DVAEE  VP+ +F   SA   W YF +  L++ G++P    KDMD+P+  + G+E +
Sbjct  128   SVIDVAEEFQVPVFAFRTSSACCIWTYFHVRKLVEEGDVPVVQDKDMDKPVTCIPGLENV  187

Query  675   LRRRDLPGNCRVDDLEDPFFKFMMEFRKCF--RTKHHIINSFQELEGSTLDQMRIGDMLN  848
             +RRRDLPG  R++  +DP  +F +  +     R    IIN+F  LE + + ++       
Sbjct  188   VRRRDLPGIFRIERADDPGLEFFINDQTLVMPRAFAIIINTFDGLEATMISKL-ASVFTK  246

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             +Y +GPLH L  N       T  +S++ L ++ + CM WLD QP  SV++V FG+   ++
Sbjct  247   MYTVGPLHGL-SNARAKEETTSASSNSILWKEDRGCMFWLDSQPSRSVVFVSFGSFVGLT  305

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEV-PTEILNGLEG-----RCCVVEW  1190
              + + EF HGL+NSG  FLW + P  +       GEV P+ IL  L+      +  +V W
Sbjct  306   RDKMLEFGHGLVNSGYPFLWVIRPDSIT------GEVDPSLILGELKAMIEDNKGLMVSW  359

Query  1191  APQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDM  1370
             APQ+EVLAH A+G FLTH GWNS +ES+ AGVPMI WP   DQQ+NSRF+ +VWKIGLDM
Sbjct  360   APQEEVLAHPAIGVFLTHSGWNSTLESVYAGVPMICWPAIGDQQINSRFVSDVWKIGLDM  419

Query  1371  KDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KDTCDR  IEKMVR LME +++E ++   +    A E  KEGGSS S+LE LI+DI  M
Sbjct  420   KDTCDRSTIEKMVRSLMEDKREEIMKSVNEIKKLAHETIKEGGSSFSNLEKLIDDIWSM  478



>ref|XP_003613026.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES95984.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   346 bits (888),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 188/473 (40%), Positives = 287/473 (61%), Gaps = 28/473 (6%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFS--DVISRFRCYSGFRFET  317
             +P P+  H+++ML LA+LL + +L +TF+ T +  N L+  +  DV S  +CY   +F+T
Sbjct  9     FPCPAQGHVNTMLKLAELLLIQNLHITFLNTEYIHNRLISLNIDDVKSISQCYPKLQFKT  68

Query  318   IPDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADG-FA  494
             I D       + H   G  IV ++ S++   KP L++I+V      S    CII DG F 
Sbjct  69    ISD---FQNKEKHPGFGENIVDVISSINMYGKPSLRDIIV------SEKISCIILDGGFG  119

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEK  671
             + A D+A E G+ +I F  V+A+  W YF +P L+   E+P  G +DMD  I +V GME 
Sbjct  120   DLATDLAAEFGIQLIHFRTVAASTVWIYFCMPKLLDCNEIPIRGDEDMDRIIRNVPGMEN  179

Query  672   LLRRRDLPGNCRVDDLEDPFFKFMMEFRKC-FRTKHHIINSFQELEGSTLDQMRIGDMLN  848
             ++R RDLP     + ++      +++  +   +    I+N+F++LE   L Q+R+     
Sbjct  180   IIRCRDLPRFGTSNKMDHIILDKVLQLTQASLKGNAVILNTFEDLESPILSQIRL-HFPK  238

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSN-GLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
             +Y IGPLH    + L +   T ++S N    +  + CM WL+ QP  SV+YV FG+ T +
Sbjct  239   LYTIGPLH----HHLNTMKKTTSSSFNSNFFKVDRTCMTWLESQPLKSVVYVSFGSTTTM  294

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKK-VERGEVPTEILNGLEGRCCVVEWAPQQ  1202
             + E + EFWHGL+NS + FLW + P +V  K+ ++  E  T    GL     +VEWAPQ+
Sbjct  295   TREEILEFWHGLLNSKKAFLWVIRPNMVQEKRLIKELEEGTSKEKGL-----IVEWAPQE  349

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             EVL+H A+G FLTH GWNS +ES+V GVPMI WP+++DQ +NSRF+ EVWK+GLDMKD C
Sbjct  350   EVLSHKAIGAFLTHSGWNSTLESVVCGVPMICWPYFSDQPLNSRFVSEVWKLGLDMKDVC  409

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             DR+++E MV D+M  +K+EF + A + A+ A +     GSS ++L++LI+ I+
Sbjct  410   DRNVVENMVNDIMVNKKEEFSKSATKMADLASKSVNPDGSSYNNLQDLIQYIR  462



>ref|XP_004305167.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   343 bits (881),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 197/473 (42%), Positives = 269/473 (57%), Gaps = 21/473 (4%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   HI  +L LA+LLC + L VTF+ T H  N L     + +RF       FE+I 
Sbjct  11    FPFPLQGHIKPLLCLAELLCHAGLHVTFVNTRHNHNRLANLPALSARFPT---LNFESIS  67

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIV---VTSGGEDSAPQRCIIADGFA  494
             DGLP    +  R+ G    +LL +L  + KP  KE++   + + G       CII DG  
Sbjct  68    DGLP---LEHPRTLGS---ELLIALKTSIKPHFKELLQSPLKANGVALPAPTCIITDGLV  121

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
              FA DVAEE+G+PI S++       W    +P+LI+ G+LPF   DM+  I  V GME L
Sbjct  122   TFAFDVAEELGLPIFSYNVPCTRYMWTCLCLPNLIEQGQLPFPDDDMNVEITGVPGMEGL  181

Query  675   LRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDML-N  848
             LRR DLPG CRV     P  +F + E +   R    I+++  EL+   L  M   +M   
Sbjct  182   LRRVDLPGFCRVKQSNHPGLQFAIHETQTQKRASTLILDTIYELDAPCLSHM--ANMFPK  239

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             +Y +GPLH LL +++G  + +L  S  GL +    CM WLD QP  SVLYV FGTL  ++
Sbjct  240   IYTLGPLHSLLHSQIGDVSRSLA-SHGGLWKGDPNCMTWLDSQPTKSVLYVSFGTLVTLT  298

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
                + EFW+GL+NSG  FLW +  R  +   +    +P E+  G + R  +V W  Q+EV
Sbjct  299   GTQIIEFWYGLINSGHPFLWVI--RSDITSGLGGDPIPMELEIGTKERGYIVNWVSQEEV  356

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH +VGGFLTH GWNS +ESIVAG+PMI WP   D  + SR + E WKIGL +K+ CDR
Sbjct  357   LAHKSVGGFLTHSGWNSTLESIVAGIPMICWPNLGDHYIISRTVSEKWKIGLQLKENCDR  416

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
               IE M+R LME ++ E        +  A++   +GGSS  +LE LI+DI+ M
Sbjct  417   KEIETMIRMLMEFKRGEIQSSMDVISKVARDSVVKGGSSNHNLEMLIQDIRNM  469



>emb|CBI31566.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   344 bits (883),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 190/474 (40%), Positives = 272/474 (57%), Gaps = 61/474 (13%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   +++SML LA+LLCL+ ++VTF+   +  + LL +S+V +RF  Y GFRFETI DGL
Sbjct  16    PLQGNVNSMLKLAELLCLAGIQVTFLNCHYPHHCLLSYSNVQARFSRYPGFRFETISDGL  75

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT---SGGEDSAPQRCIIADGFANFA  503
             P     +H  +    + ++  +  T  P   E++++   S  +   P  CI+AD   +FA
Sbjct  76    PM----EHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSTSDTRPPLTCIMADQLMSFA  131

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              DVA EVG+PI+ F  +SA + WAYFS P LI+AGE+P  G DMD  ++SV GME  LRR
Sbjct  132   TDVANEVGLPIVIFCAISACSFWAYFSFPQLIEAGEVPITGDDMDRLVVSVPGMEGFLRR  191

Query  684   RDLPGNCRVDDLEDPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP + RV+D+  P  + +M+ FR+  R    +IN+F +LEG  L Q+R       YA+
Sbjct  192   RDLPSSGRVNDVAYPGLQHLMKIFRQAQRAHALVINTFDDLEGPVLSQIR-DHYPRTYAV  250

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L++KL S   + + SSN   E+ K C+ WLDRQPP SV+YV FG+L +++++ L
Sbjct  251   GPLHAHLKSKLAS-ETSTSQSSNSFREEDKSCILWLDRQPPKSVIYVSFGSLAIITKDEL  309

Query  1041  AEFWHGLMNSGQRFLWALNP----------------------------------------  1100
              EFWHGL+NSG RFLW + P                                        
Sbjct  310   REFWHGLVNSGSRFLWVIRPDALVVPPTVTWAYQLLNIWLCSSKQLVWRPPLLSGTACSS  369

Query  1101  ----RLVLNKKVER-GEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIM  1265
                  ++L K ++  GEV  +     +G C       +++V   S    +L+   + S +
Sbjct  370   KLKIEMILMKTLKHLGEVEYKDAPHTKGYCL------KKKVKHFSEAHAWLSLKKFLSTL  423

Query  1266  ESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEV  1427
             + I AGVPMI WP +ADQQ+NSRF+  VWK+G+DMKDTCDR +IEKM    ME+
Sbjct  424   KGITAGVPMICWPRFADQQINSRFMSHVWKLGIDMKDTCDRIMIEKMHLISMEI  477



>ref|XP_010674285.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=536

 Score =   344 bits (883),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/401 (45%), Positives = 259/401 (65%), Gaps = 22/401 (5%)
 Frame = +3

Query  378   VQLLH-SLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEVGVPIISFHPV  554
             ++ LH +L+ +A+P L+E++   G  D     C I DG+  FA ++A E  VP+I+F   
Sbjct  144   LEALHEALAPSAEPLLRELLF--GTRDKI--TCFIIDGWLRFAYEIANEAEVPVIAFRCP  199

Query  555   SAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEKLLRRRDLPGNCRVDDLEDPF  731
             SA   WAYF IP +I+AGE+PF + ++MD+ + +V GM+  LR RDLP  CR  D+    
Sbjct  200   SACCIWAYFCIPQIIEAGEVPFKDNEEMDQLVKNVAGMDSFLRCRDLPSFCRGQDMSS--  257

Query  732   FKFMMEFRKCF-----RTKH---HIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRN  887
                  E ++ F     RTKH    I+N+F++LEG  L Q+R      VY+IGPLH  L+ 
Sbjct  258   ---CCELQEYFAGEIQRTKHAHSFILNTFEDLEGPILSQIR-SQCSTVYSIGPLHAHLKY  313

Query  888   KLGSCNVTLTTSSNGLH-EDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLM  1064
             +LG     L+ +S+    E  K C+ WLD++P  SV+Y+  G+ T +++  L E W G++
Sbjct  314   RLGKGETPLSNNSSSSLWEVDKSCISWLDQKPDKSVIYISLGSTTTLTKNQLTELWTGVV  373

Query  1065  NSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTH  1244
              S + FLW + P +++   ++   +P ++L G + R C+V+WAPQ EVL H A+GGFLTH
Sbjct  374   QSKRYFLWVVRPNVIIEGGLD-SPIPNDLLEGTDKRGCIVKWAPQDEVLTHRAIGGFLTH  432

Query  1245  CGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLME  1424
              GWNS +ESIVAGVPM+ WP +ADQQ+NSRF  EVW+IGLDMKDTCDR I+EKM+ DLM+
Sbjct  433   SGWNSTLESIVAGVPMLCWPHFADQQLNSRFASEVWRIGLDMKDTCDRTIVEKMINDLMD  492

Query  1425  VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              +KDE  + AK+ +  AK+   EGGSS S+L  LIEDI  M
Sbjct  493   GKKDELQRSAKRVSQEAKKSISEGGSSYSNLNRLIEDIIAM  533


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +3

Query  153  PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
            P   HI  ML+LA+L CL++LKVTF+ T      L   +++ +RF  Y  FRFETIPD 
Sbjct  17   PLQGHITPMLHLAELFCLANLKVTFLNTNKNHKLLTQHTNIHARFARYPSFRFETIPDS  75



>emb|CDP14405.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   338 bits (866),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 228/346 (66%), Gaps = 17/346 (5%)
 Frame = +3

Query  522   VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD-----------MDEPILSVKGME  668
             +G+P I F  V A + WA F I  +I AGE+P  GKD           MD  + SV GME
Sbjct  1     MGIPFIYFRTVGACSFWANFCIQDVIDAGEIPLKGKDEDKVSYRNKKEMDLMVTSVAGME  60

Query  669   KLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
               LRRRDLP   RV D+ +P  + +  E R+  + +  ++NSF++LEG  LDQ+R   M 
Sbjct  61    GYLRRRDLPAFFRVADVNNPGLQTIKSETRRSVKARALLLNSFEDLEGPILDQIR-KHMP  119

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTS---SNGLHEDGKKCMDWLDRQPPNSVLYVCFGTL  1016
              +++IGPLH  L+ ++ +   T   S   S    E+ + C++WL+ QP  SV+YV FG++
Sbjct  120   ILFSIGPLHAHLKVRIAASKSTTEKSMGHSGSFWEEDRSCIEWLNSQPDKSVIYVSFGSV  179

Query  1017  TLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAP  1196
             T+++ + L EFW+GL+NSGQ FLW + P  V+ K      +P EI  G + R  +V WAP
Sbjct  180   TIMTRDELLEFWYGLVNSGQMFLWVMRPDSVIGKD-GVSHLPVEIEEGTKARGYIVGWAP  238

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q+EVLAH A GGFLTHCGWNS +ESI AG+PMI WP++ADQ +NSRF+ EVWK+GLDMKD
Sbjct  239   QEEVLAHPATGGFLTHCGWNSTLESINAGIPMICWPYFADQTINSRFVDEVWKLGLDMKD  298

Query  1377  TCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISS  1514
             TCDR  +E MVRDLMEVRKDEFL++A+  AN AK+   EGGSS  S
Sbjct  299   TCDRVTVEIMVRDLMEVRKDEFLKKAEHMANLAKKAVSEGGSSYLS  344



>gb|KHG08953.1| hypothetical protein F383_15475 [Gossypium arboreum]
Length=484

 Score =   342 bits (876),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 185/471 (39%), Positives = 282/471 (60%), Gaps = 22/471 (5%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             P P+  H+  ML LA+LL  +  ++TF+ T +  +  L   D+ +  R +  F+F TIPD
Sbjct  15    PIPAQGHLRPMLKLAELLSNASFQITFLNTEYFHHTFLSSIDIHAFSRRFPKFQFVTIPD  74

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGF-ANFA  503
             GLP     D    G GI   L SL+  AKP + E++V+   +   P  CIIADG  ++ A
Sbjct  75    GLP----PDSPRPGKGIAHYLISLTDAAKPAVVEVLVSLRSKSGRPPTCIIADGIMSSAA  130

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             V   EE G+P+++F   SA  TW YF++ +L++ GELP   KDMD+ +  + G+E +LR 
Sbjct  131   VAAGEEFGIPVLAFRTYSACCTWTYFNLSNLVEGGELPLPDKDMDKLVTCIPGLENVLRH  190

Query  684   RDLPGNCRVDDLEDPFFK--FMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
             RDLP  CR++  +D      F+ +     R    I+N+F++LE   + ++       +Y 
Sbjct  191   RDLPSFCRLEKADDHLLYDFFIAQASAMRRASALILNTFEQLETPFISKLA-SIFSKIYT  249

Query  858   IGPLHELLRNKLGSCNV----TLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
             IGPLH L        NV     L ++ +   ++ K C+ WLD  P  SV++V FG++   
Sbjct  250   IGPLHCL-------SNVDDPTALASTKSIFWQEEKGCLTWLDSHPSKSVVFVSFGSVVTF  302

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQE  1205
             + + + EFWHGL+NSG+ FLW +    ++ +   R ++  ++ +  +G+  +V WAPQ+E
Sbjct  303   TLDQMLEFWHGLVNSGKPFLWVIRSNAIIGEDDPR-KILEDLKDNTKGKGSIVSWAPQEE  361

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VLAH AVG FLTH GWNS +ESI AGVPMI WP + DQ VNSR +  VW++G DMKD+C 
Sbjct  362   VLAHPAVGAFLTHSGWNSTLESIYAGVPMICWPLFVDQYVNSRCVSYVWRVGFDMKDSCH  421

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             R IIEKMVRD++E++ +E ++  ++ +  A+E  KE G S  +L+ +I+DI
Sbjct  422   RSIIEKMVRDVIEMKNEEIMKSMEEISKQAQESVKESGPSYCNLDKMIQDI  472



>ref|XP_010676681.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=503

 Score =   341 bits (874),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 202/471 (43%), Positives = 275/471 (58%), Gaps = 30/471 (6%)
 Frame = +3

Query  168   IHSMLNLAQLLCLS--HLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHG  341
             I+  L LA LL LS  HL +TF+        LL   D+ SRF      +F         G
Sbjct  43    INCFLKLAHLLSLSSDHLNITFLNAEFVHQRLL---DLPSRFPHVKFLKFSD-------G  92

Query  342   LTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEE  521
             ++ D   +      ++  L A     L E +     E  AP  C+I+DG      + A E
Sbjct  93    ISGDEPRTPAKFPAMVGFLQAEISRRLPEFM-----ESPAPATCLISDGVFTSVGERANE  147

Query  522   VGVPIISFHPVSAAATWAY-FSIPSLIQAGELPFN-GKDMDEPILSVKGM-EKLLRRRDL  692
             +G+P++ F  +S    WA  F +P L+  GELPF  G D+DEP+  + G  +  LR  DL
Sbjct  148   LGIPVVYFSTLSPCCVWASCFLVPKLVDYGELPFKKGMDLDEPVSDIPGAADTSLRWCDL  207

Query  693   PGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGP-  866
             PG CR  D+ DP+ + ++ EFR+    + HI+N+F +LE   L ++R+    N+Y IGP 
Sbjct  208   PGICRTHDMTDPYVQLVLKEFRELPNAQGHILNTFDDLEEPLLSELRLL-CPNLYTIGPI  266

Query  867   -LHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
              LH   R +L S       +SN L ++ + C+ WLD QP  SV+YV FG++  ++ + L 
Sbjct  267   HLHSRTRQQLES---EQRITSNSLWQEDRSCIAWLDAQPSGSVIYVSFGSVVPLTMDQLT  323

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERG---EVPTEILNGLEGRCCVVEWAPQQEVLA  1214
             EFW+GL+NSG RFLW     +V+  +       +VPTEIL G   R  +V+WAPQ+EVLA
Sbjct  324   EFWYGLVNSGTRFLWVRRSGMVVEMEESEEISLQVPTEILEGTRNRGFIVKWAPQEEVLA  383

Query  1215  HSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHI  1394
             H AVGGFLTH GWNS +ESIV G+PM+ WP   DQ V SRF+G+VWKIG+DMKD CDR +
Sbjct  384   HRAVGGFLTHSGWNSTLESIVEGLPMLCWPNGIDQLVISRFVGDVWKIGIDMKDICDRGV  443

Query  1395  IEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             IE MV DLM+ RKDEF +RA + +  A E  +EGGSS  +L  LIEDIK M
Sbjct  444   IEHMVIDLMKGRKDEFSRRANRLSKLAGEAVREGGSSWRALHRLIEDIKFM  494



>ref|XP_007026851.1| UDP-Glycosyltransferase superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY07353.1| UDP-Glycosyltransferase superfamily protein isoform 2 [Theobroma 
cacao]
Length=489

 Score =   339 bits (870),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 196/484 (40%), Positives = 275/484 (57%), Gaps = 29/484 (6%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+H  I  M  LA+LL  ++ +VTF+ T    + LL  SD+ +    Y  F+  + P
Sbjct  14    FPFPAHGHIKPMFRLAELLSHANFQVTFLNTQRNHDLLLLSSDIPAFRSRYPNFQLLSYP  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADG--FAN  497
             D +P GL D HR S  G V LL S  A AKP L E++    G    P  CIIAD     +
Sbjct  74    DKVPLGL-DPHRRSEQGFVDLLLSTKAAAKPALSELLEKKTGR--RPPTCIIADWAIMCS  130

Query  498   FAVDVAEEVG-VPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKL  674
              A+DVA+E G +P+ +F    A   W  F +  LI+ GE+P   KDMD+P+ S+ G+   
Sbjct  131   SAMDVAKEFGNIPVFAFQTACAHYMWMDFHLLKLIEEGEVPLRDKDMDKPVTSISGLGMS  190

Query  675   LRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHH--IINSFQELEGSTLDQMRIGDMLN  848
             +RRRDL G  R D +     +    +     ++ +  I N+F +LE   + ++       
Sbjct  191   VRRRDLSGFARFDTVCKQVIEISTNYGSSAVSQAYGVIHNTFDKLEAPVISKLSSFLPFK  250

Query  849   VYAIGPLHELLRN-------KLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCF  1007
             +Y IGPLH LL N        L S NVT+        ++   C+ WLD QP  SV++V F
Sbjct  251   IYTIGPLHCLLNNYCIKDSNPLHSINVTIC-------KEDTNCITWLDSQPSGSVIFVSF  303

Query  1008  GTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEG----RC  1175
             G+L  +S   + E   GL+NS + FLW + P  ++ ++ E    P +IL  LE     + 
Sbjct  304   GSLVSLSRSQILEIGQGLLNSCRPFLWVILPNPIVGQQ-EDDSTPGQILMELENMSKEKG  362

Query  1176  CVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWK  1355
              +V WAPQ++VLAH A+GGFLTH GWNS MESI A VPMI WP  ADQ VNSR + E+W+
Sbjct  363   LIVSWAPQEKVLAHPAIGGFLTHSGWNSTMESIYARVPMICWPTEADQLVNSRCVSELWR  422

Query  1356  IGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIED  1535
             IG DMKDTCDR  +EK+V DLME ++DE ++   +    A+E  +EGGSS  +L+ LI D
Sbjct  423   IGFDMKDTCDRSTVEKLVNDLMEDKRDEIMKSMDKITRQAEESVQEGGSSYCNLQRLITD  482

Query  1536  IKRM  1547
             I+ +
Sbjct  483   IRSL  486



>dbj|BAM63146.1| uncharacterized glucosyltransferase 2 [Ipomoea nil]
Length=464

 Score =   338 bits (866),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 188/467 (40%), Positives = 265/467 (57%), Gaps = 15/467 (3%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLL---CFSDVISRFRCYSG-FRFETIPDGLPHGL  344
             ML LA+LLCL+ + VTF+ T H    LL      DV SRF  Y G FRFE I DG P   
Sbjct  1     MLKLAELLCLAGVHVTFLNTKHNHQRLLRSAANGDVESRFDRYPGSFRFEVISDGFP---  57

Query  345   TDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEV  524
              +DH  S    + +++SL   A+P L+E+++    E      C + +   ++  ++ +EV
Sbjct  58    -EDHPRSVEDFLDVVNSLQTVAEPHLREVLLRPP-ESGRKVTCAVVEAVFSYVFEIGKEV  115

Query  525   GVPIISFHPVSAAATWAYFSIPSLIQAGELPFN---GKDMDEPILSVKGMEKLLRRRDLP  695
             GVP+ +F  +S      Y  IP L Q G+LP     G+D++  +  V GME +L+ RDLP
Sbjct  116   GVPVFAFETISPCCLGVYLCIPKLFQDGKLPLIKDLGEDLETVVDVVAGMEGVLKVRDLP  175

Query  696   GNCRVDD--LEDPFFKFMMEFRKCFRTKHHII-NSFQELEGSTLDQMRIGDMLNVYAIGP  866
               CR +    E      M E     +  H +I NSF+ELEG  L  +R     N Y IGP
Sbjct  176   EFCRTEGPRAEKSRKLAMAEIHSLSKLAHGLILNSFEELEGPILPHIRTHFPGNTYMIGP  235

Query  867   LHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAE  1046
             + + L+ +L    +T + SSN    +   C+ WLD QP  SV+YV FG+L  ++   L E
Sbjct  236   VQQHLKTRLAEREITQSPSSNSFWREDNTCIQWLDEQPDESVIYVSFGSLNTLTMAQLME  295

Query  1047  FWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAV  1226
              WHGL+ S  RFLW L P +V +       + TE+  G      +V WAPQ+EVLAH A+
Sbjct  296   VWHGLVASAVRFLWVLRPDIVKDNLSSDQNLVTELRKGCSENGQIVSWAPQEEVLAHRAI  355

Query  1227  GGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKM  1406
             GGF TH GWNS +ESI+AG PMI      DQ +  R + EVWKIG+DM+D CDR  IEKM
Sbjct  356   GGFWTHSGWNSTLESIIAGKPMICSAQIVDQLITRRVVSEVWKIGVDMEDKCDRLSIEKM  415

Query  1407  VRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             V+++M  R  E  + A++F+  A+E    GGSS ++L++LI +I+R+
Sbjct  416   VKEVMGSRGQELKKSAQKFSKLARESVNNGGSSYTNLDHLINEIRRL  462



>ref|XP_010044032.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW86038.1| hypothetical protein EUGRSUZ_B02744 [Eucalyptus grandis]
Length=473

 Score =   337 bits (865),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 200/468 (43%), Positives = 273/468 (58%), Gaps = 14/468 (3%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP+  HI  ML LA+LL  + L+VTF+ T H    +L            S  R E+I D
Sbjct  13    PFPAQGHIKPMLCLAKLLAAAGLRVTFLNTHHNHRRILPRGPSSPP---SSLLRLESISD  69

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAV  506
             GLP    DDH  S   I +LL S+    K  L+E +V+   E   P  C+IADG  +  +
Sbjct  70    GLP----DDHPRSLERIEELLLSIKTAMKAALREFLVSKSAE--PPVTCVIADGIMSIGI  123

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
             DVAEE+ VP ISF   SA   W YF IP+ I  G+LPF   D+D+    + G E LLRRR
Sbjct  124   DVAEELSVPAISFRTFSACCLWTYFCIPTFIHEGKLPFPDDDLDKEFHGLLGAEGLLRRR  183

Query  687   DLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGP  866
             DLP  CR     + +  FM E     R    I+N+F  LE   L  +      ++Y IGP
Sbjct  184   DLPSICRSAIAINLYRYFMDETIAMTRACALILNTFDALEAPMLSHLAT-IFTDIYTIGP  242

Query  867   LHEL-LRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
             LH L +++ +G  +   + S   L  + + CM WL+ Q   SV+YV FG+L  ++ + L 
Sbjct  243   LHALAVKSHVGHFS-GRSESVGSLQMEDRSCMVWLNSQASRSVVYVSFGSLVKITVDQLM  301

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EFWHGL+N G+ FLW L    +L +  E+       L  +  R  VV+WAPQ+EVLAH+A
Sbjct  302   EFWHGLVNCGRPFLWVLREDAILGENEEKARSLLSELKVVSERRRVVDWAPQEEVLAHAA  361

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             VGGFLTH GWNS +E IVAG+PMI WP  ADQQ+NSR++ EVWKIGLDMKDTCDR  +E 
Sbjct  362   VGGFLTHSGWNSTLEGIVAGIPMICWPRIADQQINSRWVSEVWKIGLDMKDTCDRSTVET  421

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             MVR LM+ +K+E ++   + +  + +     GSS  +LE L+++I+++
Sbjct  422   MVRLLMDDKKEEIMKSMARISALSSDSVGPEGSSSKNLERLVKNIRKI  469



>gb|EPS60746.1| hypothetical protein M569_14056, partial [Genlisea aurea]
Length=455

 Score =   337 bits (863),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 184/429 (43%), Positives = 259/429 (60%), Gaps = 25/429 (6%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   H++SML L++LLCL+ + VT + +  + + L   SDV SRF  YSGFR     DGL
Sbjct  11    PLQGHVNSMLKLSELLCLAGIHVTLLLSKFSSSRLRRHSDVESRFSRYSGFRIAVFDDGL  70

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIV-VTSGGEDSAPQRCI---IADGFANF  500
             P    +D+   G   + LL S+    +  L++++  T    D   +R +   + DG  +F
Sbjct  71    P----EDNPRVGESTIDLLSSILRVGETELRKVLEATDSLSDGGARRRVSFFVIDGVLSF  126

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD-----------MDEPI  647
             A+ VAEE+G+P++ F  +SA + W YF    LI AGELP  G+D           +D P+
Sbjct  127   AMPVAEELGIPVVYFRTISACSFWCYFCSSELIAAGELPLRGEDEGKYEYWRNPNLDLPV  186

Query  648   LSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQ  824
              S+ GME +LRRRDLP   RV D  D   + M  E RK   +   I+N+F++LEG  +D+
Sbjct  187   TSIPGMEAILRRRDLPSFLRVTDPNDSVLQIMAAETRKTALSAGLILNTFEDLEGPIMDE  246

Query  825   MRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVC  1004
             +R   + NV++IGPLH  L++ L     +   SS+ L ED +  +DWL+ QPP SV+YV 
Sbjct  247   IR-KRIPNVFSIGPLHTHLKSHLDP-QSSSLASSSFLRED-RTSIDWLNSQPPKSVIYVS  303

Query  1005  FGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVL--NKKVERGEVPTEILNGLEGRCC  1178
             FG+LT ++EE   EFW+GL+NSG  FLW + P  +   + +     +P E+  G + R  
Sbjct  304   FGSLTQLTEEEHLEFWYGLVNSGHMFLWVMRPDSIAGSDNRHRNAAIPKELEEGTKQRGY  363

Query  1179  VVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKI  1358
             +VEW PQ EVLAH +VG F TH GWNS +ESI AGVPMI WP++ADQQ NSRF+   WK+
Sbjct  364   LVEWVPQMEVLAHPSVGAFFTHGGWNSTLESICAGVPMICWPYFADQQTNSRFVSHEWKV  423

Query  1359  GLDMKDTCD  1385
             G DMKD+CD
Sbjct  424   GFDMKDSCD  432



>ref|XP_007026848.1| UDP-glucosyl transferase 85A3, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY07350.1| UDP-glucosyl transferase 85A3, putative isoform 2, partial [Theobroma 
cacao]
Length=478

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 182/472 (39%), Positives = 276/472 (58%), Gaps = 19/472 (4%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFPS  HI  +L+LA+LL  +  +VTF+      + LL   D+ +  R +  F F ++PD
Sbjct  15    PFPSLGHIKPLLSLAELLSHASFQVTFLNPQQIHDRLLLSMDMPAFHRRHPEFEFLSMPD  74

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS--APQRCIIADGF-AN  497
              +    +D  R     +   + SL +  KP L E++++   E     P  CIIADG  ++
Sbjct  75    PVRRS-SDRPRPGLFSLHDNILSLGSVIKPALGELLISFNRERGRRQPATCIIADGLLSS  133

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
               +DVAE+  +P  +    SA   WAYF+ P L++ G++PF  +DMD+ +  + G+E ++
Sbjct  134   PVIDVAEQFEIPFFALRTSSACCIWAYFNPPKLVEEGDVPFQDEDMDKLVTCIPGLENVV  193

Query  678   RRRDLPGNCRVDDLEDPFFKFMMEFRKCF--RTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             RRRDLPG  R++   DP  ++ +  +     R    I+N+F ELE   + ++       V
Sbjct  194   RRRDLPGIFRIERANDPALEYFINDQTLVLPRASGLILNTFDELEAPVIAKLG-SHFTKV  252

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y +GPLH L   ++    +++ +  N L ++   CM WLD Q   SV++V FG++   + 
Sbjct  253   YTVGPLHSLSTVRMKDL-ISVASGENILWKEDTSCMTWLDSQLSKSVIFVSFGSVISFTR  311

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEG----RCCVVEWAPQ  1199
             + + E WHGL+N G+ FLWA+    ++ +     + P+ IL  L+     +  +V WAPQ
Sbjct  312   DQMFELWHGLVNCGKPFLWAIRQDSIIGE-----DGPSLILGKLKDMTGDKGLLVSWAPQ  366

Query  1200  QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDT  1379
             + VL H A+GGF TH GWNS +ESI AGVPMI WP   DQQ+NSRF+ +VWKIG DMKD+
Sbjct  367   ELVLTHPAIGGFFTHSGWNSTLESIFAGVPMICWPAIGDQQMNSRFVSDVWKIGFDMKDS  426

Query  1380  CDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIED  1535
             CDR +IEKMVRDLME +++E ++   +    A E  KEGGSS  +L+ LI+D
Sbjct  427   CDRSLIEKMVRDLMEDKREEIMKSVNEIKKLAHEAVKEGGSSFCNLDKLIDD  478



>ref|XP_007026850.1| UDP-glucosyl transferase 85A4-like protein isoform 1 [Theobroma 
cacao]
 gb|EOY07352.1| UDP-glucosyl transferase 85A4-like protein isoform 1 [Theobroma 
cacao]
Length=490

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 197/485 (41%), Positives = 276/485 (57%), Gaps = 30/485 (6%)
 Frame = +3

Query  150   YPFPSH--IHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+H  I  M  LA+LL  ++ +VTF+ T    + LL  SD+ +    Y  F+  + P
Sbjct  14    FPFPAHGHIKPMFRLAELLSHANFQVTFLNTQRNHDLLLLSSDIPAFRSRYPNFQLLSYP  73

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADG--FAN  497
             D +P GL D HR S  G V LL S  A AKP L E++    G    P  CIIAD     +
Sbjct  74    DKVPLGL-DPHRRSEQGFVDLLLSTKAAAKPALSELLEKKTGR--RPPTCIIADWAIMCS  130

Query  498   FAVDVAEEVG-VPIISFHPVSAAATWAYFSIPSLIQAGELPFNG-KDMDEPILSVKGMEK  671
              A+DVA+E G +P+ +F    A   W  F +  LI+ GE+P  G KDMD+P+ S+ G+  
Sbjct  131   SAMDVAKEFGNIPVFAFQTACAHYMWMDFHLLKLIEEGEVPLRGYKDMDKPVTSISGLGM  190

Query  672   LLRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHH--IINSFQELEGSTLDQMRIGDML  845
              +RRRDL G  R D +     +    +     ++ +  I N+F +LE   + ++      
Sbjct  191   SVRRRDLSGFARFDTVCKQVIEISTNYGSSAVSQAYGVIHNTFDKLEAPVISKLSSFLPF  250

Query  846   NVYAIGPLHELLRN-------KLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVC  1004
              +Y IGPLH LL N        L S NVT+        ++   C+ WLD QP  SV++V 
Sbjct  251   KIYTIGPLHCLLNNYCIKDSNPLHSINVTIC-------KEDTNCITWLDSQPSGSVIFVS  303

Query  1005  FGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEG----R  1172
             FG+L  +S   + E   GL+NS + FLW + P  ++ ++ E    P +IL  LE     +
Sbjct  304   FGSLVSLSRSQILEIGQGLLNSCRPFLWVILPNPIVGQQ-EDDSTPGQILMELENMSKEK  362

Query  1173  CCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVW  1352
               +V WAPQ++VLAH A+GGFLTH GWNS MESI A VPMI WP  ADQ VNSR + E+W
Sbjct  363   GLIVSWAPQEKVLAHPAIGGFLTHSGWNSTMESIYARVPMICWPTEADQLVNSRCVSELW  422

Query  1353  KIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIE  1532
             +IG DMKDTCDR  +EK+V DLME ++DE ++   +    A+E  +EGGSS  +L+ LI 
Sbjct  423   RIGFDMKDTCDRSTVEKLVNDLMEDKRDEIMKSMDKITRQAEESVQEGGSSYCNLQRLIT  482

Query  1533  DIKRM  1547
             DI+ +
Sbjct  483   DIRSL  487



>emb|CBI36709.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 189/469 (40%), Positives = 262/469 (56%), Gaps = 68/469 (14%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P   H++ ML LA+LL L+ L++TF+ + +  + LL +++++ R+  Y GFRF+TI 
Sbjct  35    FPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNILDRYTRYPGFRFQTIS  94

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP     D   +G G+  ++  + AT KP  +E+V+ S    S P  CIIADG  +FA
Sbjct  95    DGLPL----DRPRTGAGLRDMMDGIKATTKPLFREMVI-SWCRSSDPVTCIIADGLMSFA  149

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             +DVA EVGVPIIS   VS     AYFS   LI+AGE+PF   DMD  +  V GME  LRR
Sbjct  150   IDVANEVGVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRLVTRVPGMEGFLRR  209

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CR  D  D   +F++ E ++  R    I+N+F++L+G  L Q+R      +Y I
Sbjct  210   RDLPSFCRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIR-NHCPKIYTI  268

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GPLH  L+++L S   T +  SN    + + C+ WLDRQP  SV+YV FG++T++++E +
Sbjct  269   GPLHAHLKSRLAS-ETTTSQFSNSFWVEDRSCLAWLDRQPSKSVIYVSFGSITVITKEQM  327

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFWHGL+NSG RFLW + P  +  K    G+ P                          
Sbjct  328   MEFWHGLVNSGSRFLWVIRPDSLTEKD---GDAPG-------------------------  359

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
                     CGW          VP            NSRF+  VWK+G+DMKDTCDR  IE
Sbjct  360   --------CGW----------VP------------NSRFVSHVWKMGMDMKDTCDRVTIE  389

Query  1401  KMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             KMVRD+ME R+ EF +     A  A+    EGG+S  + + LIEDI+ M
Sbjct  390   KMVRDVMEGRRAEFTKSVDAMAKLARRSLSEGGTSYCNFDRLIEDIRLM  438



>emb|CDP05613.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   332 bits (851),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/405 (45%), Positives = 244/405 (60%), Gaps = 24/405 (6%)
 Frame = +3

Query  393   SLSATAKPFLKEIV----VTSGGEDSAPQRCIIADGFANFAVDVAEEVGVPIISFHPVSA  560
             SL +  KPFLKE +    V   G++  P   IIADG  + A+DVAEE+G+P+I F   SA
Sbjct  6     SLQSVMKPFLKEFLSKDPVGGSGKNRPPFTSIIADGILSVALDVAEEIGLPVIYFRTTSA  65

Query  561   AATWAYFSIPSLIQAGELPFN-------GKDMDEPILSVKGMEKLLRRRDLPGNCRVDDL  719
                W YF  P L +AGE PF+         DMD PI  VKGME +LR RDL    R +DL
Sbjct  66    GFFWPYFCTPLLTEAGEFPFSFTILYSERNDMDLPIAHVKGMEGVLRHRDLTSFYRANDL  125

Query  720   EDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLG  896
               P FK ++ E  +  R K  I+N+F++LE   L  +RI    N+Y IGPL+  L+ +L 
Sbjct  126   NSPRFKLLLNENLQTPRAKGLILNTFEDLERPILSHVRI-QCPNLYTIGPLYAHLKTRLQ  184

Query  897   SCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQ  1076
                V        L E+   C+ WLD QPP SVLYV FG++T+++ E L EFWHG++NS  
Sbjct  185   LQLVLERGRGFDLCEEDTSCIKWLDNQPPKSVLYVSFGSITIITREKLLEFWHGIVNSRV  244

Query  1077  RFLWALNPRLV--------LNKKVERGEVPTEILNGLEG-RCCVVEW--APQQEVLAHSA  1223
             RFLW +    +        L    +   +  +++N     R   V +  APQ+EVLA  A
Sbjct  245   RFLWVIRSDSIRVRLGDDGLETDKQYKYLGKKLINNYSSDRGYRVGYFLAPQEEVLARPA  304

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             +  FLTH GWNS +ES+V G PMI WP++ DQ  NSRF+GE+WK+GLD+KDTCDR I+EK
Sbjct  305   IDRFLTHSGWNSTLESMVEGKPMICWPYFGDQHPNSRFVGELWKLGLDIKDTCDRKIVEK  364

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             M++ LM  RKDEFLQRA + A  A++  +EGGSS  +   LI+DI
Sbjct  365   MIKGLMVERKDEFLQRANEMAKLARKSIEEGGSSFCNFLRLIDDI  409



>ref|XP_007026847.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07349.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
Length=496

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/476 (38%), Positives = 278/476 (58%), Gaps = 21/476 (4%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFPS  HI  +L+LA+LL  +  +VTF+      + LL   D+ +  R +  F F ++PD
Sbjct  15    PFPSLGHIKPLLSLAELLSHASFQVTFLNPQQIHDRLLLSMDMPAFHRRHPEFEFLSMPD  74

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS--APQRCIIADGF-AN  497
              +    +D  R     +   + SL +  KP L E++++   E     P  CIIADG  ++
Sbjct  75    PVRRS-SDRPRPGLFSLHDNILSLGSVIKPALGELLISFNRERGRRQPATCIIADGLLSS  133

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN--GKDMDEPILSVKGMEK  671
               +DVAE+  +P  +    SA   WAYF+ P L++ G++PF    +DMD+ +  + G+E 
Sbjct  134   PVIDVAEQFEIPFFALRTSSACCIWAYFNPPKLVEEGDVPFQVADEDMDKLVTCIPGLEN  193

Query  672   LLRRRDLPGNCRVDDLEDPFFKFMMEFRKCF--RTKHHIINSFQELEGSTLDQMRIGDML  845
             ++RRRDLPG  R++   DP  ++ +  +     R    I+N+F ELE   + ++      
Sbjct  194   VVRRRDLPGIFRIERANDPALEYFINDQTLVLPRASGLILNTFDELEAPVIAKLG-SHFT  252

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
              VY +GPLH L   ++    +++ +  N L ++   CM WLD Q   SV++V FG++   
Sbjct  253   KVYTVGPLHSLSTVRMKDL-ISVASGENILWKEDTSCMTWLDSQLSKSVIFVSFGSVISF  311

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEG----RCCVVEWA  1193
             + + + E WHGL+N G+ FLWA+    ++ +     + P+ IL  L+     +  +V WA
Sbjct  312   TRDQMFELWHGLVNCGKPFLWAIRQDSIIGE-----DGPSLILGKLKDMTGDKGLLVSWA  366

Query  1194  PQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMK  1373
             PQ+ VL H A+GGF TH GWNS +ESI AGVPMI WP   DQQ+NSRF+ +VWKIG DMK
Sbjct  367   PQELVLTHPAIGGFFTHSGWNSTLESIFAGVPMICWPAIGDQQMNSRFVSDVWKIGFDMK  426

Query  1374  DTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             D+CDR +IEKMVRDLME +++E ++   +    A E  KEGGSS  +L+ LI+DI+
Sbjct  427   DSCDRSLIEKMVRDLMEDKREEIMKSVNEIKKLAHEAVKEGGSSFCNLDKLIDDIR  482



>ref|XP_007207170.1| hypothetical protein PRUPE_ppa022102mg [Prunus persica]
 gb|EMJ08369.1| hypothetical protein PRUPE_ppa022102mg [Prunus persica]
Length=474

 Score =   333 bits (855),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 190/477 (40%), Positives = 267/477 (56%), Gaps = 28/477 (6%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   H+  +L LA+LLC + L VT++ T H    L     + + F       FE+I 
Sbjct  11    FPFPLQGHMKPLLCLAELLCHAGLHVTYVNTHHNHQRLANRQALSTHF---PTLHFESIS  67

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT------SGGEDSAPQRCIIAD  485
             DGLP    DD R+      QLL +L  + +P  +E++ T      S      P  CI+ D
Sbjct  68    DGLPE---DDPRTLNS---QLLIALKTSIRPHFRELLKTISLKAESNDALVPPPSCIMTD  121

Query  486   GFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGM  665
             G   FA DVAEE+G+PI+SF+       W    +P LI+ G+LPF   DM+  I  V GM
Sbjct  122   GLVTFAFDVAEELGLPILSFNVPCPRYLWTCLCLPKLIENGQLPFQDDDMNVEITGVPGM  181

Query  666   EKLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDM  842
             E LL R+DLPG CRV   + P  +F + E +   R    I+++  EL+   +  M +   
Sbjct  182   EGLLHRQDLPGFCRVKQADHPSLQFAINETQTLKRASALILDTVYELDTPCISHMALM-F  240

Query  843   LNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTL  1022
               +Y +GPLH LL +++G  +  L  S   L +    CM WLD QP  SV+YV FGTL  
Sbjct  241   PKIYTLGPLHALLNSQIGDMSRGLA-SHGSLWKSDLNCMTWLDSQPSKSVIYVSFGTLVH  299

Query  1023  VSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERG--EVPTEILNGLEGRCCVVEWAP  1196
             ++   + EFW+GL+NSG  FLW      V+   +  G  ++P E+ NG + R C+V+W  
Sbjct  300   LTRAQVIEFWYGLINSGHPFLW------VMRSDITSGDHQIPPELENGTKERGCIVDWVS  353

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q+EVLAH +VGGFLTH GWNS +ESIVAG+PMI WP   D  + SR +   WKIGL + +
Sbjct  354   QEEVLAHKSVGGFLTHSGWNSTLESIVAGLPMICWPNLGDHYIISRTVCRQWKIGLQLNE  413

Query  1377  TCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              CDR  IE MV+ LM  +++E        +  A++   EGGSS ++LE LIE I+ +
Sbjct  414   NCDRSNIESMVQTLMGSKREEIQSSMDAISKLARDSVAEGGSSHNNLEQLIEYIRNL  470



>emb|CBI36705.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   331 bits (848),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 186/458 (41%), Positives = 256/458 (56%), Gaps = 66/458 (14%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDH  356
             ML LA+LL L+ L++TF+ + +  + LL +++++ R+  Y GFRF+TI DGLP     D 
Sbjct  1     MLKLAELLSLAGLRITFLNSDYNHHRLLRYTNILDRYTRYPGFRFQTISDGLPL----DR  56

Query  357   RSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEVGVPI  536
               +G G+  ++  + AT KP  +E+V+ S  + S P  CIIADG  +FA+DVA EVGVPI
Sbjct  57    PWTGAGLRDMMDGIKATTKPLFREMVI-SWCQSSDPVTCIIADGLMSFAIDVANEVGVPI  115

Query  537   ISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDLPGNCRVDD  716
             IS   VS     AYFS   LI+AGE+PF   DMD  +  V GME  LRRRDLP  CR  D
Sbjct  116   ISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRLVTRVPGMEGFLRRRDLPSFCRTRD  175

Query  717   LEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKL  893
               D   +F++ E ++  R    I+N+F++L+G  L Q+R      +Y IGPLH  L+++L
Sbjct  176   ANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIR-NHCPKIYTIGPLHAHLKSRL  234

Query  894   GSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSG  1073
              S   T +  SN   E+ + C+ WLDRQP  S +YV FG++T++++E + EFWHGL+NSG
Sbjct  235   AS-ETTTSQFSNSFWEEDRSCLAWLDRQPSKSFIYVSFGSITVITKEQMMEFWHGLVNSG  293

Query  1074  QRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGW  1253
              RFLW + P  +  K    G+ P                                  CGW
Sbjct  294   SRFLWVIRPDSLTEKD---GDAP---------------------------------GCGW  317

Query  1254  NSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRK  1433
                       VP            NSRF+  VWKIG+DMKDTCDR  +EKMVRD+ME R+
Sbjct  318   ----------VP------------NSRFVSHVWKIGMDMKDTCDRVTVEKMVRDVMEERR  355

Query  1434  DEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              EF +     A  A+    EGG+S  +   LIEDI+ M
Sbjct  356   AEFTKSVDAMAKLARSSLSEGGTSYCNFNRLIEDIRLM  393



>ref|XP_007207618.1| hypothetical protein PRUPE_ppa019804mg [Prunus persica]
 gb|EMJ08817.1| hypothetical protein PRUPE_ppa019804mg [Prunus persica]
Length=474

 Score =   332 bits (850),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 189/477 (40%), Positives = 265/477 (56%), Gaps = 28/477 (6%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   H+  +L LA+LLC + L VT++ T H    L     +   F       FE+I 
Sbjct  11    FPFPLQGHMKPLLCLAELLCHAGLHVTYVNTHHNHQRLANRQALSIHF---PTLHFESIS  67

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT------SGGEDSAPQRCIIAD  485
             DGLP    DD R+      QLL +L  + +P  +E++ T      S      P  CI+ D
Sbjct  68    DGLPE---DDPRTLNS---QLLIALKTSIRPHFRELLKTISFKAESNDALVPPPSCIMTD  121

Query  486   GFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGM  665
             G   FA DV EE+G+PI+SF+       W    +P LI+ G+LPF   DM+  I  V GM
Sbjct  122   GLVTFAFDVGEELGLPILSFNVPCPRYLWTCLCLPKLIENGQLPFQDDDMNVEITGVPGM  181

Query  666   EKLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDM  842
             E LL R+DLPG CRV   + P  +F + E +   R    I+++  EL+   +  M +   
Sbjct  182   EGLLHRQDLPGFCRVKQADHPSLQFAINETQTLKRASALILDTVYELDAPCISHMALM-F  240

Query  843   LNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTL  1022
               +Y +GPLH LL +++G  +  L  S   L +    CM WLD QP  SV+YV FGTL  
Sbjct  241   PKIYTLGPLHALLNSQIGDMSRGLA-SHGSLWKSDLNCMTWLDSQPSKSVIYVSFGTLVH  299

Query  1023  VSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERG--EVPTEILNGLEGRCCVVEWAP  1196
             ++   + EFW+GL+NSG  FLW      V+   +  G  ++P E+ NG + R C+V+W  
Sbjct  300   LTRAQVIEFWYGLVNSGHPFLW------VMRSDITSGDHQIPAELENGTKERGCIVDWVS  353

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q+EVLAH +VGGFLTH GWNS +ESIVAG+PMI WP   D  + SR +   WKIGL + +
Sbjct  354   QEEVLAHKSVGGFLTHSGWNSTLESIVAGLPMICWPKLGDHYIISRTVCRQWKIGLQLNE  413

Query  1377  TCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              CDR  IE MV+ LM  +++E        +  A++   EGGSS ++LE LIE I+ +
Sbjct  414   NCDRSNIESMVQTLMGSKREEIQSSMDAISKLARDSVAEGGSSHNNLEQLIEYIRNL  470



>ref|XP_006361974.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=378

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 175/397 (44%), Positives = 248/397 (62%), Gaps = 31/397 (8%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LAQLL LS+  VTF+ TV   + ++   DV+SRF   S F  +   
Sbjct  10    FPFPAQGHVNSMLKLAQLLSLSNFDVTFLVTVDTHDRVVNHIDVLSRFG--SVFHLQ---  64

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
               LPHG++ D  ++  GI  L +SL+  AKPFL+E +  S         C+I DG  + A
Sbjct  65    -ALPHGISMDGVNTRDGISMLYYSLNTIAKPFLREFIPNSS------VTCLIVDGILSMA  117

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              DVAEE+ +PII F  VSA++ W+YF IP LIQAGELP      D  +  VKGME  LR 
Sbjct  118   ADVAEEINLPIIYFRTVSASSFWSYFCIPELIQAGELPLKENAKDLTLTKVKGMEDFLRG  177

Query  684   RDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  C+  DL +P F+ +M E R+  R +  I+N+F++LE             + ++ 
Sbjct  178   RDLPSFCQASDLTNPDFRIVMTETRQTPRAQGLILNTFEDLERP-----------HTFSN  226

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
               +H  L+ KL     T +TSSN L ++ ++CM WLD QPP S++YV FG++  +++E L
Sbjct  227   SNVHAHLKAKLA----TKSTSSNNLWQEDERCMSWLDTQPPKSMIYVSFGSVAGLTKEEL  282

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EFW+GL+NS Q+FLW + P L++ ++  + E+  E+  G + R  + +W PQ++VLAH 
Sbjct  283   LEFWYGLVNSEQKFLWVMRPDLIIGQE-RKDEISVELEQGTKARGYMADWVPQEKVLAHR  341

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNS  1331
              +GGFLTH GWNS +ESIV GV MI WP +ADQQVNS
Sbjct  342   EIGGFLTHSGWNSTLESIVEGVSMICWPRFADQQVNS  378



>ref|XP_007206751.1| hypothetical protein PRUPE_ppa025141mg [Prunus persica]
 gb|EMJ07950.1| hypothetical protein PRUPE_ppa025141mg [Prunus persica]
Length=482

 Score =   330 bits (846),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 187/475 (39%), Positives = 265/475 (56%), Gaps = 28/475 (6%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   H+  +L LA+LLC + L VT++ T H    L     + + F       FE+I 
Sbjct  11    FPFPLQGHMKPLLCLAELLCHAGLHVTYVNTHHNHQRLANRQALSTHF---PTLHFESIS  67

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT------SGGEDSAPQRCIIAD  485
             DGLP    DD R+      QLL +L  + +P  +E++ T      S      P  CI+ D
Sbjct  68    DGLPE---DDPRTLNS---QLLIALKTSIRPHFRELLKTISLKAESNDTLVPPPSCIMTD  121

Query  486   GFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGM  665
             G   FA DVAEE+G+PI+SF+       W    +P LI+ G+LPF   DM+  I  V GM
Sbjct  122   GLVTFAFDVAEELGLPILSFNVPCPRYLWTCLCLPKLIENGQLPFQDDDMNVEITGVPGM  181

Query  666   EKLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDM  842
             E LL R+DLPG CRV   + P  +F + E +   R    I+++  EL+   +  M +   
Sbjct  182   EGLLHRQDLPGFCRVKQADHPSLQFAINETQTLKRASALILDTVYELDAPCISHMALM-F  240

Query  843   LNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTL  1022
               +Y +GPLH LL +++G  +  L  S   L +    CM WLD QP  S++YV FGTL  
Sbjct  241   PKIYTLGPLHALLNSQIGDMSRGLA-SHGSLWKSDLNCMTWLDSQPSKSIIYVSFGTLVH  299

Query  1023  VSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERG--EVPTEILNGLEGRCCVVEWAP  1196
             ++   + EFW+GL+NSG  FLW      V+   +  G  ++P E+ NG + R C+V+W  
Sbjct  300   LTRAQVIEFWYGLVNSGHPFLW------VMRSDITSGDHQIPAELENGTKERGCIVDWVS  353

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q+EVLAH +VGGFLTH GWNS +ESIVAG+PMI WP   D  + S  +   WKIGL + +
Sbjct  354   QEEVLAHKSVGGFLTHSGWNSTLESIVAGLPMICWPKLGDHYIISSTVCRQWKIGLQLNE  413

Query  1377  TCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
              CDR  IE MV+ LM  +++E        +  +++   EGGSS ++LE LIE I+
Sbjct  414   NCDRSNIESMVQTLMGSKREEIQSSMDAISKLSRDSVAEGGSSHNNLEQLIEYIR  468



>ref|XP_006379614.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
 gb|ERP57411.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
Length=365

 Score =   326 bits (835),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/343 (48%), Positives = 221/343 (64%), Gaps = 5/343 (1%)
 Frame = +3

Query  522   VGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDLPGN  701
             + VP++   PV +   + + +   ++         +DMD  I  V GME  LR RDLP  
Sbjct  20    IFVPLV---PVPSGLIFRFLTSLKVVNFPSETAGNEDMDRLITKVPGMETFLRCRDLPSF  76

Query  702   CRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHEL  878
             CRV D+  P    +M E R+  R K  I+N+F++LEG  + Q+R      +Y+IGPLHE 
Sbjct  77    CRVSDMTHPNLLLVMNETRQSPRAKALILNTFEDLEGPLMSQIRT-HCPEIYSIGPLHEH  135

Query  879   LRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHG  1058
             L+ KL + N     SSN L E  + CM WLD QP  SVLYV FG+ T+++   L EFW+G
Sbjct  136   LQAKLSAKNEKSCQSSNSLREIDRSCMTWLDNQPEKSVLYVSFGSFTVMTRHQLLEFWYG  195

Query  1059  LMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFL  1238
             L++S +RFLW + P  +  K  E  ++P E+  G + R  +  W PQ+EVLAH A+ GFL
Sbjct  196   LVSSKKRFLWVIRPDSIATKDGEFEKIPVEVEEGTKERGFIAGWVPQEEVLAHKAIAGFL  255

Query  1239  THCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDL  1418
             TH GWNS +ESIVAGVPMI WP++ADQQVNSRF+GEVWK+GLDMKD CDR I+EKMV DL
Sbjct  256   THSGWNSTLESIVAGVPMICWPYFADQQVNSRFVGEVWKLGLDMKDQCDREIVEKMVNDL  315

Query  1419  MEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             M  R++EF++ A + A  +++  +EGGSS  +L  LIEDI+ M
Sbjct  316   MVERREEFVRSATRMAELSRKSVREGGSSYCNLNRLIEDIRTM  358



>ref|XP_007026846.1| UDP-glucosyl transferase 85A3, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07348.1| UDP-glucosyl transferase 85A3, putative isoform 2 [Theobroma 
cacao]
Length=448

 Score =   327 bits (839),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 185/451 (41%), Positives = 265/451 (59%), Gaps = 29/451 (6%)
 Frame = +3

Query  225   FITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDHRSSGVGIVQLLHSLSA  404
              I  +H R   L  +D+++R   Y  F+F TIPD +P    D  RS  +     L +   
Sbjct  1     MIQRIHDR---LLSTDLLAR---YPEFQFLTIPDVVPR---DRPRSGTMSPGDFLLAAGP  51

Query  405   TAKPFLKEIVVTSGGEDS--APQRCIIADG-FANFAVDVAEEVGVPIISFHPVSAAATWA  575
               KP L+++ ++   +     P  CII DG  ++  +DVAEE  VP+ +F   SA   W 
Sbjct  52    VIKPALRQLFISLCKKKGRWQPATCIIEDGILSSSVIDVAEEFQVPVFAFRTSSACCIWT  111

Query  576   YFSIPSLIQAGELPF-NGKDMDEPILSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMMEF  752
             YF +  L++ G++P    KDMD+P+  + G+E ++RRRDLPG  R++  +DP  +F +  
Sbjct  112   YFHVRKLVEEGDVPVVQDKDMDKPVTCIPGLENVVRRRDLPGIFRIERADDPGLEFFIND  171

Query  753   RKCF--RTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSS  926
             +     R    IIN+F  LE + + ++       +Y +GPLH L  N       T  +S+
Sbjct  172   QTLVMPRAFAIIINTFDGLEATMISKL-ASVFTKMYTVGPLHGL-SNARAKEETTSASSN  229

Query  927   NGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRL  1106
             + L ++ + CM WLD QP  SV++V FG+   ++ + + EF HGL+NSG  FLW + P  
Sbjct  230   SILWKEDRGCMFWLDSQPSRSVVFVSFGSFVGLTRDKMLEFGHGLVNSGYPFLWVIRPDS  289

Query  1107  VLNKKVERGEV-PTEILNGLEG-----RCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIME  1268
             +       GEV P+ IL  L+      +  +V WAPQ+EVLAH A+G FLTH GWNS +E
Sbjct  290   IT------GEVDPSLILGELKAMIEDNKGLMVSWAPQEEVLAHPAIGVFLTHSGWNSTLE  343

Query  1269  SIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQ  1448
             S+ AGVPMI WP   DQQ+NSRF+ +VWKIGLDMKDTCDR  IEKMVR LME +++E ++
Sbjct  344   SVYAGVPMICWPAIGDQQINSRFVSDVWKIGLDMKDTCDRSTIEKMVRSLMEDKREEIMK  403

Query  1449  RAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
                +    A E  KEGGSS S+LE LI+DI+
Sbjct  404   SVNEIKKLAHETIKEGGSSFSNLEKLIDDIR  434



>ref|XP_008242286.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=474

 Score =   327 bits (839),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 184/475 (39%), Positives = 269/475 (57%), Gaps = 24/475 (5%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   HI  +L LA+LLC + L VTF+ T H  +  L   + +S    +    FE+I 
Sbjct  11    FPFPLQGHIKPLLCLAELLCHAGLHVTFVNT-HPNHKHLANPEALSTH--FPTLHFESIS  67

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT------SGGEDSAPQRCIIAD  485
             DGLP    DDH  +  G  +LL +L  + +P  +E++ T      S      P  CII D
Sbjct  68    DGLP----DDHPRALNG--ELLMALKTSIRPHFRELLETISLKAESNDASVPPLNCIITD  121

Query  486   GFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGM  665
             G   FA D+AEE+ +PI+S++   A   W    +P LI+ G+LPF   DM   I  V GM
Sbjct  122   GLVTFAFDLAEELEIPILSYNVPCARYLWTCLCLPDLIEQGQLPFPDDDMSVEITGVSGM  181

Query  666   EKLLRRRDLPGNCRVDDLEDPFFKFMMEFRKC-FRTKHHIINSFQELEGSTLDQMRIGDM  842
             +  L R+DLP  CRV   + P  +F + + +   R+   I+++  EL+ S L  M +   
Sbjct  182   DGPLHRQDLPSFCRVKQTDHPALQFAITWTQAQRRSSALILDTVYELDASCLSHMALM-F  240

Query  843   LNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTL  1022
               +Y +GPLH LL  ++G+ + +L  S  GL +    CM WLD QP  SV+YV FGTL  
Sbjct  241   PKIYTLGPLHALLNAQIGNVSKSLA-SHGGLWKSDPNCMTWLDFQPSRSVIYVSFGTLVN  299

Query  1023  VSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQ  1202
             ++   + EFW+GL+NS   F+W +   ++        ++P E+  G + R  +V+W  Q+
Sbjct  300   LTRAQIIEFWYGLVNSRHPFMWVIRSDIIYRAH----QIPAELEIGTKERGYIVDWVSQE  355

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             EVLAH AVGGFLTH GWNS +ESIVAG+PMI WP   D  + SR + + WKIGL +K+ C
Sbjct  356   EVLAHKAVGGFLTHSGWNSTLESIVAGLPMICWPNLGDHYIISRTVSQKWKIGLQLKENC  415

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             DR  IE M++ LM  +++E        +  A++   +GGSS ++LE LIE I+ +
Sbjct  416   DRCNIETMIQTLMGPKREEIQSSMDTISKLARDSVVKGGSSHNNLEQLIEHIRSL  470



>ref|XP_007207791.1| hypothetical protein PRUPE_ppa025605mg [Prunus persica]
 gb|EMJ08990.1| hypothetical protein PRUPE_ppa025605mg [Prunus persica]
Length=483

 Score =   325 bits (833),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 182/473 (38%), Positives = 264/473 (56%), Gaps = 24/473 (5%)
 Frame = +3

Query  150   YPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP   HI  +L LA+LLC +   VTF+ T H    L     + + F       FE+I 
Sbjct  11    FPFPLQGHIKPLLCLAELLCHAGFHVTFVNTHHNHKRLANPEALSTHF---PTLHFESIS  67

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT------SGGEDSAPQRCIIAD  485
             DGLP    DDH  +  G  +LL +L  + +P  +E++ T      S    + P  CII D
Sbjct  68    DGLP----DDHPRALNG--ELLIALKTSIRPHFRELLETISIKAESNDAPAPPLNCIITD  121

Query  486   GFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGM  665
             G   FA D+AEE+ +P++S++   A   W    +P LI+ G+LPF   DM   I  V GM
Sbjct  122   GLVTFAFDLAEELEIPVLSYNVPCARYLWTCLCLPDLIEQGQLPFPDDDMSVEITGVSGM  181

Query  666   EKLLRRRDLPGNCRVDDLEDPFFKFMMEFRKC-FRTKHHIINSFQELEGSTLDQMRIGDM  842
             +  L R+DLP  CRV     P  +F + + +   R    I+++  EL+ S L  M +   
Sbjct  182   DGPLHRQDLPSFCRVKQANHPALQFAINWTQAQRRASALILDTVYELDASCLSHMALM-F  240

Query  843   LNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTL  1022
               +Y +GPLH LL  ++G+ + +L  S  GL +    CM WLD QP  SV+YV FGTL  
Sbjct  241   PKIYTLGPLHALLNAQIGNVSKSLA-SHGGLWKSDPNCMTWLDSQPSRSVIYVSFGTLVN  299

Query  1023  VSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQ  1202
             ++   + EFW+GL+NSG  F+W +   ++        ++P E+  G + R  +V+W  Q+
Sbjct  300   LTRAQMIEFWYGLVNSGHPFMWVIRSDIIYGAH----QIPAELEIGTKERGYIVDWVSQE  355

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             EVLAH AVGGFLTH GWNS +ESIVAG+PMI WP   D  + SR + + WKIGL + + C
Sbjct  356   EVLAHKAVGGFLTHSGWNSTLESIVAGLPMICWPNLGDHYIISRTVSQKWKIGLQLNEIC  415

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             DR  IE M++ LM  +++E        +  A++   +GGSS ++LE LIE I+
Sbjct  416   DRCNIETMIQTLMGPKREEIQSSIDTISKLARDSVVKGGSSHNNLEQLIEYIR  468



>ref|XP_008346926.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Malus domestica]
Length=476

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 181/474 (38%), Positives = 267/474 (56%), Gaps = 24/474 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI  +L LA+LLC S   VTF+ T H        S+ IS    +    FE+I DGL
Sbjct  13    PLQGHIKPLLCLAELLCHSGFHVTFVNT-HQNYKRFGNSEAISTH--FPTLHFESISDGL  69

Query  333   PHGLTDDHRS--SGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA------PQRCIIADG  488
             P    ++H    S   +++L  S+    +  LK I++ +  +D        P  CII DG
Sbjct  70    P----EEHPRAISSTLLIELKSSIKPPFRELLKTIILRADDKDHVIGCWVPPLTCIITDG  125

Query  489   FANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGME  668
                 A D+A+E+G+PII+ +       W   SIP L++ G++PF   DM+  I+ V GME
Sbjct  126   TLAGAFDIAQELGIPIIAHNVPYPGYLWTVLSIPKLVEQGQIPFKDDDMNVEIMGVPGME  185

Query  669   KLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
               LRRRDLPG C+V   + P  +++  E++   R    I++S  EL+   L  M      
Sbjct  186   GYLRRRDLPGFCKVKQADHPALQYISNEYKTLKRASALILDSVYELDAPILSHMA-QVFP  244

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
              +Y +GP+H LL +++G  +  L + +    +  +KCM WLD  P  SV+YV FG+L  +
Sbjct  245   KIYTLGPIHALLNSQVGDISRELNSHT----KTAQKCMTWLDNHPSRSVIYVSFGSLVKL  300

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQE  1205
             + E + EFW+GL+ SGQ F+W +   +   + ++   VP E+  G + R  +VEWAPQ+E
Sbjct  301   THEQVIEFWYGLVKSGQPFIWVIRSDITSRQDLD---VPAELETGTKERGFIVEWAPQEE  357

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VLAH AVGGFLTH GWNS +E IVAGVPMI +P   D  + SR +   WKIGL + + CD
Sbjct  358   VLAHIAVGGFLTHSGWNSTLEGIVAGVPMICFPILGDHMIVSRTVCLKWKIGLPLSENCD  417

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R  IE +++DLM  +K+   +     +  A++  K+GGSS  +LE LI+ I+ M
Sbjct  418   RSEIETVIKDLMGYKKEGIQKSMDSTSKLARDSVKKGGSSHCNLELLIQQIRDM  471



>gb|EPS61663.1| hypothetical protein M569_13131, partial [Genlisea aurea]
Length=464

 Score =   322 bits (824),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 185/449 (41%), Positives = 268/449 (60%), Gaps = 24/449 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P    +++ML L++LLCL+ + VTF+ +  +   L   SD+ SRF  YSGFR   I DGL
Sbjct  24    PLQGPVNAMLKLSELLCLAGIHVTFLLSNFSYALLRRHSDIESRFSRYSGFRIAGIDDGL  83

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIV-VTSGGEDSAPQR---CIIADGFANF  500
             P    +D    GVG + LL S+    +  L++++  T    D + +R    II DG  NF
Sbjct  84    P----EDRPRVGVGSIDLLSSILRVGETELRKVLEATDSLRDGSARRRVSFIIIDGILNF  139

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD-----------MDEPI  647
              + VAEE+G+P++ F  +SA + WA F    +I AGELP  G++           +D P+
Sbjct  140   VLPVAEELGIPVVHFRTISACSFWASFCSKEVIAAGELPLRGEEEGKYEYWRNPNLDLPV  199

Query  648   LSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQ  824
              S+ GME +LRRRDLP   RV D  D   + +  + RK   +   I+N+F++LEG  +D+
Sbjct  200   TSIPGMEAILRRRDLPSFFRVTDPNDSELQMLATDTRKAALSAGLILNTFEDLEGPIIDE  259

Query  825   MRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVC  1004
             +R   + NVY+IGPLH  L++ L   + ++ +SS+ L ED +  +DWL+ QPP SV+YV 
Sbjct  260   IR-KRIPNVYSIGPLHTHLKSHLDPRSSSVASSSSFLRED-RTSIDWLNSQPPKSVIYVS  317

Query  1005  FGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVV  1184
             FG+LT ++EE   EF +GL+NSG RFLW + P  +     ++  +P E+  G   R  VV
Sbjct  318   FGSLTQLTEEEHLEFLNGLVNSGHRFLWVVRPDSIAGS--DKVAIPEELEQGTRERGYVV  375

Query  1185  EWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGL  1364
             EWAPQ EVLAH +VG F TH GWNS +ESI AGVPMI WP++ DQ  NSRF+   WK+GL
Sbjct  376   EWAPQMEVLAHPSVGAFFTHGGWNSTLESICAGVPMICWPYFIDQPTNSRFVSHEWKVGL  435

Query  1365  DMKDTCDRHIIEKMVRDLMEVRKDEFLQR  1451
             D+       + E +   + + R+DE  +R
Sbjct  436   DVNSCDRVVVEEMVREVMEDRRRDELSER  464



>ref|XP_004305165.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Fragaria vesca 
subsp. vesca]
Length=503

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 185/452 (41%), Positives = 254/452 (56%), Gaps = 19/452 (4%)
 Frame = +3

Query  207   SHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDHRSSGVGIVQL  386
             S L VTF+ T H  N L     + +RF       FE+I DGLP    +  R+ G    +L
Sbjct  60    SGLHVTFVNTRHNHNRLANLPALSARFPT---LNFESISDGLP---LEHPRTLGS---EL  110

Query  387   LHSLSATAKPFLKEIV---VTSGGEDSAPQRCIIADGFANFAVDVAEEVGVPIISFHPVS  557
             L +L  + KP  KE++   + + G       CII DG   FA DVAEE+G+PI+ ++   
Sbjct  111   LMALKTSIKPHFKELLQSPLKANGVALPAPTCIITDGLVTFAFDVAEELGLPILGYNVPC  170

Query  558   AAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDLPGNCRVDDLEDPFFK  737
                 W    +P+LI+ G+LPF   DM+  I  V GME LLRR DLPG CRV     P  +
Sbjct  171   TRYMWTCLCLPNLIEQGQLPFPDDDMNVEITGVPGMEGLLRRVDLPGFCRVKQSNHPGLQ  230

Query  738   FMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDML-NVYAIGPLHELLRNKLGSCNVT  911
             F + E +   R    I+++  EL+   L  M   +M   +Y +GPLH LL +++G  + +
Sbjct  231   FAIRETQTQKRASALILDTIYELDAPCLSHM--ANMFPKIYTLGPLHSLLHSQIGDVSRS  288

Query  912   LTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWA  1091
             L  S  GL +D   CM WLD Q   SVLYV FGTL  ++   + EFW+GL+ SG  FLW 
Sbjct  289   LA-SYGGLWKDDPNCMTWLDSQATKSVLYVSFGTLVTLTRTQIMEFWYGLIYSGHPFLWV  347

Query  1092  LNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMES  1271
             +  R  +   +    +P E+  G + R  +V W  Q+EVLAH +VGGFLTH GWNS +ES
Sbjct  348   I--RSDITSDLGGDPIPMELEIGTKERGYIVNWVSQEEVLAHKSVGGFLTHSGWNSTLES  405

Query  1272  IVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQR  1451
             IVAG+PMI WP   D  + SR + E WKIGL +K+ CDR  IE M+R LME ++ E    
Sbjct  406   IVAGIPMICWPNLGDHYIISRTVSEKWKIGLQLKENCDRKEIETMIRMLMEFKRGEIQSS  465

Query  1452  AKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
                 +  A++   +GGSS  +LE LI+DI+ M
Sbjct  466   MDVISKVARDSVVKGGSSNHNLEMLIQDIRNM  497



>gb|KHN15666.1| UDP-glycosyltransferase 85A7 [Glycine soja]
Length=459

 Score =   320 bits (821),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 185/468 (40%), Positives = 260/468 (56%), Gaps = 24/468 (5%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDH  356
             M NLA+LL L   K+TF+ T H  N L+ F+D+ S    + GF F +I DG+P  L  + 
Sbjct  1     MFNLAKLLSLKGHKITFVNTHHNHNRLIQFTDLPSFHTQFPGFHFASITDGVPDNLPQN-  59

Query  357   RSSGVGIVQLLHSLSATAKP--------FLKEIVVTSGGEDSAPQRC-IIADGF-ANFAV  506
                     +  H +S T++          L  +VV    +   P  C IIADG  +  ++
Sbjct  60    --------EFEHMISPTSRSEVAGEFRGLLSRLVVEKPRQWDPPPSCVIIADGLMSTVSM  111

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEKLLRR  683
             DVA+E GVP+I+F   SA ATW    +  ++Q G +   N +DMD+ + S+ G+E LLR 
Sbjct  112   DVAKEFGVPLIAFRTYSATATWVSIHVSKIVQEGVMDLQNPEDMDKVLRSIPGLENLLRE  171

Query  684   RDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
              DLP   ++         ++ E     +    I+N+F +LE S + ++       VY IG
Sbjct  172   CDLPSILKLKPGSLYIDFYIKETLTMTQASGLIVNTFDQLEASIITKLTT-IFPKVYTIG  230

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
             PLH L + +  + N   ++SS  L ++ K C+ WLD+Q   SVLYV FGTL  VS E L 
Sbjct  231   PLHTLTKTQFITNN---SSSSLHLRKEDKSCITWLDQQKARSVLYVSFGTLAKVSHEQLV  287

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             E WHGL+ S + FLW +   L++ +      VP E+    + R  +V WAPQ+EVLAH +
Sbjct  288   EIWHGLVGSLKPFLWVIRQGLIIGEGGLGHNVPMELELKTKERGLMVNWAPQEEVLAHPS  347

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             VGGF TH GWNS +E I  GVPM+ WP  ADQ VNSR + E W IGLDM   CDR I+EK
Sbjct  348   VGGFFTHSGWNSTLECITEGVPMLCWPLIADQTVNSRCVSEQWGIGLDMNGICDRLIVEK  407

Query  1404  MVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             MV++LME + +       + A  A +   E GSS  ++ENLI+DI  M
Sbjct  408   MVKNLMENQIERLTSSTNEIAEKAHDSVNENGSSFHNIENLIKDIGTM  455



>ref|XP_008242262.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=456

 Score =   318 bits (816),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 181/466 (39%), Positives = 258/466 (55%), Gaps = 26/466 (6%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDH  356
             +L LA+LLC + L  T++        L     + + F       FE+I DGLP    DD 
Sbjct  4     LLCLAELLCHAGLHATYVNPPPTHQRLANRQALSTHF---PTLHFESISDGLPE---DDP  57

Query  357   RSSGVGIVQLLHSLSATAKPFLKEIVVT------SGGEDSAPQRCIIADGFANFAVDVAE  518
             R+      QLL +L  + +P  +E++ T      S      P  CI+ DG   FA DVAE
Sbjct  58    RTLNS---QLLIALKTSIRPHFRELLKTISLKAESNDALVPPPSCIVTDGLVTFAFDVAE  114

Query  519   EVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDLPG  698
             E+G+PI+S++       W    +P LI+ G+LPF   DM+  I  V GME LLRR+DLPG
Sbjct  115   ELGLPILSYNVPCPRYLWTCLCLPKLIENGQLPFQDDDMNVEITGVPGMEGLLRRQDLPG  174

Query  699   NCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHE  875
              CRV   + P  +F + E +   R+   I+++  EL+   +  M +     +Y +GPLH 
Sbjct  175   FCRVKQADHPSLQFAINETQTLKRSSALILDTVYELDAPCISHMAL-TFPKIYTLGPLHA  233

Query  876   LLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWH  1055
             LL +++G  +  L  S   L +    CM WLD QP  SV+YV FGTL  ++   + EFW+
Sbjct  234   LLNSQIGDMSRGLA-SHGSLWKSDLNCMTWLDSQPSKSVIYVSFGTLVHLTHAQVIEFWY  292

Query  1056  GLMNSGQRFLWALNPRLVLNKKVERG--EVPTEILNGLEGRCCVVEWAPQQEVLAHSAVG  1229
             GL+NSG  FLW      V+   +  G  ++P E+  G + R  +V+W  Q+EVLAH +VG
Sbjct  293   GLVNSGHPFLW------VMRSDITSGDHQIPAELEKGTKERGYIVDWVSQEEVLAHKSVG  346

Query  1230  GFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMV  1409
             GFLTH GWNS +ESIVAG+PMI WP   D  + SR +   WKIGL + + CDR  IE MV
Sbjct  347   GFLTHSGWNSTLESIVAGLPMICWPNLGDHYIISRTVCRQWKIGLQLNENCDRSNIESMV  406

Query  1410  RDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             + LM  +++E        +  A++   EGGSS ++LE LIE I+ +
Sbjct  407   QTLMGPKREEIQSSMDAISKLARDSVAEGGSSHNNLEQLIEYIRNL  452



>ref|XP_009594030.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=380

 Score =   314 bits (805),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 230/373 (62%), Gaps = 5/373 (1%)
 Frame = +3

Query  432   VVTSGGEDSAPQRCIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGE  611
             ++ SG ++  P  C+I D  + + VD+  E+GVP+I F  +S +  W Y  +  LI++GE
Sbjct  1     MLRSGAKE--PVTCVIPDALSYYVVDIGNEMGVPVIPFDTISPSCVWVYLCLSKLIESGE  58

Query  612   LPFNGKDMDEPILSVKGMEKLLRRRDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIIN  788
             LPF   D+D  +  +  ME LLRRRDLP  C +D   DP F   + +  +  ++   I+N
Sbjct  59    LPFKDNDLDASVTHIPAMEGLLRRRDLPHFCLMDYKTDPNFLAALKQIERIPQSHGLILN  118

Query  789   SFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWL  968
             +F++L+ S L  +R       YAIGP+H  L+ KL S N      SN L E+    + WL
Sbjct  119   TFEDLDRSFLSCIR-SYSPKTYAIGPVHLHLKAKLASKNTPSLPFSNSLWEEDHSSIKWL  177

Query  969   DRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTE  1148
             D QP  SV+YV FG+  ++S++ + EF HGL+NS  +FLW + P ++   K +  +   E
Sbjct  178   DAQPMGSVIYVSFGSAVVLSKKEILEFRHGLLNSKVKFLWVMRPNILKGGKSDV-QFMKE  236

Query  1149  ILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVN  1328
             +  G +G   VV WAPQ+ VLAH ++ GFLTH GWNS +ES++ G PMI WP Y DQ+V 
Sbjct  237   LAEGCKGNGYVVSWAPQKMVLAHPSISGFLTHSGWNSTLESVIEGKPMICWPQYVDQRVT  296

Query  1329  SRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSI  1508
             SR + E+W+IGLDMKD CDR  IE+ ++DLME ++DEF +  ++ +  AK    EGGSS 
Sbjct  297   SRLVNELWQIGLDMKDMCDRSTIERTIKDLMETKRDEFKKSIEELSKLAKLSIGEGGSSY  356

Query  1509  SSLENLIEDIKRM  1547
             ++L+ LI DIK +
Sbjct  357   NNLDCLIHDIKEL  369



>ref|XP_003522179.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Glycine max]
 gb|KHN15665.1| UDP-glycosyltransferase 85A7 [Glycine soja]
Length=482

 Score =   315 bits (808),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 182/474 (38%), Positives = 271/474 (57%), Gaps = 19/474 (4%)
 Frame = +3

Query  147   AYPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
              +P   HI  M NL +LL     ++TF+ T H  N LL F+D+ S    +  F F T+ D
Sbjct  15    TFPAEGHIKPMFNLTKLLSQKGHRITFVNTRHNHNRLLQFTDLPSFHTQFPNFNFATVND  74

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS---APQRCIIADGF-A  494
             G+P G    H  +   ++    S S  A  F +  +++S  E      P  C+I DG  +
Sbjct  75    GVPDG----HPPNDFSVMVSPASRSKVALEFRE--LLSSLVEKRCLWGPPSCMIVDGMMS  128

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEK  671
               A+D AEE G+P+++F   SA  TW    I  +I+   +   + +D+D+ + S+ G+E 
Sbjct  129   TIAMDAAEEFGIPVLTFRTYSATCTWVTIHISKVIREEAVDMQDPEDIDKVLSSIPGLEN  188

Query  672   LLRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             LLR RDLP   R+    +    ++ E     R    I+N+F +LE   +  M       V
Sbjct  189   LLRDRDLPSVFRLKPGSNGLEFYIKETLAMTRASGLILNTFDQLEAPII-TMLSTIFPKV  247

Query  852   YAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSE  1031
             Y IGPLH L++ ++ +     ++SS  L ++ K C+ WL+ Q   SVLYV FGT+  +S 
Sbjct  248   YTIGPLHTLIKTQITNN----SSSSLHLRKEDKICITWLNHQKEKSVLYVSFGTVVKLSH  303

Query  1032  ETLAEFWHGLMNSGQRFLWALNPRLVLNKK--VERGEVPTEILNGLEGRCCVVEWAPQQE  1205
             E L EFWHGL+NS + FLW +  R ++N++  +E   VP E+  G + R  +V+WAPQ+E
Sbjct  304   EQLLEFWHGLVNSMKPFLWVMR-RDLINREGIMENINVPIELELGTKERGLLVDWAPQEE  362

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VLAH +VGGFLTHCGWNSI+E IV GVPM+ WP  ADQ VN+R + E W IG+D+  T D
Sbjct  363   VLAHPSVGGFLTHCGWNSILECIVEGVPMLCWPLMADQTVNNRCVSEQWGIGIDIDGTYD  422

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R +IE MV++++E + +   +   + A  A++  KE GSS  ++E +IEDI  M
Sbjct  423   RLVIENMVKNVLENQIEGLKRSVDEIAKKARDSIKETGSSYHNIEKMIEDIMSM  476



>ref|XP_003560193.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=478

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 187/483 (39%), Positives = 264/483 (55%), Gaps = 42/483 (9%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             +P   HI+SML+ A  L  + L VTF   VH  +NL       +  R     RF ++PDG
Sbjct  12    WPLQGHINSMLHFAAALVGAGLHVTF---VHTEHNLRRVDPAAASPR----LRFTSVPDG  64

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT-----------SGGEDSAPQRCI  476
             LP    DDH  S   +  +  SL  T     + ++ +           + G    P  C+
Sbjct  65    LP----DDHPRSVGDLKDVAKSLMTTGPAVYRALLASLLPASTHADADADGRGFPPVSCV  120

Query  477   IADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-GKDMDEPILS  653
             +ADG   FA+D+AEE+GVP ++F   SA +  AYFS+  L++ GE+PF  G D+DEP+  
Sbjct  121   VADGLLPFAIDIAEELGVPALAFRTASACSVLAYFSMARLMELGEVPFPVGADLDEPVRG  180

Query  654   VKGMEKLLRRRDLPGNCR--VDDLE-DPFFKFMMEF--RKCFRTKHHIINSFQELEGSTL  818
             V GME  LRRRDLP +CR   D  E DP  + +++F    C + +  I N+   LEG+ +
Sbjct  181   VPGMEDFLRRRDLPSSCRRHADTHEVDPLLQLLVKFTLHSC-KARALIFNTAASLEGAAV  239

Query  819   DQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLY  998
               +    M +V+AIGPLH +        +V     +  L  +   C+ WLD     SV+Y
Sbjct  240   AHI-APHMRDVFAIGPLHAM--------SVAAPAPAASLWREDDGCVAWLDGHADRSVVY  290

Query  999   VCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCC  1178
             V  G+L ++S E   EF  GL+N+G  FLW L P +V   +    +   E   GL G+  
Sbjct  291   VSLGSLAVISLEQFTEFLSGLVNAGYAFLWVLRPGMVGASQSAVLQEAVEA-AGL-GKAR  348

Query  1179  VVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKI  1358
             VV+WAPQ++VL H AVG FLT+ GWNS +E++V  VPM+ WPF+ADQQ+NSRF+G VW  
Sbjct  349   VVDWAPQRDVLRHRAVGCFLTNTGWNSTLEAVVEAVPMVCWPFFADQQINSRFVGAVWGT  408

Query  1359  GLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             GLDMKD C+R ++E MVR+ ME         A+  A   +    +GGSS    E L+  I
Sbjct  409   GLDMKDVCERAVMEGMVREAME--SGGLRMSAQALAQEVRRDIAQGGSSALEFERLVGFI  466

Query  1539  KRM  1547
             K +
Sbjct  467   KEL  469



>ref|NP_001148991.1| cytokinin-O-glucosyltransferase 2 [Zea mays]
 gb|ACG33743.1| cytokinin-O-glucosyltransferase 2 [Zea mays]
Length=480

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 190/477 (40%), Positives = 261/477 (55%), Gaps = 32/477 (7%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSG-FRFETI  320
             +P P+  H++S L+ +  L  + L VTF+ T H   NL       +     S   RF ++
Sbjct  12    FPAPAQGHLNSFLHFSTGLLRAGLHVTFLHTDH---NLRRLGTAAAEATVASPRLRFLSV  68

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT--SGGEDSAPQRCIIADGFA  494
             PDGLP    DD   +  G+ +L+ SL   A    + ++ +  +GG    P  C++ADG  
Sbjct  69    PDGLP----DDDPRTVDGLPELMESLRTKASASYRALLASLRAGGGGFPPVTCVVADGIM  124

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEK  671
              F VDVAEE+GVP ISF  VSA A  AY S+P LI  GELPF  G D+D PI  V GME 
Sbjct  125   PFVVDVAEELGVPAISFRTVSACAVLAYLSVPKLIALGELPFPKGGDLDAPIRGVPGMES  184

Query  672   LLRRRDLPGNCR--VDDLEDPFFKFMMEF--RKCFRTKHHIINSFQELEGSTLDQMRIGD  839
              LRRRDLP   R      E+P    ++      C + +  I+N+   LE S+L  +   +
Sbjct  185   FLRRRDLPIQFRQLTSTYEEPLVAAVVAATVHSCCKARALIVNTTTSLERSSLGHL-TQE  243

Query  840   MLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLD-RQPPNSVLYVCFGTL  1016
             M +V+A+GPLH +              SS    +DG  CM WLD +Q   +V+Y+  G+L
Sbjct  244   MRDVFAVGPLHAM-------SPAPAVASSLWRPDDG--CMAWLDNQQAERAVVYISLGSL  294

Query  1017  TLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAP  1196
              ++S E   EF HGL+ +G  FLW L P +++    +   +   I    + R CVV W P
Sbjct  295   AVISHEQFTEFLHGLVATGYPFLWVLRPDMLVAS--QDAALREAIGAVGKDRACVVXWVP  352

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q++VL H AVG FLTH GWNS ME IV GVPM+ WPF+ADQQ+NSRF+G VW+ GLDMKD
Sbjct  353   QRDVLRHRAVGCFLTHSGWNSTMEGIVEGVPMVCWPFFADQQINSRFVGAVWRNGLDMKD  412

Query  1377  TCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              CDR ++E  VR+ ME   +E  +     A   K    + G+S    + LI  I  +
Sbjct  413   VCDRVVVESTVREAME--SEEIRRSVHALAEQVKRDVADDGASALEFKRLISFITEL  467



>gb|ACF88457.1| unknown [Zea mays]
 tpg|DAA40852.1| TPA: cytokinin-O-glucosyltransferase 2 [Zea mays]
Length=480

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 190/477 (40%), Positives = 262/477 (55%), Gaps = 32/477 (7%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSG-FRFETI  320
             +P P+  H++S L+ +  L  + L VTF+ T H   NL       +     S   RF ++
Sbjct  12    FPAPAQGHLNSFLHFSTGLLRAGLHVTFLHTDH---NLRRLGTAAAEATVASPRLRFLSV  68

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT--SGGEDSAPQRCIIADGFA  494
             PDGLP    DD   +  G+ +L+ SL   A    + ++ +  +GG    P  C++ADG  
Sbjct  69    PDGLP----DDDPRTVDGLPELMESLRTKASASYRALLASLRAGGGGFPPVTCVVADGIM  124

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEK  671
              F VDVAEE+GVP ISF  VSA A  AY S+P LI  GELPF  G D+D PI  V GME 
Sbjct  125   PFVVDVAEELGVPAISFRTVSACAVLAYLSVPKLIALGELPFPEGGDLDAPIRGVPGMES  184

Query  672   LLRRRDLPGNCR--VDDLEDPFFKFMMEF--RKCFRTKHHIINSFQELEGSTLDQMRIGD  839
              LRRRDLP   R      E+P    ++      C + +  I+N+   LE S+L  +   +
Sbjct  185   FLRRRDLPIQFRQLTSTYEEPLVAAVVAATVHSCCKARALIVNTTTSLERSSLGHL-TQE  243

Query  840   MLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLD-RQPPNSVLYVCFGTL  1016
             M +V+A+GPLH +              SS    +DG  CM WLD +Q   +V+Y+  G+L
Sbjct  244   MRDVFAVGPLHAM-------SPAPAVASSLWRPDDG--CMAWLDNQQAERAVVYISLGSL  294

Query  1017  TLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAP  1196
              ++S E   EF HGL+ +G  FLW L P +++    +   +   I    + R CVV W P
Sbjct  295   AVISHEQFTEFLHGLVATGYPFLWVLRPDMLVAS--QDAALREAIGAVGKDRACVVPWVP  352

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q++VL H AVG FLTH GWNS +E IV GVPM+ WPF+ADQQ+NSRF+G VW+ GLDMKD
Sbjct  353   QRDVLRHRAVGCFLTHSGWNSTIEGIVEGVPMVCWPFFADQQINSRFVGAVWRNGLDMKD  412

Query  1377  TCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              CDR ++E  VR+ ME   +E  + A   A   K    + G+S    + LI  I  +
Sbjct  413   VCDRVVVESTVREAME--SEEIRRSAHALAEQVKRDVADDGASALEFKRLISFITEL  467



>ref|XP_007133982.1| hypothetical protein PHAVU_010G009000g [Phaseolus vulgaris]
 gb|ESW05976.1| hypothetical protein PHAVU_010G009000g [Phaseolus vulgaris]
Length=484

 Score =   312 bits (799),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 189/474 (40%), Positives = 265/474 (56%), Gaps = 18/474 (4%)
 Frame = +3

Query  147   AYPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
             A PFP+  HI  M  L +LLC    ++TF+ T H  N LL  +D+ S    +  FRF  +
Sbjct  13    ALPFPAEGHIKPMFYLTKLLCHKGHRITFVNTQHIHNRLLQHTDLPSFNSDFPDFRFTFV  72

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPF---LKEIVVTSGGEDSAPQRCIIADGF  491
              DG+PH L  D  S  +       S S  A+ F   L+ +V      +  P  CIIADG 
Sbjct  73    ADGVPHDLAPDDFSVTISPT----SRSRVAEEFGEMLRGLV--ENPSEWGPPSCIIADGI  126

Query  492   -ANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGM  665
              +  A+D A+EVGVP+I+F   SA ATW    +  ++  G +   + +D+ + + S+ G+
Sbjct  127   MSTIAMDAAQEVGVPVIAFRTYSATATWVTIHVIKVLHEGLMDMQDPEDVHKVVSSIPGL  186

Query  666   EKLLRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
             E LLR  DLP   ++         FM E++   R    I+N+F ELE  T+ ++      
Sbjct  187   ENLLRDCDLPSVYKLKRGSLALEFFMKEYQTMTRASGLILNTFDELEAPTITKLTTV-FP  245

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
              VY IGPLH  L+N++ + N +L   S  +    + C+ WLD Q   SVLYV FGT+  +
Sbjct  246   RVYTIGPLHTHLKNQV-TQNPSL---SLNVRTQDRSCITWLDHQRAKSVLYVSFGTVVKL  301

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQE  1205
             SEE L EFWHGL+NS + FLW +   L+  K      V  E+  G + R  +VEWAPQ+E
Sbjct  302   SEEQLLEFWHGLVNSLKPFLWVIRKELMDGKAGFGNNVAKELELGTKERGLLVEWAPQEE  361

Query  1206  VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCD  1385
             VLA  AVGGFLTHCGWNS +E I  GVPM+   F  DQ +NSR + E W IG+ +    D
Sbjct  362   VLAQPAVGGFLTHCGWNSTLECIGEGVPMLCVLFMVDQTINSRCVSEQWGIGVGIDGIFD  421

Query  1386  RHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             R IIEKMV+D++E R +     A Q A  A++  K+ GSS  ++E++I+DI  M
Sbjct  422   RLIIEKMVKDVLENRIEGLRNSADQIAKQARDSIKQTGSSSRNIESMIKDILSM  475



>ref|NP_001175205.1| Os07g0489200 [Oryza sativa Japonica Group]
 dbj|BAC84378.1| putative UDP-glucose glucosyltransferase [Oryza sativa Japonica 
Group]
 gb|EAZ39845.1| hypothetical protein OsJ_24285 [Oryza sativa Japonica Group]
 dbj|BAH93933.1| Os07g0489200 [Oryza sativa Japonica Group]
Length=482

 Score =   311 bits (798),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 181/475 (38%), Positives = 263/475 (55%), Gaps = 25/475 (5%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             +P   HI+ ML+ A  L  + L VTF+ + H         D           R+ +IPDG
Sbjct  11    WPVQGHINCMLHFATGLLRAGLHVTFLHSDHTLPAAGDDDDDALAAASPR-LRYASIPDG  69

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS-APQRCIIADGFANFAV  506
             LP G    H  + V +++ + + S+  +  L E+    G      P  C++ADG   FAV
Sbjct  70    LPDG-HPRHAGAAVRLMESVQTQSSAYRSLLAELARGDGDGGGFPPVTCVVADGLLPFAV  128

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEKLLRR  683
             DVAEE+GVP +SF   SA +  AY S+P L + GELPF  G D+DEP+  V GME  LRR
Sbjct  129   DVAEELGVPALSFRTASACSFLAYLSVPRLFELGELPFPAGGDLDEPVRGVPGMESFLRR  188

Query  684   RDLPGNCR--VDDLEDPFFKFMMEFRKCFRTKHH---IINSFQELEGSTLDQMRIGDMLN  848
             RDLPG CR   +   DP  + +++F    R++H    ++N+   +E + LD +   +M +
Sbjct  189   RDLPGQCRNCTELQNDPLLEMVIDFTA--RSRHARALVLNTAASMERAALDHI-ARNMRD  245

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             V+A+GPLH +              +S    +DG  CM WLD Q   SV+YV  G+LT++S
Sbjct  246   VFAVGPLHVMSPAP------AAALASQWREDDG--CMAWLDGQADRSVVYVSLGSLTVIS  297

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEG--RCCVVEWAPQQ  1202
              E   EF  GL+ +G  FLW L P +V   +++  ++   ++    G  +  VV WAPQ+
Sbjct  298   PEQFTEFLSGLVAAGHPFLWVLRPDMV-TARLQHADLQEAVVAAAAGDSKARVVRWAPQR  356

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             +VL H AVG FLTH GWNS +E+ V GVP + WPF+ DQQ+NSR +G VW+ GLDMKD C
Sbjct  357   DVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFVDQQINSRLVGAVWRTGLDMKDVC  416

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             D  ++ +MVR+ ME    E    A+  +        +GGSS +  + LI  I+++
Sbjct  417   DAAVLARMVREAME--SGEIRASAQALSQQLGRDVADGGSSATEFKRLIAFIEQL  469



>dbj|BAC57706.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
Length=485

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 183/470 (39%), Positives = 256/470 (54%), Gaps = 33/470 (7%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI  ML+ A  L  + L VTF+   H+ +NL   +   S        R+ +IPDGL
Sbjct  18    PVHGHITCMLHFATGLLAAGLHVTFL---HSDHNLRRAAAASS-----PRLRYVSIPDGL  69

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATA----KPFLKEIVVTSGGEDSAPQRCIIADGFANF  500
             P    +  R  G  IV+L+ SL   A    +  L  +++        P  C++ADG  +F
Sbjct  70    P---VEHPRDVG-RIVELMESLKTKASVAYRSLLASLLLGDATGGFPPVTCVVADGIMSF  125

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEKLL  677
             AVDVAEE+G+P ++F   SA +  AY S+P L++ GELPF +G D+DEP+  V GME  L
Sbjct  126   AVDVAEELGIPALAFRTDSACSFLAYLSLPRLLELGELPFKDGDDLDEPVRGVPGMESFL  185

Query  678   RRRDLPGNCR--VDDLEDPFFKFMMEFRK-CFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
             RRRDLP  CR   D   DP  + +  F       +  ++N+   +E + L  +    M +
Sbjct  186   RRRDLPSQCRDCSDPDNDPLLQIVYGFTAHSGNARALVLNTAASMERAALAHI-APHMRD  244

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             V+AIGPLH +        + T   +   L  +   C+ WLD Q   SV+YV  G+LT++S
Sbjct  245   VFAIGPLHAM--------SPTAPAAGGSLWREDDGCLAWLDGQADGSVVYVSLGSLTVIS  296

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E   EF HGL+ +G  FLW L P +V   +              + R  VVEWAPQ+ V
Sbjct  297   LEQFTEFLHGLVAAGYPFLWVLRPDMVGASQSAALREAVAAAGKSKAR--VVEWAPQRGV  354

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             L H AVG FLTH GWNS +E+ V GVPM+ WPF+ DQQ+NSRF+G VW+ GLDMKD CD 
Sbjct  355   LRHRAVGCFLTHAGWNSTLEAAVEGVPMVCWPFFTDQQINSRFVGGVWRTGLDMKDVCDA  414

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
              ++ +MVR+ ME    +    A+  A   +    +GGSS +  + L+E I
Sbjct  415   AVVARMVREAME--SGQIRASAQALAREVRRDVADGGSSTAEFKRLVEFI  462



>ref|NP_001059664.1| Os07g0486700 [Oryza sativa Japonica Group]
 dbj|BAF21578.1| Os07g0486700 [Oryza sativa Japonica Group]
Length=492

 Score =   311 bits (796),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 183/470 (39%), Positives = 256/470 (54%), Gaps = 33/470 (7%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI  ML+ A  L  + L VTF+   H+ +NL   +   S        R+ +IPDGL
Sbjct  18    PVHGHITCMLHFATGLLAAGLHVTFL---HSDHNLRRAAAASS-----PRLRYVSIPDGL  69

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATA----KPFLKEIVVTSGGEDSAPQRCIIADGFANF  500
             P    +  R  G  IV+L+ SL   A    +  L  +++        P  C++ADG  +F
Sbjct  70    P---VEHPRDVG-RIVELMESLKTKASVAYRSLLASLLLGDATGGFPPVTCVVADGIMSF  125

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEKLL  677
             AVDVAEE+G+P ++F   SA +  AY S+P L++ GELPF +G D+DEP+  V GME  L
Sbjct  126   AVDVAEELGIPALAFRTDSACSFLAYLSLPRLLELGELPFKDGDDLDEPVRGVPGMESFL  185

Query  678   RRRDLPGNCR--VDDLEDPFFKFMMEFRK-CFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
             RRRDLP  CR   D   DP  + +  F       +  ++N+   +E + L  +    M +
Sbjct  186   RRRDLPSQCRDCSDPDNDPLLQIVYGFTAHSGNARALVLNTAASMERAALAHI-APHMRD  244

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             V+AIGPLH +        + T   +   L  +   C+ WLD Q   SV+YV  G+LT++S
Sbjct  245   VFAIGPLHAM--------SPTAPAAGGSLWREDDGCLAWLDGQADGSVVYVSLGSLTVIS  296

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
              E   EF HGL+ +G  FLW L P +V   +              + R  VVEWAPQ+ V
Sbjct  297   LEQFTEFLHGLVAAGYPFLWVLRPDMVGASQSAALREAVAAAGKSKAR--VVEWAPQRGV  354

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             L H AVG FLTH GWNS +E+ V GVPM+ WPF+ DQQ+NSRF+G VW+ GLDMKD CD 
Sbjct  355   LRHRAVGCFLTHAGWNSTLEAAVEGVPMVCWPFFTDQQINSRFVGGVWRTGLDMKDVCDA  414

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
              ++ +MVR+ ME    +    A+  A   +    +GGSS +  + L+E I
Sbjct  415   AVVARMVREAME--SGQIRASAQALAREVRRDVADGGSSTAEFKRLVEFI  462



>gb|EAZ03904.1| hypothetical protein OsI_26038 [Oryza sativa Indica Group]
Length=498

 Score =   311 bits (796),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 183/484 (38%), Positives = 259/484 (54%), Gaps = 38/484 (8%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  HI+ M++ A  L  + L VTF+ +   R+         +        RF +IP
Sbjct  13    FPFPAQGHINCMMHFATGLLGAGLHVTFLHS--DRSLRRLGGAAAALAAGSPRLRFLSIP  70

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS---GGEDSA------PQRCI  476
             DGLP    DDH  +   +++ + S+        + +++ S    G+D +      P  C+
Sbjct  71    DGLP----DDHARAAGDLLEHMESIRTKGSVAYRRVLLASLVRAGDDGSTGVQFPPVTCV  126

Query  477   IADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILS  653
             +ADG    A+D+AEE+GVP + F  VSA +  AY SIP L + GELPF  G D+DEP+  
Sbjct  127   VADGIMPLAIDIAEEIGVPALGFRTVSACSFLAYLSIPRLFELGELPFPAGGDLDEPVRG  186

Query  654   VKGMEKLLRRRDLPGNCRV----DDLEDPFFKFMMEFRKCFR-TKHHIINSFQELEGSTL  818
             V GME  LRRRDLP  CR     +   DP  + + E     R  +  ++N+   +EG  L
Sbjct  187   VPGMETFLRRRDLPSFCRGGGGGESQNDPMLQTVNEVTAHSRKARALVLNTSASMEGPAL  246

Query  819   DQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLY  998
               +    M +V+AIGPLH +              ++  L      CM WLD QP  SV+Y
Sbjct  247   AHI-APHMRDVFAIGPLHTMF---------PAPAAAGSLWRADDGCMAWLDGQPDRSVVY  296

Query  999   VCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCC  1178
             V  G+ T++S E   EF HGL+ +G  FLW L P +V   +              + R  
Sbjct  297   VSLGSFTVISLEQFTEFLHGLVAAGHAFLWVLRPDMVGASQSAALREAAAAAG--DSRAR  354

Query  1179  VVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKI  1358
             VVEWAPQ +VL H AVG FLTH GWNS +E+   GVP + WPF+ADQQ+NSRF+G VW+ 
Sbjct  355   VVEWAPQLDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQINSRFVGGVWRT  414

Query  1359  GLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANS-AKECAKEGGSSISSLENLIED  1535
             GLDMKD CD  ++E+MVR+ ME    E    A+  A    ++ A +GGSS +  + L+  
Sbjct  415   GLDMKDVCDAAVVERMVREAME--SAEIRASAQALARQLRRDIADDGGSSAAEFQRLVGF  472

Query  1536  IKRM  1547
             IK +
Sbjct  473   IKEL  476



>ref|XP_007133898.1| hypothetical protein PHAVU_010G001300g [Phaseolus vulgaris]
 gb|ESW05892.1| hypothetical protein PHAVU_010G001300g [Phaseolus vulgaris]
Length=484

 Score =   310 bits (794),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 184/473 (39%), Positives = 264/473 (56%), Gaps = 16/473 (3%)
 Frame = +3

Query  147   AYPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
             A PFP+  HI  M  L +LLC    ++TF+ T H  N LL  +D+ S    +  FRF  +
Sbjct  13    ALPFPAEGHIKPMFYLTKLLCHKGHRITFVNTQHIHNRLLQHTDLPSFHADFPDFRFTFV  72

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIV--VTSGGEDSAPQRCIIADGF-  491
              DG+PH L  +  S    ++    S S  A+ F +E++  +        P  CIIADG  
Sbjct  73    ADGVPHDLAPNDFS----VIVSPSSRSRVAEEF-REMLRGLVENPPPWGPPSCIIADGMM  127

Query  492   ANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGME  668
             +  A+D A+E+GVP+I+F   SA ATW    +  +++ G +   N +D+ + + S+ G+E
Sbjct  128   STIAMDAAQELGVPVIAFRTYSATATWVTIHVSKVLEEGVMDMQNPEDVHKVVSSIPGLE  187

Query  669   KLLRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLN  848
              LLR  DLP   ++         FM E     R    I+N+F ELE  T+  +       
Sbjct  188   NLLRDCDLPNVFKMKRGSSGLDFFMKETLTMTRASALILNTFDELEAPTITNLTTV-FPR  246

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             VY IGPLH  L+N++ + N +L+ +   +    + C+ WLD Q   SVLYV FGT+  +S
Sbjct  247   VYTIGPLHTHLKNQV-TQNPSLSLN---VRTQDRSCITWLDHQRAKSVLYVSFGTVVKLS  302

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEV  1208
             EE L EFWHGL+NS + FLW +   L+  K      V  E+  G   R  +VEWAPQ+ V
Sbjct  303   EEQLLEFWHGLVNSLKPFLWVVRKDLMNGKGGFGDNVAEELELGTRERGLLVEWAPQEGV  362

Query  1209  LAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDR  1388
             LAH AVGGFLTHCGWNS +E I  GVPM+ WPF  DQ VN R + E W IG+ +    DR
Sbjct  363   LAHPAVGGFLTHCGWNSTLECIGEGVPMLCWPFMVDQTVNGRCVSEQWGIGVGIDGNFDR  422

Query  1389  HIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
              +IEKMV+D++E R +       + A  A++  K+ GSS  ++E++I+D+  M
Sbjct  423   LVIEKMVKDVLENRIEGLRNSVDEIAKHARDSVKQTGSSSRNIESMIKDMMTM  475



>gb|EAZ39840.1| hypothetical protein OsJ_24281 [Oryza sativa Japonica Group]
Length=486

 Score =   310 bits (793),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 185/482 (38%), Positives = 257/482 (53%), Gaps = 35/482 (7%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P   HI+ M++ A  L  + L VTF+ T H+   L C +            RF +IP
Sbjct  13    FPAPGQGHINCMMHFATGLVGAGLHVTFLHTDHSLRRLGCAAAAGGADSPR--LRFMSIP  70

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT--SGGEDSA------PQRCII  479
             DGLP    DDH  +   IV+LL SL        + ++ +    G+D A      P  C++
Sbjct  71    DGLP----DDHPRAVGDIVELLESLRTNGSVPYRSLLASLVRAGDDGASSGGFPPVTCVV  126

Query  480   ADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGEL---PFNGKDMDEPIL  650
             ADG   FA DVAEE+GVP + F   SA +  AY S+  L + GE+   P +G D+DEP+ 
Sbjct  127   ADGSMPFAADVAEEIGVPSLVFRTASACSVLAYLSVDRLFELGEVVLFPADG-DLDEPVR  185

Query  651   SVKGMEKLLRRRDLPGNCR--VDDLEDPFFKFMMEFRKCFR-TKHHIINSFQELEGSTLD  821
              V GME  LRRRDLPGN R   +D  DP  + ++E     R  +  ++N+   +EG  L 
Sbjct  186   GVPGMESFLRRRDLPGNFRNCTEDQNDPIVQMLIEVTAHSRGARAVVLNTAASMEGPALA  245

Query  822   QMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYV  1001
              +    M +V+AIGPLH +           +  ++  L      C+ WLD QP  SV+YV
Sbjct  246   HV-APRMRDVFAIGPLHAMF---------PVPAAAGSLWRADDGCVAWLDGQPDRSVVYV  295

Query  1002  CFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCV  1181
               G+  ++S E   EF HGL+ +G  FLW L P +V   +                +  V
Sbjct  296   SLGSFAVISLEQFTEFLHGLVAAGYPFLWVLRPDMVGASQSAGALREAVAAAEKNNKARV  355

Query  1182  VEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIG  1361
             V WAPQ++VL H AVG FLTH GWNS +E+   GVP + WPF+ADQQ+NSRF+G VW  G
Sbjct  356   VGWAPQRDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQINSRFVGAVWGTG  415

Query  1362  LDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             LDMKD CD  ++E+MVR+ ME    E    A+  A   ++   +GGSS +  E L+  IK
Sbjct  416   LDMKDVCDAAVVERMVREAME--SGEIRASAQALAREVRQDVADGGSSAAEFERLVGFIK  473

Query  1542  RM  1547
              +
Sbjct  474   EL  475



>ref|XP_003520949.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Glycine max]
Length=477

 Score =   309 bits (791),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 184/480 (38%), Positives = 263/480 (55%), Gaps = 30/480 (6%)
 Frame = +3

Query  147   AYPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
             A PFP+  HI  M NLA+LL     ++TF+ T H  N LL F+D+ S    +  F F +I
Sbjct  11    AIPFPAEGHIKPMFNLAKLLSHRSHRITFVNTHHNHNRLLQFTDLPSFHTQFPDFHFASI  70

Query  321   PDGLPHGLTDDHRSSG-VGIVQLLHSLSA---TAKPF--LKEIVVTSGGEDSAPQRCIIA  482
              DG+P   +D+ R    +  + +L + SA    AK F  L   ++   G+      CII 
Sbjct  71    TDGIP---SDNPRKGALINYLPMLITPSARSLVAKEFRELFSRLLEKNGDQWQQPSCIIV  127

Query  483   DGF-ANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF----NGKDMDEPI  647
             DG  +   + VA+E  +P+I+F   SA  TW    +  L + G        + +++    
Sbjct  128   DGLMSTIVMGVAQEFRIPVIAFRTYSATCTWVTIFMSKLAKEGAQQLRSNQDAENLKSAS  187

Query  648   LSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQM  827
              ++ G+E LLR  DLP +    D          E     +    I+N+F++LE S + ++
Sbjct  188   ANIPGLENLLRNCDLPPDSGTRDF------IFEETLAMTQASAIILNTFEQLEPSIITKL  241

Query  828   RIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCF  1007
                    VY+IGPLH L +  + + + +       L ++ + C+ WLD Q   SVLYV F
Sbjct  242   AT-IFPKVYSIGPLHTLCKTMITTNSTSSPHKDGRLRKEDRSCITWLDHQKAKSVLYVSF  300

Query  1008  GTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVE  1187
             GT+  +S E L EFWHGL+NS + FLW +   L++ K V     P E+  G + R  +V 
Sbjct  301   GTVVNLSYEQLMEFWHGLVNSLKPFLWVIQKELIIQKNV-----PIELEIGTKERGFLVN  355

Query  1188  WAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLD  1367
             WAPQ+EVLA+ AVGGFLTHCGWNS +ESI  GVPM+ WP   DQ VNSR + E WKIGL+
Sbjct  356   WAPQEEVLANPAVGGFLTHCGWNSTLESIAEGVPMLCWPSITDQTVNSRCVSEQWKIGLN  415

Query  1368  MKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             M  +CDR ++E MVRD+ME   ++ ++ A   A  A    KE GSS  +LENLI+DI  M
Sbjct  416   MNGSCDRFVVENMVRDIME--NEDLMRSANDVAKKALHGIKENGSSYHNLENLIKDISLM  473



>ref|XP_004173134.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 85A1-like, 
partial [Cucumis sativus]
Length=308

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 203/306 (66%), Gaps = 6/306 (2%)
 Frame = +3

Query  627   KDMDEPILSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQEL  803
             +DMD  I ++ GME LLR RDLPG CRV D  D   ++ + + +  ++    I+NSF++L
Sbjct  2     EDMDRMITNLPGMENLLRCRDLPGLCRVTDTNDSVLQYTLKQTQGSYQFHALILNSFEDL  61

Query  804   EGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPP  983
             EG  L ++R     N+Y IGPLH LL+ KL       T S N L E  + C+ WLD QPP
Sbjct  62    EGPILSKIRTNLCPNLYTIGPLHSLLKTKLSH----ETESLNNLWEVDRTCLAWLDNQPP  117

Query  984   NSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGL  1163
              SV+YV FG++T++  E L EFWHGL+NSG+ FLW + P LV  K  E  E+P ++  G 
Sbjct  118   GSVIYVSFGSITVMGNEGLMEFWHGLVNSGRNFLWVIRPDLVSGKNGEI-EIPADLEEGT  176

Query  1164  EGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLG  1343
             + R  VV WAPQ++VL+H AVGGFLTH GWNS +ESIVAG  M+ WP+ ADQQVNSRF+ 
Sbjct  177   KQRGYVVGWAPQEKVLSHEAVGGFLTHSGWNSTLESIVAGKAMVCWPYTADQQVNSRFVS  236

Query  1344  EVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLEN  1523
              VWK+G+DMKD CDR I+ KMV ++M  RK+EF + A + AN A+     GGSS +  + 
Sbjct  237   NVWKLGVDMKDMCDREIVAKMVNEVMVNRKEEFKRSAIEMANLARRSVSLGGSSYADFDR  296

Query  1524  LIEDIK  1541
             L+ +I+
Sbjct  297   LVNEIR  302



>gb|EMT06489.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=461

 Score =   307 bits (787),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 183/470 (39%), Positives = 254/470 (54%), Gaps = 37/470 (8%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             +P   HI+ ML+L   L  +  +VTF+ T H  + L       +R     G R  ++PDG
Sbjct  12    WPLQGHINCMLHLTAALLDAGFRVTFLHTEHNLSRL-------ARAALPPGLRLLSVPDG  64

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT-SGGEDSAPQRCIIADGFANFAV  506
             LP    DDH  S   + +L  S+  T     + ++++     D+ P  C+IADG   FAV
Sbjct  65    LP----DDHPRSVRSLKELTESMFTTGSAAYRALLLSLRSDSDAPPLTCVIADGIMPFAV  120

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
             D+AEE+GVP ++F   SA +  AY S+P+L++ GE+PF     D+P+  V GME  LRRR
Sbjct  121   DIAEELGVPALAFRTASACSYLAYLSVPTLVELGEVPFPA---DDPVRGVPGMEGFLRRR  177

Query  687   DLP-GNCRVDDLE-DPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
             DLP G  R +D   DP    + E      + +  I+N+   +EG  L ++    M +++A
Sbjct  178   DLPRGVGRSEDGAFDPMLLAIAEGIAHAGKARALILNTAASMEGPALARI-APHMRDLFA  236

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IGPLH                ++  L  +   CM WLD     SV+YV  G+L ++S E 
Sbjct  237   IGPLH------------AEHDAAASLWSEDDSCMAWLDGHGDRSVVYVSLGSLAVISHEQ  284

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
               EF  GL+ +G  FLW L P +V       G V  E +     +  VVEWAPQ+ VL H
Sbjct  285   FTEFLAGLVATGYAFLWVLRPDMVKTT----GSVLREAVKEAGSKARVVEWAPQRGVLRH  340

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              AVG FLTH GWNS +E+   GVPM+ WPF+ADQQ+NSRF+G VW+ GLDMKD C+R I+
Sbjct  341   RAVGCFLTHGGWNSTLEAAAEGVPMVCWPFFADQQINSRFVGAVWRTGLDMKDLCNRAIV  400

Query  1398  EKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +  VR+ ME    E   RA   A   K     GGSS S LE L+  I+ +
Sbjct  401   QGKVREAME--SGELRGRAHAMAQQLKLDVAVGGSSSSDLERLVGFIREL  448



>ref|XP_008467017.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
Length=304

 Score =   301 bits (772),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 202/304 (66%), Gaps = 7/304 (2%)
 Frame = +3

Query  633   MDEPILSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHHII-NSFQELEG  809
             MD  I ++ GME LLR RDLPG CRV D  D   +F ++  +     H +I NSF++LE 
Sbjct  1     MDRMITNLPGMENLLRCRDLPGFCRVTDTNDSVLQFNIKQTQRSNQFHALILNSFEDLEE  60

Query  810   STLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNS  989
               L ++R     N+YAIGPLH LLR KL       T + N L E  + C+ WLD QPP S
Sbjct  61    PILSKIRTL-WPNLYAIGPLHSLLRTKLSRE----TEALNNLWEVDRTCLAWLDNQPPGS  115

Query  990   VLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEG  1169
             V+YV FG++T++  E L EFWHGL+NSG+ FLW + P LV  K  E  E+P E+  G + 
Sbjct  116   VIYVSFGSITVMGNEGLMEFWHGLVNSGRNFLWVIRPDLVSGKNGEI-EIPAELEEGTKQ  174

Query  1170  RCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEV  1349
             R  VV WAPQ++VL+H AVGGFLTH GWNS +ESIVAG PM+ WP+ ADQQVNSRF+  V
Sbjct  175   RGYVVGWAPQEKVLSHEAVGGFLTHSGWNSTLESIVAGKPMVCWPYTADQQVNSRFVSNV  234

Query  1350  WKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLI  1529
             WK+G+DMKD CDR I+ KMV ++M  RK+EF++ A + AN A+     GGSS +  + L+
Sbjct  235   WKLGVDMKDLCDRDIVAKMVNEIMVNRKEEFMRTASEMANLARRSVSPGGSSYADFDRLV  294

Query  1530  EDIK  1541
              +I+
Sbjct  295   NEIR  298



>gb|EAZ03903.1| hypothetical protein OsI_26037 [Oryza sativa Indica Group]
Length=482

 Score =   307 bits (786),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 180/475 (38%), Positives = 261/475 (55%), Gaps = 25/475 (5%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             +P   HI+ ML+ A  L  + L VTF+ + H         D           R+ +IPDG
Sbjct  11    WPVQGHINCMLHFATGLLRAGLHVTFLHSDHTLPAASDDDDDALAAASPR-LRYASIPDG  69

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDS-APQRCIIADGFANFAV  506
             LP G    H  + V +++ + + S+     L E+    G      P  C++ADG   FAV
Sbjct  70    LPDG-HPRHAGAAVRLMESVQTQSSAYHSLLAELARGDGDGGGFPPVTCVVADGLLPFAV  128

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILSVKGMEKLLRR  683
             DVAEE+GVP +SF   SA +  AY S+P L + GELPF  G D+DEP+  V GME  LRR
Sbjct  129   DVAEELGVPALSFRTASACSFLAYLSVPRLFELGELPFPAGGDLDEPVRGVPGMESFLRR  188

Query  684   RDLPGNCR--VDDLEDPFFKFMMEFRKCFRTKHH---IINSFQELEGSTLDQMRIGDMLN  848
             RDLPG CR   +   DP  + +++F    R++H    ++N+   +E + LD +   +M +
Sbjct  189   RDLPGQCRNCTELQNDPLLEMVIDFTA--RSRHARALVLNTAASMERAALDHI-ARNMRD  245

Query  849   VYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVS  1028
             V+A+GPLH +              +S    +DG  CM WLD Q   SV+YV  G+LT++S
Sbjct  246   VFAVGPLHVMSPAP------AAALASQWREDDG--CMAWLDGQADRSVVYVSLGSLTVIS  297

Query  1029  EETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEG--RCCVVEWAPQQ  1202
              E   EF  GL+ +G  FLW L P +V   +++  ++   +     G  +  VV WAPQ+
Sbjct  298   PEQFTEFLSGLVAAGHPFLWVLRPDMV-TARLQHADLQEAVAAAAAGDSKARVVRWAPQR  356

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             +VL H AVG FLTH GWNS +E+ V GVP + WPF+ DQQ+NSR +G VW+ GLDMKD C
Sbjct  357   DVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFVDQQINSRLVGAVWRTGLDMKDVC  416

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             D  ++ +MVR+ ME    E    A+  +        +GGSS +  + L+  I+++
Sbjct  417   DAAVLARMVREAME--SGEIRASAQALSQQLGRDVADGGSSATEFKRLVAFIEQL  469



>ref|NP_001059665.1| Os07g0487100 [Oryza sativa Japonica Group]
 dbj|BAC57710.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
 dbj|BAC84366.1| putative UDP-glucose glucosyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF21579.1| Os07g0487100 [Oryza sativa Japonica Group]
Length=486

 Score =   307 bits (786),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 184/482 (38%), Positives = 256/482 (53%), Gaps = 35/482 (7%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P P   HI+ M++ A  L  + L VTF+ T H+   L   +            RF +IP
Sbjct  13    FPAPGQGHINCMMHFATGLVGAGLHVTFLHTDHSLRRLGGAAAAGGADSPR--LRFMSIP  70

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT--SGGEDSA------PQRCII  479
             DGLP    DDH  +   IV+LL SL        + ++ +    G+D A      P  C++
Sbjct  71    DGLP----DDHPRAVGDIVELLESLRTNGSVPYRSLLASLVRAGDDGASSGGFPPVTCVV  126

Query  480   ADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGEL---PFNGKDMDEPIL  650
             ADG   FA DVAEE+GVP + F   SA +  AY S+  L + GE+   P +G D+DEP+ 
Sbjct  127   ADGSMPFAADVAEEIGVPSLVFRTASACSVLAYLSVDRLFELGEVVLFPADG-DLDEPVR  185

Query  651   SVKGMEKLLRRRDLPGNCR--VDDLEDPFFKFMMEFRKCFR-TKHHIINSFQELEGSTLD  821
              V GME  LRRRDLPGN R   +D  DP  + ++E     R  +  ++N+   +EG  L 
Sbjct  186   GVPGMESFLRRRDLPGNFRNCTEDQNDPIVQMLIEVTAHSRGARAVVLNTAASMEGPALA  245

Query  822   QMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYV  1001
              +    M +V+AIGPLH +           +  ++  L      C+ WLD QP  SV+YV
Sbjct  246   HV-APRMRDVFAIGPLHAMF---------PVPAAAGSLWRADDGCVAWLDGQPDRSVVYV  295

Query  1002  CFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCV  1181
               G+  ++S E   EF HGL+ +G  FLW L P +V   +                +  V
Sbjct  296   SLGSFAVISLEQFTEFLHGLVAAGYPFLWVLRPDMVGASQSAGALREAVAAAEKNNKARV  355

Query  1182  VEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIG  1361
             V WAPQ++VL H AVG FLTH GWNS +E+   GVP + WPF+ADQQ+NSRF+G VW  G
Sbjct  356   VGWAPQRDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQINSRFVGAVWGTG  415

Query  1362  LDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             LDMKD CD  ++E+MVR+ ME    E    A+  A   ++   +GGSS +  E L+  IK
Sbjct  416   LDMKDVCDAAVVERMVREAME--SGEIRASAQALAREVRQDVADGGSSAAEFERLVGFIK  473

Query  1542  RM  1547
              +
Sbjct  474   EL  475



>ref|XP_004957723.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Setaria italica]
Length=483

 Score =   303 bits (777),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 180/482 (37%), Positives = 256/482 (53%), Gaps = 38/482 (8%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI++ML  A  L  +   VTF+ T H    +   + V S  R     RF +IPDGL
Sbjct  12    PVQGHINAMLPFAAALLDAGAHVTFLHTDHNLRRVGRAASVASSPR----LRFLSIPDGL  67

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVT---------SGGEDS---APQRCI  476
             P    DD R S   + +L  SL        + +  +         +G +D     P  C+
Sbjct  68    P----DDSRRSVGDLGELDRSLREVGSVRYRALFASLLSAGSPNRAGADDEHRFPPLTCV  123

Query  477   IADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKDMDEPILS  653
             +ADG   +A+D+AEE+GVP ++F   SA +  A+ S P L + G+LPF  G D+DEP+  
Sbjct  124   VADGLMPWAIDIAEELGVPALAFRTSSACSFLAFMSAPGLFELGDLPFPAGGDLDEPVRG  183

Query  654   VKGMEKLLRRRDLPGNCR----VDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLD  821
             V GME  LRRRDLP + R     DD++            C + +  ++N+   LE S L 
Sbjct  184   VPGMESFLRRRDLPSSFRRRGDTDDVDPSLHVVAKASAHCGKARALVLNTAASLERSALA  243

Query  822   QMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYV  1001
              +    M ++++IGPLH +      SC+         L  +   C+ WLD Q   SV+YV
Sbjct  244   HI-APRMRDLFSIGPLHAMSPALAASCS---------LWREDDGCLAWLDGQADRSVVYV  293

Query  1002  CFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCV  1181
               G+ T++S E   EF  G+  +G  FLW L P +V   +            G +G+  +
Sbjct  294   SLGSFTVISREQFKEFLSGIAATGYPFLWVLRPDMVWASQDGVLHEAAMAAAG-DGKARI  352

Query  1182  VEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIG  1361
             V WAPQ++VL H AVG FLTH GWNS +E++V GVPM+ WPF+ADQ VNSRF+G VW+ G
Sbjct  353   VAWAPQRDVLRHRAVGCFLTHAGWNSTLEAVVEGVPMVCWPFFADQHVNSRFVGAVWRNG  412

Query  1362  LDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             LDMKD C+R ++E+ VR+ ME   DE  + A+  A   K     GGSS + LE L+  I+
Sbjct  413   LDMKDVCERGVVERTVREAME--SDEIRRAAQALAQLVKRDVAAGGSSATELERLVGFIR  470

Query  1542  RM  1547
              +
Sbjct  471   EL  472



>ref|XP_003560194.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=479

 Score =   303 bits (775),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 184/484 (38%), Positives = 255/484 (53%), Gaps = 41/484 (8%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             +P   HI+SML  A  L  + + VTF+   H   NL   +   S     +  RF ++PDG
Sbjct  10    WPLQGHINSMLPFAVALAGAGVHVTFL---HTEPNLRRAAATAS---PAARLRFMSVPDG  63

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATA----KPFLKEIVVTSGGEDSAPQ---------R  470
             LP    DDH  S   + +L  SL+ T     +  L  ++  +G   +             
Sbjct  64    LP----DDHPRSVGDLTELAMSLNTTGAAAYRALLDSMLSAAGSHAADAGAAVGVFPAVS  119

Query  471   CIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-GKDMDEPI  647
             C++ D F  F VDVAEE+GVP ++FH  SA +  AY S+P L + GE+P + G D+D P+
Sbjct  120   CVVGDVFLPFTVDVAEELGVPALAFHTASACSVLAYLSLPRLTELGEVPVSVGVDLDAPV  179

Query  648   LSVKGMEKLLRRRDLPGNCR----VDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGST  815
               V GME  LRRRDLP  CR       ++           +    +  IIN+   LE   
Sbjct  180   RGVPGMEGFLRRRDLPSTCRRRPDTHGIDPALHILAGHAARSSGARALIINTAVSLEAPA  239

Query  816   LDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVL  995
             L ++    M +++AIGPLH        + +     +S  L  + + CM+WLD Q   SV+
Sbjct  240   LARI-APRMRDLFAIGPLH--------AMSSAAAPASTSLWPEDEGCMEWLDGQADKSVV  290

Query  996   YVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRC  1175
             YV  G+L ++S E   EF HGL+N+G  FLWAL P  V   +    +   E      G+ 
Sbjct  291   YVSLGSLAVISLEQFTEFLHGLVNAGYAFLWALRPDTVGASQSTVLQEAVE--AAANGKA  348

Query  1176  CVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWK  1355
              VV+WAPQ++VL H AVG FLTH GWNS +E IV GVP++ WPF+ DQQ NSRF+G VW 
Sbjct  349   RVVDWAPQRDVLRHRAVGCFLTHAGWNSTLEGIVEGVPLVCWPFFGDQQTNSRFVGAVWG  408

Query  1356  IGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIED  1535
              GLDMKD C+R ++E MVR+ ME    E  + A+  A   +    EGGSS S    L+  
Sbjct  409   TGLDMKDVCERAVVEGMVREAME--SGELRRSAQALAKEVRRDVAEGGSSASEFRRLVGF  466

Query  1536  IKRM  1547
             IK +
Sbjct  467   IKEL  470



>ref|XP_002462875.1| hypothetical protein SORBIDRAFT_02g033580 [Sorghum bicolor]
 gb|EER99396.1| hypothetical protein SORBIDRAFT_02g033580 [Sorghum bicolor]
Length=509

 Score =   303 bits (776),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 188/488 (39%), Positives = 264/488 (54%), Gaps = 43/488 (9%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSG-FRFETI  320
             +P P+  H++S L+L+  L  + L VTF+ T H   NL      ++     S   RF ++
Sbjct  15    FPAPAQGHLNSFLHLSTGLLRAGLHVTFLHTDH---NLRRLGAAVAEATAASPRLRFLSV  71

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA----------PQR  470
             PDGLP    DD   +  G+ +L+ +L   A    + +++ S    +           P  
Sbjct  72    PDGLP----DDDPRAVDGLPRLVEALCTKASASYRALMLASLSPRADGGGGAADGFPPVT  127

Query  471   CIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF--NGKD-MDE  641
             C++ DG   F VDVAEE+GVP IS+  VSA A  AY S+P L+  GELPF   G D +DE
Sbjct  128   CVVGDGILPFVVDVAEELGVPAISYRTVSACAVLAYLSVPRLLDLGELPFPEGGDDVLDE  187

Query  642   PILSVKGMEKLLRRRDLPGNCR--VDDLEDPFFKFMMEFR-KCFRTKHHIINSFQELEGS  812
             P+  V GME  LRRRDLP   R      E+P  K ++E      + +  ++N+   LE  
Sbjct  188   PVRGVPGMESFLRRRDLPIQFRQLTSTHEEPLIKAVVEATLHSRKARALMVNTTTSLERR  247

Query  813   TLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQP---P  983
             +LD +   +M  V+A+GPLH +              +S   H+DG  CM WLD Q     
Sbjct  248   SLDHL-AKEMRGVFAVGPLHAM-------SPAPAAATSLWRHDDG--CMAWLDSQAEAAA  297

Query  984   NSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGL  1163
              SV+Y+  G+L ++S E   EF HGL+ SG  FLW L P ++     +   +   +    
Sbjct  298   RSVVYISLGSLAVISHEQFTEFLHGLVASGYPFLWVLRPDML--GASQDAALQEAVAAVG  355

Query  1164  EGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLG  1343
              GR  VV WAPQ++VL H AVG FLTH GWNS +E IV GVPM+ WPF+ADQQ+NSRF+G
Sbjct  356   SGRARVVPWAPQRDVLRHRAVGCFLTHSGWNSTLEGIVEGVPMVCWPFFADQQINSRFVG  415

Query  1344  EVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLEN  1523
              VW+ GLDMKD CDR ++E+ VR+ ME    E  + A   A   K    +GG+S    E 
Sbjct  416   AVWRNGLDMKDVCDRGVVERTVREAME--SAEIRRSAHALAEQVKRDVADGGASALEFER  473

Query  1524  LIEDIKRM  1547
             L+  ++ +
Sbjct  474   LVSFVREL  481



>emb|CBI31568.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   298 bits (763),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 156/350 (45%), Positives = 207/350 (59%), Gaps = 35/350 (10%)
 Frame = +3

Query  444   GGEDSAPQRCIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN  623
             G +   P  CIIADG  +F +D+A EVG+PIISF  VSA + WAYFS   LI++GELP  
Sbjct  7     GSDTRPPVSCIIADGMMSFTIDIANEVGIPIISFRTVSACSFWAYFSALKLIESGELPLK  66

Query  624   GKDMDEPILSVKGMEKLLRRRDLPGNCRVDDLEDP-FFKFMMEFRKCFRTKHHIINSFQE  800
             G DMD+ + S+ GME  LR+RDLP   RV +L+D        E ++  R    I+N+F++
Sbjct  67    GNDMDQLVTSIPGMEGFLRKRDLPSLLRVSNLDDEGLLLVTKETQQTPRAHALILNTFED  126

Query  801   LEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQP  980
             LEG  L Q+R       Y IGPLH  L+ +L S + T + SSN   ++ + C+ WLD QP
Sbjct  127   LEGPILGQIR-NHCPKTYTIGPLHAHLKTRLASESTT-SQSSNSFRQEDRSCIAWLDHQP  184

Query  981   PNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNG  1160
               SV+YV FG++ ++S + L EF +GL+NS  RFLW +    +  +  E  + P E++ G
Sbjct  185   SKSVIYVSFGSMVVISRKQLIEFCYGLVNSSSRFLWVIRTDSLAEEDGEH-QTPAELMEG  243

Query  1161  LEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFL  1340
              + R  +VEWAPQ+EVLAH AVGGFLTH                                
Sbjct  244   AKERSYIVEWAPQEEVLAHPAVGGFLTHS-------------------------------  272

Query  1341  GEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAK  1490
             G VWK+G DMKDTCDR I+EKMVRDLME RKDE L+ A   A  A++C K
Sbjct  273   GHVWKLGSDMKDTCDRLIVEKMVRDLMEERKDELLETADMMATRARKCLK  322



>dbj|BAJ98857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score =   301 bits (772),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 183/477 (38%), Positives = 255/477 (53%), Gaps = 40/477 (8%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             +P   HI+SML+ A  L  + L VTF   VH  +NL       +        RF ++PDG
Sbjct  11    WPLQGHINSMLHFAAGLLDAGLHVTF---VHTEHNLR--RAQRAEAAATPRLRFVSLPDG  65

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS------GGEDSAPQRCIIADGF  491
             L    + DH  S   +  L  SL  T     + ++ ++      GG  +    C++ADG 
Sbjct  66    L----SVDHPRSVGDLKDLAKSLMTTGPAAYRALLASALSPAAIGGFPA--LSCVVADGL  119

Query  492   ANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-GKDMDEPILSVKGME  668
               FA+DVAEE+GVP ++F   SA +  AY S+P L++ GE+P   G D+D P+ SV GME
Sbjct  120   LPFAIDVAEELGVPALAFRTSSACSFLAYLSVPKLVELGEVPIPVGADLDGPVCSVPGME  179

Query  669   KLLRRRDLPGNCR----VDDLEDPFFKFMMEFRK-CFRTKHHIINSFQELEGSTLDQMRI  833
               LRRRDLP +CR      D+ DP  + ++ +       +  I N+   LE S L  +  
Sbjct  180   DFLRRRDLPSSCRRRPETQDV-DPLLQLLVSYTAHSCNARALIFNTAASLERSALAHI-A  237

Query  834   GDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGT  1013
               M +V+AIGPLH +               +  L  +   CM WLD Q   SV+YV  G+
Sbjct  238   PHMRDVFAIGPLHAI---------SAAPAPATSLWREDDGCMAWLDGQADRSVVYVSLGS  288

Query  1014  LTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGL-EGRCCVVEW  1190
             L ++S E   EF  GL+NSG  FLW L P ++      +  V  E +    +G+  VV W
Sbjct  289   LAVISLEQFTEFLSGLVNSGYTFLWVLRPDMI---GASQSAVLQEAVGAAGKGKARVVGW  345

Query  1191  APQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDM  1370
             APQ++VL H AVG FLTH GWNS +E I  GVP++ WPF+ DQQ+NSRF+G VW  GLDM
Sbjct  346   APQRDVLRHRAVGCFLTHAGWNSTLEGIAEGVPLVCWPFFLDQQINSRFVGAVWGAGLDM  405

Query  1371  KDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             KD CDR ++E MVR  ME   ++    A+  +   +    EGGSS +  + L+  IK
Sbjct  406   KDVCDRAVVEGMVRQAME--SEQLRMSAQTLSQEVRRDVAEGGSSATEFQRLLAFIK  460



>ref|NP_001175206.1| Os07g0489950 [Oryza sativa Japonica Group]
 dbj|BAC80059.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
 dbj|BAH93934.1| Os07g0489950 [Oryza sativa Japonica Group]
Length=490

 Score =   302 bits (774),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 175/476 (37%), Positives = 250/476 (53%), Gaps = 35/476 (7%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             +P   H++ ML+LA  L  + + VTF+   H   NL       +        RF ++ DG
Sbjct  15    WPIQGHLNVMLHLAVALAGAGVHVTFL---HTDYNLRRLGAAAAAAVASPWLRFMSVTDG  71

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS---------GGEDSAPQRCIIA  482
             LP    DDH  +   + ++  SL    +   + ++ +S         GG    P   ++A
Sbjct  72    LP----DDHPRTVANLGEISRSLHTAGRAAYRALLASSSQLVPADAAGGGAFPPVTTVVA  127

Query  483   DGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-GKDMDEPILSVK  659
             D    FA+DVAEE+GVP ++F   SA +  AY S+P L++ GELPF  G D+DEP+  V 
Sbjct  128   DALLPFAIDVAEELGVPALAFRTASACSFLAYMSVPRLVELGELPFPPGGDLDEPVRGVP  187

Query  660   GMEKLLRRRDLPGNCR------VDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLD  821
             GME  LRRRDLP  CR       DD      +       C + +  I+N+   LE   L 
Sbjct  188   GMEGFLRRRDLPSPCRHHGANNNDDAAALLGRLADAAVHCSKARALILNTAASLEAPALA  247

Query  822   QMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYV  1001
              +    M +V+A+GPLH +  +   +   +L  + +G       CM WLD Q   SV+YV
Sbjct  248   HI-APRMRDVFAVGPLHAM--SPAPAAATSLWRADDG-------CMAWLDCQADRSVVYV  297

Query  1002  CFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCV  1181
               G+LT++S E   EF  GL+ +G  FLW L P +V  ++       +      + +  V
Sbjct  298   SLGSLTVISPEQFTEFLSGLVAAGNPFLWVLRPDMVTARRRHADLQESVTAAAGDSKARV  357

Query  1182  VEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIG  1361
             V WAPQ++VL H AVG FLTH GWNS +E+ V GVP + WPF+ DQQ+NSRF+G VW+ G
Sbjct  358   VGWAPQRDVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFTDQQINSRFVGGVWRTG  417

Query  1362  LDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLI  1529
             LDMKD CD  ++ +MVR+ ME    E    A+  A   +    EGGSS   L+ L+
Sbjct  418   LDMKDVCDAAVVARMVREAME--SGEIRASAQSVARQLRRDVAEGGSSAMELKRLV  471



>gb|EAZ03912.1| hypothetical protein OsI_26045 [Oryza sativa Indica Group]
Length=490

 Score =   301 bits (772),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 174/476 (37%), Positives = 250/476 (53%), Gaps = 35/476 (7%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             +P   H++ ML+LA  L  + + VTF+   H   NL       +        RF ++ DG
Sbjct  15    WPIQGHLNVMLHLAVALAGAGVHVTFL---HTDYNLRRLGAAAAAAVASPWLRFMSVTDG  71

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTS---------GGEDSAPQRCIIA  482
             LP    DDH  +   + ++  SL    +   + ++ +S         GG    P   ++A
Sbjct  72    LP----DDHPRTVANLGEISRSLHTAGRAAYRALLASSSQLVPADAAGGGAFPPVTTVVA  127

Query  483   DGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-GKDMDEPILSVK  659
             D    FA+DVAEE+GVP ++F   SA +  AY S+P L++ GELPF  G D+DEP+  V 
Sbjct  128   DALLPFAIDVAEELGVPALAFRTASACSFLAYMSVPRLVELGELPFPPGGDLDEPVRGVP  187

Query  660   GMEKLLRRRDLPGNCR------VDDLEDPFFKFMMEFRKCFRTKHHIINSFQELEGSTLD  821
             GME  LRRRDLP  CR       DD      + +     C + +  I+N+   LE   L 
Sbjct  188   GMEGFLRRRDLPSPCRHHGANNNDDAAALLGRLVDAAVHCSKARALILNTAASLEAPALA  247

Query  822   QMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYV  1001
              +    M +V+A+GPLH +  +   +   +L  + +G       CM WLD Q   SV+YV
Sbjct  248   HI-APRMRDVFAVGPLHAM--SPAPAAATSLWRADDG-------CMAWLDCQADRSVVYV  297

Query  1002  CFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCV  1181
               G+LT++S E   EF  GL+ +G  FLW L P +V  ++       +      + +  V
Sbjct  298   SLGSLTVISPEQFTEFLSGLVAAGNPFLWVLRPDMVTARRRHADLQESVTAAAGDSKARV  357

Query  1182  VEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIG  1361
             V WAPQ++VL H AVG FLTH GWNS +E+ V GVP + WPF+ DQQ+NSR +G VW+ G
Sbjct  358   VGWAPQRDVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFVDQQINSRLVGAVWRTG  417

Query  1362  LDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLI  1529
             LDMKD CD  ++ +MVR+ ME    E    A+  A   +    EGGSS   L+ L+
Sbjct  418   LDMKDVCDAAVVARMVREAME--SGEIRASAQSVARQLRRDVAEGGSSAMELKRLV  471



>ref|XP_003575790.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=487

 Score =   300 bits (768),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 183/480 (38%), Positives = 262/480 (55%), Gaps = 28/480 (6%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             +P   HI+ ML+LA +L  + ++VTF+ T H  + L   S   +      G R  +IPDG
Sbjct  12    WPLQGHINCMLDLAAVLLDAGVRVTFLHTDHNLSRLPKGS--TTTLAPQQGLRLLSIPDG  69

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKP-FLKEIVVTSGGEDSAPQRCIIADGFANFAV  506
             LP    +DH  S   + ++  S+  T +  +   ++  S     +P  C+IADG   FAV
Sbjct  70    LP----EDHPRSVRHLKEISESMLTTGQAAYRALLLSLSSAAAGSPVTCVIADGIMPFAV  125

Query  507   DVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRR  686
             DVAEE+GVP ++F   SA +  AY S+P L++  E PF     DEP+  V GME+ LRRR
Sbjct  126   DVAEELGVPALAFRTASACSYLAYLSVPRLLELQEAPFPS---DEPVRGVPGMERFLRRR  182

Query  687   DLP---GNCRVDDLE-DPFFKFMME-FRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNV  851
             DLP   G  + D +E DP    + +   +  + +  I+N+   +EG+ L ++    M ++
Sbjct  183   DLPRGVGIPKGDGVEFDPMLLTIADGIARAGKARALILNTAASMEGAALGRI-APHMRDL  241

Query  852   YAIGPLHELLRNKLGSC------NVTLTTSSNGL---HEDGKKCMDWLDRQPPNSVLYVC  1004
             +A+GPLH         C      N +  T  NG     E+   CM WLD     SV+YV 
Sbjct  242   FAVGPLHATNGVANAQCRASGNGNASANTKINGHGRGSEEHHGCMAWLDAWRERSVVYVS  301

Query  1005  FGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEG-RCCV  1181
              G+L +++ E   EF  GL+ +G  FLW L P +VL          T+ +    G +  V
Sbjct  302   MGSLAVITHEQFTEFLCGLVGAGHAFLWVLRPDMVLQATTTSSISVTDAVMAAAGDKAHV  361

Query  1182  VEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIG  1361
             VEWAPQ+ VL H AVG FL H GWNS +E++  GVPM+ WPF+ADQQ+NSRF+G VW+ G
Sbjct  362   VEWAPQRAVLRHRAVGCFLMHGGWNSTLEAVAEGVPMVCWPFFADQQINSRFMGAVWRTG  421

Query  1362  LDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             LD+KD CDR I+E+ VR+ ME    E   RA+  A+        GGSS S  + L+  I+
Sbjct  422   LDIKDVCDRAIVEREVREAME--SAEIRARAQAMAHQLGLDVAPGGSSSSERDRLVAFIR  479



>ref|XP_010060016.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=480

 Score =   300 bits (767),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 185/476 (39%), Positives = 257/476 (54%), Gaps = 27/476 (6%)
 Frame = +3

Query  153   PFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP  SHI++MLNLA+LL      VTF+ T +  N LL  S   S       FRF TIPD
Sbjct  11    PFPAQSHINAMLNLAKLLHHRGFHVTFVNTEYNHNRLL-RSRGPSSLDGLPSFRFRTIPD  69

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPF----LKEIVVTSGGEDSAPQRCIIADGFA  494
             GLP   +DD  +  V    L  S      P+    LK +   S    S P  C+++DG+ 
Sbjct  70    GLPP--SDDDATQDVP--ALCQSTQKCCLPYFQDLLKRLNEESATSGSPPVSCVVSDGWT  125

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD------MDEPILSV  656
              F +D AE VGVP + F P+SA A   +    SL+  G  P           +D  I  +
Sbjct  126   TFTLDAAEAVGVPEVLFWPISACAFMGFLHFRSLVDEGRAPLKDASYLTNGYLDTIIDWI  185

Query  657   KGMEKLLRRRDLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRI  833
              GM  + R RDLP   R  D +DP   F ++EF +  R    + N+F+ LE   LD ++ 
Sbjct  186   PGMRNI-RLRDLPSFIRTTDPDDPILNFCLVEFARVKRASAWVFNTFERLEHEVLDALK-  243

Query  834   GDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGT  1013
                  +Y IGP+H LL  +L S + T    SN L ED   C++WLD +PP SV+YV FG+
Sbjct  244   AMFPPIYTIGPIH-LLVEQL-SDDDTRPIRSNLLEED-LGCLEWLDSKPPGSVVYVNFGS  300

Query  1014  LTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWA  1193
             + ++S   L EF  GL NSGQ FLW + P L++        +P + L     R  +  W 
Sbjct  301   IIVMSPAQLVEFAWGLANSGQVFLWVIRPDLIIGNT---AILPPDFLAATRERSLLASWC  357

Query  1194  PQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMK  1373
             PQ+ VL+HSAVGGFLTHC WNS +ESI A VP+  WPF+ DQQ N R+  + W IG+++ 
Sbjct  358   PQERVLSHSAVGGFLTHCRWNSTIESIAASVPVACWPFFGDQQTNCRYSCQEWGIGMEID  417

Query  1374  DTCDRHIIEKMVRDLME-VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
                 R  +E+ VR+LME  R  E  ++A ++  +A+E  +  GSS  +LE +I ++
Sbjct  418   SDVRRDEVERQVRELMEGERGKEMKRKAMEWQETAREATRPSGSSFLNLEGVINEV  473



>ref|XP_008242242.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Prunus mume]
Length=448

 Score =   295 bits (755),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 159/398 (40%), Positives = 228/398 (57%), Gaps = 17/398 (4%)
 Frame = +3

Query  381   QLLHSLSATAKPFLKEIVVT------SGGEDSAPQRCIIADGFANFAVDVAEEVGVPIIS  542
             QLL +L  + +P  +E++ T      S    + P  C++ DG   FA DVAEE+G+PI+S
Sbjct  55    QLLIALKTSIRPHFRELLKTISLKAESNDALAPPPSCVMTDGLLTFAFDVAEELGLPILS  114

Query  543   FHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRRRDLPGNCRVDDLE  722
             ++       W    +P LI+ G+LPF   DM+  I  V GME LL R+DLPG CRV   +
Sbjct  115   YNVPCPRYLWTCLCLPKLIENGQLPFQDDDMNVEITGVPGMEGLLHRQDLPGFCRVKQAD  174

Query  723   DPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGS  899
              P  +F + E +   R    I+++  EL+   +  M +     +Y +GPLH LL +++G 
Sbjct  175   HPSLQFAINETQTLKRASALILDTVYELDAPCISHMALM-FPKIYTLGPLHALLNSQIGD  233

Query  900   CNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQR  1079
              +  L  S   L +    CM WLD QP  SV+YV FGTL  ++   + EFW+GL+NSG  
Sbjct  234   MSRGLA-SHGSLWKSNLDCMTWLDSQPFKSVIYVSFGTLVHLTRAQVIEFWYGLVNSGHP  292

Query  1080  FLWALNPRLVLNKKVERG--EVPTEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGW  1253
             FLW      V+   +  G  ++P E+  G + R  +V+W  Q+EVLAH +VGGFLTH GW
Sbjct  293   FLW------VMKSDITSGDHQIPVELEKGTKERGYIVDWVSQEEVLAHKSVGGFLTHSGW  346

Query  1254  NSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRK  1433
             NS +ESIVAG+PMI WP   D  + SR +   WKIGL + + CDR  IE MV+ LM  ++
Sbjct  347   NSTLESIVAGLPMICWPNLGDHYIISRTVCRQWKIGLQLNENCDRSNIESMVQTLMGPKR  406

Query  1434  DEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +E        +  A++   EGGSS ++LE LIE I+ +
Sbjct  407   EEIQSSMDAISKLARDNVAEGGSSHNNLEQLIEYIRNL  444



>ref|XP_003576916.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=493

 Score =   296 bits (758),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 189/487 (39%), Positives = 261/487 (54%), Gaps = 35/487 (7%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVH--ARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P   HI+ ML+ A  L  + L VTF+ T H  AR + L  +    R R      F ++P
Sbjct  11    WPLQGHINCMLHFAAGLVGAGLHVTFLHTEHNLARVDPLASAAATPRLR------FVSVP  64

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP G     R     ++  + +        L++   T+      P  C++ADG   FA
Sbjct  65    DGLPAGHPRTVRDLKEPLLTTVPAAYRALLASLQQQPSTTADAGFPPVSCVVADGLLPFA  124

Query  504   VDVAEE-VGVPIISFHPVSAAATWAYFSIPSLIQAGE---LPFNGKDMDEPILSVKGMEK  671
             +D+ EE  GVP ++F  VSA +  AY S+P L++ GE   +P +  D+DE +L V GME 
Sbjct  125   IDIPEEEFGVPALAFRTVSACSILAYLSVPRLVELGEAIPIPLDA-DLDELVLGVPGMEG  183

Query  672   LLRRRDLPGNCRVD---DLEDPFFKFMMEFRKCFRTKHH--IINSFQELEGSTL----DQ  824
              LRRRDLP  CRV+      DP    +++F    R K    I+N+   LEG +L    +Q
Sbjct  184   FLRRRDLPSPCRVNAETQEADPLLDMIVDFTAHSRDKARALILNTAASLEGESLAHIAEQ  243

Query  825   MRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNG--LHEDGKKCMDWLDRQPPNSVLY  998
             MR GD   V+AIGPLH      + S + +    ++G    EDG  C++WLD Q   SV+Y
Sbjct  244   MR-GD---VFAIGPLHLHAAANVSSSSSSPAPVASGSMWREDGG-CIEWLDAQGDRSVVY  298

Query  999   VCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKK----VERGEVPTEILNGLE  1166
             V  G+LT++S E   EF  GL+ +G  FLW L P +V   +     E  +    +     
Sbjct  299   VSLGSLTVISLEQFTEFLSGLVGAGHAFLWVLRPDMVTATQNALLREAVDAAAALHGNAA  358

Query  1167  GRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGE  1346
                 VV+WAPQ+ VL H AVG FLTH GWNS +E    GVPM+ WPF+ADQQ+NSRF+G 
Sbjct  359   PAAFVVDWAPQRAVLRHRAVGCFLTHAGWNSTVECAAEGVPMVCWPFFADQQINSRFVGA  418

Query  1347  VWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENL  1526
             VW  GLDMKD CDR ++E MVR+ ME       + A   A   +   +EGGSS    + L
Sbjct  419   VWGTGLDMKDVCDRAVVEAMVREAME--SAGIRRSAVALAERVRRDVEEGGSSAVEFDRL  476

Query  1527  IEDIKRM  1547
             +  IK +
Sbjct  477   VGFIKEL  483



>ref|XP_010060018.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   295 bits (754),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 184/476 (39%), Positives = 254/476 (53%), Gaps = 27/476 (6%)
 Frame = +3

Query  153   PFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFP  SHI++MLNLA+LL      VTF+ T +  N LL  S   S       FRF TIPD
Sbjct  16    PFPAQSHINAMLNLAKLLHDRGFHVTFVNTEYNHNRLL-RSRGPSSLDSLPSFRFRTIPD  74

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPF----LKEIVVTSGGEDSAPQRCIIADGFA  494
             GLP    D  +     I  L  S      P+    LK +   S    S P  C+++D   
Sbjct  75    GLPPSDGDATQD----IPALCQSTQERCLPYFQDLLKRLDEESATSGSPPVSCVVSDVST  130

Query  495   NFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD------MDEPILSV  656
              F +D AE VGVP + F P+SA A   +    SLI  G  P           +D  I  +
Sbjct  131   TFTLDAAEAVGVPEVLFWPISACAFMGFLQFRSLIDEGLAPLKDASYLTNGYLDTIIDWI  190

Query  657   KGMEKLLRRRDLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRI  833
              GM  + R RDLP   R  D +DP   F ++EF +  R    + N+F+ LE   L+ ++ 
Sbjct  191   PGMRNI-RLRDLPSFIRTTDPDDPMLNFCLVEFARAKRASAWVFNTFERLEHEVLEALK-  248

Query  834   GDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGT  1013
                  +Y IGP+H LL  +L   +  L   +  L ++   C++WLD +PP SV+YV FG+
Sbjct  249   AMFPPIYTIGPIH-LLLEQLSDDDTRLIRFN--LWKEDLGCLEWLDLKPPGSVVYVNFGS  305

Query  1014  LTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWA  1193
             +T++S   L EF  GL NSGQ FLW + P LV   K     +P + L     R  +V W 
Sbjct  306   ITVMSPAQLVEFAWGLANSGQVFLWVIRPDLV---KGNTAILPPDFLAATRERSLLVSWC  362

Query  1194  PQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMK  1373
             PQ+ VL+HSAVGGFLTHCGWNSI+ESI A VP+  WPF+ADQQ N R+  + W IG+++ 
Sbjct  363   PQERVLSHSAVGGFLTHCGWNSIIESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEID  422

Query  1374  DTCDRHIIEKMVRDLME-VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
                 R  +E+ VR+LME  R  E  ++A ++   A+E     GSS  +L+ +I+ +
Sbjct  423   SDVRRDEVERQVRELMEGERGKEMKRKAMEWKEMAREATCPSGSSFLNLDEVIDKV  478



>ref|XP_003563101.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=495

 Score =   295 bits (755),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 176/490 (36%), Positives = 255/490 (52%), Gaps = 48/490 (10%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNL-----LCFSDVISRFRCYSGFR  308
             +P P+  HI+ ML     L  + L VTF+ + H    L        ++  +        R
Sbjct  9     FPCPAQGHINCMLQFTAGLLAAGLHVTFLHSDHNLRRLRHANNNNNNESTAAANSSPRLR  68

Query  309   FETIPDGLPHGLTDDHRSSGVGIVQLLHSL----SATAKPFLKEIVVTSGGEDS------  458
             F ++PDGLP    DDH  S   +V+ + S+    S   +  L  +   +   D+      
Sbjct  69    FMSVPDGLP----DDHPRSAGNLVEFMESMFAKTSVAYRALLSSLRAPAPPLDANDDGLL  124

Query  459   -APQRCIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-NGKD  632
               P  C++ADG   FA+ V+EE+GVP ++F   SA +  AY S+P L+  GE+P     D
Sbjct  125   FPPVTCVVADGMLPFAITVSEELGVPALAFRTASACSFLAYLSVPDLVALGEVPVPESAD  184

Query  633   MDEPILSVKGMEKLLRRRDLPGNCR-------VDDLEDPFFKFMMEFRKCFR-TKHHIIN  788
             +D P+  V GME  LR RDLP  CR         D  DP  + +++     R  +  I+N
Sbjct  185   LDAPVRGVPGMEAFLRLRDLPSFCRGRSDPAGTADGLDPMLRILVDSVPQSRNARAFILN  244

Query  789   SFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWL  968
             +   LE   L  +    M +++A+GPLH + +            +   L  +   CM WL
Sbjct  245   TSASLERDALSHI-APHMRDLFAVGPLHAMFQAP---------GAGGALWREDDACMRWL  294

Query  969   DRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTE  1148
             D Q   +V+YV  G+L ++S E   EF  GL+N+G  FLW L P +V      +  V  +
Sbjct  295   DAQADGTVVYVSLGSLAVISLEQFTEFLSGLVNAGHPFLWVLRPDMV---DASQNAVLQD  351

Query  1149  ILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVN  1328
              +   +G  CVVEWAPQ++VL H AVG FLTH GWNS +E +V GVP + WPF+ADQQ N
Sbjct  352   AVKQSKG--CVVEWAPQRDVLRHRAVGCFLTHAGWNSTLECVVEGVPTVCWPFFADQQTN  409

Query  1329  SRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSI  1508
             SRF+G VW  GLDMKD C+R ++E+MVR+ +E    E  + A++ A   +    EGGSS 
Sbjct  410   SRFMGAVWGTGLDMKDVCERAVVERMVREAVE--SGELRRSAQELAREVRRDIAEGGSSA  467

Query  1509  SSLENLIEDI  1538
             +    L+E I
Sbjct  468   TEFRRLVEFI  477



>ref|XP_010064217.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 179/475 (38%), Positives = 254/475 (53%), Gaps = 27/475 (6%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI+ MLNLA+LL      VTF+ T +  + LL  S   S       FRF TIPDGL
Sbjct  18    PAQGHINPMLNLAKLLHCRGFHVTFVNTEYNHSRLL-RSRGPSSLDGLPSFRFRTIPDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPF----LKEIVVTSGGEDSAPQRCIIADGFANF  500
             P    D  +     I  L  S      P+    LK +   S    S P  C+++D    F
Sbjct  77    PPSDGDTTQD----IPALCQSTQRCCLPYFQDLLKRLNEESATSGSPPVSCVVSDITMTF  132

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF-------NGKDMDEPILSVK  659
              +D AE +GVP + F P+SA A   +    SLI  G +P        NG ++D  I  + 
Sbjct  133   TLDAAEAIGVPEVLFWPISACAFMGFLQFRSLIDKGLVPLKDASYLTNG-NLDTVIDWIP  191

Query  660   GMEKLLRRRDLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIG  836
             GM  + R RDLP   R  D +DP   F ++EF +  R    + N+F+ LE   L+ ++  
Sbjct  192   GMRNI-RLRDLPSFIRTTDPDDPMINFCLVEFARAKRASAWVFNTFERLEHEVLEALK-A  249

Query  837   DMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTL  1016
                 +Y IGP+H LL  +L   +  L   +  L ++   C++WLD +PP+SVLYV FG++
Sbjct  250   MFPPIYTIGPIH-LLLEQLSDDDTRLIRFN--LWKEDLGCLEWLDSKPPSSVLYVNFGSI  306

Query  1017  TLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAP  1196
             T++S   L EF  GL NSGQ FLW + P LV+        +P + L     R  +  W P
Sbjct  307   TVISPAQLVEFAWGLANSGQVFLWVIRPDLVIGNT---AILPPDFLAATRERSLLASWCP  363

Query  1197  QQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKD  1376
             Q+ VL+HSAVGGFLTHCGWNSI+ESI A VP++ WPF+ADQQ N R+  + W IG+++ +
Sbjct  364   QERVLSHSAVGGFLTHCGWNSIIESIEASVPVVCWPFFADQQTNCRYSCQEWGIGMEIDN  423

Query  1377  TCDRHIIEKMVRDLME-VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
                R  +E+ VR+LME  R  E  ++  ++   A+E     GSS  +L+ +I  +
Sbjct  424   DVRRDEVERQVRELMEGGRGKEMKRKVMEWKEMAREATHPSGSSFLNLDEVINKV  478



>gb|KCW66540.1| hypothetical protein EUGRSUZ_F00337 [Eucalyptus grandis]
Length=460

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 179/466 (38%), Positives = 249/466 (53%), Gaps = 25/466 (5%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDH  356
             MLNLA+LL      VTF+ T +  N LL  S   S       FRF TIPDGLP   +DD 
Sbjct  1     MLNLAKLLHHRGFHVTFVNTEYNHNRLL-RSRGPSSLDGLPSFRFRTIPDGLPP--SDDD  57

Query  357   RSSGVGIVQLLHSLSATAKPF----LKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEV  524
              +  V    L  S      P+    LK +   S    S P  C+++DG+  F +D AE V
Sbjct  58    ATQDVP--ALCQSTQKCCLPYFQDLLKRLNEESATSGSPPVSCVVSDGWTTFTLDAAEAV  115

Query  525   GVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD------MDEPILSVKGMEKLLRRR  686
             GVP + F P+SA A   +    SL+  G  P           +D  I  + GM  + R R
Sbjct  116   GVPEVLFWPISACAFMGFLHFRSLVDEGRAPLKDASYLTNGYLDTIIDWIPGMRNI-RLR  174

Query  687   DLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLP   R  D +DP   F ++EF +  R    + N+F+ LE   LD ++      +Y IG
Sbjct  175   DLPSFIRTTDPDDPILNFCLVEFARVKRASAWVFNTFERLEHEVLDALK-AMFPPIYTIG  233

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
             P+H LL  +L S + T    SN L ED   C++WLD +PP SV+YV FG++ ++S   L 
Sbjct  234   PIH-LLVEQL-SDDDTRPIRSNLLEED-LGCLEWLDSKPPGSVVYVNFGSIIVMSPAQLV  290

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EF  GL NSGQ FLW + P L++        +P + L     R  +  W PQ+ VL+HSA
Sbjct  291   EFAWGLANSGQVFLWVIRPDLIIGNT---AILPPDFLAATRERSLLASWCPQERVLSHSA  347

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             VGGFLTHC WNS +ESI A VP+  WPF+ DQQ N R+  + W IG+++     R  +E+
Sbjct  348   VGGFLTHCRWNSTIESIAASVPVACWPFFGDQQTNCRYSCQEWGIGMEIDSDVRRDEVER  407

Query  1404  MVRDLME-VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
              VR+LME  R  E  ++A ++  +A+E  +  GSS  +LE +I ++
Sbjct  408   QVRELMEGERGKEMKRKAMEWQETAREATRPSGSSFLNLEGVINEV  453



>gb|EAZ39846.1| hypothetical protein OsJ_24286 [Oryza sativa Japonica Group]
Length=411

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 158/376 (42%), Positives = 210/376 (56%), Gaps = 21/376 (6%)
 Frame = +3

Query  441   SGGEDSAPQRCIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF  620
             S G    P  C++ADG    A+D+AEE+GVP + F  VSA +  AY SIP L + GELPF
Sbjct  28    STGVQFPPVTCVVADGIMPLAIDIAEEIGVPALGFRTVSACSFLAYLSIPRLFELGELPF  87

Query  621   -NGKDMDEPILSVKGMEKLLRRRDLPGNCRV----DDLEDPFFKFMMEFRKCFR-TKHHI  782
               G D+DEP+  V GME  LRRRDLP  CR     D   DP  + + E     R  +  +
Sbjct  88    PAGGDLDEPVRGVPGMETFLRRRDLPSFCRGGGGGDSQNDPMLQTVNEVTAHSRKARALV  147

Query  783   INSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMD  962
             +N+   +EG  L  +    M +V+AIGPLH +              ++  L      CM 
Sbjct  148   LNTSASMEGPALAHI-APHMRDVFAIGPLHTMF---------PAPAAAGSLWRADDGCMA  197

Query  963   WLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVP  1142
             WLD QP  SV+YV  G+ T++S E   EF HGL+ +G  FLW L P +V   +       
Sbjct  198   WLDGQPDRSVVYVSLGSFTVISLEQFTEFLHGLVAAGHAFLWVLRPDMVGASQSAALREA  257

Query  1143  TEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQ  1322
                    + R  VVEWAPQ +VL H AVG FLTH GWNS +E+   GVP + WPF+ADQQ
Sbjct  258   AAAAG--DSRARVVEWAPQLDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQ  315

Query  1323  VNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANS-AKECAKEGG  1499
             +NSRF+G VW+ GLDMKD CD  ++E+MVR+ ME    E    A+  A    ++ A +GG
Sbjct  316   INSRFVGGVWRTGLDMKDVCDAAVVERMVREAME--SAEIRASAQALARQLRRDIADDGG  373

Query  1500  SSISSLENLIEDIKRM  1547
             SS +  + L+  IK +
Sbjct  374   SSAAEFQRLVGFIKEL  389



>ref|NP_001059667.1| Os07g0489300 [Oryza sativa Japonica Group]
 dbj|BAC80053.1| putative glucosyltransferase-12 [Oryza sativa Japonica Group]
 dbj|BAD31530.1| putative glucosyltransferase-12 [Oryza sativa Japonica Group]
 dbj|BAF21581.1| Os07g0489300 [Oryza sativa Japonica Group]
Length=445

 Score =   287 bits (735),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 158/376 (42%), Positives = 210/376 (56%), Gaps = 21/376 (6%)
 Frame = +3

Query  441   SGGEDSAPQRCIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF  620
             S G    P  C++ADG    A+D+AEE+GVP + F  VSA +  AY SIP L + GELPF
Sbjct  62    STGVQFPPVTCVVADGIMPLAIDIAEEIGVPALGFRTVSACSFLAYLSIPRLFELGELPF  121

Query  621   -NGKDMDEPILSVKGMEKLLRRRDLPGNCRV----DDLEDPFFKFMMEFRKCFR-TKHHI  782
               G D+DEP+  V GME  LRRRDLP  CR     D   DP  + + E     R  +  +
Sbjct  122   PAGGDLDEPVRGVPGMETFLRRRDLPSFCRGGGGGDSQNDPMLQTVNEVTAHSRKARALV  181

Query  783   INSFQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMD  962
             +N+   +EG  L  +    M +V+AIGPLH +              ++  L      CM 
Sbjct  182   LNTSASMEGPALAHI-APHMRDVFAIGPLHTMF---------PAPAAAGSLWRADDGCMA  231

Query  963   WLDRQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVP  1142
             WLD QP  SV+YV  G+ T++S E   EF HGL+ +G  FLW L P +V   +       
Sbjct  232   WLDGQPDRSVVYVSLGSFTVISLEQFTEFLHGLVAAGHAFLWVLRPDMVGASQSAALREA  291

Query  1143  TEILNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQ  1322
                    + R  VVEWAPQ +VL H AVG FLTH GWNS +E+   GVP + WPF+ADQQ
Sbjct  292   AAAAG--DSRARVVEWAPQLDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQ  349

Query  1323  VNSRFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANS-AKECAKEGG  1499
             +NSRF+G VW+ GLDMKD CD  ++E+MVR+ ME    E    A+  A    ++ A +GG
Sbjct  350   INSRFVGGVWRTGLDMKDVCDAAVVERMVREAME--SAEIRASAQALARQLRRDIADDGG  407

Query  1500  SSISSLENLIEDIKRM  1547
             SS +  + L+  IK +
Sbjct  408   SSAAEFQRLVGFIKEL  423



>gb|KHG03787.1| hypothetical protein F383_26945 [Gossypium arboreum]
Length=314

 Score =   283 bits (723),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 146/307 (48%), Positives = 197/307 (64%), Gaps = 3/307 (1%)
 Frame = +3

Query  633   MDEPILSVKGMEKLLRRRDLPGNCRVDDLEDPFFKFMM-EFRKCFRTKHHIINSFQELEG  809
             MD  I +V GME  LR RDLP  CR  D+ED   K ++ + RK  +    I+N+ +EL+G
Sbjct  2     MDRLITTVPGMETYLRCRDLPTICRKLDIEDSIIKLVVKQTRKSLQADALILNTAEELDG  61

Query  810   STLDQMRIGDMLNVYAIGPLHELLRNKLGSCN-VTLTTSSNGLHEDGKKCMDWLDRQPPN  986
               L Q+R    L VYA+GPLH     +L + +  +    SN L E  K C+ WL++QP  
Sbjct  62    PILSQIRTKCPL-VYAVGPLHAQFNTRLNAKHGESYDHFSNTLWEVDKSCIFWLNKQPNR  120

Query  987   SVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLE  1166
             SV+YV FG++T  S E L + W+GL+NS  +FL  + P  V+ K  E  +V  E++   +
Sbjct  121   SVIYVSFGSITSTSREQLVKLWYGLLNSKTKFLIVVRPNSVIGKDGEGEDVVMELMEKSK  180

Query  1167  GRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGE  1346
              R  +V WAPQ+EVL+H A+GGF TH GWNS +ES+VAGVPMI WP +ADQ VNSR + E
Sbjct  181   DRGYIVNWAPQEEVLSHPAIGGFFTHNGWNSTLESVVAGVPMICWPQFADQHVNSRVVSE  240

Query  1347  VWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENL  1526
             VW+IG+DMKD CD  I+EKMV D+M  RK+EF + A + A    +C   GGSS S+L+ L
Sbjct  241   VWEIGMDMKDVCDSKIVEKMVNDVMVDRKEEFAKSAYEMAKVTNQCVNVGGSSYSNLDRL  300

Query  1527  IEDIKRM  1547
             IEDI+ M
Sbjct  301   IEDIRIM  307



>ref|NP_001059671.1| Os07g0490100 [Oryza sativa Japonica Group]
 dbj|BAC80066.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
 dbj|BAF21585.1| Os07g0490100 [Oryza sativa Japonica Group]
 dbj|BAG97501.1| unnamed protein product [Oryza sativa Japonica Group]
Length=480

 Score =   288 bits (737),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/422 (39%), Positives = 231/422 (55%), Gaps = 32/422 (8%)
 Frame = +3

Query  303   FRFETIPDGLPHGLTDDHRSSGVGIVQLLHSL----SATAKPFLKEIVVTSGGEDS-APQ  467
              RF ++PDGLP    DDH  S   +  ++ SL     A  +  L  ++V SGG     P 
Sbjct  64    LRFLSVPDGLP----DDHPRSASDVPVMVDSLLGAGQAAYRALLGSLLVGSGGAGGFPPV  119

Query  468   RCIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-GKDMDEP  644
               ++AD    FA+DVAEE+GVP ++F   SA++  AY S+P L + GELPF  G D+DEP
Sbjct  120   TSVVADALLTFAIDVAEELGVPALAFRTASASSLLAYMSVPRLFELGELPFPPGGDLDEP  179

Query  645   ILSVKGMEKLLRRRDLPGNCRV---DDLEDPFFKFMMEFRK-CFRTKHHIINSFQELEGS  812
             +  V GME  LRRRDLP   R    D    P  + +++      + +  I+N+   LE  
Sbjct  180   VRGVPGMEGFLRRRDLPSTFRRHGNDHDVHPKLQMLVDLTTGSCKARAVILNTAASLEAP  239

Query  813   TLDQM--RIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPN  986
              L  +  R+ D   V+A+GPLH +              ++  L  +   CM WLD Q   
Sbjct  240   ALAHIAPRVRD---VFAVGPLHAM---------SPAPAAATSLWREDDGCMAWLDGQADR  287

Query  987   SVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGL-  1163
             SV+YV  G+LT++S E   EF  GL+ +G  FLW L P +V   +++  ++   +     
Sbjct  288   SVVYVSLGSLTVISPEQFTEFLSGLVAAGHPFLWVLRPDMV-TARLQHADLQEAVAAAAG  346

Query  1164  EGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLG  1343
               +  VV WAPQ++VL H AVG FLTH GWNS +E+ V GVP + WPF+ DQQ+NSRF+G
Sbjct  347   HSKARVVRWAPQRDVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFVDQQINSRFVG  406

Query  1344  EVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLEN  1523
              VW  GLDMKD CD  ++ +MVR+ ME    E    A+  A   +    +GGSS +  + 
Sbjct  407   GVWGTGLDMKDACDAAVVARMVREAME--SGEIRATAQALAEKVRRDVADGGSSATEFKR  464

Query  1524  LI  1529
             L+
Sbjct  465   LV  466



>gb|EEC82058.1| hypothetical protein OsI_26044 [Oryza sativa Indica Group]
Length=480

 Score =   288 bits (737),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/422 (39%), Positives = 231/422 (55%), Gaps = 32/422 (8%)
 Frame = +3

Query  303   FRFETIPDGLPHGLTDDHRSSGVGIVQLLHSL----SATAKPFLKEIVVTSGGEDS-APQ  467
              RF ++PDGLP    DDH  S   +  ++ SL     A  +  L  ++V SGG     P 
Sbjct  64    LRFLSVPDGLP----DDHPRSASDVPVMVDSLLGAGQAAYRALLGSLLVGSGGAGGFPPV  119

Query  468   RCIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-GKDMDEP  644
               ++AD    FA+DVAEE+GVP ++F   SA++  AY S+P L + GELPF  G D+DEP
Sbjct  120   TSVVADALLTFAIDVAEELGVPALAFRTASASSLLAYMSVPRLFELGELPFPPGGDLDEP  179

Query  645   ILSVKGMEKLLRRRDLPGNCRV---DDLEDPFFKFMMEFRK-CFRTKHHIINSFQELEGS  812
             +  V GME  LRRRDLP   R    D    P  + +++      + +  I+N+   LE  
Sbjct  180   VRGVPGMEGFLRRRDLPSTFRRHGNDHDVHPKLQMLVDLTTGSCKARAVILNTAASLEAP  239

Query  813   TLDQM--RIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPN  986
              L  +  R+ D   V+A+GPLH +              ++  L  +   CM WLD Q   
Sbjct  240   ALAHIAPRVRD---VFAVGPLHAM---------SPAPAAATSLWREDDGCMAWLDGQADR  287

Query  987   SVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGL-  1163
             SV+YV  G+LT++S E   EF  GL+ +G  FLW L P +V   +++  ++   +     
Sbjct  288   SVVYVSLGSLTVISPEQFTEFLSGLVAAGHPFLWVLRPDMV-TARLQHADLQEAVAAAAG  346

Query  1164  EGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLG  1343
               +  VV WAPQ++VL H AVG FLTH GWNS +E+ V GVP + WPF+ DQQ+NSRF+G
Sbjct  347   HSKARVVRWAPQRDVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFVDQQINSRFVG  406

Query  1344  EVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLEN  1523
              VW  GLDMKD CD  ++ +MVR+ ME    E    A+  A   +    +GGSS +  + 
Sbjct  407   GVWGTGLDMKDACDAAVVARMVREAME--SGEIRATAQALAEKVRRDVADGGSSATEFKR  464

Query  1524  LI  1529
             L+
Sbjct  465   LV  466



>ref|XP_008450117.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Cucumis melo]
Length=472

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 172/474 (36%), Positives = 258/474 (54%), Gaps = 28/474 (6%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  HI   L LA LLC + L+VTF++T H    L   + + +     S   F++I 
Sbjct  12    FPFPAKGHIKPFLCLAHLLCNAGLRVTFLSTDHHHQKLHNLTHLATA--QISSLHFQSIS  69

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DGLP    D  R+   G  QL  S+    KP  +E+++ S    ++P  C+I D    F 
Sbjct  70    DGLP---PDHPRNVLDG--QLSKSMPLVTKPLFRELLL-SYKNGTSPITCVITDLIFRFP  123

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             +DVA+E+G+P+  F   SA   + YFSIP L++ G++P+   + ++ +  + G E L R 
Sbjct  124   MDVAQELGIPVFCFSTFSARFLFLYFSIPKLLEDGQIPYPEGNSNQALHGIPGGEGLFRC  183

Query  684   RDLPGNCRVDDLEDPFFKFMMEFRKCFRTKHH--IINSFQELEGSTLDQMRIGDMLNVYA  857
             +DLPG   V+ + + +       +    TK H  I+N+F ELE   +  +       VY 
Sbjct  184   KDLPGYWSVEAVAN-YNPMNFVNQTLATTKSHGLILNTFDELEAPFITNLS-KIYKKVYT  241

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IGP+H LL+        ++ T      ED   C+ WLD QPP SV++V FG++  +    
Sbjct  242   IGPIHSLLKK-------SVQTQYEFWKED-HSCLAWLDSQPPRSVMFVSFGSIVKLKSSQ  293

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEIL------NGLEGRCCVVEWAPQ  1199
             L EFW+GL+NSG+ FL  L    +  +  E  E   E++         EGR  +V WAPQ
Sbjct  294   LKEFWNGLVNSGKAFLLVLRSDALTEETGEEDEKQKELVIKEIMETKDEGRWVIVNWAPQ  353

Query  1200  QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDT  1379
             ++VL H A+GGFLTH GWNS +ES+  GVPM+ WP   DQ  N+ +L +VWKIG++M+D+
Sbjct  354   EKVLRHEAIGGFLTHSGWNSTLESVAVGVPMVCWPQIGDQPSNATWLSKVWKIGVEMEDS  413

Query  1380  CDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
              DR  +E  VR +ME    +      + A  A +   + G+S  +L+ LIEDIK
Sbjct  414   HDRCTVESRVRSIMEHEDKKMENAIVELAKRADDRVSKEGTSCRNLQRLIEDIK  467



>ref|XP_007219664.1| hypothetical protein PRUPE_ppa023956mg [Prunus persica]
 gb|EMJ20863.1| hypothetical protein PRUPE_ppa023956mg [Prunus persica]
Length=394

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 169/444 (38%), Positives = 235/444 (53%), Gaps = 77/444 (17%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P  SH+ + LN A+LLCL++  +TF+ +    N LL   D+ S F          IPD +
Sbjct  18    PLQSHVTTTLNFAELLCLANFHITFLNSHFVHNRLLRHIDIQSHF---------AIPDFV  68

Query  333   PHG---LTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
                      D  S G+G++                              C++ADG  NFA
Sbjct  69    STASPTRNGDFCSIGLGLLA-----------------------------CVVADGIMNFA  99

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              D+A+E+G+  ISF  +SA+  W+YF IP LI+A ELPF   +MD  I SV GME +L R
Sbjct  100   TDIAKEIGLMSISFRTISASCYWSYFGIPKLIEASELPFKESEMDILITSVPGMEDILLR  159

Query  684   RDLPGNCRVDDL-EDPFFKFMM-EFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYA  857
             RDLPG CR  ++  D   +F++ + +   R    I+N+F+ELE   L  +R   + N YA
Sbjct  160   RDLPGFCRTSNVAADKTLQFVIRQSQGNVRADSLIVNTFEELEAPALYHIR-DHIPNTYA  218

Query  858   IGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEET  1037
             IG LH  L ++L S   T   +SN L E+ + CM WLD QPP SVL+V FG++T+++ + 
Sbjct  219   IGSLHTHLSSRLASIKGTAPIASNSLWEEDRSCMAWLDAQPPKSVLHVSFGSITVMTRDE  278

Query  1038  LAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAH  1217
             L E W+GL+     FLW + P  V+    E G+ P E+L G   R  +V WAP +EVL H
Sbjct  279   LMEIWYGLV----WFLWVMRPDSVVGDGGE-GQAPEELLAGTRERGYMVGWAPPEEVLKH  333

Query  1218  SAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHII  1397
              A+GGF T C                            R + EVWK+G DMKD CDR I+
Sbjct  334   QAIGGFWTEC----------------------------RLVSEVWKLGFDMKDRCDRVIL  365

Query  1398  EKMVRDLMEVRKDEFLQRAKQFAN  1469
             EKM+RDLM  RK EF++ A + A+
Sbjct  366   EKMIRDLMGERKVEFMKSATEMAD  389



>gb|ACD03242.1| UDP-glycosyltransferase UGT709A10 [Avena strigosa]
Length=470

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 185/475 (39%), Positives = 252/475 (53%), Gaps = 31/475 (7%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             +P   HI+ M +LA  L  + L VTF+   H  +NL   +   +        R  +IPDG
Sbjct  17    WPLQGHINCMHHLATALLDAGLHVTFL---HTHHNLRRLATKPAPAPSQPRLRLLSIPDG  73

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA--PQRCIIADGFANFA  503
             LP    +DH  S   +  L+ S+  T     + +++ S        P  C+IADG   FA
Sbjct  74    LP----EDHPRSVAHLNDLMDSMRTTGSAAYRALLLASSSNKDGHPPVTCVIADGVMAFA  129

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
             VDVAEEVGVP I+F   SA +   Y S+  L++ GE PF     D+P+  V GME  LRR
Sbjct  130   VDVAEEVGVPAIAFRTASACSFLTYLSVRRLVELGEFPFPS---DQPVSGVPGMEGFLRR  186

Query  684   RDLP------GNCRVDDLEDPFFKFMMEFR-KCFRTKHHIINSFQELEGSTLDQMRIGDM  842
             RDLP      G+   D   DP    M E        +  I+N+   +EG  L Q+    M
Sbjct  187   RDLPRAPRPAGSATDDCGVDPMLLNMGECTVHSGEARALILNTSASMEGPALAQI-APHM  245

Query  843   LNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTL  1022
              +V+++GPLH        S   T  T+S    +DG  CM WLD Q   SV+YV  G+LT+
Sbjct  246   RDVFSVGPLHVAAGTGTKS---TAPTASLWREDDG--CMAWLDGQQDRSVVYVSLGSLTV  300

Query  1023  VSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQ  1202
             +SEE LAEF  GL  +G  FLW L P +V         V T  L G + R  VV WAPQ+
Sbjct  301   ISEEQLAEFLSGLAATGYAFLWVLRPDMVAGGTTSLAAVKT--LVGEKAR--VVHWAPQR  356

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             +VL H AVG FLTH GWNS +E+   GVPM+ W F+ DQ +NSRF+  VW+ G+D+KD C
Sbjct  357   DVLRHPAVGCFLTHAGWNSTLEAAYEGVPMVCWTFFGDQLINSRFVDTVWQTGVDIKDVC  416

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             DR ++EK VR+ ME    +    A+  A   +    +GGSS S ++ L+  I+ +
Sbjct  417   DRAVVEKAVREAME--SAQIRAAAQAMARQLRLDVADGGSSSSEIKRLVAFIRDL  469



>gb|EAZ03162.1| hypothetical protein OsI_25314 [Oryza sativa Indica Group]
Length=502

 Score =   287 bits (735),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 182/481 (38%), Positives = 255/481 (53%), Gaps = 48/481 (10%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P+P   HI+ ML+LA  L  + L VTF+ T H   +        +R R  S      IP
Sbjct  21    FPWPQQGHINPMLHLASALLDAGLHVTFLHTDHNLRHRFARPHHPTRLRLLS------IP  74

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGE------DSAPQ--RCII  479
             DGLP    DDH  +  G+++LL S+   +    + +++T          D AP    C++
Sbjct  75    DGLP----DDHPRAVGGLIELLDSMRTASSAAYRALLLTESSRSRPDSLDDAPPPVTCVV  130

Query  480   ADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVK  659
              DG   FA+ VAEE+GVP ++F   SA A  AY S+P L++ GE P      DE +  V 
Sbjct  131   VDGVMPFAITVAEEIGVPALAFRTESAFAFLAYLSVPRLLELGETPVPS---DEQVRGVP  187

Query  660   GMEKLLRRRDLPG--NCRVDDL----EDP---FFKFMMEFRKCFRTKHHIINSFQELEGS  812
             GME LLRRRDLP     + DD+     DP             C  ++  I+N+   +EG 
Sbjct  188   GMEGLLRRRDLPRVVPTKQDDVGAEEADPVPVLLTIADTAAHCRNSRALILNTAASMEGP  247

Query  813   TLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSV  992
              + ++    M +V+A+GPLH     ++ +  + L    +   +D   C  WLD Q   SV
Sbjct  248   AIARI-APHMRDVFAVGPLHA----RVATNTIALEKHED---DDDYGCKAWLDGQDDRSV  299

Query  993   LYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGR  1172
             +YV  G+LT++S E LAEF HGL+ +G  FL+ L P +V +       V  E +     R
Sbjct  300   VYVNLGSLTVLSSEQLAEFLHGLVAAGYAFLFVLQPDMVASSSA----VLQEAVEAAGER  355

Query  1173  CCVVEWAPQ--QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGE  1346
               VVEW P+    VL H AVG FL H GWNS++E+ V GVP++ WPF+ADQ V SRF+  
Sbjct  356   ALVVEWVPRDVHYVLRHGAVGCFLMHGGWNSMLEAAVEGVPVVCWPFFADQPVVSRFVAA  415

Query  1347  VWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENL  1526
             VWK GLDMKD CDR ++E+MVR+ ME    E    A+  A   +     GGSS S L+ L
Sbjct  416   VWKTGLDMKDVCDRAVVERMVREAME--SPEIRASAQAMARQLRLDVAAGGSSSSELQRL  473

Query  1527  I  1529
             +
Sbjct  474   V  474



>gb|KCW66542.1| hypothetical protein EUGRSUZ_F00339 [Eucalyptus grandis]
Length=460

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 176/467 (38%), Positives = 250/467 (54%), Gaps = 27/467 (6%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDH  356
             MLNLA+LL      VTF+ T +  + LL  S   S       FRF TIPDGLP    D  
Sbjct  1     MLNLAKLLHCRGFHVTFVNTEYNHSRLL-RSRGPSSLDGLPSFRFRTIPDGLPPSDGDTT  59

Query  357   RSSGVGIVQLLHSLSATAKPF----LKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEV  524
             +     I  L  S      P+    LK +   S    S P  C+++D    F +D AE +
Sbjct  60    QD----IPALCQSTQRCCLPYFQDLLKRLNEESATSGSPPVSCVVSDITMTFTLDAAEAI  115

Query  525   GVPIISFHPVSAAATWAYFSIPSLIQAGELPF-------NGKDMDEPILSVKGMEKLLRR  683
             GVP + F P+SA A   +    SLI  G +P        NG ++D  I  + GM  + R 
Sbjct  116   GVPEVLFWPISACAFMGFLQFRSLIDKGLVPLKDASYLTNG-NLDTVIDWIPGMRNI-RL  173

Query  684   RDLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP   R  D +DP   F ++EF +  R    + N+F+ LE   L+ ++      +Y I
Sbjct  174   RDLPSFIRTTDPDDPMINFCLVEFARAKRASAWVFNTFERLEHEVLEALK-AMFPPIYTI  232

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP+H LL  +L   +  L   +  L ++   C++WLD +PP+SVLYV FG++T++S   L
Sbjct  233   GPIH-LLLEQLSDDDTRLIRFN--LWKEDLGCLEWLDSKPPSSVLYVNFGSITVISPAQL  289

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHS  1220
              EF  GL NSGQ FLW + P LV+        +P + L     R  +  W PQ+ VL+HS
Sbjct  290   VEFAWGLANSGQVFLWVIRPDLVIGNT---AILPPDFLAATRERSLLASWCPQERVLSHS  346

Query  1221  AVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIE  1400
             AVGGFLTHCGWNSI+ESI A VP++ WPF+ADQQ N R+  + W IG+++ +   R  +E
Sbjct  347   AVGGFLTHCGWNSIIESIEASVPVVCWPFFADQQTNCRYSCQEWGIGMEIDNDVRRDEVE  406

Query  1401  KMVRDLME-VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
             + VR+LME  R  E  ++  ++   A+E     GSS  +L+ +I  +
Sbjct  407   RQVRELMEGGRGKEMKRKVMEWKEMAREATHPSGSSFLNLDEVINKV  453



>ref|XP_006658565.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Oryza brachyantha]
Length=505

 Score =   286 bits (732),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 175/486 (36%), Positives = 250/486 (51%), Gaps = 45/486 (9%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P+P+  HI+ M +LA     +   VTF+ T H   NL      ++        RF ++P
Sbjct  12    FPWPAQGHINPMAHLAVAFAGAGAHVTFLHTDH---NLRRLGSAVAA--ASPRLRFLSVP  66

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA--------------  461
             DGLP    D+H  S   I+++  SL+   +   + ++ +                     
Sbjct  67    DGLP----DEHPRSVADILEIGRSLATAGRVAYRALLASLLQPQPGGHGGADAGTGAGGG  122

Query  462   ----PQRCIIADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFN-G  626
                 P   ++ADG   FA+D+AEE+GVP ++F   SA +  AY S+P L + GELPF  G
Sbjct  123   GCFPPVTAVVADGLLTFAIDIAEELGVPALAFRTTSACSVLAYLSVPKLFELGELPFPPG  182

Query  627   KDMDEPILSVKGMEKLLRRRDLPGNCRV--DDLE-DPFFKFMME-FRKCFRTKHHII-NS  791
              D+DEP+  V GME  LRRRDLP   R   DD +  P  + ++E   + F+    +I N+
Sbjct  183   GDLDEPVRGVPGMEGFLRRRDLPSPFRRHGDDHDVGPMLQPVVEHITQSFKQARAVILNT  242

Query  792   FQELEGSTLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLD  971
                LEG  +  +      +VY IGPLH +      +   +L    +G       C+ WLD
Sbjct  243   AASLEGPVVAHI-APHARDVYTIGPLHAMSPAPATASAASLWKEDDG-------CLPWLD  294

Query  972   RQPPNSVLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEI  1151
              +   SV+YV  G+LT++S E   EF  GL+ +G  FLW L P +V   +    +     
Sbjct  295   ARADRSVVYVSLGSLTVISLEQFTEFLSGLVAAGHPFLWVLRPDMVAASQNAAVQEAVRA  354

Query  1152  LNGLEGRCCVVEWAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNS  1331
               G      VVEWA Q++V  H AVG FLTH GWNS +E+ V G+PM+ WPF+ADQQ NS
Sbjct  355   AAGNSKAAGVVEWARQRDVRRHRAVGCFLTHAGWNSTLEAAVEGIPMVCWPFFADQQTNS  414

Query  1332  RFLGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSIS  1511
             RF+G VW+ GLDMKD CDR ++E+MVR  ME    E     +  A   +     GGSS  
Sbjct  415   RFVGGVWRTGLDMKDVCDRAVVERMVRLAME--SGEIRASTQALARQVRRDVAAGGSSAR  472

Query  1512  SLENLI  1529
              L+ L+
Sbjct  473   ELKRLV  478



>gb|KCW66544.1| hypothetical protein EUGRSUZ_F00340 [Eucalyptus grandis]
Length=460

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 178/466 (38%), Positives = 246/466 (53%), Gaps = 25/466 (5%)
 Frame = +3

Query  177   MLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGLPHGLTDDH  356
             MLNLA+LL      VTF+ T +  N LL  S   S       FRF TIPDGLP    D  
Sbjct  1     MLNLAKLLHDRGFHVTFVNTEYNHNRLL-RSRGPSSLDSLPSFRFRTIPDGLPPSDGDAT  59

Query  357   RSSGVGIVQLLHSLSATAKPF----LKEIVVTSGGEDSAPQRCIIADGFANFAVDVAEEV  524
             +     I  L  S      P+    LK +   S    S P  C+++D    F +D AE V
Sbjct  60    QD----IPALCQSTQERCLPYFQDLLKRLDEESATSGSPPVSCVVSDVSTTFTLDAAEAV  115

Query  525   GVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD------MDEPILSVKGMEKLLRRR  686
             GVP + F P+SA A   +    SLI  G  P           +D  I  + GM  + R R
Sbjct  116   GVPEVLFWPISACAFMGFLQFRSLIDEGLAPLKDASYLTNGYLDTIIDWIPGMRNI-RLR  174

Query  687   DLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAIG  863
             DLP   R  D +DP   F ++EF +  R    + N+F+ LE   L+ ++      +Y IG
Sbjct  175   DLPSFIRTTDPDDPMLNFCLVEFARAKRASAWVFNTFERLEHEVLEALK-AMFPPIYTIG  233

Query  864   PLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETLA  1043
             P+H LL  +L   +  L   +  L ++   C++WLD +PP SV+YV FG++T++S   L 
Sbjct  234   PIH-LLLEQLSDDDTRLIRFN--LWKEDLGCLEWLDLKPPGSVVYVNFGSITVMSPAQLV  290

Query  1044  EFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQEVLAHSA  1223
             EF  GL NSGQ FLW + P LV   K     +P + L     R  +V W PQ+ VL+HSA
Sbjct  291   EFAWGLANSGQVFLWVIRPDLV---KGNTAILPPDFLAATRERSLLVSWCPQERVLSHSA  347

Query  1224  VGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTCDRHIIEK  1403
             VGGFLTHCGWNSI+ESI A VP+  WPF+ADQQ N R+  + W IG+++     R  +E+
Sbjct  348   VGGFLTHCGWNSIIESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEIDSDVRRDEVER  407

Query  1404  MVRDLME-VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
              VR+LME  R  E  ++A ++   A+E     GSS  +L+ +I+ +
Sbjct  408   QVRELMEGERGKEMKRKAMEWKEMAREATCPSGSSFLNLDEVIDKV  453



>ref|XP_009781211.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=352

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 156/351 (44%), Positives = 216/351 (62%), Gaps = 21/351 (6%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  H++SML LAQLL LS+  V+F+ TV   + LL  +DV+SRF   S F  + +P
Sbjct  13    FPFPAQGHVNSMLKLAQLLSLSNFHVSFLVTVDTHDRLLNHTDVLSRFG--SEFHLQALP  70

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANFA  503
             DG+   L + +   GVG  +L  SL+  AKPFL+E +         P  C+IADG  + A
Sbjct  71    DGI--SLDEMNTRDGVG--KLYDSLNTIAKPFLREFLA------EPPVTCVIADGILSMA  120

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLLRR  683
              DVAEE+ +PII F  +SA A W+YFSIP L+QA ELP     MD  +  VKGME  LR 
Sbjct  121   ADVAEEINLPIIYFRTISACAFWSYFSIPELLQASELPLKLNGMDITLTKVKGMEDFLRG  180

Query  684   RDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDMLNVYAI  860
             RDLP  CRV DL    F+ +  E R+  R +  I+N+F++LEG  L Q+R     NVY I
Sbjct  181   RDLPSFCRVSDLTSADFRLLSTETRQTPRARGLILNTFEDLEGPILTQIRTV-CPNVYTI  239

Query  861   GPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLVSEETL  1040
             GP+H  L+ +L     T  TSSN L ++ + C++WLD QPP SVLYV FG++  V+ E L
Sbjct  240   GPVHAHLKARLA----TKCTSSNSLWQEDESCINWLDTQPPKSVLYVSFGSIAGVTREEL  295

Query  1041  AEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWA  1193
              EFW+GL+NS Q FLW +   L++ ++V + E+P E+  G + R  + +W 
Sbjct  296   LEFWYGLVNSDQNFLWVMRAGLIMGQEV-KHEIPVELEQGTKARGYMADWV  345



>ref|XP_004306404.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   285 bits (729),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 168/473 (36%), Positives = 261/473 (55%), Gaps = 23/473 (5%)
 Frame = +3

Query  153   PFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPD  326
             PFPS  H++ M+ LA+LL      +T + T      L+  S      +    F+F TIPD
Sbjct  17    PFPSQGHVNPMMQLAKLLYSRGFHITIVNTEFNHRRLI-RSRGSDSVKGLPDFQFATIPD  75

Query  327   GLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQ-RCIIADGFANFA  503
             GLP    D  +     +  L  S+  T +   KE+V         PQ  CI++DG   F 
Sbjct  76    GLPPSDKDATQD----VPPLCDSIRKTCRGPFKELVTKLNSSSEVPQITCIVSDGVTGFG  131

Query  504   VDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD------MDEPILSVKGM  665
              +VA+E+G+P + F   SA    AY     L++ G +PF  +       +D+P+  + GM
Sbjct  132   REVAKELGIPEVQFWTASACGFMAYLQYSELVKRGIVPFKDESFMEDGTLDKPVDWIPGM  191

Query  666   EKLLRRRDLPGNCRVDDLEDPFFKFM-MEFRKCFRTKHHIINSFQELEGSTLDQMRIGDM  842
              K +R +D+P   RV D+ D  F F+  E + C ++   I N+F ELE   L+++ +   
Sbjct  192   -KNMRLKDIPSFIRVTDVNDVMFDFLGSEAQNCLKSSAIIFNTFDELEHEVLEEISVM-F  249

Query  843   LNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTL  1022
              N+Y IGPL  L R+     N  + + S+GL ++  KC+ WLD+Q P+SV+YV +G++T+
Sbjct  250   PNIYTIGPLALLGRHV--PENKLVKSLSSGLWKEDVKCLKWLDKQKPDSVVYVNYGSVTM  307

Query  1023  VSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQQ  1202
             ++++ L EF  GL NS   FLW + P +V    V    +P E L  ++ R  +  W PQ+
Sbjct  308   MTDQHLREFAWGLANSKHHFLWIVRPDVVKGDSVV---LPEEFLKEIKDRGYIASWCPQE  364

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             +VLAH +VG FLTHCGWNS +E+I  GVP+I WPF+++QQ N RF    W IG+++ +  
Sbjct  365   QVLAHPSVGVFLTHCGWNSTIETISEGVPVICWPFFSEQQTNCRFACTEWGIGMEVNNDV  424

Query  1383  DRHIIEKMVRDLMEVRKDEFL-QRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
              R  IE++V++++   K   + Q AK++     E A  GGSS ++ + LIE +
Sbjct  425   KRDEIEELVKEMLVGEKGRKMRQMAKEWKKKVMEAADIGGSSYNNFDRLIEQV  477



>dbj|BAJ90455.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   285 bits (729),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 187/484 (39%), Positives = 252/484 (52%), Gaps = 42/484 (9%)
 Frame = +3

Query  147   AYPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
             A+P+P   HI+ ML+LA  L  + L+VTF+   H  +NL  F  V      +   R  ++
Sbjct  18    AFPWPLQGHINPMLHLASALLDAGLRVTFL---HTEHNLRRFIRVPPH---HPRLRLLSV  71

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVV-TSGGEDSAPQRCIIADGFAN  497
             PDGLP    DDH  S  G+++L+ S+   A    + +++ T   E      C++ADG   
Sbjct  72    PDGLP----DDHPRSVDGLMELVESMRTVASAAYRALLLRTMESEPDDAVTCVVADGVMP  127

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             FA+ VAE +GVP ++F   SA    AY S+P L++ GELP      DE +  V GME  L
Sbjct  128   FAISVAEGIGVPALAFRTESACGFLAYLSVPRLLELGELPVPS---DEQVHGVAGMEGFL  184

Query  678   RRRDLP---------GNCR---VDDLEDP---FFKFMMEFRKCFRTKHHIINSFQELEGS  812
             RRRDLP         GN     VD   DP            +C  ++  I+N+   +EG 
Sbjct  185   RRRDLPRVVPVPLQRGNGEEEEVDSGPDPVPVLLTIADTAARCGESRALILNTSASIEGL  244

Query  813   TLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSV  992
              L  +    M +V+A+GPLH        +   T T   +G   D      WLD     SV
Sbjct  245   ALSGI-APHMRDVFAVGPLHARRARARQAAAETKTEHVSG---DDMSLTAWLDGHEDRSV  300

Query  993   LYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLV--LNKKVERGEVPTEILNGLE  1166
             +YV  G+LT++S E LAEF HGL+ +G  FL      ++  +   V   E    +     
Sbjct  301   VYVNLGSLTIISSEQLAEFLHGLVAAGYAFLCVFRRDMLDLMTAAVSLREAVEAVAGAGI  360

Query  1167  GRCCVVEWAPQQE---VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRF  1337
              R  VVEWA Q++   VL H AVG FLTH GWNS +E+ V GVP + WPF+ADQQ NSRF
Sbjct  361   DRALVVEWALQRDAHHVLRHRAVGCFLTHGGWNSTLEAAVEGVPAVCWPFFADQQTNSRF  420

Query  1338  LGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSL  1517
             +G VWK GLDMKD CDR ++EKMVR+ ME    E    A+  A   +    E GSS S L
Sbjct  421   VGAVWKTGLDMKDVCDRAVVEKMVREAME--SPEIRASAQSMARQLRLDIAEAGSSSSEL  478

Query  1518  ENLI  1529
             E L+
Sbjct  479   ERLV  482



>dbj|BAJ89885.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   285 bits (729),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 188/484 (39%), Positives = 252/484 (52%), Gaps = 42/484 (9%)
 Frame = +3

Query  147   AYPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
             A+P+P   HI+ ML+LA  L  + L+VTF+ T H   NL  F  V      +   R  ++
Sbjct  18    AFPWPLQGHINPMLHLASALLDAGLRVTFLHTGH---NLRRFIRVPPH---HPRLRLLSV  71

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVV-TSGGEDSAPQRCIIADGFAN  497
             PDGLP    DDH  S  G+++L+ S+   A    + +++ T   E      C++ADG   
Sbjct  72    PDGLP----DDHPRSVDGLMELVESMRTVASAAYRALLLRTMESEPDDAVTCVVADGVMP  127

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             FA+ VAE +GVP ++F   SA    AY S+P L++ GELP      DE +  V GME  L
Sbjct  128   FAISVAEGIGVPALAFRTESACGFLAYLSVPRLLELGELPVPS---DEQVHGVAGMEGFL  184

Query  678   RRRDLP---------GNCR---VDDLEDP---FFKFMMEFRKCFRTKHHIINSFQELEGS  812
             RRRDLP         GN     VD   DP            +C  ++  I+N+   +EG 
Sbjct  185   RRRDLPRVVPVPLQRGNGEEEEVDSGPDPVPVLLTIADTAARCGESRALILNTSASIEGL  244

Query  813   TLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSV  992
              L  +    M +V+A+GPLH        +   T T   +G   D      WLD     SV
Sbjct  245   ALSGI-APHMRDVFAVGPLHARRARARQAAAETKTEHVSG---DDMSLTAWLDGHEDRSV  300

Query  993   LYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLV--LNKKVERGEVPTEILNGLE  1166
             +YV  G+LT++S E LAEF HGL+ +G  FL      ++  +   V   E    +     
Sbjct  301   VYVNLGSLTIISSEQLAEFLHGLVAAGYAFLCVFRRDMLDLMTAAVSLREAVEAVAGAGI  360

Query  1167  GRCCVVEWAPQQE---VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRF  1337
              R  VVEWA Q++   VL H AVG FLTH GWNS +E+ V GVP + WPF+ADQQ NSRF
Sbjct  361   DRALVVEWALQRDAHHVLRHRAVGCFLTHGGWNSTLEAAVEGVPAVCWPFFADQQTNSRF  420

Query  1338  LGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSL  1517
             +G VWK GLDMKD CDR ++EKMVR+ ME    E    A+  A   +    E GSS S L
Sbjct  421   VGAVWKTGLDMKDVCDRAVVEKMVREAME--SPEIRASAQSMARQLRLDIAEAGSSSSEL  478

Query  1518  ENLI  1529
             E L+
Sbjct  479   ERLV  482



>gb|KGN54319.1| hypothetical protein Csa_4G303180 [Cucumis sativus]
Length=471

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/478 (34%), Positives = 257/478 (54%), Gaps = 37/478 (8%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +PFP+  HI     LA LLC + L+VTF++T H    L   + + ++        F++I 
Sbjct  12    FPFPAKGHIKPFFCLAHLLCNAGLRVTFLSTEHHHQKLHNLTHLAAQI---PSLHFQSIS  68

Query  324   DGL----PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGF  491
             DGL    P  L D          QL  S+    KP  +++++ S  + ++P  C+I D  
Sbjct  69    DGLSLDHPRNLLDG---------QLFKSMPQVTKPLFRQLLL-SYKDGTSPITCVITDLI  118

Query  492   ANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEK  671
               F +DVA+E+ +P+  F   SA   + YFSIP L++ G++P+   + ++ +  + G E 
Sbjct  119   LRFPMDVAQELDIPVFCFSTFSARFLFLYFSIPKLLEDGQIPYPEGNSNQVLHGIPGAEG  178

Query  672   LLRRRDLPGNCRVDDLED--PFFKFMMEFRKCFRTKHHIINSFQELEGSTLDQMRIGDML  845
             LLR +DLPG   V+ + +  P   F+ +     ++   I+N+F ELE   +  +      
Sbjct  179   LLRCKDLPGYWSVEAVANYNPM-NFVNQTIATSKSHGLILNTFDELEVPFITNLS-KIYK  236

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
              VY IGP+H LL+        ++ T      ED   C+ WLD QPP SV++V FG++  +
Sbjct  237   KVYTIGPIHSLLKK-------SVQTQYEFWKED-HSCLAWLDSQPPRSVMFVSFGSIVKL  288

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEIL------NGLEGRCCVVE  1187
                 L EFW+GL++SG+ FL  L    ++ +  E  E   E++         EGR  +V 
Sbjct  289   KSSQLKEFWNGLVDSGKAFLLVLRSDALVEETGEEDEKQKELVIKEIMETKEEGRWVIVN  348

Query  1188  WAPQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLD  1367
             WAPQ++VL H A+GGFLTH GWNS +ES+  GVPM+ WP   DQ  N+ +L +VWKIG++
Sbjct  349   WAPQEKVLEHKAIGGFLTHSGWNSTLESVAVGVPMVSWPQIGDQPSNATWLSKVWKIGVE  408

Query  1368  MKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIK  1541
             M+D+ DR  +E  VR +ME    +      + A    +   + G+S  +L+ LIEDI+
Sbjct  409   MEDSYDRSTVESKVRSIMEHEDKKMENAIVELAKRVDDRVSKEGTSYQNLQRLIEDIE  466



>dbj|BAJ85877.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   283 bits (723),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 186/484 (38%), Positives = 252/484 (52%), Gaps = 42/484 (9%)
 Frame = +3

Query  147   AYPFP--SHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETI  320
             A+P+P   HI+ ML+LA  L  + L+VTF+   H  +NL  F  V      +   R  ++
Sbjct  18    AFPWPLQGHINPMLHLASALLDAGLRVTFL---HTEHNLRRFIRVPPH---HPRLRLLSV  71

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVV-TSGGEDSAPQRCIIADGFAN  497
             PDGLP    DDH  S  G+++L+ S+   A    + +++ T   E      C++ADG   
Sbjct  72    PDGLP----DDHPRSVDGLMELVESMRTVASAAYRALLLRTMESEPDDAVTCVVADGVMP  127

Query  498   FAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVKGMEKLL  677
             FA+ VAE +GVP ++F   SA    AY S+P L++ GELP      DE +  V GME  L
Sbjct  128   FAISVAEGIGVPALAFRTESACGFLAYLSVPRLLELGELPVPS---DEQVHGVAGMEGFL  184

Query  678   RRRDLP---------GNCR---VDDLEDP---FFKFMMEFRKCFRTKHHIINSFQELEGS  812
             RRRDLP         GN     VD   DP            +C  ++  I+N+   +EG 
Sbjct  185   RRRDLPRVVPVPLQRGNGEEEEVDSGPDPVPVLLTIADIAARCGESRALILNTSASIEGL  244

Query  813   TLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSV  992
              L  +    M +V+A+GPLH        +   T T   +G   D      WLD     SV
Sbjct  245   ALSGI-APHMRDVFAVGPLHARRARARQAAAETKTEHVSG---DDMSLTAWLDGHEDRSV  300

Query  993   LYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLV--LNKKVERGEVPTEILNGLE  1166
             +YV  G+LT++S E LAEF HGL+ +G  FL      ++  +   V   E    +     
Sbjct  301   VYVNLGSLTIISSEQLAEFLHGLVAAGYAFLCVFRRDMLDLMTAAVSLREAVEAVAGAGI  360

Query  1167  GRCCVVEWAPQQE---VLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRF  1337
              R  VVEWA Q++   VL H AVG FLTH GWNS +++ V GVP + WPF+ADQQ NSRF
Sbjct  361   DRALVVEWALQRDAHHVLRHRAVGCFLTHGGWNSTLKAAVEGVPAVCWPFFADQQTNSRF  420

Query  1338  LGEVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSL  1517
             +G VWK GLDMKD CDR ++EKMVR+ ME    E    A+  A   +    E GSS S L
Sbjct  421   VGAVWKTGLDMKDVCDRAVVEKMVREAME--SPEIRASAQSMARQLRLDIAEAGSSSSEL  478

Query  1518  ENLI  1529
             E L+
Sbjct  479   ERLV  482



>ref|XP_010060017.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   281 bits (720),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 174/474 (37%), Positives = 247/474 (52%), Gaps = 24/474 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI+ MLNLA+LL      VTF+ T +  + LL  S   S       FRF TIPDGL
Sbjct  18    PAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLL-RSRGPSSLDGLPSFRFRTIPDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVV----TSGGEDSAPQRCIIADGFANF  500
             P     D       I  L  S S    P+ ++++      S    S P  C+++DG   F
Sbjct  77    P---PSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASGSPPVSCVVSDGMMTF  133

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD------MDEPILSVKG  662
              +D AE +GVP + F   SA     Y    SL+  G  P           +D  I  + G
Sbjct  134   TLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLKDASYLTNGYLDTTIDWIPG  193

Query  663   MEKLLRRRDLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGD  839
             M  + R RDLP   R  D +D    F + E ++  R    + N+F  LE   LD ++   
Sbjct  194   MRNI-RLRDLPSFLRTTDKDDLMIDFCLRETKRAKRASAIVFNTFDRLEHEVLDALK-AI  251

Query  840   MLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLT  1019
                +Y +GPLH LL  +L   N T +  SN   ED   C++WLD +PP+SV+YV FG++T
Sbjct  252   FPPIYTLGPLH-LLTKQLPD-NDTKSIGSNLWKED-LGCLEWLDSKPPSSVVYVNFGSIT  308

Query  1020  LVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQ  1199
             ++S   L EF  GL +SGQ FLW + P LV+    +   +P E  +    R  +  W PQ
Sbjct  309   VMSPAQLVEFAWGLADSGQTFLWVIRPDLVVG---DTAILPPEFSSSTRERSLLASWCPQ  365

Query  1200  QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDT  1379
             + VL+HSAVGGFLTH GWNS +ESI AGVPM+ WPF+ +QQ N R+  + W IG+++   
Sbjct  366   ERVLSHSAVGGFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIGMEIDSN  425

Query  1380  CDRHIIEKMVRDLME-VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
               R  + + VR+LME  R  E  ++A ++   A+E  +  GSS  +L+ +I+ +
Sbjct  426   VKRDEVSRQVRELMEGERGKEMKRKAMEWKEMAREATRPSGSSCLNLDEVIDKV  479



>gb|KCW66541.1| hypothetical protein EUGRSUZ_F00338, partial [Eucalyptus grandis]
Length=478

 Score =   281 bits (718),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 174/472 (37%), Positives = 246/472 (52%), Gaps = 24/472 (5%)
 Frame = +3

Query  153   PFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDGL  332
             P   HI+ MLNLA+LL      VTF+ T +  + LL  S   S       FRF TIPDGL
Sbjct  18    PAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLL-RSRGPSSLDGLPSFRFRTIPDGL  76

Query  333   PHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVV----TSGGEDSAPQRCIIADGFANF  500
             P     D       I  L  S S    P+ ++++      S    S P  C+++DG   F
Sbjct  77    P---PSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASGSPPVSCVVSDGMMTF  133

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD------MDEPILSVKG  662
              +D AE +GVP + F   SA     Y    SL+  G  P           +D  I  + G
Sbjct  134   TLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLKDASYLTNGYLDTTIDWIPG  193

Query  663   MEKLLRRRDLPGNCRVDDLEDPFFKF-MMEFRKCFRTKHHIINSFQELEGSTLDQMRIGD  839
             M  + R RDLP   R  D +D    F + E ++  R    + N+F  LE   LD ++   
Sbjct  194   MRNI-RLRDLPSFLRTTDKDDLMIDFCLRETKRAKRASAIVFNTFDRLEHEVLDALK-AI  251

Query  840   MLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLT  1019
                +Y +GPLH LL  +L   N T +  SN   ED   C++WLD +PP+SV+YV FG++T
Sbjct  252   FPPIYTLGPLH-LLTKQLPD-NDTKSIGSNLWKED-LGCLEWLDSKPPSSVVYVNFGSIT  308

Query  1020  LVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEWAPQ  1199
             ++S   L EF  GL +SGQ FLW + P LV+    +   +P E  +    R  +  W PQ
Sbjct  309   VMSPAQLVEFAWGLADSGQTFLWVIRPDLVVG---DTAILPPEFSSSTRERSLLASWCPQ  365

Query  1200  QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDT  1379
             + VL+HSAVGGFLTH GWNS +ESI AGVPM+ WPF+ +QQ N R+  + W IG+++   
Sbjct  366   ERVLSHSAVGGFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIGMEIDSN  425

Query  1380  CDRHIIEKMVRDLME-VRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIE  1532
               R  + + VR+LME  R  E  ++A ++   A+E  +  GSS  +L+ +I+
Sbjct  426   VKRDEVSRQVRELMEGERGKEMKRKAMEWKEMAREATRPSGSSCLNLDEVID  477



>ref|XP_004957721.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Setaria italica]
Length=456

 Score =   280 bits (716),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 177/475 (37%), Positives = 253/475 (53%), Gaps = 55/475 (12%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSG-FRFETI  320
             +P P+  H++S L+ +  L  + L VTF+ T H   NL             S   RF ++
Sbjct  14    FPVPAQGHLNSFLHFSTGLLRAGLHVTFLHTDH---NLRRLGAAAREAAAASPRLRFLSV  70

Query  321   PDGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSAPQRCIIADGFANF  500
             PDGLP    DD   +  GI            P L E + T+GG   A  R ++A      
Sbjct  71    PDGLP----DDDPRALDGI------------PRLMETLRTTGG---AAYRDLLAS-----  106

Query  501   AVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPF--NGKDMDEPILSVKGMEKL  674
                  EE+GVP I++  VSA +  AY S+P LI+ GELPF   G D+DEP+  V GME  
Sbjct  107   ----LEELGVPAIAYRTVSACSVLAYMSVPRLIELGELPFPEGGGDLDEPVRGVPGMESF  162

Query  675   LRRRDLPGNCR--VDDLEDPFFKFMMEFR-KCFRTKHHIINSFQELEGSTLDQMRIGDML  845
             LRRRDLP  CR   +  +DP  K ++    +  + +  ++N+   LE S+L  +   +M 
Sbjct  163   LRRRDLPIECRSLTETHQDPLLKAVVAATARSRKARALMLNTTASLERSSLTHL-AQEMR  221

Query  846   NVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFGTLTLV  1025
             +V+A+G LH +              +S   H+DG  C  WLD     SV+Y+  G+LT++
Sbjct  222   DVFAVGLLHAMF-------PAPAAATSLWRHDDG--CTAWLDGHAERSVVYISLGSLTVI  272

Query  1026  SEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGL-EGRCCVVEWAPQQ  1202
             S E   EF  GL+ +G  FLW L P ++      + +   E +  + E R  VV WAPQ+
Sbjct  273   SHEQFTEFLRGLVAAGYPFLWVLRPDML---GASQDDALREAVAAVGEDRALVVPWAPQR  329

Query  1203  EVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDMKDTC  1382
             +VL H AVG FLTH GWNS +E +  GVP++ WPF+ DQQ+NSRF+G VW+ GLDMKD C
Sbjct  330   DVLRHRAVGCFLTHAGWNSTVEGVAEGVPLVCWPFFVDQQINSRFVGAVWRNGLDMKDVC  389

Query  1383  DRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLENLIEDIKRM  1547
             +R ++E+ VR+ ME   DE  + A+  A   +    +GGSS      L+  IK +
Sbjct  390   ERDVVERTVREAME--SDEIRRSARALAEQVERDIADGGSSAMEFGRLVGFIKEL  442



>ref|NP_001062593.1| Os09g0119600 [Oryza sativa Japonica Group]
 dbj|BAD20019.1| UDP-glucose glucosyltransferase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF24507.1| Os09g0119600 [Oryza sativa Japonica Group]
 gb|EAZ43782.1| hypothetical protein OsJ_28402 [Oryza sativa Japonica Group]
 dbj|BAG86872.1| unnamed protein product [Oryza sativa Japonica Group]
Length=504

 Score =   281 bits (719),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 182/482 (38%), Positives = 255/482 (53%), Gaps = 46/482 (10%)
 Frame = +3

Query  150   YPFPS--HIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIP  323
             +P+P   HI+ ML+LA  L  + L VTF+ T H   +        +R R  S      IP
Sbjct  19    FPWPQQGHINPMLHLASALLDAGLHVTFLHTDHNLRHRFARPHHPTRLRLLS------IP  72

Query  324   DGLPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGE------DSAPQ--RCII  479
             DGLP    DDH  +  G+++LL S+   +    + +++T          D AP    C++
Sbjct  73    DGLP----DDHPRAVGGLIELLDSMRTASSAAYRALLLTESSRSRPDSLDDAPPPVTCVV  128

Query  480   ADGFANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKDMDEPILSVK  659
              DG   FA+ VAEE+GVP ++F   SA A  AY S+P L++ GE P      DE +  V 
Sbjct  129   VDGVMPFAITVAEEIGVPALAFRTESAFAFLAYLSVPRLLELGETPVPS---DEQVRGVP  185

Query  660   GMEKLLRRRDLPG--NCRVDDL----EDP---FFKFMMEFRKCFRTKHHIINSFQELEGS  812
             GME LLRRRDLP     + DD+     DP             C  ++  I+N+   +EG 
Sbjct  186   GMEGLLRRRDLPRVVPTKQDDVGAEEADPVPVLLTVADTAAHCRNSRALILNTAASMEGP  245

Query  813   TLDQMRIGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKK-CMDWLDRQPPNS  989
              + ++    M +V+A+GPLH     ++ +  + L    +   +D    C  WLD Q   S
Sbjct  246   AIARI-APHMRDVFAVGPLHA----RVATNTIALEKHEDDDEDDDDYGCKAWLDGQDDRS  300

Query  990   VLYVCFGTLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEG  1169
             V+YV  G+LT++S E LAEF HGL+ +G  FL+ L P +V +       V  E +     
Sbjct  301   VVYVNLGSLTVLSSEQLAEFLHGLVAAGYAFLFVLQPDMVASSSA----VLQEAVEAAGE  356

Query  1170  RCCVVEWAPQ--QEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLG  1343
             R  VVEW P+    VL H AVG FL H GWNS++E+ V GVP++ WPF+ADQ V SRF+ 
Sbjct  357   RALVVEWVPRDVHYVLRHRAVGCFLMHGGWNSMLEAAVEGVPVVCWPFFADQPVVSRFVA  416

Query  1344  EVWKIGLDMKDTCDRHIIEKMVRDLMEVRKDEFLQRAKQFANSAKECAKEGGSSISSLEN  1523
              VWK GLDMKD CDR ++E+MVR+ ME    E    A+  A   +     GGSS S L+ 
Sbjct  417   AVWKTGLDMKDVCDRAVVERMVREAME--SPEIRASAQAMARQLRLDVAAGGSSSSELQR  474

Query  1524  LI  1529
             L+
Sbjct  475   LV  476



>ref|XP_003618663.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES74881.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=485

 Score =   280 bits (717),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/477 (35%), Positives = 252/477 (53%), Gaps = 25/477 (5%)
 Frame = +3

Query  150   YPFPSHIHSMLNLAQLLCLSHLKVTFITTVHARNNLLCFSDVISRFRCYSGFRFETIPDG  329
             YP   HI+ ++ LA+LL L    +TF+ T +    LL  S   + F  ++ F FE IPDG
Sbjct  13    YPVQGHINPLIKLAKLLHLRGFHITFVNTEYNHKRLLK-SRGPNAFVGFTDFTFEAIPDG  71

Query  330   LPHGLTDDHRSSGVGIVQLLHSLSATAKPFLKEIVVTSGGEDSA------PQRCIIADGF  491
             LP    D        I  L  S+        +E++  S   DSA      P  CIIAD  
Sbjct  72    LPSNEGDGDGDVSQDIYALCESIRKNFLQPFRELI--SRLNDSATSGLVPPVTCIIADNS  129

Query  492   ANFAVDVAEEVGVPIISFHPVSAAATWAYFSIPSLIQAGELPFNGKD------MDEPILS  653
              +F +   EE+ +P++ F P +A   W  F + +L   G +P   +       +D  +  
Sbjct  130   MSFTIQAGEELSIPVVFFSPANACTFWTGFHLLTLFDKGVIPLKDESYLTNGYLDTKVDC  189

Query  654   VKGMEKLLRRRDLPGNCRVDDLEDPFFKFMMEFR-KCFRTKHHIINSFQELEGSTLDQMR  830
             ++G++   R +DLPG  R+ D  D   +F +E   +  R    I N+  ELE   ++ + 
Sbjct  190   IQGLQNF-RLKDLPGYIRITDPNDCIVQFTIEAAGRAHRASAFIFNTSNELEKDVMNVLS  248

Query  831   IGDMLNVYAIGPLHELLRNKLGSCNVTLTTSSNGLHEDGKKCMDWLDRQPPNSVLYVCFG  1010
                  N+ AIGPL  LL     S    L + S  L ++  KC+DWL+ + P SV+YV FG
Sbjct  249   -STFPNICAIGPLSSLLSQ---SPQNHLASLSTNLWKEDTKCLDWLESKEPKSVVYVNFG  304

Query  1011  TLTLVSEETLAEFWHGLMNSGQRFLWALNPRLVLNKKVERGEVPTEILNGLEGRCCVVEW  1190
             ++T+++ E L EF  GL NS Q FLW + P LV+   V    + +E +N +  R  +  W
Sbjct  305   SMTVMTAEKLLEFAWGLANSKQPFLWIIRPDLVIGGSVV---LSSEFVNEISDRGLIASW  361

Query  1191  APQQEVLAHSAVGGFLTHCGWNSIMESIVAGVPMIGWPFYADQQVNSRFLGEVWKIGLDM  1370
              PQ++VL H ++GGFLTHCGWNS  ESI AGVPM+ WPF+ADQ  N R++   W+IG+++
Sbjct  362   CPQEQVLNHPSIGGFLTHCGWNSTTESICAGVPMLCWPFFADQPANCRYICNEWEIGMEI  421

Query  1371  KDTCDRHIIEKMVRDLMEVRKDEFL-QRAKQFANSAKECAKEGGSSISSLENLIEDI  1538
                  R  +EK+V +LM   K + + Q+A +    A+E  + GG S  +L+ +I ++
Sbjct  422   DTNVKRDEVEKLVNELMVGEKGKKMRQKAIELKKKAEEDTRPGGCSYMNLDKVINEV  478



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4708716422032