BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c35672_g1_i1 len=1479 path=[1:0-1478]

Length=1479
                                                                      Score     E

ref|XP_009761052.1|  PREDICTED: cytokinin dehydrogenase 5               747   0.0      
ref|XP_009609662.1|  PREDICTED: cytokinin dehydrogenase 5               744   0.0      
ref|NP_001274957.1|  cytokinin oxidase/dehydrogenase precursor          743   0.0      
ref|NP_001266251.1|  cytokinin oxidase/dehydrogenase-like precursor     732   0.0      
ref|XP_008377186.1|  PREDICTED: cytokinin dehydrogenase 5-like          726   0.0      
ref|XP_011083611.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    724   0.0      
emb|CDP07468.1|  unnamed protein product                                721   0.0      
ref|XP_002510450.1|  gulonolactone oxidase, putative                    720   0.0      Ricinus communis
ref|XP_010110013.1|  Cytokinin dehydrogenase 5                          721   0.0      
ref|XP_002280797.1|  PREDICTED: cytokinin dehydrogenase 5 isoform X1    716   0.0      Vitis vinifera
emb|CBI19763.3|  unnamed protein product                                718   0.0      
gb|KDP38564.1|  hypothetical protein JCGZ_04489                         716   0.0      
ref|XP_002300742.2|  cytokinin oxidase 6 family protein                 716   0.0      Populus trichocarpa [western balsam poplar]
gb|AIU94750.1|  cytokinin oxidase                                       714   0.0      
gb|EYU32888.1|  hypothetical protein MIMGU_mgv1a004444mg                715   0.0      
ref|XP_009335765.1|  PREDICTED: cytokinin dehydrogenase 5               715   0.0      
gb|KHG00982.1|  Cytokinin dehydrogenase 5 -like protein                 713   0.0      
emb|CAN81010.1|  hypothetical protein VITISV_017949                     711   0.0      Vitis vinifera
ref|XP_006435071.1|  hypothetical protein CICLE_v10000709mg             713   0.0      
ref|XP_004291832.1|  PREDICTED: cytokinin dehydrogenase 5-like          711   0.0      
ref|XP_007221789.1|  hypothetical protein PRUPE_ppa003895mg             711   0.0      
ref|XP_008387997.1|  PREDICTED: cytokinin dehydrogenase 5-like          711   0.0      
ref|XP_002307681.1|  hypothetical protein POPTR_0005s25380g             709   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006473567.1|  PREDICTED: cytokinin dehydrogenase 5-like          710   0.0      
ref|XP_011028922.1|  PREDICTED: cytokinin dehydrogenase 5-like          707   0.0      
ref|XP_008221343.1|  PREDICTED: cytokinin dehydrogenase 5               704   0.0      
ref|XP_010254676.1|  PREDICTED: cytokinin dehydrogenase 5-like          703   0.0      
ref|XP_007017645.1|  Cytokinin oxidase 5                                702   0.0      
gb|AHL64253.1|  cytokinin dehydrogenase 5                               702   0.0      
ref|XP_010061263.1|  PREDICTED: cytokinin dehydrogenase 5               701   0.0      
ref|XP_011048828.1|  PREDICTED: cytokinin dehydrogenase 5-like          701   0.0      
ref|XP_010275527.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    698   0.0      
dbj|BAM74648.1|  cytokinin oxidase/dehydrogenase                        695   0.0      
ref|XP_010672675.1|  PREDICTED: cytokinin dehydrogenase 5               689   0.0      
gb|KFK41981.1|  hypothetical protein AALP_AA2G196900                    684   0.0      
emb|CDY47521.1|  BnaAnng09190D                                          683   0.0      
ref|XP_006390301.1|  hypothetical protein EUTSA_v10018378mg             683   0.0      
ref|XP_009106198.1|  PREDICTED: cytokinin dehydrogenase 5               683   0.0      
ref|NP_177678.2|  cytokinin dehydrogenase 5                             680   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006577980.1|  PREDICTED: cytokinin dehydrogenase 5-like          679   0.0      
gb|KEH36208.1|  cytokinin oxidase/dehydrogenase-like protein            679   0.0      
ref|XP_002889026.1|  hypothetical protein ARALYDRAFT_476695             678   0.0      
gb|AAG30909.1|AF303982_1  cytokinin oxidase                             678   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444755.1|  PREDICTED: cytokinin dehydrogenase 5               677   0.0      
ref|NP_001185402.1|  cytokinin dehydrogenase 5                          675   0.0      
emb|CDX73174.1|  BnaC06g36220D                                          675   0.0      
ref|XP_010533263.1|  PREDICTED: cytokinin dehydrogenase 5               669   0.0      
ref|XP_003527677.1|  PREDICTED: cytokinin dehydrogenase 5-like          668   0.0      
gb|KHN45882.1|  Cytokinin dehydrogenase 5                               663   0.0      
ref|XP_004500976.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    665   0.0      
ref|XP_007136628.1|  hypothetical protein PHAVU_009G060200g             665   0.0      
ref|XP_009398389.1|  PREDICTED: cytokinin dehydrogenase 5               664   0.0      
gb|KDO84681.1|  hypothetical protein CISIN_1g042782mg                   654   0.0      
ref|XP_006838693.1|  hypothetical protein AMTR_s00002p00248240          655   0.0      
ref|XP_010428567.1|  PREDICTED: cytokinin dehydrogenase 5 isoform X1    654   0.0      
ref|XP_010471656.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    653   0.0      
ref|XP_010416431.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    653   0.0      
ref|XP_006302113.1|  hypothetical protein CARUB_v10020114mg             653   0.0      
ref|XP_010932835.1|  PREDICTED: cytokinin dehydrogenase 5-like          650   0.0      
ref|XP_008796604.1|  PREDICTED: cytokinin dehydrogenase 5-like          649   0.0      
ref|XP_010907734.1|  PREDICTED: cytokinin dehydrogenase 5-like          645   0.0      
ref|XP_008804537.1|  PREDICTED: cytokinin dehydrogenase 5-like          642   0.0      
ref|XP_009408782.1|  PREDICTED: cytokinin dehydrogenase 5-like          637   0.0      
ref|XP_004152677.1|  PREDICTED: cytokinin dehydrogenase 5-like          632   0.0      
gb|AAG13068.1|AC023754_6  Similar to cytokinin oxidase                  630   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004970152.1|  PREDICTED: cytokinin dehydrogenase 5-like          606   0.0      
ref|XP_008672378.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X1    599   0.0      
gb|ADP38079.1|  cytokinin dehydrogenase 4                               599   0.0      
ref|XP_002458582.1|  hypothetical protein SORBIDRAFT_03g036160          598   0.0      Sorghum bicolor [broomcorn]
gb|AFW84922.1|  hypothetical protein ZEAMMB73_083779                    588   0.0      
ref|NP_001044409.1|  Os01g0775400                                       583   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001185960.1|  cytokinin dehydrogenase 4b precursor               582   0.0      
emb|CDM84390.1|  unnamed protein product                                580   0.0      
ref|XP_003569936.1|  PREDICTED: cytokinin dehydrogenase 5               572   0.0      
dbj|BAK01307.1|  predicted protein                                      570   0.0      
ref|XP_006646382.1|  PREDICTED: cytokinin dehydrogenase 5-like          561   0.0      
gb|KHG27003.1|  Cytokinin dehydrogenase 5 -like protein                 553   0.0      
ref|XP_004500977.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    548   0.0      
gb|KHN22222.1|  Cytokinin dehydrogenase 5                               535   0.0      
gb|KGN62632.1|  hypothetical protein Csa_2G362450                       528   0.0      
ref|XP_004295395.1|  PREDICTED: cytokinin dehydrogenase 6-like          530   0.0      
ref|XP_006843486.1|  hypothetical protein AMTR_s00053p00208790          528   2e-180   
ref|XP_009391556.1|  PREDICTED: cytokinin dehydrogenase 4-like is...    527   6e-180   
ref|XP_010279585.1|  PREDICTED: cytokinin dehydrogenase 9-like          525   2e-178   
ref|XP_010938664.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X1    523   3e-178   
ref|XP_004303072.1|  PREDICTED: cytokinin dehydrogenase 6-like          522   8e-178   
gb|EMS58043.1|  Cytokinin dehydrogenase 5                               521   3e-177   
ref|XP_009793978.1|  PREDICTED: cytokinin dehydrogenase 3               520   7e-177   
ref|XP_007131444.1|  hypothetical protein PHAVU_011G014000g             520   1e-176   
gb|KDO83251.1|  hypothetical protein CISIN_1g008291mg                   520   2e-176   
ref|XP_006438909.1|  hypothetical protein CICLE_v10031210mg             518   3e-176   
dbj|BAK52671.1|  cytokinin oxidase                                      519   4e-176   
ref|XP_002304773.1|  FAD-binding domain-containing family protein       517   6e-176   Populus trichocarpa [western balsam poplar]
ref|XP_009417944.1|  PREDICTED: cytokinin dehydrogenase 4-like          517   7e-176   
ref|XP_010938665.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X2    517   7e-176   
ref|XP_008796239.1|  PREDICTED: cytokinin dehydrogenase 9-like          517   1e-175   
ref|XP_011088157.1|  PREDICTED: cytokinin dehydrogenase 6-like          516   1e-175   
ref|XP_010670377.1|  PREDICTED: cytokinin dehydrogenase 6-like          516   2e-175   
ref|XP_006482960.1|  PREDICTED: cytokinin dehydrogenase 6-like          516   2e-175   
ref|XP_009610079.1|  PREDICTED: cytokinin dehydrogenase 3               516   2e-175   
ref|XP_002513118.1|  Cytokinin dehydrogenase, putative                  516   2e-175   Ricinus communis
ref|XP_002270841.2|  PREDICTED: cytokinin dehydrogenase 9               516   2e-175   Vitis vinifera
emb|CBI28611.3|  unnamed protein product                                518   4e-175   
ref|XP_011042115.1|  PREDICTED: cytokinin dehydrogenase 6-like          515   4e-175   
ref|XP_010262099.1|  PREDICTED: cytokinin dehydrogenase 3-like          515   4e-175   
ref|XP_002284560.2|  PREDICTED: cytokinin dehydrogenase 1-like          516   6e-175   Vitis vinifera
ref|XP_006421171.1|  hypothetical protein CICLE_v10006491mg             514   2e-174   
ref|XP_007008757.1|  Cytokinin oxidase/dehydrogenase 6 isoform 1        514   2e-174   
ref|XP_010242231.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X1    513   3e-174   
ref|NP_001243813.1|  cytokinin dehydrogenase 3-like                     513   4e-174   
ref|XP_002514119.1|  gulonolactone oxidase, putative                    513   4e-174   Ricinus communis
ref|XP_007219000.1|  hypothetical protein PRUPE_ppa004120mg             512   1e-173   
gb|KDP40485.1|  hypothetical protein JCGZ_24484                         511   1e-173   
ref|XP_006292397.1|  hypothetical protein CARUB_v10018610mg             512   1e-173   
ref|XP_008811766.1|  PREDICTED: cytokinin dehydrogenase 4-like          511   1e-173   
ref|XP_006654329.1|  PREDICTED: cytokinin dehydrogenase 9-like          511   2e-173   
ref|XP_006411418.1|  hypothetical protein EUTSA_v10016470mg             512   2e-173   
gb|EPS70157.1|  hypothetical protein M569_04602                         510   2e-173   
ref|NP_181682.1|  cytokinin dehydrogenase 1                             512   3e-173   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM74647.1|  cytokinin oxidase/dehydrogenase                        510   4e-173   
ref|XP_009391555.1|  PREDICTED: cytokinin dehydrogenase 4-like is...    511   5e-173   
ref|XP_008349298.1|  PREDICTED: cytokinin dehydrogenase 6-like          509   7e-173   
ref|XP_009368087.1|  PREDICTED: cytokinin dehydrogenase 6-like          509   7e-173   
ref|XP_009408848.1|  PREDICTED: cytokinin dehydrogenase 6-like          509   1e-172   
ref|XP_006491496.1|  PREDICTED: cytokinin dehydrogenase 1-like          510   1e-172   
ref|XP_007008758.1|  Cytokinin oxidase/dehydrogenase 6 isoform 2        509   1e-172   
gb|KHN39533.1|  Cytokinin dehydrogenase 6                               509   1e-172   
ref|XP_002879935.1|  ATCKX1/CKX1                                        510   1e-172   
ref|XP_008797779.1|  PREDICTED: cytokinin dehydrogenase 6-like          509   2e-172   
ref|XP_003538221.1|  PREDICTED: cytokinin dehydrogenase 6               509   2e-172   
ref|XP_010269658.1|  PREDICTED: cytokinin dehydrogenase 1-like          509   2e-172   
ref|XP_009784170.1|  PREDICTED: cytokinin dehydrogenase 6-like is...    509   2e-172   
ref|XP_003542331.1|  PREDICTED: cytokinin dehydrogenase 3-like          508   2e-172   
ref|XP_008375236.1|  PREDICTED: cytokinin dehydrogenase 6-like          508   3e-172   
ref|XP_007149023.1|  hypothetical protein PHAVU_005G034000g             508   3e-172   
ref|XP_006645310.1|  PREDICTED: cytokinin dehydrogenase 4-like          508   4e-172   
gb|KDO49370.1|  hypothetical protein CISIN_1g009793mg                   508   4e-172   
ref|XP_010921880.1|  PREDICTED: cytokinin dehydrogenase 9-like          508   4e-172   
ref|XP_009354403.1|  PREDICTED: cytokinin dehydrogenase 6-like          508   4e-172   
ref|XP_010106427.1|  Cytokinin dehydrogenase 1                          507   5e-172   
ref|XP_006475463.1|  PREDICTED: cytokinin dehydrogenase 3-like          507   5e-172   
gb|KHN11723.1|  Cytokinin dehydrogenase 6                               508   5e-172   
ref|XP_003605865.1|  Cytokinin oxidase                                  507   8e-172   
ref|XP_007154651.1|  hypothetical protein PHAVU_003G136400g             507   8e-172   
ref|XP_002876723.1|  predicted protein                                  507   8e-172   
ref|NP_001055371.2|  Os05g0374200                                       506   1e-171   Oryza sativa Japonica Group [Japonica rice]
gb|AII20187.1|  cytokinin oxidase/dehydrogenase-like 7                  507   2e-171   
ref|XP_011037797.1|  PREDICTED: cytokinin dehydrogenase 6-like          506   2e-171   
ref|NP_001244909.1|  cytokinin oxidase/dehydrogenase-like 2             506   2e-171   
ref|XP_009590336.1|  PREDICTED: cytokinin dehydrogenase 6-like          506   2e-171   
gb|KHN35852.1|  Cytokinin dehydrogenase 3                               505   2e-171   
ref|XP_006451484.1|  hypothetical protein CICLE_v10007992mg             506   2e-171   
ref|XP_008445865.1|  PREDICTED: cytokinin dehydrogenase 6               506   2e-171   
emb|CBI27904.3|  unnamed protein product                                504   2e-171   
ref|XP_002279519.1|  PREDICTED: cytokinin dehydrogenase 3               505   2e-171   Vitis vinifera
ref|XP_003539919.1|  PREDICTED: cytokinin dehydrogenase 6-like          506   2e-171   
ref|XP_003534923.1|  PREDICTED: cytokinin dehydrogenase 3-like          506   3e-171   
gb|EAY97807.1|  hypothetical protein OsI_19727                          505   3e-171   Oryza sativa Indica Group [Indian rice]
ref|XP_003534375.1|  PREDICTED: cytokinin dehydrogenase 6-like          505   5e-171   
ref|XP_007138720.1|  hypothetical protein PHAVU_009G231700g             505   6e-171   
ref|XP_010067774.1|  PREDICTED: cytokinin dehydrogenase 6-like          505   6e-171   
ref|XP_004143695.1|  PREDICTED: cytokinin dehydrogenase 6-like          505   6e-171   
ref|XP_011075363.1|  PREDICTED: cytokinin dehydrogenase 1               505   7e-171   
ref|NP_001105526.1|  cytokinin oxidase 2 precursor                      504   1e-170   Zea mays [maize]
gb|AFW83998.1|  cytokinin oxidase 3, mRNA                               503   1e-170   
gb|AFK79777.1|  cytokinin oxidase/dehydrogenase                         502   1e-170   
ref|XP_003547474.1|  PREDICTED: cytokinin dehydrogenase 3-like          504   1e-170   
ref|XP_010090055.1|  Cytokinin dehydrogenase 3                          504   1e-170   
ref|XP_009784168.1|  PREDICTED: cytokinin dehydrogenase 6-like is...    504   1e-170   
ref|XP_006368582.1|  FAD-binding domain-containing family protein       504   1e-170   
emb|CBI37291.3|  unnamed protein product                                501   2e-170   
ref|XP_003565050.1|  PREDICTED: cytokinin dehydrogenase 4               503   2e-170   
dbj|BAG16373.1|  cytokinin oxidase family protein                       503   2e-170   Brassica oleracea var. italica [asparagus broccoli]
gb|KFK36997.1|  hypothetical protein AALP_AA4G199000                    504   2e-170   
dbj|BAM74650.1|  cytokinin oxidase/dehydrogenase                        504   2e-170   
gb|AFW83999.1|  LOW QUALITY PROTEIN: cytokinin oxidase 3                503   3e-170   
ref|XP_002263646.1|  PREDICTED: cytokinin dehydrogenase 3               503   3e-170   Vitis vinifera
ref|NP_191903.3|  cytokinin oxidase/dehydrogenase 6                     503   3e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141995.1|  PREDICTED: cytokinin dehydrogenase 1-like          503   3e-170   
ref|NP_001244908.1|  cytokinin oxidase/dehydrogenase-like 7 precu...    503   3e-170   
ref|XP_010912967.1|  PREDICTED: cytokinin dehydrogenase 6               503   4e-170   
ref|NP_001275006.1|  cytokinin oxidase/dehydrogenase                    503   5e-170   
emb|CDX79932.1|  BnaA05g02240D                                          502   6e-170   
ref|XP_010505935.1|  PREDICTED: cytokinin dehydrogenase 1               504   7e-170   
emb|CAE55201.1|  cytokinin oxidase 3                                    501   9e-170   Zea mays [maize]
ref|XP_006293839.1|  hypothetical protein CARUB_v10022823mg             505   9e-170   
ref|XP_007012819.1|  Cytokinin oxidase                                  501   2e-169   
dbj|BAF00384.1|  cytokinin oxidase -like protein                        501   2e-169   Arabidopsis thaliana [mouse-ear cress]
emb|CDP03155.1|  unnamed protein product                                501   2e-169   
ref|XP_004251670.1|  PREDICTED: cytokinin dehydrogenase 3               501   2e-169   
ref|NP_001105163.1|  cytokinin oxidase 3 precursor                      500   3e-169   Zea mays [maize]
ref|XP_010090224.1|  Cytokinin dehydrogenase 1                          501   4e-169   
ref|XP_006351290.1|  PREDICTED: cytokinin dehydrogenase 1-like          500   4e-169   
ref|XP_008459369.1|  PREDICTED: cytokinin dehydrogenase 3-like          500   4e-169   
ref|XP_004142714.1|  PREDICTED: cytokinin dehydrogenase 1-like          500   5e-169   
ref|XP_002456917.1|  hypothetical protein SORBIDRAFT_03g045410          499   5e-169   Sorghum bicolor [broomcorn]
gb|KHN32384.1|  Cytokinin dehydrogenase 6                               500   5e-169   
ref|XP_006402274.1|  hypothetical protein EUTSA_v10005878mg             500   6e-169   
dbj|BAL04493.1|  cytokinin oxidase                                      500   6e-169   
ref|XP_007162153.1|  hypothetical protein PHAVU_001G128800g             501   7e-169   
ref|XP_008464594.1|  PREDICTED: cytokinin dehydrogenase 1 isoform X1    499   1e-168   
gb|KHN14944.1|  Cytokinin dehydrogenase 1                               499   1e-168   
ref|XP_010242232.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X2    499   1e-168   
emb|CDY14777.1|  BnaC04g47740D                                          499   1e-168   
emb|CDY23844.1|  BnaC04g01930D                                          501   1e-168   
emb|CDP13849.1|  unnamed protein product                                495   2e-168   
gb|KHN13439.1|  Cytokinin dehydrogenase 3                               494   2e-168   
ref|XP_003553393.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    499   2e-168   
ref|XP_003635659.1|  PREDICTED: cytokinin dehydrogenase 3-like          494   2e-168   
ref|XP_010672924.1|  PREDICTED: cytokinin dehydrogenase 1-like          498   3e-168   
ref|XP_009767664.1|  PREDICTED: cytokinin dehydrogenase 1-like          498   3e-168   
ref|XP_002439706.1|  hypothetical protein SORBIDRAFT_09g018640          497   3e-168   Sorghum bicolor [broomcorn]
ref|XP_004513273.1|  PREDICTED: cytokinin dehydrogenase 6-like          502   4e-168   
ref|XP_010517646.1|  PREDICTED: cytokinin dehydrogenase 1-like          499   5e-168   
dbj|BAG16379.1|  cytokinin oxidase family protein                       497   5e-168   Brassica rapa var. perviridis [kabuna]
ref|XP_009630860.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    497   5e-168   
ref|XP_002308930.2|  hypothetical protein POPTR_0006s04650g             498   6e-168   Populus trichocarpa [western balsam poplar]
ref|XP_010523657.1|  PREDICTED: cytokinin dehydrogenase 6               497   7e-168   
ref|XP_004971217.1|  PREDICTED: cytokinin dehydrogenase 4-like          496   7e-168   
ref|XP_009609443.1|  PREDICTED: cytokinin dehydrogenase 1-like          498   9e-168   
dbj|BAK52672.1|  cytokinin oxidase                                      497   1e-167   
emb|CDP14175.1|  unnamed protein product                                493   1e-167   
ref|XP_010508710.1|  PREDICTED: cytokinin dehydrogenase 1-like          498   1e-167   
ref|XP_008244287.1|  PREDICTED: cytokinin dehydrogenase 1               497   1e-167   
dbj|BAH47540.1|  cytokinin oxidase                                      496   1e-167   Zinnia violacea [garden zinnia]
ref|XP_010418548.1|  PREDICTED: cytokinin dehydrogenase 6               496   2e-167   
ref|XP_002308300.2|  Cytokinin dehydrogenase 3 precursor family p...    496   2e-167   Populus trichocarpa [western balsam poplar]
ref|XP_004508239.1|  PREDICTED: cytokinin dehydrogenase 3-like          496   2e-167   
ref|XP_009630800.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    496   2e-167   
ref|XP_006353538.1|  PREDICTED: cytokinin dehydrogenase 3               496   2e-167   
gb|ACM79256.1|  cytokinin oxidase/dehydrogenase                         495   2e-167   Gossypium hirsutum [American cotton]
ref|XP_009142753.1|  PREDICTED: cytokinin dehydrogenase 1-like          495   3e-167   
ref|XP_009393975.1|  PREDICTED: cytokinin dehydrogenase 6-like          495   4e-167   
ref|XP_007028626.1|  Cytokinin oxidase/dehydrogenase 1 isoform 1        496   4e-167   
ref|XP_010231472.1|  PREDICTED: cytokinin dehydrogenase 9               494   4e-167   
gb|EMS67590.1|  Cytokinin dehydrogenase 4                               491   4e-167   
emb|CAN77185.1|  hypothetical protein VITISV_039458                     494   4e-167   Vitis vinifera
ref|XP_002264445.1|  PREDICTED: cytokinin dehydrogenase 3               494   5e-167   Vitis vinifera
ref|XP_011009888.1|  PREDICTED: cytokinin dehydrogenase 3               495   5e-167   
ref|XP_002534458.1|  gulonolactone oxidase, putative                    494   7e-167   Ricinus communis
emb|CAN80714.1|  hypothetical protein VITISV_042932                     494   7e-167   Vitis vinifera
ref|XP_010523651.1|  PREDICTED: cytokinin dehydrogenase 1               495   8e-167   
ref|XP_009133497.1|  PREDICTED: cytokinin dehydrogenase 1-like          495   8e-167   
ref|XP_010468848.1|  PREDICTED: cytokinin dehydrogenase 6-like          494   8e-167   
ref|NP_001045353.1|  Os01g0940000                                       494   9e-167   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007203158.1|  hypothetical protein PRUPE_ppa024442mg             494   9e-167   
gb|EAY77168.1|  hypothetical protein OsI_05138                          494   9e-167   Oryza sativa Indica Group [Indian rice]
ref|XP_011048092.1|  PREDICTED: cytokinin dehydrogenase 1               494   1e-166   
ref|NP_001244907.1|  cytokinin oxidase/dehydrogenase-like 5 precu...    494   1e-166   
ref|XP_004962256.1|  PREDICTED: cytokinin dehydrogenase 9-like          493   1e-166   
ref|XP_004493454.1|  PREDICTED: cytokinin dehydrogenase 1-like          494   1e-166   
ref|XP_009782890.1|  PREDICTED: cytokinin dehydrogenase 1-like          494   2e-166   
ref|XP_007203595.1|  hypothetical protein PRUPE_ppb021417mg             492   3e-166   
ref|NP_001275401.1|  cytokinin oxidase/dehydrogenase 2                  493   3e-166   
emb|CDY11474.1|  BnaA09g40400D                                          489   5e-166   
ref|XP_003599606.1|  Cytokinin dehydrogenase                            493   5e-166   
ref|XP_008242354.1|  PREDICTED: cytokinin dehydrogenase 3-like          491   9e-166   
ref|XP_010547318.1|  PREDICTED: cytokinin dehydrogenase 6-like          491   1e-165   
gb|EMT30248.1|  Cytokinin dehydrogenase 1                               491   1e-165   
gb|EYU20769.1|  hypothetical protein MIMGU_mgv1a022053mg                491   2e-165   
ref|XP_008392337.1|  PREDICTED: cytokinin dehydrogenase 1-like          491   2e-165   
ref|XP_009116997.1|  PREDICTED: cytokinin dehydrogenase 6               491   2e-165   
ref|XP_009799177.1|  PREDICTED: cytokinin dehydrogenase 3-like          490   2e-165   
gb|AAN16383.1|  cytokinin dehydrogenase 2                               490   3e-165   Hordeum vulgare [barley]
emb|CBI33301.3|  unnamed protein product                                486   3e-165   
gb|EAZ14789.1|  hypothetical protein OsJ_04719                          486   4e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006604338.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    490   7e-165   
ref|XP_009363232.1|  PREDICTED: cytokinin dehydrogenase 1-like          489   9e-165   
ref|XP_003625100.1|  Cytokinin oxidase                                  489   1e-164   
ref|XP_004514814.1|  PREDICTED: cytokinin dehydrogenase 6-like          489   1e-164   
gb|KDP33841.1|  hypothetical protein JCGZ_07412                         488   2e-164   
gb|KEH32513.1|  cytokinin oxidase/dehydrogenase-like protein            488   2e-164   
emb|CDY35410.1|  BnaA03g19500D                                          489   2e-164   
emb|CBI37295.3|  unnamed protein product                                491   2e-164   
gb|AAM08400.2|AF490591_1  cytokinin dehydrogenase 2                     488   2e-164   Hordeum vulgare [barley]
ref|XP_011078924.1|  PREDICTED: cytokinin dehydrogenase 1-like          488   3e-164   
ref|XP_004305707.1|  PREDICTED: cytokinin dehydrogenase 1-like          488   3e-164   
ref|XP_009336587.1|  PREDICTED: cytokinin dehydrogenase 1-like          488   4e-164   
ref|XP_009602355.1|  PREDICTED: cytokinin dehydrogenase 3-like          487   5e-164   
ref|XP_009352666.1|  PREDICTED: cytokinin dehydrogenase 3-like          487   5e-164   
gb|EYU27005.1|  hypothetical protein MIMGU_mgv1a004144mg                487   7e-164   
emb|CDX76698.1|  BnaC08g32840D                                          487   7e-164   
ref|XP_002323274.1|  hypothetical protein POPTR_0016s04340g             487   8e-164   
gb|EPS64605.1|  cytokinin oxidase                                       484   1e-163   
ref|XP_008450862.1|  PREDICTED: cytokinin dehydrogenase 3-like          485   2e-163   
ref|XP_008443336.1|  PREDICTED: cytokinin dehydrogenase 1-like          487   2e-163   
ref|XP_004488057.1|  PREDICTED: cytokinin dehydrogenase 3-like          485   2e-163   
gb|EMS64767.1|  Cytokinin dehydrogenase 9                               486   3e-163   
ref|XP_004288952.1|  PREDICTED: cytokinin dehydrogenase 3-like          484   3e-163   
ref|XP_008360505.1|  PREDICTED: cytokinin dehydrogenase 1-like          486   4e-163   
ref|XP_008367923.1|  PREDICTED: cytokinin dehydrogenase 3-like          484   4e-163   
ref|XP_011033192.1|  PREDICTED: cytokinin dehydrogenase 1-like          484   2e-162   
ref|NP_001244203.1|  cytokinin dehydrogenase 1-like                     484   2e-162   
gb|KCW79507.1|  hypothetical protein EUGRSUZ_C00881                     482   3e-162   
ref|XP_010047562.1|  PREDICTED: cytokinin dehydrogenase 3-like          483   3e-162   
emb|CAC17752.1|  cytokinin oxidase                                      482   4e-162   
ref|XP_004158449.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    481   5e-162   
ref|XP_010915226.1|  PREDICTED: cytokinin dehydrogenase 6-like          482   8e-162   
ref|XP_004159659.1|  PREDICTED: cytokinin dehydrogenase 1-like          482   1e-161   
gb|AGW52152.1|  CKX3                                                    481   2e-161   
ref|XP_004136791.1|  PREDICTED: cytokinin dehydrogenase 1-like          481   3e-161   
gb|AAO50082.1|  cytokinin dehydrogenase 3                               479   3e-161   
ref|XP_003635626.2|  PREDICTED: cytokinin dehydrogenase 3-like          474   4e-161   
emb|CBI41113.3|  unnamed protein product                                474   5e-161   
gb|EMT32653.1|  Cytokinin dehydrogenase 1                               476   9e-161   
ref|XP_010047563.1|  PREDICTED: cytokinin dehydrogenase 3-like          477   6e-160   
emb|CCH15046.1|  cytokinin oxidase/dehydrogenase 1                      474   8e-160   
gb|AES65430.2|  cytokinin oxidase/dehydrogenase-like protein            476   1e-159   
ref|XP_004288951.1|  PREDICTED: cytokinin dehydrogenase 2-like          475   1e-159   
ref|XP_008805777.1|  PREDICTED: cytokinin dehydrogenase 6-like          476   2e-159   
ref|XP_004144003.1|  PREDICTED: cytokinin dehydrogenase 3-like          475   2e-159   
ref|XP_006595335.1|  PREDICTED: cytokinin dehydrogenase 3-like          475   3e-159   
ref|XP_003595184.1|  Cytokinin dehydrogenase                            475   3e-159   
ref|XP_010036309.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    474   4e-159   
ref|XP_003550630.1|  PREDICTED: cytokinin dehydrogenase 3-like          476   5e-159   
ref|XP_010036308.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    475   5e-159   
ref|XP_006576244.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    474   6e-159   
ref|XP_009402032.1|  PREDICTED: cytokinin dehydrogenase 6-like          474   8e-159   
ref|XP_004507936.1|  PREDICTED: cytokinin dehydrogenase 3-like          473   2e-158   
gb|KEH32514.1|  cytokinin oxidase/dehydrogenase-like protein            473   2e-158   
ref|XP_004173096.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    471   5e-158   
ref|XP_010696503.1|  PREDICTED: cytokinin dehydrogenase 3               472   1e-157   
ref|XP_011093737.1|  PREDICTED: cytokinin dehydrogenase 3               471   1e-157   
ref|NP_001275030.1|  cytokinin oxidase/dehydrogenase 1 precursor        471   1e-157   
ref|XP_010026881.1|  PREDICTED: cytokinin dehydrogenase 3-like          469   2e-157   
gb|EMT24221.1|  Cytokinin dehydrogenase 5                               465   3e-157   
emb|CDY22528.1|  BnaC03g23380D                                          470   3e-157   
emb|CAB87797.1|  cytokinin oxidase-like protein                         469   3e-157   
gb|KCW60471.1|  hypothetical protein EUGRSUZ_H03198                     469   1e-156   
ref|XP_003595179.1|  Cytokinin dehydrogenase                            468   1e-156   
gb|ABN05767.1|  FAD linked oxidase, N-terminal                          467   1e-156   
gb|ABM98099.2|  cytokinin oxidase                                       467   4e-156   
ref|XP_002988125.1|  hypothetical protein SELMODRAFT_127173             467   4e-156   
ref|XP_003571719.1|  PREDICTED: cytokinin dehydrogenase 7-like          466   6e-156   
gb|KCW60469.1|  hypothetical protein EUGRSUZ_H03195                     466   6e-156   
gb|ABN08744.1|  FAD linked oxidase, N-terminal                          466   6e-156   
ref|XP_010024208.1|  PREDICTED: cytokinin dehydrogenase 3-like          466   7e-156   
ref|XP_010040366.1|  PREDICTED: cytokinin dehydrogenase 3-like          466   9e-156   
ref|XP_010024059.1|  PREDICTED: cytokinin dehydrogenase 3-like          466   9e-156   
gb|EPS73626.1|  hypothetical protein M569_01132                         466   9e-156   
ref|XP_002972678.1|  hypothetical protein SELMODRAFT_98722              465   4e-155   
gb|ADB45878.1|  cytokinin oxidase/dehydrogenase                         463   9e-155   
ref|XP_010090054.1|  Cytokinin dehydrogenase 4                          461   9e-154   
ref|XP_009352704.1|  PREDICTED: cytokinin dehydrogenase 2-like          459   2e-153   
gb|AAG30907.1|AF303980_1  cytokinin oxidase                             460   2e-153   
ref|NP_194703.1|  cytokinin dehydrogenase 4                             459   2e-153   
ref|XP_009381235.1|  PREDICTED: cytokinin dehydrogenase 6-like          459   3e-153   
gb|KCW45277.1|  hypothetical protein EUGRSUZ_L01060                     454   5e-153   
ref|XP_010451656.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    458   7e-153   
gb|ADB45880.1|  cytokinin oxidase/dehydrogenase                         457   3e-152   
ref|XP_009361720.1|  PREDICTED: cytokinin dehydrogenase 4-like          455   8e-152   
ref|XP_007203856.1|  hypothetical protein PRUPE_ppa021859mg             454   1e-151   
ref|XP_008242393.1|  PREDICTED: cytokinin dehydrogenase 4-like          454   2e-151   
ref|XP_006294012.1|  hypothetical protein CARUB_v10023000mg             454   2e-151   
ref|XP_010451653.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    454   2e-151   
ref|XP_006401261.1|  hypothetical protein EUTSA_v10013271mg             454   3e-151   
gb|EAZ13725.1|  hypothetical protein OsJ_03648                          458   3e-151   
ref|XP_010433070.1|  PREDICTED: cytokinin dehydrogenase 4               454   4e-151   
ref|XP_008338887.1|  PREDICTED: cytokinin dehydrogenase 4-like          453   5e-151   
gb|AFK79779.1|  cytokinin oxidase/dehydrogenase                         454   5e-151   
ref|XP_009124316.1|  PREDICTED: cytokinin dehydrogenase 2-like          452   1e-150   
ref|XP_010438272.1|  PREDICTED: cytokinin dehydrogenase 4-like          452   1e-150   
emb|CDY30204.1|  BnaA03g49660D                                          452   1e-150   
emb|CAN61742.1|  hypothetical protein VITISV_038638                     451   2e-150   
ref|XP_002869416.1|  predicted protein                                  452   3e-150   
ref|XP_009137860.1|  PREDICTED: cytokinin dehydrogenase 4               451   5e-150   
gb|AEV76971.1|  cytokinin oxidase/dehydrogenase 2                       452   8e-150   
ref|XP_006412813.1|  hypothetical protein EUTSA_v10024918mg             451   9e-150   
ref|XP_010443356.1|  PREDICTED: cytokinin dehydrogenase 3               450   9e-150   
gb|ADG57787.1|  cytokinin oxidase 2                                     451   1e-149   
ref|XP_007138721.1|  hypothetical protein PHAVU_009G231800g             450   1e-149   
ref|XP_010447814.1|  PREDICTED: cytokinin dehydrogenase 4-like          449   2e-149   
ref|NP_200507.1|  cytokinin dehydrogenase 3                             449   2e-149   
ref|XP_008451152.1|  PREDICTED: cytokinin dehydrogenase 4               449   4e-149   
ref|XP_009389713.1|  PREDICTED: cytokinin dehydrogenase 6-like          449   4e-149   
gb|ADG57788.1|  cytokinin oxidase 2                                     449   6e-149   
ref|XP_004488073.1|  PREDICTED: cytokinin dehydrogenase 3-like          448   6e-149   
gb|AEV76973.1|  cytokinin oxidase/dehydrogenase 8                       448   9e-149   
ref|XP_009120210.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X2    447   1e-148   
ref|XP_001777510.1|  predicted protein                                  449   2e-148   
gb|ADB45879.1|  cytokinin oxidase/dehydrogenase                         447   2e-148   
gb|AFK79773.1|  cytokinin oxidase/dehydrogenase                         448   2e-148   
gb|AEC33261.1|  cytokinin oxidase/dehydrogenase                         448   2e-148   
ref|XP_006409043.1|  hypothetical protein EUTSA_v10023158mg             446   3e-148   
ref|XP_011077990.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    447   3e-148   
ref|XP_004971745.1|  PREDICTED: cytokinin dehydrogenase 2-like          447   5e-148   
ref|XP_001777489.1|  predicted protein                                  444   6e-148   
ref|XP_010026880.1|  PREDICTED: cytokinin dehydrogenase 3-like          446   7e-148   
gb|KCW60470.1|  hypothetical protein EUGRSUZ_H03197                     444   8e-148   
ref|XP_004488074.1|  PREDICTED: cytokinin dehydrogenase 3-like          445   1e-147   
gb|EAY85042.1|  hypothetical protein OsI_06399                          445   2e-147   
gb|EMT16465.1|  Cytokinin dehydrogenase 1                               445   2e-147   
gb|EEC80843.1|  hypothetical protein OsI_23446                          444   2e-147   
gb|ADG57789.1|  cytokinin oxidase 2                                     445   3e-147   
ref|XP_009120209.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X1    444   4e-147   
sp|Q5Z620.1|CKX10_ORYSJ  RecName: Full=Cytokinin dehydrogenase 10...    444   4e-147   
ref|XP_010227585.1|  PREDICTED: cytokinin dehydrogenase 10-like         444   5e-147   
dbj|BAM74651.1|  cytokinin oxidase/dehydrogenase                        444   7e-147   
gb|KFK29530.1|  hypothetical protein AALP_AA7G146300                    443   7e-147   
ref|XP_006280310.1|  hypothetical protein CARUB_v10026233mg             442   8e-147   
gb|AEK84310.1|  cytokinin oxidase/dehydrogenase                         444   8e-147   
gb|ACU22904.1|  unknown                                                 441   9e-147   
gb|EYU37164.1|  hypothetical protein MIMGU_mgv1a004294mg                443   9e-147   
ref|XP_002883987.1|  hypothetical protein ARALYDRAFT_480522             442   1e-146   
ref|XP_008660924.1|  PREDICTED: cytokinin dehydrogenase 10-like         443   1e-146   
emb|CDY54283.1|  BnaC07g50850D                                          442   2e-146   
gb|KFK40311.1|  hypothetical protein AALP_AA3G358400                    441   2e-146   
gb|AFW87013.1|  hypothetical protein ZEAMMB73_853322                    443   2e-146   
gb|EYU29892.1|  hypothetical protein MIMGU_mgv1a007407mg                437   3e-146   
ref|XP_009112608.1|  PREDICTED: cytokinin dehydrogenase 2               441   3e-146   
gb|AEV76972.1|  cytokinin oxidase/dehydrogenase 7                       441   4e-146   
ref|XP_004968471.1|  PREDICTED: cytokinin dehydrogenase 1-like          441   4e-146   
gb|KFK42198.1|  hypothetical protein AALP_AA2G224300                    441   4e-146   
gb|KHN06617.1|  Cytokinin dehydrogenase 3                               440   6e-146   
ref|XP_002866175.1|  hypothetical protein ARALYDRAFT_918856             440   7e-146   
ref|XP_001786014.1|  predicted protein                                  439   9e-146   
ref|NP_565455.1|  cytokinin oxidase 2                                   439   1e-145   
gb|EEE56570.1|  hypothetical protein OsJ_05919                          439   1e-145   
ref|XP_008679837.1|  PREDICTED: cytokinin dehydrogenase 7-like          439   3e-145   
ref|XP_006297443.1|  hypothetical protein CARUB_v10013466mg             438   4e-145   
ref|XP_010026879.1|  PREDICTED: cytokinin dehydrogenase 3-like          438   5e-145   
ref|XP_010254443.1|  PREDICTED: cytokinin dehydrogenase 3-like          438   5e-145   
sp|Q6YW51.1|CKX6_ORYSJ  RecName: Full=Cytokinin dehydrogenase 6; ...    438   6e-145   
gb|AFK79770.1|  cytokinin oxidase/dehydrogenase                         439   7e-145   
ref|XP_006453000.1|  hypothetical protein CICLE_v10007999mg             437   8e-145   
ref|XP_011094006.1|  PREDICTED: cytokinin dehydrogenase 3-like          437   8e-145   
gb|AEK84309.1|  cytokinin oxidase/dehydrogenase                         439   9e-145   
emb|CDY62828.1|  BnaCnng41060D                                          437   1e-144   
gb|KDO73618.1|  hypothetical protein CISIN_1g009956mg                   437   1e-144   
ref|XP_006474490.1|  PREDICTED: cytokinin dehydrogenase 7-like          437   2e-144   
gb|EEC72755.1|  hypothetical protein OsI_06398                          437   2e-144   
gb|AFK79784.1|  cytokinin oxidase/dehydrogenase                         438   2e-144   
gb|AAG30905.1|AF303978_1  cytokinin oxidase                             436   2e-144   
ref|XP_004144113.1|  PREDICTED: cytokinin dehydrogenase 4-like          436   3e-144   
dbj|BAK05047.1|  predicted protein                                      437   4e-144   
ref|XP_010539134.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    436   7e-144   
ref|XP_010454451.1|  PREDICTED: cytokinin dehydrogenase 7-like          435   8e-144   
sp|Q6YW50.1|CKX7_ORYSJ  RecName: Full=Cytokinin dehydrogenase 7; ...    435   9e-144   
ref|XP_002455033.1|  hypothetical protein SORBIDRAFT_03g003280          435   1e-143   
pdb|3S1D|A  Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseD...    434   2e-143   
ref|XP_009409596.1|  PREDICTED: cytokinin dehydrogenase 7-like          434   2e-143   
ref|XP_006657073.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    435   2e-143   
emb|CDM81697.1|  unnamed protein product                                434   2e-143   
ref|NP_001185809.1|  cytokinin dehydrogenase 8 precursor                434   2e-143   
ref|XP_002451780.1|  hypothetical protein SORBIDRAFT_04g007740          434   3e-143   
pdb|2QKN|A  Chain A, Crystal Structure Of Maize Cytokinin Oxidase...    433   4e-143   
ref|XP_010415434.1|  PREDICTED: cytokinin dehydrogenase 2               432   4e-143   
ref|XP_003565448.1|  PREDICTED: cytokinin dehydrogenase 1-like          433   5e-143   
ref|NP_001105591.1|  cytokinin dehydrogenase 1 precursor                433   6e-143   
ref|XP_001784400.1|  predicted protein                                  431   9e-143   
emb|CAN76251.1|  hypothetical protein VITISV_025507                     434   1e-142   
pdb|1W1O|A  Chain A, Native Cytokinin Dehydrogenase                     432   2e-142   
ref|XP_003564990.2|  PREDICTED: cytokinin dehydrogenase 2-like          432   2e-142   
pdb|3S1F|A  Chain A, Asp169glu Mutant Of Maize Cytokinin OxidaseD...    431   2e-142   
ref|XP_010467897.1|  PREDICTED: cytokinin dehydrogenase 2-like          431   2e-142   
pdb|2QPM|A  Chain A, Leu492ala Mutant Of Maize Cytokinin OxidaseD...    431   3e-142   
ref|XP_010026877.1|  PREDICTED: cytokinin dehydrogenase 3-like          430   4e-142   
ref|XP_010493247.1|  PREDICTED: cytokinin dehydrogenase 7-like          430   1e-141   
pdb|3S1E|A  Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseD...    429   1e-141   
sp|Q9T0N8.2|CKX1_MAIZE  RecName: Full=Cytokinin dehydrogenase 1; ...    430   1e-141   
ref|XP_004967225.1|  PREDICTED: cytokinin dehydrogenase 10-like         431   1e-141   
gb|AFK79768.1|  cytokinin oxidase/dehydrogenase                         430   2e-141   
ref|XP_009126512.1|  PREDICTED: cytokinin dehydrogenase 7-like          428   5e-141   
gb|EAZ22265.1|  hypothetical protein OsJ_05920                          427   5e-141   
ref|XP_002438603.1|  hypothetical protein SORBIDRAFT_10g022590          429   6e-141   
ref|XP_001776926.1|  predicted protein                                  427   6e-141   
ref|XP_009126914.1|  PREDICTED: cytokinin dehydrogenase 3               427   7e-141   
ref|XP_010420976.1|  PREDICTED: cytokinin dehydrogenase 7               427   7e-141   
ref|XP_010098364.1|  Cytokinin dehydrogenase 7                          427   1e-140   
gb|EMS46287.1|  Cytokinin dehydrogenase 2                               426   1e-140   
emb|CDY20702.1|  BnaA02g08420D                                          427   1e-140   
ref|XP_002453544.1|  hypothetical protein SORBIDRAFT_04g007730          427   2e-140   
ref|XP_004141436.1|  PREDICTED: cytokinin dehydrogenase 7-like          426   2e-140   
ref|XP_004951450.1|  PREDICTED: cytokinin dehydrogenase 7-like          427   2e-140   
gb|KFK26358.1|  hypothetical protein AALP_AA8G238000                    426   2e-140   
gb|AFK79785.1|  cytokinin oxidase/dehydrogenase                         427   3e-140   
gb|ADK56162.1|  cytokinin oxidase/dehydrogenase                         427   3e-140   
emb|CDY16602.1|  BnaC09g36710D                                          424   3e-140   
ref|XP_010049279.1|  PREDICTED: cytokinin dehydrogenase 7               426   3e-140   
gb|ACV04939.1|  cytokinin oxidase/dehydrogenase                         427   4e-140   
gb|KGN55376.1|  hypothetical protein Csa_4G647490                       427   6e-140   
ref|XP_002279960.1|  PREDICTED: cytokinin dehydrogenase 7               425   7e-140   
emb|CDY67088.1|  BnaA09g52930D                                          423   8e-140   
emb|CDP13465.1|  unnamed protein product                                425   9e-140   
ref|XP_008452781.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    424   1e-139   
ref|NP_850863.1|  cytokinin dehydrogenase 7                             424   1e-139   
ref|XP_006287493.1|  hypothetical protein CARUB_v10000702mg             424   1e-139   
ref|XP_009120710.1|  PREDICTED: cytokinin dehydrogenase 7               424   2e-139   
ref|XP_007161054.1|  hypothetical protein PHAVU_001G038800g             423   3e-139   
ref|XP_003544550.1|  PREDICTED: cytokinin dehydrogenase 7-like          423   3e-139   
ref|XP_002871976.1|  hypothetical protein ARALYDRAFT_489034             423   3e-139   
gb|AFM10539.1|  cytokinin oxidase                                       422   1e-138   
ref|XP_006400694.1|  hypothetical protein EUTSA_v10013259mg             422   1e-138   
emb|CDY60734.1|  BnaA07g35940D                                          430   1e-138   
ref|XP_004303465.1|  PREDICTED: cytokinin dehydrogenase 7-like          421   2e-138   
ref|XP_003534915.2|  PREDICTED: cytokinin dehydrogenase 3-like          421   2e-138   
ref|XP_002309468.1|  cytokinin oxidase family protein                   421   2e-138   
gb|AFK48435.1|  unknown                                                 421   2e-138   
ref|XP_006475550.1|  PREDICTED: cytokinin dehydrogenase 3-like          422   4e-138   
ref|XP_006475551.1|  PREDICTED: cytokinin dehydrogenase 3-like          420   4e-138   



>ref|XP_009761052.1| PREDICTED: cytokinin dehydrogenase 5 [Nicotiana sylvestris]
Length=527

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/435 (81%), Positives = 393/435 (90%), Gaps = 3/435 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPL--VSEKFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HSINGQAM   GVV+QMSG + +  K L  VSEKFMYADVWGGELWIDVL STLE+GLAP
Sbjct  93    HSINGQAMITNGVVIQMSGGSNSKQKLLTEVSEKFMYADVWGGELWIDVLTSTLEYGLAP  152

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYLYLSVGGTLSNAGISGQAFNHGPQI+NVHELDVVTGKGE +TCSE++NSELFHA
Sbjct  153   KSWTDYLYLSVGGTLSNAGISGQAFNHGPQINNVHELDVVTGKGELLTCSEKENSELFHA  212

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
              LGGLGQFG+ITRARIALE APQRVRWIRVLYS+F  FT+DQEYLISLHG+P +QKFDYV
Sbjct  213   ALGGLGQFGIITRARIALEQAPQRVRWIRVLYSNFSTFTEDQEYLISLHGKPASQKFDYV  272

Query  945   EGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             EGFVIVDEGLINNWRSSFFSP NPVK SS+KS+GGVLYCLEITKNY  S AD VDQEI+ 
Sbjct  273   EGFVIVDEGLINNWRSSFFSPSNPVKISSLKSEGGVLYCLEITKNYHLSNADIVDQEIET  332

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LLKKLK+IP+SVFTTDLPYVDFLDRVHKAELKLRSKGLW+VPHPWLNLFVPKSRI +FD+
Sbjct  333   LLKKLKYIPASVFTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSRIADFDK  392

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
             GVFKGILGNKTSGPILIYPMNKNKWDER+S VTPEEEVFYLV  LRSA+ NG+E+QTL+ 
Sbjct  393   GVFKGILGNKTSGPILIYPMNKNKWDERSSVVTPEEEVFYLVGFLRSALTNGDETQTLEY  452

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEK-WERFQHRKLQFDPKHILSTG  229
             L +QN  ILKFC+++ I++KQYLPHY+TQ+EW++HFG+K W RFQ RKL FDP+HIL+TG
Sbjct  453   LSNQNYQILKFCEDAKIKIKQYLPHYTTQREWRDHFGDKYWTRFQQRKLDFDPRHILATG  512

Query  228   QLIFTPSFNAMTASW  184
             Q IF PSFN  TASW
Sbjct  513   QRIFMPSFNPNTASW  527



>ref|XP_009609662.1| PREDICTED: cytokinin dehydrogenase 5 [Nicotiana tomentosiformis]
Length=527

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/435 (81%), Positives = 393/435 (90%), Gaps = 3/435 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPL--VSEKFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HSINGQAMT  GVV+QMSG + +  K L  VSEKFMYADVWGGELWIDVL STLE+GLAP
Sbjct  93    HSINGQAMTTKGVVIQMSGGSNSKQKLLTEVSEKFMYADVWGGELWIDVLTSTLEYGLAP  152

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYLYLSVGGTLSNAGISGQAFNHGPQI+NVHELDVVTGKGE +TCSE++NSELFHA
Sbjct  153   KSWTDYLYLSVGGTLSNAGISGQAFNHGPQINNVHELDVVTGKGELLTCSEKENSELFHA  212

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
              LGGLGQFG+ITRARIALE APQRVRWIRVLYS+F  FT+DQEYLISL  +P +QKFDYV
Sbjct  213   ALGGLGQFGIITRARIALEQAPQRVRWIRVLYSNFSTFTEDQEYLISLQAKPASQKFDYV  272

Query  945   EGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             EGFVIVDEGLINNWRSSFFSP NPVK SS+K+DGGVLYCLEITKNY  S AD VDQEI+ 
Sbjct  273   EGFVIVDEGLINNWRSSFFSPSNPVKISSLKADGGVLYCLEITKNYHLSNADIVDQEIET  332

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LLKKLK+IP+SVFTTDLPYVDFLDRVHKAELKLRSKGLW+VPHPWLNLFVPKSRI +FD+
Sbjct  333   LLKKLKYIPASVFTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSRIVDFDK  392

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
             GVFKGILGNKTSGPILIYPMNKNKWDER+S VTPEEEVFYLV  LRSA+ N +E+QTL+ 
Sbjct  393   GVFKGILGNKTSGPILIYPMNKNKWDERSSVVTPEEEVFYLVGFLRSALTNSDETQTLEY  452

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEK-WERFQHRKLQFDPKHILSTG  229
             L +QN +ILKFC+++ I++KQYLPHY+TQ+EW++HFG+K W RFQ RKL+FDP+HIL+TG
Sbjct  453   LSNQNYEILKFCEDANIKIKQYLPHYTTQREWRDHFGDKYWTRFQQRKLEFDPRHILATG  512

Query  228   QLIFTPSFNAMTASW  184
             Q IF PSFN  TASW
Sbjct  513   QRIFMPSFNPNTASW  527



>ref|NP_001274957.1| cytokinin oxidase/dehydrogenase precursor [Solanum tuberosum]
 gb|ACP40988.1| cytokinin oxidase/dehydrogenase [Solanum tuberosum]
Length=526

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/434 (81%), Positives = 391/434 (90%), Gaps = 2/434 (0%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPL-VSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQAMT  GVV+QMSG   +  K L +SEKFMYADVWGGELWIDVL STLE+GLAPK
Sbjct  93    HSINGQAMTTNGVVVQMSGGGGSKNKMLTISEKFMYADVWGGELWIDVLTSTLEYGLAPK  152

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGE +TCSE++NSELF AV
Sbjct  153   SWTDYLYLTVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGELLTCSEKENSELFQAV  212

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARIALE APQRVRWIRVLYS+F  FT+DQEYLISLHG+P +QKFDYVE
Sbjct  213   LGGLGQFGIITRARIALEQAPQRVRWIRVLYSNFSTFTQDQEYLISLHGKPASQKFDYVE  272

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGLINNWRSSFFSP NPVK SS+K++GGVLYCLEITKNY  S ADT+DQEI++L
Sbjct  273   GFVIVDEGLINNWRSSFFSPSNPVKISSLKAEGGVLYCLEITKNYHLSNADTIDQEIEIL  332

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             LKKL +IP+S FTTDLPYVDFLDRVHKAELKLRSKGLW+VPHPWLNLFVPKSRI EFD+G
Sbjct  333   LKKLNYIPASEFTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSRIAEFDKG  392

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNKNKWD+R+S VTPEE+VFYLVA LRSA+ENG+E+QTL  L
Sbjct  393   VFKGILGNKTSGPILIYPMNKNKWDDRSSVVTPEEDVFYLVAFLRSALENGDETQTLDYL  452

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEK-WERFQHRKLQFDPKHILSTGQ  226
              +QN +ILKFC++  I +KQYLPHY  Q+EW++HFGEK W RFQ RKL+FDP+HIL+TGQ
Sbjct  453   SNQNYEILKFCEDEKINVKQYLPHYDNQREWRDHFGEKYWTRFQQRKLEFDPRHILATGQ  512

Query  225   LIFTPSFNAMTASW  184
              IF PSFN   A+W
Sbjct  513   KIFIPSFNPNIATW  526



>ref|NP_001266251.1| cytokinin oxidase/dehydrogenase-like precursor [Solanum lycopersicum]
 dbj|BAM09006.1| cytokinin oxidase/dehydrogenase-like [Solanum lycopersicum]
Length=524

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/433 (80%), Positives = 386/433 (89%), Gaps = 2/433 (0%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HSINGQAMT  GVV+QMSG         VSEKFMYADVWGGELWIDVL STLE+GLAPKS
Sbjct  93    HSINGQAMTRNGVVVQMSGGLKN-KMLTVSEKFMYADVWGGELWIDVLTSTLEYGLAPKS  151

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYLYL+VGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGE +TCSE++NSELF AVL
Sbjct  152   WTDYLYLTVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGELLTCSEKENSELFQAVL  211

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE APQRVRWIRVLYS+F  FT DQEYLISLHG+P +QKFDYVEG
Sbjct  212   GGLGQFGIITRARIALEQAPQRVRWIRVLYSNFSTFTHDQEYLISLHGKPSSQKFDYVEG  271

Query  939   FVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVLL  760
             FVIVDEGLINNWRSS FSP NPVK SS+K++GGVLYCLEITKNY  + ADT+DQEI++LL
Sbjct  272   FVIVDEGLINNWRSSIFSPSNPVKVSSLKAEGGVLYCLEITKNYHLTNADTIDQEIEILL  331

Query  759   KKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRGV  580
             KKL +IP+S FTTDLPYVDFLDRVHKAELKLRSKGLW+VPHPWLNLFVPKSRI EFD+GV
Sbjct  332   KKLNYIPASEFTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSRIAEFDKGV  391

Query  579   FKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNLQ  400
             FKGILGNKTSGPILIYPMNKNKWD+R+S VTPEE+VFYLVA LRSA+E+G+E+QTL  L 
Sbjct  392   FKGILGNKTSGPILIYPMNKNKWDDRSSVVTPEEDVFYLVAFLRSALESGDETQTLDYLS  451

Query  399   SQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEK-WERFQHRKLQFDPKHILSTGQL  223
             +QN +ILKFC++  I +KQYLPHY  Q+EW++HFGEK W RFQ RKL+FDP+HIL+TGQ 
Sbjct  452   NQNNEILKFCEDESINVKQYLPHYDNQREWRDHFGEKYWTRFQQRKLEFDPRHILATGQR  511

Query  222   IFTPSFNAMTASW  184
             IF PSFN   A+W
Sbjct  512   IFMPSFNPNIANW  524



>ref|XP_008377186.1| PREDICTED: cytokinin dehydrogenase 5-like [Malus domestica]
Length=538

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/427 (79%), Positives = 388/427 (91%), Gaps = 4/427 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKP----LVSEKFMYADVWGGELWIDVLKSTLEHGL  1312
             HSINGQA T  GVV+QMSG ++    P     VSEK MY D WGGELWIDVL+STLE+GL
Sbjct  95    HSINGQAQTNNGVVIQMSGGSSRSGTPGQAARVSEKGMYVDAWGGELWIDVLRSTLEYGL  154

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             APKSWTDYLYLSVGGTLSNAGISGQAFN+GPQISNVHELDVVTGKGE +TCSEEQNSELF
Sbjct  155   APKSWTDYLYLSVGGTLSNAGISGQAFNYGPQISNVHELDVVTGKGELLTCSEEQNSELF  214

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             HAVLGGLGQFG+ITRARIALE +PQRVRWIRVLYS+F AFTKDQE+LISLHGQP +QKFD
Sbjct  215   HAVLGGLGQFGIITRARIALEXSPQRVRWIRVLYSNFSAFTKDQEFLISLHGQPTSQKFD  274

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             YVEGFVIVDEGLINNWRSSFFSP NPVK +S+ S+GGVLYCLEITKNYD+STA T+DQEI
Sbjct  275   YVEGFVIVDEGLINNWRSSFFSPSNPVKITSINSEGGVLYCLEITKNYDESTAVTIDQEI  334

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LL+KL F+P+SVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI +F
Sbjct  335   EDLLEKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRISDF  394

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
             D GVFKGILGNKTSGPILIYPMNK+KWD+ +S VTP+E+VFYLVALLRSA++ G+E++TL
Sbjct  395   DEGVFKGILGNKTSGPILIYPMNKDKWDQSSSVVTPDEDVFYLVALLRSALDTGDETRTL  454

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             ++L +QNR IL+FC ++GIE+KQYLPHY+T++EW +HFG+KW+RF  RK++FDP+ IL+T
Sbjct  455   EHLTNQNRQILRFCDDAGIEVKQYLPHYTTREEWMDHFGDKWDRFYQRKMKFDPRRILAT  514

Query  231   GQLIFTP  211
             GQ IF+P
Sbjct  515   GQRIFSP  521



>ref|XP_011083611.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 5 [Sesamum 
indicum]
Length=521

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/432 (79%), Positives = 383/432 (89%), Gaps = 3/432 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HSINGQAMT  G + QMSG+      P VSEK MY DVWGGELWIDVL+STLE+GLAPKS
Sbjct  93    HSINGQAMTGNGXI-QMSGSRGKPAPPRVSEKSMYVDVWGGELWIDVLRSTLEYGLAPKS  151

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYLYLSVGGTL+NAGISGQAFNHGPQISNV+ELDVVTGKGE +TCS+EQNSEL+ AVL
Sbjct  152   WTDYLYLSVGGTLANAGISGQAFNHGPQISNVYELDVVTGKGELLTCSKEQNSELYDAVL  211

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP+RVRWIRVLYS+F AFT+DQEYLISLHGQP  QKFDYVEG
Sbjct  212   GGLGQFGIITRARIALERAPRRVRWIRVLYSNFTAFTQDQEYLISLHGQP--QKFDYVEG  269

Query  939   FVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVLL  760
             FVIVDEGLINNWRSSFFSPRNPVK SS+ +DGGVLYCLEITKNY +S ADT+DQE++ LL
Sbjct  270   FVIVDEGLINNWRSSFFSPRNPVKISSLNADGGVLYCLEITKNYQESNADTIDQEVEALL  329

Query  759   KKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRGV  580
             KKL FIP+SVFTTDLPYVDFLDRVHKAELKLR+K LWDVPHPWLNLFVPKSRI +FD+GV
Sbjct  330   KKLNFIPASVFTTDLPYVDFLDRVHKAELKLRAKNLWDVPHPWLNLFVPKSRIADFDKGV  389

Query  579   FKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNLQ  400
             FKGILGN TSGPILIYPMNKNKWD+++S VTP E+VFYLVALLRSA++NG+E+Q L+ L 
Sbjct  390   FKGILGNNTSGPILIYPMNKNKWDDKSSVVTPNEDVFYLVALLRSALDNGDETQGLEYLS  449

Query  399   SQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQLI  220
             +QNR IL+FC E+GI +KQYLPHYSTQQEW  HFGEKW  F  RK++FDP+HIL+TGQ I
Sbjct  450   NQNRGILQFCDEAGINVKQYLPHYSTQQEWMRHFGEKWSLFSRRKMEFDPRHILATGQRI  509

Query  219   FTPSFNAMTASW  184
             F P  N   AS+
Sbjct  510   FAPLLNPRGASF  521



>emb|CDP07468.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/444 (77%), Positives = 386/444 (87%), Gaps = 12/444 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK--------PLVSEKFMYADVWGGELWIDVLKSTL  1324
             HSINGQAMT  GVV+QMS  +    +        P V EKFMY DVWGGELWIDVL+STL
Sbjct  93    HSINGQAMTTNGVVIQMSSGSGERRRLGIGRPVAPRVYEKFMYVDVWGGELWIDVLRSTL  152

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             E+GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNV+ELDVVTGKGE +TCSEE+N
Sbjct  153   EYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELLTCSEEEN  212

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             S+LFHAVLGGLGQFG+ITRARIALE APQ VRWIRVLYS+F  FT DQEYLISLHGQ  +
Sbjct  213   SDLFHAVLGGLGQFGIITRARIALEPAPQMVRWIRVLYSNFSTFTHDQEYLISLHGQSDS  272

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSV--KSDGGVLYCLEITKNYDQSTAD  790
             QKFDYVEGF IVDEGLINNWRSSFFSPRNPVK SS+  K +GGVLYCLE+T+NY    AD
Sbjct  273   QKFDYVEGFAIVDEGLINNWRSSFFSPRNPVKISSIDAKGNGGVLYCLEVTRNYGGLDAD  332

Query  789   TVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPK  610
             T+D+E+D LL KL FIP++VFTTDLPYVDFLDRVHKAEL LRSKGLWDVPHPWLNLFVPK
Sbjct  333   TIDEEVDALLTKLNFIPNTVFTTDLPYVDFLDRVHKAELTLRSKGLWDVPHPWLNLFVPK  392

Query  609   SRIDEFDRGVFKGILG--NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVE  436
             SRI +FDRGVFKGILG  N+TSGPILIYPMNKNKWDE+TSAVTPEE+VFYLVALLRSA++
Sbjct  393   SRIADFDRGVFKGILGSKNRTSGPILIYPMNKNKWDEKTSAVTPEEDVFYLVALLRSALD  452

Query  435   NGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQF  256
             NG+E+QTL  L  QNR IL+FC ++GI +KQYLP+Y+TQQ+W++HFG KW +F  RKL+F
Sbjct  453   NGDETQTLDYLSDQNRRILRFCDDAGINVKQYLPYYTTQQQWRDHFGHKWAQFYQRKLEF  512

Query  255   DPKHILSTGQLIFTPSFNAMTASW  184
             DP+HIL+TGQ IF PSFN  +ASW
Sbjct  513   DPRHILATGQRIFKPSFNPTSASW  536



>ref|XP_002510450.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF52637.1| gulonolactone oxidase, putative [Ricinus communis]
Length=540

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/434 (78%), Positives = 387/434 (89%), Gaps = 9/434 (2%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPK--------PLVSEKFMYADVWGGELWIDVLKST  1327
             HSINGQA T   GVV++MSG+ +   +        P VS K M+ DVWGGELWIDVLKST
Sbjct  94    HSINGQAQTRINGVVIEMSGSDSRRSQLGLRKPASPKVSAKEMHVDVWGGELWIDVLKST  153

Query  1326  LEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQ  1147
             LE+GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGE +TCS++Q
Sbjct  154   LEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGEILTCSDQQ  213

Query  1146  NSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPP  967
             NSELFHAVLGGLGQFG+ITRARIALE APQRVRWIRVLYS F +FT+DQEYLISL G   
Sbjct  214   NSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSSFSSFTRDQEYLISLQGNSA  273

Query  966   AQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADT  787
             AQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVK SS+ ++GGVLYCLE+TKNYD ST DT
Sbjct  274   AQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEVTKNYDDSTVDT  333

Query  786   VDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKS  607
             +DQEI+ LLKKL FIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKS
Sbjct  334   IDQEIEWLLKKLNFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKS  393

Query  606   RIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGN  427
             RI +FD+GVFKGILGNKTSGPILIYPMN+NKW++R+SAVTP+EEVFYLVALLRSA++NG 
Sbjct  394   RIADFDKGVFKGILGNKTSGPILIYPMNRNKWEQRSSAVTPDEEVFYLVALLRSALDNGE  453

Query  426   ESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPK  247
             E+QTL+ L +QNR IL+FC ++GI++KQYLPHY++++EW +HFG+KW +F H K++FDP+
Sbjct  454   ETQTLEYLSNQNRQILRFCDDAGIKVKQYLPHYTSEEEWVDHFGDKWSKFYHNKMEFDPR  513

Query  246   HILSTGQLIFTPSF  205
              IL+TGQ IF PSF
Sbjct  514   RILATGQRIFMPSF  527



>ref|XP_010110013.1| Cytokinin dehydrogenase 5 [Morus notabilis]
 gb|EXC25031.1| Cytokinin dehydrogenase 5 [Morus notabilis]
Length=566

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/436 (78%), Positives = 386/436 (89%), Gaps = 11/436 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGA-----------AAAVPKPLVSEKFMYADVWGGELWIDVLK  1333
             HSINGQA    GVV++MS +           AAA  +P VSE+ MY DVWGG+LWIDVLK
Sbjct  111   HSINGQAQATNGVVIKMSSSRERTAADQTSAAAAAARPQVSEREMYVDVWGGDLWIDVLK  170

Query  1332  STLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSE  1153
             +TLEHGLAPKSWTDYLYL+VGGTLSNAGISGQ FNHGPQI+NV ELDVVTGKGE +TCSE
Sbjct  171   ATLEHGLAPKSWTDYLYLTVGGTLSNAGISGQTFNHGPQIANVQELDVVTGKGELLTCSE  230

Query  1152  EQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQ  973
             E+NSELFHAVLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F +FTKDQE+LISLHG 
Sbjct  231   EKNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSSFTKDQEFLISLHGL  290

Query  972   PPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTA  793
             P +Q+FDYVEGFVIVDEGLINNWRSSFFSPRNPVK SS+ +DGGVLYCLEITKNYD+STA
Sbjct  291   PASQRFDYVEGFVIVDEGLINNWRSSFFSPRNPVKLSSINADGGVLYCLEITKNYDESTA  350

Query  792   DTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  613
             +T+DQE++ LLKKL FIP+SVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPW NLFVP
Sbjct  351   ETIDQEVEGLLKKLDFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWFNLFVP  410

Query  612   KSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVEN  433
             KSRI +FD GVFK ILGNKTSGPILIYPMNK+KWD+R+SAVTP+E+VFYLVALLRSA++ 
Sbjct  411   KSRISDFDEGVFKSILGNKTSGPILIYPMNKDKWDQRSSAVTPDEDVFYLVALLRSALDT  470

Query  432   GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFD  253
              +E+Q+L+ L  QNR IL+FC  +GI+ KQYLPHY+TQQEW +HFG+KW +F  RK++FD
Sbjct  471   ADETQSLEYLMHQNRQILRFCAAAGIKAKQYLPHYTTQQEWVDHFGDKWAQFHKRKMEFD  530

Query  252   PKHILSTGQLIFTPSF  205
             P+HIL+TGQ IFTPSF
Sbjct  531   PRHILATGQRIFTPSF  546



>ref|XP_002280797.1| PREDICTED: cytokinin dehydrogenase 5 isoform X1 [Vitis vinifera]
Length=524

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/427 (79%), Positives = 385/427 (90%), Gaps = 5/427 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK---PLVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HSINGQA T++GVV++MS A+  V +   P VSE+  Y D WGGELWIDVLK+TLEHGLA
Sbjct  93    HSINGQAQTSSGVVIEMS-ASKGVRQWGLPRVSEQSRYVDAWGGELWIDVLKTTLEHGLA  151

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNV+ELDVVTGKGE +TCSEEQNSELFH
Sbjct  152   PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELLTCSEEQNSELFH  211

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             AVLGGLGQFG+ITRARI LE APQRVRWIRVLYS+F  FTKDQEYLISLHGQPP QKFDY
Sbjct  212   AVLGGLGQFGIITRARIGLEPAPQRVRWIRVLYSNFSTFTKDQEYLISLHGQPPNQKFDY  271

Query  948   VEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             VEGFVIVDEGLINNWRSSFFSPRNPVK SS  ++GGVLYCLE+TKNY +STADT+DQ+++
Sbjct  272   VEGFVIVDEGLINNWRSSFFSPRNPVKISSFGTNGGVLYCLEVTKNYHESTADTIDQDVE  331

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LLK+L FIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP+SRI +FD
Sbjct  332   ALLKRLDFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPRSRIADFD  391

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
              GVFKGILGNKTSGPILIYPMNKNKWD+RTS VTPEE+VFYLVALLRSA+++G+E+Q+L+
Sbjct  392   EGVFKGILGNKTSGPILIYPMNKNKWDDRTSVVTPEEDVFYLVALLRSALDSGDEAQSLE  451

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQFDPKHILST  232
              L +QNR IL+FC ++GI++KQYLPHY+TQ++W +HFG +KW  F  RK+ FDP+ IL+T
Sbjct  452   YLSNQNRQILRFCDDAGIKVKQYLPHYTTQEDWVDHFGDDKWTLFSKRKMDFDPRRILAT  511

Query  231   GQLIFTP  211
             GQ IF P
Sbjct  512   GQRIFKP  518



>emb|CBI19763.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/427 (79%), Positives = 385/427 (90%), Gaps = 5/427 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK---PLVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HSINGQA T++GVV++MS A+  V +   P VSE+  Y D WGGELWIDVLK+TLEHGLA
Sbjct  148   HSINGQAQTSSGVVIEMS-ASKGVRQWGLPRVSEQSRYVDAWGGELWIDVLKTTLEHGLA  206

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNV+ELDVVTGKGE +TCSEEQNSELFH
Sbjct  207   PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELLTCSEEQNSELFH  266

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             AVLGGLGQFG+ITRARI LE APQRVRWIRVLYS+F  FTKDQEYLISLHGQPP QKFDY
Sbjct  267   AVLGGLGQFGIITRARIGLEPAPQRVRWIRVLYSNFSTFTKDQEYLISLHGQPPNQKFDY  326

Query  948   VEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             VEGFVIVDEGLINNWRSSFFSPRNPVK SS  ++GGVLYCLE+TKNY +STADT+DQ+++
Sbjct  327   VEGFVIVDEGLINNWRSSFFSPRNPVKISSFGTNGGVLYCLEVTKNYHESTADTIDQDVE  386

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LLK+L FIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP+SRI +FD
Sbjct  387   ALLKRLDFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPRSRIADFD  446

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
              GVFKGILGNKTSGPILIYPMNKNKWD+RTS VTPEE+VFYLVALLRSA+++G+E+Q+L+
Sbjct  447   EGVFKGILGNKTSGPILIYPMNKNKWDDRTSVVTPEEDVFYLVALLRSALDSGDEAQSLE  506

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQFDPKHILST  232
              L +QNR IL+FC ++GI++KQYLPHY+TQ++W +HFG +KW  F  RK+ FDP+ IL+T
Sbjct  507   YLSNQNRQILRFCDDAGIKVKQYLPHYTTQEDWVDHFGDDKWTLFSKRKMDFDPRRILAT  566

Query  231   GQLIFTP  211
             GQ IF P
Sbjct  567   GQRIFKP  573



>gb|KDP38564.1| hypothetical protein JCGZ_04489 [Jatropha curcas]
Length=538

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/437 (77%), Positives = 382/437 (87%), Gaps = 6/437 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAA------VPKPLVSEKFMYADVWGGELWIDVLKSTLEH  1318
             HSINGQA T+ GVV++MS A  +         P VS K M+ DVWGGELWIDVL+STLE+
Sbjct  95    HSINGQAQTSNGVVVEMSSARRSQLGRGKPDPPQVSAKEMHVDVWGGELWIDVLRSTLEY  154

Query  1317  GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSE  1138
             GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGE +TCS+EQNSE
Sbjct  155   GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGEILTCSQEQNSE  214

Query  1137  LFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQK  958
             LFHAVLGGLGQFG+ITRARIAL  APQRVRWIRVLYS F +FT DQEYLISL+G P  QK
Sbjct  215   LFHAVLGGLGQFGIITRARIALGPAPQRVRWIRVLYSSFSSFTTDQEYLISLYGNPSTQK  274

Query  957   FDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQ  778
             FDYVEGFVIVDEGLINNWRSSFFSPRNPVK SS+ ++GGVLYCLEITKNYD ST D +DQ
Sbjct  275   FDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIDANGGVLYCLEITKNYDDSTLDNIDQ  334

Query  777   EIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRID  598
             E++ LLKKL FIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI 
Sbjct  335   EVESLLKKLNFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIA  394

Query  597   EFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQ  418
             +FD GVFKGILGNKTSGPILIYPMN+NKWD+RTS VTP+E+VFYLVALLRSA++NG ++Q
Sbjct  395   DFDNGVFKGILGNKTSGPILIYPMNRNKWDQRTSVVTPDEDVFYLVALLRSALDNGEDTQ  454

Query  417   TLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHIL  238
             TL  L +QNR IL+FC ++GI +KQYLPHY+T+++W +HFG+KW +F   K++FDP+ IL
Sbjct  455   TLDYLSNQNRQILRFCDDAGINVKQYLPHYTTEKDWVDHFGDKWSQFYRNKMEFDPRRIL  514

Query  237   STGQLIFTPSFNAMTAS  187
             +TGQ IF PSF + + S
Sbjct  515   ATGQRIFMPSFASPSTS  531



>ref|XP_002300742.2| cytokinin oxidase 6 family protein [Populus trichocarpa]
 gb|EEE80015.2| cytokinin oxidase 6 family protein [Populus trichocarpa]
Length=535

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/439 (76%), Positives = 390/439 (89%), Gaps = 8/439 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAA-------VPKPLVSEKFMYADVWGGELWIDVLKSTLE  1321
             HSINGQA T+ GVV++MSG +         + KP VS K  + DVWGGELWIDVL+STLE
Sbjct  93    HSINGQAQTSNGVVIEMSGGSRGSRFGLRKLDKPQVSIKEKHVDVWGGELWIDVLRSTLE  152

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             HGLAPKSWTDYLYLSVGGTLSN GISGQAFNHGPQISNV+ELDVVTGKGE  TCSEE+NS
Sbjct  153   HGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGELSTCSEEKNS  212

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELFHAVLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F  FT DQEYLISLHG P +Q
Sbjct  213   ELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTGDQEYLISLHGNPYSQ  272

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
             KFDYVEGFVIVDEGLINNWRSSFFSPRNPVK SS+ ++GGVLYCLEITKNYD++TADT+D
Sbjct  273   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEITKNYDEATADTID  332

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             QE++ L+K+L FIPSSVFTTDLPY+DFLDRVHKAELKLR+KGLW+VPHPWLNLFVPKSR+
Sbjct  333   QEVEALMKRLNFIPSSVFTTDLPYIDFLDRVHKAELKLRAKGLWEVPHPWLNLFVPKSRM  392

Query  600   DEFDRGVFKGILG-NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
              + DRGVFKGILG NKTSGPILIYPMNK+KWD+R+S VTP+E+VFYLVALLRSA++NG E
Sbjct  393   ADLDRGVFKGILGNNKTSGPILIYPMNKSKWDQRSSVVTPDEDVFYLVALLRSALDNGEE  452

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
             +Q+L+ L +QN  IL+FC ++GI++KQYLPHY+TQ+EW +HFG+KW++F  RK++FDP+H
Sbjct  453   TQSLEYLTNQNHKILRFCDDAGIKVKQYLPHYTTQEEWMDHFGDKWDQFSRRKMEFDPRH  512

Query  243   ILSTGQLIFTPSFNAMTAS  187
             IL+TGQ IF PSF + T +
Sbjct  513   ILATGQRIFNPSFPSSTRT  531



>gb|AIU94750.1| cytokinin oxidase [Morus alba var. multicaulis]
Length=496

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/436 (76%), Positives = 381/436 (87%), Gaps = 11/436 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVP-----------KPLVSEKFMYADVWGGELWIDVLK  1333
             HSINGQA    GVV++MSG+                +P VSE+ MY DVWGGELWI+VLK
Sbjct  41    HSINGQAQATNGVVIKMSGSRERTAADQTSAVAAAARPRVSEREMYVDVWGGELWIEVLK  100

Query  1332  STLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSE  1153
             +TLEHGLAPKSWTDYLYL+VGGTLSNAGISGQ FNHGPQI+NV ELDVVTGKGE +TCSE
Sbjct  101   ATLEHGLAPKSWTDYLYLTVGGTLSNAGISGQTFNHGPQIANVQELDVVTGKGELLTCSE  160

Query  1152  EQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQ  973
             E+NSELFHAVLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F +FTKDQE+LISLHG 
Sbjct  161   EKNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSSFTKDQEFLISLHGL  220

Query  972   PPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTA  793
             P +Q+ DYVEGFVIVDEGLINNWRSSFFSPRNPVK SS+ +D GVLYCLEITKNYD+STA
Sbjct  221   PASQRVDYVEGFVIVDEGLINNWRSSFFSPRNPVKLSSINADEGVLYCLEITKNYDESTA  280

Query  792   DTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  613
             +T+DQE++ LL+KL FIP+SVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPW NLFVP
Sbjct  281   ETIDQEVEGLLRKLDFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWFNLFVP  340

Query  612   KSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVEN  433
             KSRI +FD GVFK ILGNKTSGPILIYPMNK KWD+R+SA+TP+E+VFYLVALLRSA++ 
Sbjct  341   KSRISDFDEGVFKSILGNKTSGPILIYPMNKGKWDQRSSAMTPDEDVFYLVALLRSALDT  400

Query  432   GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFD  253
             G+E+Q+L+ L  QNR IL+FC  +GI+ KQYLPHY+TQQEW +HFG+KW +F  RK++FD
Sbjct  401   GDETQSLEYLMHQNRQILRFCANAGIKAKQYLPHYTTQQEWVDHFGDKWAQFHMRKMEFD  460

Query  252   PKHILSTGQLIFTPSF  205
             P+HIL+ GQ IFTPSF
Sbjct  461   PRHILAIGQRIFTPSF  476



>gb|EYU32888.1| hypothetical protein MIMGU_mgv1a004444mg [Erythranthe guttata]
Length=526

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/436 (77%), Positives = 384/436 (88%), Gaps = 6/436 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK---PLVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HSINGQAM   G+V+QMSG++A   +   P VSE+ M+ DVWGGELWIDVL+STLE+GLA
Sbjct  93    HSINGQAMAGNGLVIQMSGSSAGGSRRLGPRVSEELMHVDVWGGELWIDVLRSTLEYGLA  152

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYLYLSVGGT+SNAGISGQAFNHGPQISNV ELDVVTGKGE +TCS+E NS+L+H
Sbjct  153   PKSWTDYLYLSVGGTISNAGISGQAFNHGPQISNVLELDVVTGKGELMTCSKEHNSKLYH  212

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             AVLGGLGQFG+ITRARIALE  P RV+WIRVLYSDF  FT+DQEYLISLHGQ   +KFDY
Sbjct  213   AVLGGLGQFGIITRARIALEKTPTRVKWIRVLYSDFATFTQDQEYLISLHGQ--KRKFDY  270

Query  948   VEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             VEGFVIVDEGLINNWRSSFFSPRNPVK SS+ +DGGVLYCLEITKNY +S ADT+DQE++
Sbjct  271   VEGFVIVDEGLINNWRSSFFSPRNPVKISSLNADGGVLYCLEITKNYHESNADTIDQEVE  330

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              L+ KL +IP+SVFTTDLPYVDFLDRVHKAELKLR+K LW+VPHPWLNLFVPKSRI +FD
Sbjct  331   ALMNKLNYIPASVFTTDLPYVDFLDRVHKAELKLRAKNLWEVPHPWLNLFVPKSRIADFD  390

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             +G+FKGILGN TSGPILIYPMNKNKWDE++SAVTP E+VFYLVALLRSA+ +GNE+Q+L+
Sbjct  391   KGIFKGILGNNTSGPILIYPMNKNKWDEKSSAVTPNEDVFYLVALLRSALNDGNETQSLE  450

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
              L +QNR IL+FCKE GI++KQYLPHY+T+QEW+ HFGEKW  F  RK +FDP+ IL+TG
Sbjct  451   YLSNQNRKILRFCKEEGIDVKQYLPHYTTEQEWRNHFGEKWNLFSSRKTEFDPRRILATG  510

Query  228   QLIFTPSFN-AMTASW  184
             Q IFTPS N    ASW
Sbjct  511   QRIFTPSLNPTRGASW  526



>ref|XP_009335765.1| PREDICTED: cytokinin dehydrogenase 5 [Pyrus x bretschneideri]
Length=538

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/425 (78%), Positives = 383/425 (90%), Gaps = 4/425 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKP----LVSEKFMYADVWGGELWIDVLKSTLEHGL  1312
             HSINGQA T  G+V+QMSG +    +P     VSEK MY D WGGELWIDVL+STLE+GL
Sbjct  95    HSINGQAQTNNGIVIQMSGGSLRSGRPGQAARVSEKGMYVDTWGGELWIDVLRSTLEYGL  154

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             APKSWTDYLYL+VGGTLSNAGISGQAFN+GPQISNVHELDVVTGKG+ +TCSEEQNSELF
Sbjct  155   APKSWTDYLYLTVGGTLSNAGISGQAFNYGPQISNVHELDVVTGKGQLLTCSEEQNSELF  214

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             HAVLGGLGQFG+ITRARIALE +PQRVRWIRVLYS+F AFTKDQE+LISLHGQP +QKFD
Sbjct  215   HAVLGGLGQFGIITRARIALEPSPQRVRWIRVLYSNFSAFTKDQEFLISLHGQPSSQKFD  274

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             YVEGFVIVDEGLINNWRSSFFSP NPVK +S+ S+GGVLYCLEITKNYD+STAD +D+EI
Sbjct  275   YVEGFVIVDEGLINNWRSSFFSPSNPVKITSIDSEGGVLYCLEITKNYDESTADAIDKEI  334

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LL+KL F+P+SVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI +F
Sbjct  335   EDLLEKLNFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRISDF  394

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
             + GVFKGILGNKTSGPILIYPMNK+KWD+  S VTP+E++FYLVALLR+A++ G+E+ TL
Sbjct  395   NEGVFKGILGNKTSGPILIYPMNKDKWDQSNSVVTPDEDIFYLVALLRTALDTGDETHTL  454

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             ++L +QNR IL+FC ++GIE+KQYLPHY+TQ+EW +HFG+KW RF  RK++FDP+ IL+T
Sbjct  455   EHLTNQNRRILRFCGDAGIEVKQYLPHYTTQEEWMDHFGDKWARFYKRKMEFDPRRILAT  514

Query  231   GQLIF  217
             GQ IF
Sbjct  515   GQRIF  519



>gb|KHG00982.1| Cytokinin dehydrogenase 5 -like protein [Gossypium arboreum]
Length=520

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/436 (79%), Positives = 386/436 (89%), Gaps = 8/436 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HSINGQA T  GVV+QMSG  +   KP V    MY DVWGGELWIDVLKS LE+GLAPKS
Sbjct  89    HSINGQAQTGTGVVVQMSGVRSG-GKPSVWGGDMYVDVWGGELWIDVLKSCLEYGLAPKS  147

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYLYLSVGGTLSNAGISGQAF+HGPQISNVHELDVVTGKGE +TCS+EQN ELF AVL
Sbjct  148   WTDYLYLSVGGTLSNAGISGQAFHHGPQISNVHELDVVTGKGELMTCSKEQNQELFIAVL  207

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE APQRVRWIRVLYS+F AFTKDQEYLISLHG    QKFDYVEG
Sbjct  208   GGLGQFGIITRARISLEPAPQRVRWIRVLYSNFSAFTKDQEYLISLHGN---QKFDYVEG  264

Query  939   FVIVDEGLINNWRSSFFSPRNPVKFSSVKSD--GGVLYCLEITKNYDQSTADTVDQEIDV  766
             FVIVDEGLINNWRSSFFSPRNPVK SS+ S+  GGVLYCLEITKNY +STA+T+DQEI+ 
Sbjct  265   FVIVDEGLINNWRSSFFSPRNPVKISSLGSNNNGGVLYCLEITKNYHESTAETIDQEIEA  324

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LLKKL FIP+SVFTTDLPYVDFLDRVHKAELKLRSKG+W+VPHPWLNLFVPKS+I +FDR
Sbjct  325   LLKKLNFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGMWEVPHPWLNLFVPKSKIADFDR  384

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
             GVFKGILGNKTSGPILIYPMNKNKWD+++S VTP+E+VFYLVA LRSA++NG E+Q+L+ 
Sbjct  385   GVFKGILGNKTSGPILIYPMNKNKWDDKSSVVTPDEDVFYLVAFLRSALDNGEETQSLEY  444

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             L +QNR ILKFC E GI++KQYLPHY TQ EWKEH+G KW+RFQ  K++FDP+HIL++GQ
Sbjct  445   LTNQNRQILKFCDEDGIKVKQYLPHYKTQSEWKEHYGSKWDRFQRMKMKFDPRHILASGQ  504

Query  225   LIFTPSF--NAMTASW  184
              IFTP+F  ++  ASW
Sbjct  505   NIFTPTFLSSSKMASW  520



>emb|CAN81010.1| hypothetical protein VITISV_017949 [Vitis vinifera]
Length=515

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/428 (79%), Positives = 385/428 (90%), Gaps = 6/428 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK---PLVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HSINGQA T++GVV++MS A+  V +   P VSE+  Y D WGGELWIDVLK+TLEHGLA
Sbjct  83    HSINGQAQTSSGVVIEMS-ASKGVRQWGLPRVSEQSRYVDAWGGELWIDVLKTTLEHGLA  141

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVT-GKGESVTCSEEQNSELF  1132
             PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNV+ELDVVT GKGE +TCSEEQNSELF
Sbjct  142   PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTAGKGELLTCSEEQNSELF  201

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             HAVLGGLGQFG+ITRARI LE APQRVRWIRVLYS+F  FTKDQEYLISLHGQPP QKFD
Sbjct  202   HAVLGGLGQFGIITRARIGLEPAPQRVRWIRVLYSNFSTFTKDQEYLISLHGQPPNQKFD  261

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             YVEGFVIVDEGLINNWRSSFFSPRNPVK SS  ++GGVLYCLE+TKNY +STADT+DQ++
Sbjct  262   YVEGFVIVDEGLINNWRSSFFSPRNPVKISSFGTNGGVLYCLEVTKNYHESTADTIDQDV  321

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LLK+L FIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP+SRI +F
Sbjct  322   EALLKRLDFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPRSRIADF  381

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
             D GVFKGILGNKTSGPILIYPMNKNKWD+RTS VTPEE+VFYLVALLRSA+++G+E+Q+L
Sbjct  382   DEGVFKGILGNKTSGPILIYPMNKNKWDDRTSVVTPEEDVFYLVALLRSALDSGDEAQSL  441

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQFDPKHILS  235
             + L +QNR IL+FC ++GI++KQYLPHY+TQ++W +HFG +KW  F  RK+ FDP+ IL+
Sbjct  442   EYLSNQNRQILRFCDDAGIKVKQYLPHYTTQEDWVDHFGDDKWTLFSKRKMDFDPRRILA  501

Query  234   TGQLIFTP  211
             TGQ IF P
Sbjct  502   TGQRIFKP  509



>ref|XP_006435071.1| hypothetical protein CICLE_v10000709mg [Citrus clementina]
 gb|ESR48311.1| hypothetical protein CICLE_v10000709mg [Citrus clementina]
Length=572

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/435 (77%), Positives = 381/435 (88%), Gaps = 8/435 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAA--------AVPKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HSINGQA T+ GVV+QMSG+          A  +P V EK  Y DVWGGELWIDVL+STL
Sbjct  132   HSINGQAQTSNGVVIQMSGSRGRRLGSSTPAALRPHVYEKERYVDVWGGELWIDVLRSTL  191

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             EHGLAPKSWTDYLYLSVGGTLSNAGISGQAF+ GPQI+NVHELDVVTGKGE +TCSEEQN
Sbjct  192   EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGKGELLTCSEEQN  251

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             S LFHAVLGGLGQFG+ITRARI+LE AP+RVRWIRVLYSDF  FT+DQEYLISLH  P +
Sbjct  252   SGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQEYLISLHELPAS  311

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
             QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVK +S+ +DGGVLYCLEITKNYD+STA+T 
Sbjct  312   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGADGGVLYCLEITKNYDESTAETT  371

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             DQE++ LLKKL FIPSSVFTTDL YVDFLDRVHKAELKLRSKGLW+VPHPWLNLF+PKSR
Sbjct  372   DQEVESLLKKLNFIPSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFIPKSR  431

Query  603   IDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             I +FD+GVFKGILGNKT GPILIYPMNK+KWD R+S VTP+E+VFYLVA LRSA++NG E
Sbjct  432   IADFDKGVFKGILGNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLVAFLRSALDNGEE  491

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
              Q+L+ L  QNR ILKFC E+GI+ KQYLPHY+TQ+EW +HFG+KW +F  RK++FDP+H
Sbjct  492   MQSLEYLNHQNRQILKFCDEAGIKAKQYLPHYTTQEEWVDHFGDKWGQFYQRKMEFDPRH  551

Query  243   ILSTGQLIFTPSFNA  199
             IL+TGQ IF PSF +
Sbjct  552   ILATGQRIFKPSFQS  566



>ref|XP_004291832.1| PREDICTED: cytokinin dehydrogenase 5-like [Fragaria vesca subsp. 
vesca]
Length=535

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/442 (76%), Positives = 384/442 (87%), Gaps = 7/442 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAA-----VPKPLVSEKFMYADVWGGELWIDVLKSTLEHG  1315
             HSINGQA    GVV+ MSG   A         +VSEK +Y D WGGELWI+VL++TLEHG
Sbjct  94    HSINGQAQARNGVVIAMSGGNRAGGRRETAAGVVSEKGLYVDAWGGELWIEVLRATLEHG  153

Query  1314  LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSEL  1135
             LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNV ELDVVTGKGE +TCSEE+N+EL
Sbjct  154   LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVLELDVVTGKGELLTCSEERNAEL  213

Query  1134  FHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKF  955
             FHAVLGGLGQFG+ITRARIALE AP RVRWIRVLYS+F AFTKDQEYLISLHGQP ++KF
Sbjct  214   FHAVLGGLGQFGIITRARIALEPAPTRVRWIRVLYSNFSAFTKDQEYLISLHGQPSSRKF  273

Query  954   DYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDG--GVLYCLEITKNYDQSTADTVD  781
             DYVEGFVIVDEGLINNWRSSFFSP NPVK SS+ S+G  GVLYCLEITKNYD STAD++D
Sbjct  274   DYVEGFVIVDEGLINNWRSSFFSPSNPVKISSIDSNGNGGVLYCLEITKNYDDSTADSID  333

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             QEI+ LLK+L F+P+SVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI
Sbjct  334   QEIEALLKELDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  393

Query  600   DEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNES  421
              +FD GVFKGILGNKTSGP+LIYPMNK+KWD+R+S VTP+E+VFYLVALLRSA+++G+E+
Sbjct  394   SDFDEGVFKGILGNKTSGPVLIYPMNKDKWDQRSSVVTPDEDVFYLVALLRSALDSGDET  453

Query  420   QTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHI  241
              TL+ L +QNR I KFC E+GI++KQYLPHY+TQQEW +HFG+KW  F  RK++FDP+ I
Sbjct  454   HTLEYLTNQNRRIFKFCDEAGIKVKQYLPHYTTQQEWMDHFGDKWPLFYQRKMEFDPRRI  513

Query  240   LSTGQLIFTPSFNAMTASW*QL  175
             L+TGQ IFT   +  TA   QL
Sbjct  514   LATGQRIFTGPSSVSTAGHDQL  535



>ref|XP_007221789.1| hypothetical protein PRUPE_ppa003895mg [Prunus persica]
 gb|EMJ22988.1| hypothetical protein PRUPE_ppa003895mg [Prunus persica]
Length=542

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/432 (77%), Positives = 382/432 (88%), Gaps = 8/432 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAA--------VPKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HSINGQA T  GVV++M+G  ++             VSEK MY D WGGELWIDVL+STL
Sbjct  94    HSINGQAQTNNGVVIEMNGGGSSGRVMSRVRSGSGRVSEKGMYVDAWGGELWIDVLRSTL  153

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             E+GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQIS+V ELDVVTG+GE +TCSEE+N
Sbjct  154   EYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISSVDELDVVTGRGELLTCSEEKN  213

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             SELFHAVLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F AFTKDQE+LISLHGQP  
Sbjct  214   SELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSAFTKDQEFLISLHGQPST  273

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
              KFDYVEGFVIVDEGLINNWRSSFFSP NPVK +S+ S GGVLYCLEITKNY +STADT+
Sbjct  274   HKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKITSINSQGGVLYCLEITKNYHESTADTI  333

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             DQEI+ LLKKL F+P+SVFTTDLPYVDFLDRVHKAELKLRSK LWDVPHPWLNLFVPKSR
Sbjct  334   DQEIEGLLKKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKSLWDVPHPWLNLFVPKSR  393

Query  603   IDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             I +FD+GVFKGILGNKTSGPILIYPMNK+KWD+R+S VTP+E++FYLVALLRSA++ G+E
Sbjct  394   ISDFDKGVFKGILGNKTSGPILIYPMNKDKWDQRSSVVTPDEDIFYLVALLRSALDTGDE  453

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
             + TL++L +QNR ILKFC ++GI++KQYLPHY+TQ+EW +HFG+KW +F  RK+ FDP+ 
Sbjct  454   THTLEHLTNQNRQILKFCDDAGIKVKQYLPHYTTQEEWMDHFGDKWGQFYQRKMDFDPRR  513

Query  243   ILSTGQLIFTPS  208
             IL+TGQ IF+PS
Sbjct  514   ILATGQRIFSPS  525



>ref|XP_008387997.1| PREDICTED: cytokinin dehydrogenase 5-like [Malus domestica]
Length=538

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/425 (77%), Positives = 383/425 (90%), Gaps = 4/425 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPL----VSEKFMYADVWGGELWIDVLKSTLEHGL  1312
             HSINGQA T  GVV+QMSG +    +P     VSEK MY D WGGELWIDVL+STLE+GL
Sbjct  95    HSINGQAQTNNGVVIQMSGGSLRSGRPAQAARVSEKGMYVDTWGGELWIDVLRSTLEYGL  154

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             APKSWTDYLYL+VGGTLSNAGISGQAFN+GPQISNVHELDVVTGKG+ +TCSEEQNSELF
Sbjct  155   APKSWTDYLYLTVGGTLSNAGISGQAFNYGPQISNVHELDVVTGKGQLLTCSEEQNSELF  214

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
              AVLGGLGQFG+ITRARIALE +P+RVRWIRVLYS+F AFTKDQE+LISLHGQP +QKFD
Sbjct  215   QAVLGGLGQFGIITRARIALEPSPKRVRWIRVLYSNFSAFTKDQEFLISLHGQPSSQKFD  274

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             YVEGFVIVDEGLINNWRSSFFS  NPVK +S+ S+GGVLYCLEITKNYD+STADT+D+EI
Sbjct  275   YVEGFVIVDEGLINNWRSSFFSASNPVKITSIDSEGGVLYCLEITKNYDESTADTIDKEI  334

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LL+KL F+P+SVFTTDLPYVDFLDRVHKAELKLR+KGLWDVPHPWLNLFVPKSRI +F
Sbjct  335   EDLLEKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRAKGLWDVPHPWLNLFVPKSRISDF  394

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
             + GVFKGILGNKTSGPILIYPMNK+KWD+ +S VTP+E++FYLVALLR+A++ G+E+ TL
Sbjct  395   NEGVFKGILGNKTSGPILIYPMNKDKWDQSSSVVTPDEDIFYLVALLRTALDTGDETHTL  454

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             ++L +QNR IL+FC ++GIE+KQYLPHY+TQ+EW +HFG+KW RF  RK++FDP+ IL+T
Sbjct  455   EHLTNQNRQILRFCVDAGIEVKQYLPHYTTQEEWMDHFGDKWARFYKRKMEFDPRRILAT  514

Query  231   GQLIF  217
             GQ IF
Sbjct  515   GQRIF  519



>ref|XP_002307681.1| hypothetical protein POPTR_0005s25380g [Populus trichocarpa]
 gb|EEE94677.1| hypothetical protein POPTR_0005s25380g [Populus trichocarpa]
Length=534

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/432 (76%), Positives = 383/432 (89%), Gaps = 8/432 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAA-------VPKPLVSEKFMYADVWGGELWIDVLKSTLE  1321
             HSINGQA T+ GVV++M+G +         + KP V+ K M+ DVWGGELWIDVL+STLE
Sbjct  93    HSINGQAQTSNGVVIEMNGGSRGSRLGLGNLAKPQVAVKEMHVDVWGGELWIDVLRSTLE  152

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             HGLAPKSWTDYLYLSVGGTLSN GISGQAFNHGPQISNV+ELDVVTGKGE +TCSEE+NS
Sbjct  153   HGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGELMTCSEEKNS  212

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             +LFHAVLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F  FT DQEYLIS+HG+P   
Sbjct  213   KLFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTGDQEYLISMHGKPSTL  272

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
             KFDYVEGFVIVDEGLINNWRSSFFSPRNPVK SSV ++GGVLYCLEITKNYD+ST DT+D
Sbjct  273   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSVGANGGVLYCLEITKNYDESTGDTID  332

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             QE++ L+K L FIPS+VFTTDLPY DFLDRVH+AELKLR+KGLW+VPHPWLNLFVP+SRI
Sbjct  333   QEVEALMKNLNFIPSTVFTTDLPYTDFLDRVHRAELKLRAKGLWEVPHPWLNLFVPRSRI  392

Query  600   DEFDRGVFKGILG-NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
              + DRGVFKGILG NKTSGPILIYPMNKNKWD+R+S VTP+E+VFYLVALLRSA++NG E
Sbjct  393   ADLDRGVFKGILGNNKTSGPILIYPMNKNKWDQRSSVVTPDEDVFYLVALLRSALDNGEE  452

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
             +Q+L+ L  QNR IL+FC ++GI++KQYLPHY+T++EW +HFG+KW+RF  RK++FDP+ 
Sbjct  453   TQSLEYLTDQNRKILRFCDDAGIKVKQYLPHYTTREEWMDHFGDKWDRFYQRKMEFDPRR  512

Query  243   ILSTGQLIFTPS  208
             IL+TGQ IF PS
Sbjct  513   ILATGQRIFNPS  524



>ref|XP_006473567.1| PREDICTED: cytokinin dehydrogenase 5-like [Citrus sinensis]
Length=572

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/435 (77%), Positives = 380/435 (87%), Gaps = 8/435 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAA--------AVPKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HSINGQA T+ GVV+QMSG+          A  +P V EK  Y DVWGGELWIDVL+STL
Sbjct  132   HSINGQAQTSNGVVIQMSGSRGRRLGSSTPAALRPHVYEKERYVDVWGGELWIDVLRSTL  191

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             EHGLAPKSWTDYLYLSVGGTLSNAGISGQAF+ GPQI+NVHELDVVTGKGE +TCSEEQN
Sbjct  192   EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGKGELLTCSEEQN  251

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             S LFHAVLGGLGQFG+ITRARI+LE AP+RVRWIRVLYSDF  FT+DQEYLISLH  P +
Sbjct  252   SGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQEYLISLHELPAS  311

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
             QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVK +S+ +DGGVLYCLEITKNYD+STADT 
Sbjct  312   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGTDGGVLYCLEITKNYDESTADTT  371

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             DQE++ LLKKL FI SSVFTTDL YVDFLDRVHKAELKLRSKGLW+VPHPWLNLF+PKSR
Sbjct  372   DQEVESLLKKLNFIQSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFIPKSR  431

Query  603   IDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             I +FD+GVFKGILGNKT GPILIYPMNK+KWD R+S VTP+E+VFYLVA LRSA++NG E
Sbjct  432   IADFDKGVFKGILGNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLVAFLRSALDNGEE  491

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
              Q+L+ L  QNR ILKFC E+GI+ KQYLPHY+TQ+EW +HFG+KW +F  RK++FDP++
Sbjct  492   MQSLEYLNHQNRQILKFCDEAGIKAKQYLPHYTTQEEWVDHFGDKWGQFYQRKMEFDPRY  551

Query  243   ILSTGQLIFTPSFNA  199
             IL+TGQ IF PSF +
Sbjct  552   ILATGQRIFKPSFQS  566



>ref|XP_011028922.1| PREDICTED: cytokinin dehydrogenase 5-like [Populus euphratica]
Length=534

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/433 (76%), Positives = 386/433 (89%), Gaps = 8/433 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAA-------VPKPLVSEKFMYADVWGGELWIDVLKSTLE  1321
             HSINGQA T+ GVV++MSG +         + KP VS K  + DVWGGELWIDVL+ TLE
Sbjct  92    HSINGQAQTSNGVVIEMSGGSKGRRLGLRKLDKPQVSIKEKHVDVWGGELWIDVLRRTLE  151

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             HGLAPKSWTDYLYLSVGGTLSN GISGQAFNHGPQISNV+ELDVVTGKGE  TCSEE+NS
Sbjct  152   HGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGELWTCSEEENS  211

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELFHAVLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F  FT+DQE LISLHG P +Q
Sbjct  212   ELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTRDQEDLISLHGNPYSQ  271

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
             KFDYVEGFVIVDEGLINNWRSSFFSPRNPVK SS+ ++GGVLYCLEITKNYD++TADT+D
Sbjct  272   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEITKNYDEATADTID  331

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             QE++ L+K+L FIPSSVFTTDLPY+DFLDRVHKAELKLR+KGLW+VPHPWLNLFVPKSR+
Sbjct  332   QEVEALMKRLNFIPSSVFTTDLPYIDFLDRVHKAELKLRAKGLWEVPHPWLNLFVPKSRM  391

Query  600   DEFDRGVFKGILG-NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
              + DRGVFKGILG NKTSGPILIYPMNK+KWD+R+S VTP+E+VFYLVALLRSA++NG E
Sbjct  392   ADVDRGVFKGILGNNKTSGPILIYPMNKSKWDQRSSVVTPDEDVFYLVALLRSALDNGEE  451

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
             +Q+L+ L +QN  +L+FC ++GI++KQYLPHY+TQ+EW++HFG+KW++F  RK++FDP+H
Sbjct  452   TQSLEYLTNQNHKVLRFCDDAGIKVKQYLPHYTTQEEWRDHFGDKWDQFSRRKMEFDPRH  511

Query  243   ILSTGQLIFTPSF  205
             IL+TGQ IF P F
Sbjct  512   ILATGQRIFNPPF  524



>ref|XP_008221343.1| PREDICTED: cytokinin dehydrogenase 5 [Prunus mume]
Length=543

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/429 (77%), Positives = 377/429 (88%), Gaps = 8/429 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAA--------VPKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HSINGQA T  GVV++M+G  ++             VSEK MY D WGGELWIDVL STL
Sbjct  94    HSINGQAQTNNGVVIEMNGGGSSGRVMSRVRSGSGRVSEKGMYVDAWGGELWIDVLMSTL  153

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             E+GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQIS+V ELDVVTG+GE +TCSEE+N
Sbjct  154   EYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISSVDELDVVTGRGELLTCSEEKN  213

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             +ELFHAVLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F AFTKDQE+LISLHGQP  
Sbjct  214   AELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSAFTKDQEFLISLHGQPST  273

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
              KFDYVEGFVIVDEGLINNWRSSFFSP NPVK +S+ S GGVLYCLEITKNY +STADT+
Sbjct  274   HKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKITSINSQGGVLYCLEITKNYHESTADTI  333

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             DQEI+ LLKKL F+P+SVFTTDLPYVDFLDRVHKAELKLRSK LWDVPHPWLNLFVPKSR
Sbjct  334   DQEIECLLKKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKSLWDVPHPWLNLFVPKSR  393

Query  603   IDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             I +FD GVFKGILGNKTSGPILIYPMNK+KWD+R+S VTP+E++FYLVALLRSA++ G+E
Sbjct  394   ISDFDEGVFKGILGNKTSGPILIYPMNKDKWDQRSSVVTPDEDIFYLVALLRSALDTGDE  453

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
             + TL++L +QNR ILKFC ++GI+ KQYLPHY+TQ+EW +HFG+KW++F  RK+ FDP+ 
Sbjct  454   THTLEHLTNQNRQILKFCDDAGIKAKQYLPHYTTQEEWMDHFGDKWDQFYQRKVDFDPRR  513

Query  243   ILSTGQLIF  217
             IL+TGQ IF
Sbjct  514   ILATGQRIF  522



>ref|XP_010254676.1| PREDICTED: cytokinin dehydrogenase 5-like [Nelumbo nucifera]
Length=543

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/440 (76%), Positives = 379/440 (86%), Gaps = 15/440 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS------------GAAAAVPKPLVSEK--FMYADVWGGELWID  1342
             HSINGQA    GVV+ MS            G  AA P  L+ +K    Y DVWGGELWID
Sbjct  95    HSINGQAHATDGVVIAMSSSTSKRNRISLQGNPAARPTLLLGDKPSCSYMDVWGGELWID  154

Query  1341  VLKSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVT  1162
             VL STLE+GLAP+SWTDYLYLSVGGTLSNAGISGQAFNHGPQI+NV+ELDVVTGKGE VT
Sbjct  155   VLNSTLEYGLAPRSWTDYLYLSVGGTLSNAGISGQAFNHGPQITNVYELDVVTGKGEVVT  214

Query  1161  CSEEQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISL  982
             CS E NSELFHAVLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F AFTKDQEYLISL
Sbjct  215   CSNEHNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSAFTKDQEYLISL  274

Query  981   HGQPPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSV-KSDGGVLYCLEITKNYD  805
             HG P   +FDYVEGFVIVDEGLINNWRSSFFSPRNPVK SS+  ++GGVLYCLE+TKNYD
Sbjct  275   HGNPSTDRFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLGAANGGVLYCLEVTKNYD  334

Query  804   QSTADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLN  625
             +STADTVDQE+  LLKKL FIP+++FTTD+PY+DFLDRVHKAELKLRSKGLWDVPHPWLN
Sbjct  335   ESTADTVDQEVGALLKKLDFIPTTIFTTDIPYLDFLDRVHKAELKLRSKGLWDVPHPWLN  394

Query  624   LFVPKSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRS  445
             LFVPKSRI +FDRGVFKGILGNKTSGPILIYPMNKNKWD R+S VTP+E++FYLV LLRS
Sbjct  395   LFVPKSRIADFDRGVFKGILGNKTSGPILIYPMNKNKWDHRSSVVTPDEDIFYLVGLLRS  454

Query  444   AVENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRK  265
             A+++G E+QT++ L +QNR IL+FC E+GI++K YLP++STQ+EWK HFGEKW+ F  RK
Sbjct  455   ALDSGEETQTMEYLNNQNRQILRFCNEAGIKVKHYLPNHSTQEEWKAHFGEKWDLFVKRK  514

Query  264   LQFDPKHILSTGQLIFTPSF  205
             ++FDPK IL+TGQ IF P+F
Sbjct  515   MEFDPKRILATGQRIFQPAF  534



>ref|XP_007017645.1| Cytokinin oxidase 5 [Theobroma cacao]
 gb|EOY14870.1| Cytokinin oxidase 5 [Theobroma cacao]
Length=534

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/427 (77%), Positives = 379/427 (89%), Gaps = 7/427 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG-------AAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLE  1321
             HSINGQA T  GVV+QMSG       A+   P+P V  +  Y DVWGGELWIDVL+STL 
Sbjct  93    HSINGQAQTTNGVVIQMSGSRGSGRMASGKPPQPRVWARESYVDVWGGELWIDVLRSTLG  152

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             +GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNV+ELDVVTGKGE +TCSEEQN 
Sbjct  153   YGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELLTCSEEQNP  212

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELF AVLGGLGQFG+ITRARI+LE APQRVRWIRVLYS+F AFT DQEYLISL G+P +Q
Sbjct  213   ELFQAVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSNFSAFTTDQEYLISLQGKPTSQ  272

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
             KFDY+EGFVIVDEGLINNWRSSFFSPRNPVK SS+ ++GGVLYCLEITKNY +STADT+D
Sbjct  273   KFDYIEGFVIVDEGLINNWRSSFFSPRNPVKISSLGANGGVLYCLEITKNYHESTADTID  332

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             QE++ LLKKL FIP+SVFTTDL YVDFLDRVHKAELKLRSKGLW+VPHPWLNLFVPKS+I
Sbjct  333   QEVESLLKKLNFIPTSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSKI  392

Query  600   DEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNES  421
              +FD+GVFKGILGNKTSGPILIYPMNKNKWD R+S VTP+E+VFYLVALLRSA++NG E+
Sbjct  393   ADFDKGVFKGILGNKTSGPILIYPMNKNKWDPRSSVVTPDEDVFYLVALLRSALDNGEET  452

Query  420   QTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHI  241
             ++L+ L  QNR IL+FC ++GI++KQYLPHY+TQ+EW +HFG+KW+RF   K++FDP+HI
Sbjct  453   RSLECLTDQNRRILRFCDDAGIKVKQYLPHYTTQEEWMDHFGDKWDRFHQMKMEFDPRHI  512

Query  240   LSTGQLI  220
             L+TGQ I
Sbjct  513   LATGQQI  519



>gb|AHL64253.1| cytokinin dehydrogenase 5 [Rosa canina]
Length=541

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/435 (76%), Positives = 380/435 (87%), Gaps = 13/435 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGA-AAAVPKP----------LVSEKFMYADVWGGELWIDVLK  1333
             HSINGQA    GVV++MSG       KP          +VSEK +Y D WGGELWI+VL+
Sbjct  94    HSINGQAQARNGVVVEMSGGNRVGSGKPAAGRSETVGRVVSEKGLYMDAWGGELWIEVLR  153

Query  1332  STLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSE  1153
             +TLE+GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNV E+DVVTGKGE +TCSE
Sbjct  154   ATLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVLEVDVVTGKGELLTCSE  213

Query  1152  EQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQ  973
             E+NSELFHAVLGGLGQFG+ITRARIALE AP+RVRWIRVLYS+F AFTKDQEYLISLHGQ
Sbjct  214   ERNSELFHAVLGGLGQFGIITRARIALEPAPKRVRWIRVLYSNFSAFTKDQEYLISLHGQ  273

Query  972   PPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDG--GVLYCLEITKNYDQS  799
             P +QKFDYVEGFVIVDEGLINNWRSSFFSP NPVK SS+ S+G  G+LYCLEITKNYD S
Sbjct  274   PSSQKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSIDSNGNGGILYCLEITKNYDDS  333

Query  798   TADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLF  619
             TADT+DQEI+ LL+KL F+P+SVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLF
Sbjct  334   TADTIDQEIEALLEKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLF  393

Query  618   VPKSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAV  439
             VPKSRI +FD GVFKGILGNKTSGP+LIYPMN +KWD+++S VTP+E+VFYLVALLRSA+
Sbjct  394   VPKSRIADFDEGVFKGILGNKTSGPVLIYPMNNDKWDQQSSVVTPDEDVFYLVALLRSAL  453

Query  438   ENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQ  259
             ++G+E+ TL+ L  QNR I KFC E+GI++KQYLPHY+TQQEW +HFG+KW +F  RK++
Sbjct  454   DSGDETHTLEYLTDQNRRIFKFCDEAGIKIKQYLPHYTTQQEWMDHFGDKWPQFYQRKME  513

Query  258   FDPKHILSTGQLIFT  214
             FDP+ IL+TGQ IF 
Sbjct  514   FDPRRILATGQRIFA  528



>ref|XP_010061263.1| PREDICTED: cytokinin dehydrogenase 5 [Eucalyptus grandis]
 gb|KCW68188.1| hypothetical protein EUGRSUZ_F01857 [Eucalyptus grandis]
Length=534

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/431 (77%), Positives = 375/431 (87%), Gaps = 6/431 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAV---PKPLVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HSINGQA  A GVVL+MSGA  A    P P V+ +  Y D WGGELWIDVL+STLE GLA
Sbjct  94    HSINGQAQAAGGVVLKMSGAGPAAQSRPAPRVAAEERYVDAWGGELWIDVLRSTLERGLA  153

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYLYLSVGGTLSN GISGQAFNHGPQISNV+ELDVVTGKG+ VTCSEE+NS+LFH
Sbjct  154   PKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGDIVTCSEEKNSQLFH  213

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             AVLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F +FT+DQEYL SLHG+P ++KFDY
Sbjct  214   AVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSSFTRDQEYLTSLHGEPASKKFDY  273

Query  948   VEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             VEGFVIVDEGLINNWRSSFFSPRNPVK SS+ +DGGVLYCLE+TKNYD+S ADTVDQE++
Sbjct  274   VEGFVIVDEGLINNWRSSFFSPRNPVKISSLGTDGGVLYCLEVTKNYDESKADTVDQEVE  333

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LLK L FIP+SVFTTD+PYVDFLDRVHKAE KLR+K LWDVPHPWLNLFVP+SRI +FD
Sbjct  334   YLLKDLDFIPTSVFTTDIPYVDFLDRVHKAESKLRAKNLWDVPHPWLNLFVPRSRIADFD  393

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVEN--GNESQT  415
             RGVFKGILG+K SGPILIYPMNKNKWD+R+S VTPEE+VFYLVALLRSA  +  G+ S+ 
Sbjct  394   RGVFKGILGDKASGPILIYPMNKNKWDQRSSVVTPEEDVFYLVALLRSATVDGSGDASRR  453

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQFDPKHIL  238
             L++L  QNR ILKFC + GIE+KQYLPHYST++EW  HFG +KW RF   K++FDPK IL
Sbjct  454   LEHLADQNRRILKFCGDEGIEVKQYLPHYSTREEWTGHFGDDKWARFYQNKMEFDPKQIL  513

Query  237   STGQLIFTPSF  205
             STGQ IF P F
Sbjct  514   STGQRIFKPDF  524



>ref|XP_011048828.1| PREDICTED: cytokinin dehydrogenase 5-like [Populus euphratica]
Length=534

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/432 (76%), Positives = 379/432 (88%), Gaps = 8/432 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAA-------VPKPLVSEKFMYADVWGGELWIDVLKSTLE  1321
             HSINGQA T  GVV++MSG +         + K  V+ K M+ DVWGGELWIDVL+ TLE
Sbjct  93    HSINGQAQTNNGVVIEMSGGSRGSRLGLGNLAKQQVAVKEMHVDVWGGELWIDVLRRTLE  152

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             HGLAPKSWTDYLYLSVGGTLSN GISGQAFNHGPQISNV+ELDVVTGKGE +TCSEE+NS
Sbjct  153   HGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGELMTCSEEKNS  212

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             +LFHAVLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F  FT DQEYLIS+HG+P   
Sbjct  213   KLFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTGDQEYLISMHGKPSTL  272

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
             KFDYVEGFVIVDEGLINNWRSSFFSPRNPVK SSV ++GGVLYCLEITKNYD+ST DT+D
Sbjct  273   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSVGANGGVLYCLEITKNYDESTGDTID  332

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             QE++ L+K L FIPS+VFTTDLPY DFLDRVH+AELKLR+KGLW+VPHPWLNLFVP+SRI
Sbjct  333   QEVEALMKNLNFIPSTVFTTDLPYTDFLDRVHRAELKLRAKGLWEVPHPWLNLFVPRSRI  392

Query  600   DEFDRGVFKGILG-NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
              + DRGVFKGILG NKTSGPILIYPMNKNKWD+R+S VTP+E+VFYLVALLRSA++NG E
Sbjct  393   ADLDRGVFKGILGNNKTSGPILIYPMNKNKWDQRSSVVTPDEDVFYLVALLRSALDNGEE  452

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
             +Q+L+ L  QN  IL+FC ++GI++KQYLPHY+T++EW +HFG+KW+RF  RK++FDP+ 
Sbjct  453   TQSLEYLTDQNGKILRFCDDAGIKVKQYLPHYTTREEWMDHFGDKWDRFYQRKMEFDPRR  512

Query  243   ILSTGQLIFTPS  208
             IL+TGQ IF PS
Sbjct  513   ILATGQRIFNPS  524



>ref|XP_010275527.1| PREDICTED: cytokinin dehydrogenase 5-like isoform X1 [Nelumbo 
nucifera]
Length=535

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/441 (75%), Positives = 387/441 (88%), Gaps = 10/441 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAA---VPKPLVS----EKFMYADVWGGELWIDVLKSTLE  1321
             HSI+GQA  A GVV+ MS + +    + +P +S     K  Y DVWGGELWIDVL STLE
Sbjct  94    HSISGQAQAANGVVIAMSSSISKRNRLTRPSLSLGLGHKSSYVDVWGGELWIDVLNSTLE  153

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             HGLAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE +TCS EQNS
Sbjct  154   HGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEILTCSNEQNS  213

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             +LFHAVLGGLGQFG+ITRARIALE APQRV+WIRVLYS F AFTKDQEYLISL+G P ++
Sbjct  214   QLFHAVLGGLGQFGIITRARIALEPAPQRVKWIRVLYSKFSAFTKDQEYLISLNGHPASE  273

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSV--KSDGGVLYCLEITKNYDQSTADT  787
             +FDYVEGFVIVDEGLINNWRSSFFSPRNPVK SS+   ++GGVLYCLEITKNYD+S++DT
Sbjct  274   RFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLGAAANGGVLYCLEITKNYDESSSDT  333

Query  786   VDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKS  607
             VDQE++ LLKKL FIP+SVFTTD+PYVDFLDRVHKAELKLR+KGLWDVPHPWLNLFVPKS
Sbjct  334   VDQEVEALLKKLDFIPTSVFTTDIPYVDFLDRVHKAELKLRAKGLWDVPHPWLNLFVPKS  393

Query  606   RIDEFDRGVFKGILGN-KTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             RI +FD+GVFKGILGN KTSGPILIYPMN+NKW++R+S VTP+E+ FYLVALLRSA+++G
Sbjct  394   RIADFDQGVFKGILGNKKTSGPILIYPMNRNKWNQRSSVVTPDEDTFYLVALLRSALDSG  453

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
              E+QTL  L +QNR IL+FCKE+GI++KQYLP+ STQ+EWK+HFG+KW+    RK++FDP
Sbjct  454   EETQTLDYLSNQNRQILRFCKETGIKVKQYLPNLSTQEEWKDHFGDKWDLIVKRKMEFDP  513

Query  249   KHILSTGQLIFTPSFNAMTAS  187
             KHIL+TGQ IF P   + T+S
Sbjct  514   KHILATGQRIFQPGLTSSTSS  534



>dbj|BAM74648.1| cytokinin oxidase/dehydrogenase [Torenia fournieri]
Length=531

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/435 (78%), Positives = 381/435 (88%), Gaps = 13/435 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAA----AVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGL  1312
             HSINGQAM + G+V+QMSG +     A  K  V EK MY DVWGGELW+DVL+STL HGL
Sbjct  94    HSINGQAMASNGIVIQMSGGSVHDHEATTK--VWEKLMYVDVWGGELWVDVLRSTLRHGL  151

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNV+ELDVVTGKGE +TCS+++NSEL+
Sbjct  152   APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELLTCSKDENSELY  211

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             +AVLGGLGQFG+ITRARIALE AP RVRWIRVLYS+F AFT+DQEYLISLHGQ  ++ FD
Sbjct  212   YAVLGGLGQFGIITRARIALEKAPTRVRWIRVLYSNFTAFTEDQEYLISLHGQ--SEMFD  269

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSD--GGVLYCLEITKNYDQSTADTVDQ  778
             YVEGFVIVDEGLINNWRSSFFSPRNPVK SS+KSD  GGVLYCLE+TKNY +S AD +DQ
Sbjct  270   YVEGFVIVDEGLINNWRSSFFSPRNPVKVSSLKSDDEGGVLYCLEVTKNYHESNADFIDQ  329

Query  777   EIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRID  598
             E+D LLKKL FIPSSVFTTDLPYVDFLDRVHKAELKLR+K LWDVPHPWLNLFVPKSRI 
Sbjct  330   EVDALLKKLNFIPSSVFTTDLPYVDFLDRVHKAELKLRAKNLWDVPHPWLNLFVPKSRIH  389

Query  597   EFDRGVFKGILG-NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG-NE  424
             +FD+GVFKGILG NKTSGPILIYPMNKNKWDE+TS VTP E+VFYLVALLRSA++NG +E
Sbjct  390   DFDKGVFKGILGNNKTSGPILIYPMNKNKWDEKTSVVTPNEDVFYLVALLRSALDNGDDE  449

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQFDPK  247
              QTL  L +QNR IL FC++ GI  KQYLPHY+TQQEWK HFG +KW++F  RK +FDP+
Sbjct  450   MQTLDYLSNQNRRILGFCQDQGIGCKQYLPHYTTQQEWKLHFGDDKWKQFNKRKTEFDPR  509

Query  246   HILSTGQLIFTPSFN  202
             HIL+TGQ IFTP  N
Sbjct  510   HILATGQRIFTPLIN  524



>ref|XP_010672675.1| PREDICTED: cytokinin dehydrogenase 5 [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/427 (78%), Positives = 373/427 (87%), Gaps = 5/427 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS--GAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HSINGQA T+ GVV++M   G  +    P+V+E   Y DVWGGELW+DVLK TLE+GLAP
Sbjct  87    HSINGQAHTSDGVVIEMGIKGNKSGPGGPVVNEIEEYVDVWGGELWVDVLKCTLEYGLAP  146

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYLYL+VGGTLSNAGISGQAFNHGPQISNV ELDVVTG GE VTCSE++NSELFHA
Sbjct  147   KSWTDYLYLTVGGTLSNAGISGQAFNHGPQISNVFELDVVTGNGELVTCSEKKNSELFHA  206

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFG+ITRARIALE +PQRVRWIRVLYS+F AFTKDQEYLISLH +P +QKFDYV
Sbjct  207   VLGGLGQFGIITRARIALEPSPQRVRWIRVLYSNFTAFTKDQEYLISLHDRPSSQKFDYV  266

Query  945   EGFVIVDEGLINNWRSSFFSPRNPVKFSSV--KSDGGVLYCLEITKNYDQSTADTVDQEI  772
             EGFVIVDEGLINNWRSSFFSP NPVK SS+   ++G VLYCLEITKNY  S +++VD+EI
Sbjct  267   EGFVIVDEGLINNWRSSFFSPSNPVKISSLGASNNGDVLYCLEITKNYFDS-SESVDEEI  325

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LLKKL FIP+SVFTTDLPY+DFLDRVHKAELKLRSKGLW+VPHPWLNLFVPKS I EF
Sbjct  326   EALLKKLDFIPASVFTTDLPYMDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSSIAEF  385

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
             D+GVFKGILGNKTSGPILIYPMNK KWD  TS VTP EEVFYLVALLR+A+ENG E+QTL
Sbjct  386   DKGVFKGILGNKTSGPILIYPMNKRKWDNSTSVVTPNEEVFYLVALLRTALENGEETQTL  445

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             + L SQNR IL FCK++ I +KQYLPHY+TQQEW +HFG+KW+RF   K+QFDPKHILST
Sbjct  446   EYLTSQNRKILNFCKQAKIGVKQYLPHYTTQQEWIDHFGDKWDRFYKMKMQFDPKHILST  505

Query  231   GQLIFTP  211
             GQ IF P
Sbjct  506   GQRIFGP  512



>gb|KFK41981.1| hypothetical protein AALP_AA2G196900 [Arabis alpina]
Length=534

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/422 (76%), Positives = 371/422 (88%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA     GVV++M+   A  P+PLV  K MY DVWGGELW+DVLK TLEHGLAPK
Sbjct  99    HSINGQAAVGRNGVVVEMNHREAGTPEPLVRLKEMYVDVWGGELWVDVLKKTLEHGLAPK  158

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV ELDVVTGKGE + CSEE+N+ LFH V
Sbjct  159   SWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMKCSEEENTRLFHGV  218

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  219   LGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQ---SKFDYVE  275

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S ++T+DQEI++L
Sbjct  276   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSESETIDQEIEIL  335

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL Y+DFLDRVHKAELKLRSK LW VPHPWLNLFVPKSRI +FD+G
Sbjct  336   MKKLNFIPTSVFTTDLQYIDFLDRVHKAELKLRSKNLWGVPHPWLNLFVPKSRISDFDKG  395

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWD+R+SAVTP+EE+FYLVALLRSA+ +G E+Q L+ L
Sbjct  396   VFKGILGNKTSGPILIYPMNKDKWDDRSSAVTPDEEIFYLVALLRSALSDGEETQKLEYL  455

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW EHFG+KW+RF+  K +FDP+HIL+TGQ 
Sbjct  456   KDQNRKILEFCEQAKINVKQYLPHHATQEEWVEHFGDKWDRFRSMKTEFDPRHILATGQR  515

Query  222   IF  217
             IF
Sbjct  516   IF  517



>emb|CDY47521.1| BnaAnng09190D [Brassica napus]
Length=531

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/422 (76%), Positives = 372/422 (88%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA T   GVV++MS      P+PLV  + MY DVWGGELW+DVLK TLEHGLAPK
Sbjct  94    HSINGQASTGRNGVVVEMSHRNIGTPEPLVEPEEMYVDVWGGELWVDVLKKTLEHGLAPK  153

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV ELDVVTG+GE + CSEE+N+ LFH V
Sbjct  154   SWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGRGEVMRCSEEENTRLFHGV  213

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  214   LGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFEVFTEDQEYLISMHGQ---SKFDYVE  270

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY +S +DTVDQE+++L
Sbjct  271   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHESESDTVDQEVEIL  330

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  331   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  390

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ L
Sbjct  391   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALSDGEETQKLEYL  450

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW  H+G+KW++F+  K +FDP+HIL+TGQ 
Sbjct  451   KDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHYGDKWDQFRSMKAEFDPRHILATGQK  510

Query  222   IF  217
             IF
Sbjct  511   IF  512



>ref|XP_006390301.1| hypothetical protein EUTSA_v10018378mg [Eutrema salsugineum]
 gb|ESQ27587.1| hypothetical protein EUTSA_v10018378mg [Eutrema salsugineum]
Length=535

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/422 (77%), Positives = 370/422 (88%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA T   GVV++M+      P+PLV  + MY DVWGGELW+DVLK TLE+GLAPK
Sbjct  99    HSINGQAATGRNGVVVEMNHRKTGTPEPLVRPEEMYVDVWGGELWVDVLKKTLEYGLAPK  158

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV ELDVVTGKGE + CSEEQN+ LFH V
Sbjct  159   SWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMRCSEEQNTRLFHGV  218

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  219   LGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQ---LKFDYVE  275

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S +DTVDQE+++L
Sbjct  276   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSDTVDQEVEIL  335

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  336   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  395

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMN +KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ L
Sbjct  396   VFKGILGNKTSGPILIYPMNNDKWDERSSAVTPDEEVFYLVALLRSALSDGEETQKLEYL  455

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             ++QNR IL+FC ++ I +KQYLPH++TQ+EW  HFG+KWERF+  K +FDP+HIL+TGQ 
Sbjct  456   KNQNRRILEFCDKAKISVKQYLPHHATQEEWVAHFGDKWERFRSMKAEFDPRHILATGQR  515

Query  222   IF  217
             IF
Sbjct  516   IF  517



>ref|XP_009106198.1| PREDICTED: cytokinin dehydrogenase 5 [Brassica rapa]
Length=535

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/422 (76%), Positives = 372/422 (88%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA T   GVV++MS      P+PLV  + MY DVWGGELW+DVLK TLEHGLAPK
Sbjct  98    HSINGQASTGRNGVVVEMSHRNIGTPEPLVEPEEMYVDVWGGELWVDVLKKTLEHGLAPK  157

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV ELDVVTG+GE + CSEE+N+ LFH V
Sbjct  158   SWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGRGEVMRCSEEENTRLFHGV  217

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  218   LGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFEVFTEDQEYLISMHGQ---SKFDYVE  274

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY +S +DTVDQE+++L
Sbjct  275   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHESESDTVDQEVEIL  334

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  335   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  394

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ L
Sbjct  395   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALSDGEETQKLEYL  454

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW  H+G+KW++F+  K +FDP+HIL+TGQ 
Sbjct  455   KDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHYGDKWDQFRSMKAEFDPRHILATGQK  514

Query  222   IF  217
             IF
Sbjct  515   IF  516



>ref|NP_177678.2| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
 sp|Q67YU0.1|CKX5_ARATH RecName: Full=Cytokinin dehydrogenase 5; AltName: Full=Cytokinin 
oxidase 5; Short=AtCKX5; Short=AtCKX6; Short=CKO5; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAD44141.1| cytokinin oxidase (CKX6) [Arabidopsis thaliana]
 gb|AEE35721.1| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
Length=540

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/422 (76%), Positives = 368/422 (87%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA     GVV++M+      PKPLV    MY DVWGGELW+DVLK TLEHGLAPK
Sbjct  102   HSINGQAAAGRNGVVVEMNHGVTGTPKPLVRPDEMYVDVWGGELWVDVLKKTLEHGLAPK  161

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQAF+HGPQISNV ELDVVTGKGE + CSEE+N+ LFH V
Sbjct  162   SWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMRCSEEENTRLFHGV  221

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  222   LGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQ---LKFDYVE  278

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S ++ VDQE+++L
Sbjct  279   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSEIVDQEVEIL  338

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  339   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  398

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ L
Sbjct  399   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGEETQKLEYL  458

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW  HFG+KW+RF+  K +FDP+HIL+TGQ 
Sbjct  459   KDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPRHILATGQR  518

Query  222   IF  217
             IF
Sbjct  519   IF  520



>ref|XP_006577980.1| PREDICTED: cytokinin dehydrogenase 5-like [Glycine max]
Length=524

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/425 (76%), Positives = 367/425 (86%), Gaps = 8/425 (2%)
 Frame = -1

Query  1479  HSINGQAMTA--AGVVLQM--SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGL  1312
             HSINGQAM     GVV++M  S +        VSEK MY DVWGG+LWIDVL +TLE+GL
Sbjct  94    HSINGQAMIKEKKGVVIEMGKSDSGEDGSSIRVSEKGMYVDVWGGKLWIDVLSATLEYGL  153

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             AP SWTDYLYLSVGGTLSNAGISGQ FNHGPQI+NV+ELDVVTGKGE VTCSE++NSELF
Sbjct  154   APMSWTDYLYLSVGGTLSNAGISGQTFNHGPQITNVYELDVVTGKGELVTCSEDRNSELF  213

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             HAVLGGLGQFG+ITRARIALE AP RVRWIRVLYS+F  F KDQEYLISLHG+   ++FD
Sbjct  214   HAVLGGLGQFGIITRARIALEPAPHRVRWIRVLYSNFARFCKDQEYLISLHGKAARERFD  273

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             YVEGFVIVDEGLINNWRSSFFS  NPVK +S+ +DGGVLYCLEITKNYDQ  AD+VD+EI
Sbjct  274   YVEGFVIVDEGLINNWRSSFFSASNPVKITSLNADGGVLYCLEITKNYDQGNADSVDEEI  333

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
               LLKKL FIP+SVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI +F
Sbjct  334   QALLKKLNFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIGDF  393

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
             D+GVFKGILGNKTSGPILIYPMNKNKWD+R+S VTPEE+VFYLVA LRSA+    +++TL
Sbjct  394   DKGVFKGILGNKTSGPILIYPMNKNKWDQRSSVVTPEEDVFYLVAFLRSAL----DTETL  449

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             + L +QNR ILKFC +  I++KQYLPHY+TQQEW +HFG+KW +F  RK+QFDP+ IL+T
Sbjct  450   EYLTNQNRQILKFCHDIEIKVKQYLPHYTTQQEWMDHFGDKWTQFNARKMQFDPRRILAT  509

Query  231   GQLIF  217
             GQ IF
Sbjct  510   GQQIF  514



>gb|KEH36208.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=532

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/422 (76%), Positives = 365/422 (86%), Gaps = 5/422 (1%)
 Frame = -1

Query  1479  HSINGQAMT-AAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA T   GVV++M      +  PLV EK MY DVWGGELWI VLK+TLE+GLAP 
Sbjct  105   HSINGQADTRMKGVVIEMGKGGVGIKGPLVWEKEMYVDVWGGELWIHVLKATLEYGLAPM  164

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYLSVGGTLSN GISGQ FNHGPQISNV ELDVVTGKGE +TCSE++NS+LFH+V
Sbjct  165   SWTDYLYLSVGGTLSNGGISGQTFNHGPQISNVFELDVVTGKGEVLTCSEDRNSDLFHSV  224

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARIAL+ APQRVRWIR LYS+F  F KDQE+LISLHG+P +Q+FDYVE
Sbjct  225   LGGLGQFGIITRARIALQPAPQRVRWIRALYSNFSTFCKDQEFLISLHGKPASQRFDYVE  284

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGLINNWRSSFFSP NPVK SS+ +DGGVLYCLE+TKNY Q  AD+VD+EI  L
Sbjct  285   GFVIVDEGLINNWRSSFFSPSNPVKISSLNADGGVLYCLEVTKNYHQGNADSVDEEIQAL  344

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             LKKL FI +SVFTTD+PYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI++FD+G
Sbjct  345   LKKLDFIDTSVFTTDVPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIEDFDKG  404

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNKNKWD R+SAVTP+EEVFYLVA LRSA+    +++TL++L
Sbjct  405   VFKGILGNKTSGPILIYPMNKNKWDHRSSAVTPDEEVFYLVAFLRSAL----DAETLEHL  460

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QNR IL FC +S I +KQYLPHY+T QEW +HFG+KW +F   K+QFDP+ IL+TGQ 
Sbjct  461   TNQNRQILGFCHDSKIGVKQYLPHYTTMQEWMDHFGDKWTQFNAMKMQFDPQRILATGQR  520

Query  222   IF  217
             IF
Sbjct  521   IF  522



>ref|XP_002889026.1| hypothetical protein ARALYDRAFT_476695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65285.1| hypothetical protein ARALYDRAFT_476695 [Arabidopsis lyrata subsp. 
lyrata]
Length=537

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/439 (74%), Positives = 377/439 (86%), Gaps = 10/439 (2%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA     GVV++M+      P+ LV    MY DVWGGELW+DVLK TLE+GLAPK
Sbjct  102   HSINGQAAAGRNGVVVEMNHGVTGTPESLVRPDEMYVDVWGGELWVDVLKKTLEYGLAPK  161

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQAF+HGPQISNV ELDVVTGKGE + CSEE+N+ LFH V
Sbjct  162   SWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMRCSEEENTRLFHGV  221

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  222   LGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQ---LKFDYVE  278

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S ++TVDQE+++L
Sbjct  279   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSETVDQEVEIL  338

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  339   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  398

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ L
Sbjct  399   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGEETQKLEYL  458

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW+ HFG+KW+RF+  K +FDP+HIL+TGQ 
Sbjct  459   KDQNRRILEFCEQAKINVKQYLPHHATQEEWEAHFGDKWDRFRRLKAEFDPRHILATGQR  518

Query  222   IF-TPSFN-----AMTASW  184
             IF  PS +     + +ASW
Sbjct  519   IFQNPSLSLFPPLSSSASW  537



>gb|AAG30909.1|AF303982_1 cytokinin oxidase [Arabidopsis thaliana]
Length=540

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/422 (76%), Positives = 367/422 (87%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA     GVV++M+      PKPLV    MY DVWGGELW+DVLK TLEHGLAPK
Sbjct  102   HSINGQAAAGRNGVVVEMNHGVTGTPKPLVRPDEMYVDVWGGELWVDVLKKTLEHGLAPK  161

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQA +HGPQISNV ELDVVTGKGE + CSEE+N+ LFH V
Sbjct  162   SWTDYLYLTVGGTLSNAGISGQALHHGPQISNVLELDVVTGKGEVMRCSEEENTRLFHGV  221

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  222   LGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQ---LKFDYVE  278

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S ++ VDQE+++L
Sbjct  279   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSEIVDQEVEIL  338

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  339   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  398

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ L
Sbjct  399   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGEETQKLEYL  458

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW  HFG+KW+RF+  K +FDP+HIL+TGQ 
Sbjct  459   KDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPRHILATGQR  518

Query  222   IF  217
             IF
Sbjct  519   IF  520



>ref|XP_008444755.1| PREDICTED: cytokinin dehydrogenase 5 [Cucumis melo]
Length=546

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/439 (75%), Positives = 373/439 (85%), Gaps = 15/439 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAA----------AAVPKPLVSEKFMYADVWGGELWIDVLKS  1330
             HSINGQA T  GVV++MSG             + P P+VSEK  + DVWGGELWIDVLK 
Sbjct  100   HSINGQAQTGNGVVIEMSGGGRQHRRVGGRGVSPPVPVVSEKGRFVDVWGGELWIDVLKW  159

Query  1329  TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEE  1150
             TLE+GLAP+SWTDYLYLSVGGTLSN GISGQAFNHGPQISNVHELDVVTG GE V CS E
Sbjct  160   TLEYGLAPRSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVHELDVVTGNGEIVKCSNE  219

Query  1149  QNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQP  970
              N+ELFH VLGGLGQFG+ITRARI LE APQRVRWIRVLYS+F+AFTKDQE+LISLH + 
Sbjct  220   DNAELFHGVLGGLGQFGIITRARIILEPAPQRVRWIRVLYSNFEAFTKDQEWLISLHSKT  279

Query  969   PA-QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSV---KSDGGVLYCLEITKNYDQ  802
              + +KFDYVEGFVIVDEGLINNWRSSFFSP NPVK SS    KSDG VLYCLEITKNY +
Sbjct  280   NSKEKFDYVEGFVIVDEGLINNWRSSFFSPANPVKISSFSKNKSDGAVLYCLEITKNYHE  339

Query  801   STADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNL  622
             S++ T+DQE++ L+K+L +IP SVFTTDL YVDFLDRVHKAELKLRSKGLWDVPHPWLNL
Sbjct  340   SSSHTLDQEVEALMKQLNYIPESVFTTDLGYVDFLDRVHKAELKLRSKGLWDVPHPWLNL  399

Query  621   FVPKSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSA  442
             FVPKSRI +FDRGVFKGILGN TSGPILIYPMNK+KWD RTSAVTPE++VFYLVALLRSA
Sbjct  400   FVPKSRIADFDRGVFKGILGNNTSGPILIYPMNKHKWDPRTSAVTPEDDVFYLVALLRSA  459

Query  441   VENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKL  262
             ++NG  +Q+L+ L  QN  IL+FC ESGIE+KQYLPHY+T++EW +HFG+KW  FQ RK+
Sbjct  460   LDNGEPTQSLEYLSHQNHQILEFCYESGIEVKQYLPHYTTEEEWADHFGDKWPEFQARKM  519

Query  261   QFDPKHILSTGQLIFTPSF  205
             +FDP HIL+TGQ IF P+F
Sbjct  520   KFDPHHILATGQKIF-PAF  537



>ref|NP_001185402.1| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
 gb|AEE35722.1| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
Length=537

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/423 (76%), Positives = 368/423 (87%), Gaps = 5/423 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA     GVV++M+      PKPLV    MY DVWGGELW+DVLK TLEHGLAPK
Sbjct  98    HSINGQAAAGRNGVVVEMNHGVTGTPKPLVRPDEMYVDVWGGELWVDVLKKTLEHGLAPK  157

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVT-GKGESVTCSEEQNSELFHA  1126
             SWTDYLYL+VGGTLSNAGISGQAF+HGPQISNV ELDVVT GKGE + CSEE+N+ LFH 
Sbjct  158   SWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTVGKGEVMRCSEEENTRLFHG  217

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFG+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYV
Sbjct  218   VLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQ---LKFDYV  274

Query  945   EGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             EGFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S ++ VDQE+++
Sbjct  275   EGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSEIVDQEVEI  334

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             L+KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+
Sbjct  335   LMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDK  394

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
             GVFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ 
Sbjct  395   GVFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGEETQKLEY  454

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             L+ QNR IL+FC+++ I +KQYLPH++TQ+EW  HFG+KW+RF+  K +FDP+HIL+TGQ
Sbjct  455   LKDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPRHILATGQ  514

Query  225   LIF  217
              IF
Sbjct  515   RIF  517



>emb|CDX73174.1| BnaC06g36220D [Brassica napus]
Length=535

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/422 (75%), Positives = 369/422 (87%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA T   GVV++MS       +PLV  + MY DVWGGELW+DVLK TLEHGLAPK
Sbjct  98    HSINGQASTGRNGVVVEMSHRNIGTLEPLVEPEEMYVDVWGGELWVDVLKKTLEHGLAPK  157

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV ELDVVTG+GE + CSEE+N+ LFH V
Sbjct  158   SWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGRGEVMRCSEEENTRLFHGV  217

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE APQRVRWIRVLYS F+ FT DQEYLIS+HG     KFDYVE
Sbjct  218   LGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFEVFTDDQEYLISMHGH---SKFDYVE  274

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSP NPVK SSV S+G VLYCLEITKNY +S +DTVDQE+++L
Sbjct  275   GFVIVDEGLVNNWRSSFFSPHNPVKISSVSSNGSVLYCLEITKNYHESESDTVDQEVEIL  334

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  335   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  394

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ L
Sbjct  395   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALSDGEETQKLEYL  454

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW +H+G++W++F+  K +FDP+HIL+TGQ 
Sbjct  455   KDQNRRILEFCEQAKINVKQYLPHHATQEEWVDHYGDRWDQFRSMKTEFDPRHILATGQK  514

Query  222   IF  217
             IF
Sbjct  515   IF  516



>ref|XP_010533263.1| PREDICTED: cytokinin dehydrogenase 5 [Tarenaya hassleriana]
Length=543

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/428 (77%), Positives = 373/428 (87%), Gaps = 10/428 (2%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQM------SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLE  1321
             HSINGQA     GVV++M      SGA    P+P VS + M+ DVWGGELWIDVLK TLE
Sbjct  99    HSINGQAKAGKNGVVVEMGRREIISGAGRNPPEPEVSAEGMHVDVWGGELWIDVLKKTLE  158

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             +GLAPKSWTDYLYL+VGGT+SNAGISGQAF+HGPQISNV ELDVVTGKGE + CSEE+NS
Sbjct  159   YGLAPKSWTDYLYLTVGGTISNAGISGQAFHHGPQISNVLELDVVTGKGEVMKCSEEENS  218

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELFH VLGGLGQ G+ITRARIALE +PQRVRWIRVLYS+F  FT+DQE LISLHG P   
Sbjct  219   ELFHGVLGGLGQLGIITRARIALEPSPQRVRWIRVLYSNFSVFTRDQEQLISLHGPP---  275

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
             KFDYVEGFVIVDEGLINNWRSSFFSPRNPVK S++  DGGVLYCLE+TKNYD+S+ADTVD
Sbjct  276   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISALGGDGGVLYCLEVTKNYDESSADTVD  335

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             QE++ L+KKL FIP SVFTTDLPYVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI
Sbjct  336   QEMEQLMKKLNFIPGSVFTTDLPYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRI  395

Query  600   DEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNES  421
              +FDRGVFKGILGNKTSGPILIYPMNK+KWDER+SAV PEEEVFYLVALLRSA+ +G+E+
Sbjct  396   GDFDRGVFKGILGNKTSGPILIYPMNKDKWDERSSAVIPEEEVFYLVALLRSALSDGDET  455

Query  420   QTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHI  241
             Q L+ L+ QNR IL+FC+ESGIE KQYLPHY TQ++W  HFG+KWERF H K ++DP+HI
Sbjct  456   QRLEYLEDQNRRILRFCEESGIEAKQYLPHYVTQEQWMRHFGDKWERFSHLKAEYDPRHI  515

Query  240   LSTGQLIF  217
             L+TGQ +F
Sbjct  516   LATGQKVF  523



>ref|XP_003527677.1| PREDICTED: cytokinin dehydrogenase 5-like [Glycine max]
Length=549

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/431 (74%), Positives = 366/431 (85%), Gaps = 14/431 (3%)
 Frame = -1

Query  1479  HSINGQAMTA--AGVVLQMSGAAAAVPKP--------LVSEKFMYADVWGGELWIDVLKS  1330
             HSINGQA+     GVV++M  + +              V EK MY DVWGG+LWIDVL +
Sbjct  110   HSINGQALIKEKKGVVIEMGKSDSGDNNDHNGDSNIIRVCEKGMYVDVWGGKLWIDVLSA  169

Query  1329  TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEE  1150
             TLE+GLAP SWTDYLYLSVGGTLSNAGISGQ FNHGPQI+NV+ELDVVTGKGE VTCSE+
Sbjct  170   TLEYGLAPMSWTDYLYLSVGGTLSNAGISGQTFNHGPQITNVYELDVVTGKGELVTCSED  229

Query  1149  QNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQP  970
             +NSELFH+VLGGLGQFG+ITRARIALE AP RVRWIRVLYS+F  F KDQEYLISLHG+ 
Sbjct  230   RNSELFHSVLGGLGQFGIITRARIALEPAPHRVRWIRVLYSNFARFCKDQEYLISLHGKA  289

Query  969   PAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTAD  790
               ++FDYVEGFVIVDEGLINNWRSSFF+  NPVK +S+ +DGGVLYCLEITKNYDQ  AD
Sbjct  290   ARERFDYVEGFVIVDEGLINNWRSSFFAASNPVKITSLNADGGVLYCLEITKNYDQGNAD  349

Query  789   TVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPK  610
             +VD+EI  LLKKL FIP+SVFTTDLPYVDFLDRVHKAELKL+SKGLWDVPHPWLNLFVPK
Sbjct  350   SVDEEIQALLKKLNFIPTSVFTTDLPYVDFLDRVHKAELKLKSKGLWDVPHPWLNLFVPK  409

Query  609   SRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             SRI++FD+GVFKGILGNKTSGPILIYPMNKNKWD R+S VTPEE+VFYLVA LRSA+   
Sbjct  410   SRIEDFDKGVFKGILGNKTSGPILIYPMNKNKWDHRSSVVTPEEDVFYLVAFLRSAL---  466

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
              +++TL+ L +QNR IL+FC +S I++KQYLPHY+TQQEW +HFG+KW +F  RK+QFDP
Sbjct  467   -DTETLEYLTNQNRQILRFCHDSEIKVKQYLPHYTTQQEWMDHFGDKWTQFNARKMQFDP  525

Query  249   KHILSTGQLIF  217
             + IL TGQ IF
Sbjct  526   RRILGTGQQIF  536



>gb|KHN45882.1| Cytokinin dehydrogenase 5 [Glycine soja]
Length=424

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/412 (77%), Positives = 359/412 (87%), Gaps = 6/412 (1%)
 Frame = -1

Query  1446  GVVLQM--SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKSWTDYLYLSV  1273
             GVV++M  S +        VSEK MY DVWGG+LWIDVL +TLE+GLAP SWTDYLYLSV
Sbjct  7     GVVIEMGKSDSGEDGSSIRVSEKGMYVDVWGGKLWIDVLSATLEYGLAPMSWTDYLYLSV  66

Query  1272  GGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVLGGLGQFGVI  1093
             GGTLSNAGISGQ FNHGPQI+NV+ELDVVTGKGE VTCSE++NSELFHAVLGGLGQFG+I
Sbjct  67    GGTLSNAGISGQTFNHGPQITNVYELDVVTGKGELVTCSEDRNSELFHAVLGGLGQFGII  126

Query  1092  TRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEGFVIVDEGLI  913
             TRARIALE AP RVRWIRVLYS+F  F KDQEYLISLHG+   ++FDYVEGFVIVDEGLI
Sbjct  127   TRARIALEPAPHRVRWIRVLYSNFARFCKDQEYLISLHGKAARERFDYVEGFVIVDEGLI  186

Query  912   NNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVLLKKLKFIPSS  733
             NNWRSSFFS  NPVK +S+ +DGGVLYCLEITKNYDQ  AD+VD+EI  LLKKL FIP+S
Sbjct  187   NNWRSSFFSASNPVKITSLNADGGVLYCLEITKNYDQGNADSVDEEIQALLKKLNFIPTS  246

Query  732   VFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRGVFKGILGNKT  553
             VFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI +FD+GVFKGILGNKT
Sbjct  247   VFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIGDFDKGVFKGILGNKT  306

Query  552   SGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNLQSQNRDILKF  373
             SGPILIYPMNKNKWD+R+S VTPEE+VFYLVA LRSA+    +++TL+ L +QNR ILKF
Sbjct  307   SGPILIYPMNKNKWDQRSSVVTPEEDVFYLVAFLRSAL----DTETLEYLTNQNRQILKF  362

Query  372   CKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQLIF  217
             C +  I++KQYLPHY+TQQEW +HFG+KW +F  RK+QFDP+ IL+TGQ IF
Sbjct  363   CHDIEIKVKQYLPHYTTQQEWMDHFGDKWPQFNARKMQFDPRRILATGQQIF  414



>ref|XP_004500976.1| PREDICTED: cytokinin dehydrogenase 5-like isoform X1 [Cicer arietinum]
Length=528

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/424 (75%), Positives = 363/424 (86%), Gaps = 7/424 (2%)
 Frame = -1

Query  1479  HSINGQAMT-AAGVVLQMS--GAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HSINGQA T   GVV++M   G  ++   P V EK MY DVWGGELWI VLK+TLE+GLA
Sbjct  99    HSINGQADTRVKGVVIEMGKGGVESSNNPPRVWEKEMYVDVWGGELWIHVLKATLEYGLA  158

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYLYLSVGGTLSNAGISGQ FNHGPQISNV +LDVVTGKGE +TCSE++NS+LFH
Sbjct  159   PKSWTDYLYLSVGGTLSNAGISGQTFNHGPQISNVFQLDVVTGKGEVLTCSEDRNSDLFH  218

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             AVLGGLGQFG+ITRARIAL+ APQRVRWIRVLYS+F  F KDQE+LISLHG+P  Q+FDY
Sbjct  219   AVLGGLGQFGIITRARIALQPAPQRVRWIRVLYSNFSTFCKDQEFLISLHGKPATQRFDY  278

Query  948   VEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             VEGFVIVDEGLINNWRSSFFSP NPVK SS+ +DGGVLYCLEITKNY Q  AD+VD+EI 
Sbjct  279   VEGFVIVDEGLINNWRSSFFSPSNPVKISSLNADGGVLYCLEITKNYHQGNADSVDEEIQ  338

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LLKKL FIP SVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLF+PKSRI++FD
Sbjct  339   PLLKKLDFIPKSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFIPKSRIEDFD  398

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             +GVFKGILGNKTSGPILIYPMNKNKWD R+S VTP+EEVFYLVA LRSA+    +++TL+
Sbjct  399   KGVFKGILGNKTSGPILIYPMNKNKWDHRSSVVTPDEEVFYLVAFLRSAL----DAETLE  454

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
              L +QNR IL+FC +S I++KQYLPHY       +HFG+KW +F   K+QFDP+ IL+TG
Sbjct  455   YLTNQNRQILRFCHDSKIKVKQYLPHYXXXXXXXDHFGDKWTQFNAMKMQFDPRRILATG  514

Query  228   QLIF  217
             Q IF
Sbjct  515   QRIF  518



>ref|XP_007136628.1| hypothetical protein PHAVU_009G060200g [Phaseolus vulgaris]
 gb|ESW08622.1| hypothetical protein PHAVU_009G060200g [Phaseolus vulgaris]
Length=550

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/423 (75%), Positives = 363/423 (86%), Gaps = 9/423 (2%)
 Frame = -1

Query  1479  HSINGQAMT--AAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HSINGQA+     GVV++M    + V    V EK MY DVWGGELWI+VL +TLE+GLAP
Sbjct  121   HSINGQALIREKKGVVIEMGKGGSGVR---VCEKGMYVDVWGGELWIEVLSATLEYGLAP  177

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
              SWTDYLYLSVGGTLSNAGISGQ FNHGPQI+NV ELDVVTGKGE VTCSE++NSELFHA
Sbjct  178   MSWTDYLYLSVGGTLSNAGISGQTFNHGPQITNVFELDVVTGKGELVTCSEDRNSELFHA  237

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFG+ITRARIALE AP RVRWIRVLYSDF  F +DQEYLISLHG+P  ++FDYV
Sbjct  238   VLGGLGQFGIITRARIALEPAPHRVRWIRVLYSDFGRFCEDQEYLISLHGKPGRERFDYV  297

Query  945   EGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             EGFVIVDEGLINNWRSSFFSP NPV  +S+ +DGGVLYCLEITKNYD   AD+VD+EI  
Sbjct  298   EGFVIVDEGLINNWRSSFFSPINPVNITSLNADGGVLYCLEITKNYDHHNADSVDEEIQG  357

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LLKKL F+ +SVFT+DLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI +FD+
Sbjct  358   LLKKLHFLSTSVFTSDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIGDFDK  417

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
             GVFKGILGNKTSGPILIYPMNK+KWD R+S VTPEE+VFYLVA LRSA+    +++TL+ 
Sbjct  418   GVFKGILGNKTSGPILIYPMNKSKWDHRSSVVTPEEDVFYLVAFLRSAL----DTETLEY  473

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             L +QNR IL+FC  S I++KQYLPHY+TQQEW +HFG+KW +F  RK+QFDP+ IL+TGQ
Sbjct  474   LTNQNRQILRFCHGSEIKVKQYLPHYTTQQEWMDHFGDKWTQFNARKMQFDPRRILATGQ  533

Query  225   LIF  217
              IF
Sbjct  534   QIF  536



>ref|XP_009398389.1| PREDICTED: cytokinin dehydrogenase 5 [Musa acuminata subsp. malaccensis]
Length=532

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/434 (73%), Positives = 368/434 (85%), Gaps = 5/434 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-GAAAAVPKPLVSEKF--MYADVWGGELWIDVLKSTLEHG-L  1312
             H   GQA+   GVV++MS G     P+P  S      Y DVWGG+LWIDVL  TL +G L
Sbjct  94    HCTGGQALAPGGVVIEMSRGRLEPRPRPAYSPSTGEYYVDVWGGDLWIDVLNWTLANGDL  153

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             APKSWTDYLYLSVGGTLSNAGISGQAF+HGPQ SNV+ELDVVTGKGE +TCSEEQNSELF
Sbjct  154   APKSWTDYLYLSVGGTLSNAGISGQAFHHGPQSSNVYELDVVTGKGELITCSEEQNSELF  213

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             H VLGGLGQFG+ITRARIALE APQRVRWIRVLYSDF AFT+DQE+LISLHG  P+Q+FD
Sbjct  214   HGVLGGLGQFGIITRARIALEQAPQRVRWIRVLYSDFGAFTRDQEHLISLHGALPSQRFD  273

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             YVEGFVIVDEGLINNWRSSFFSP+NPVK SSV S+GGVLYCLE+TKNYD STADT+D+ +
Sbjct  274   YVEGFVIVDEGLINNWRSSFFSPKNPVKISSVGSNGGVLYCLEMTKNYDDSTADTIDEVV  333

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LL++L FIP++VFTTDLPYVDFLDRVHKAEL+LR+KGLW+VPHPWLNLFVP SRI +F
Sbjct  334   EALLRQLSFIPATVFTTDLPYVDFLDRVHKAELRLRAKGLWEVPHPWLNLFVPASRIADF  393

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE-SQT  415
             DRGVF+GILGN+TSGPILIYPMNK+KWD+R+S VTP+EEVFYLVA LRSA+ + ++ +Q+
Sbjct  394   DRGVFRGILGNRTSGPILIYPMNKHKWDDRSSVVTPDEEVFYLVAFLRSALSDSDDPTQS  453

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILS  235
             L+ L  QN+ IL+FC E GIE+KQYLPH+ ++ EW  HFG KW RF  RK QFDPK IL 
Sbjct  454   LEYLSQQNQKILEFCDEVGIEIKQYLPHHPSRTEWARHFGPKWARFVRRKAQFDPKFILG  513

Query  234   TGQLIFTPSFNAMT  193
             TGQ IF PS + ++
Sbjct  514   TGQGIFQPSSSPLS  527



>gb|KDO84681.1| hypothetical protein CISIN_1g042782mg, partial [Citrus sinensis]
Length=527

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/396 (79%), Positives = 348/396 (88%), Gaps = 8/396 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGA--------AAAVPKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HSINGQA T+ GVV+QMSG+          A  +P V EK  Y DVWGGELWIDVL+STL
Sbjct  132   HSINGQAQTSNGVVIQMSGSRGRRLGSSTPAALRPHVYEKERYVDVWGGELWIDVLRSTL  191

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             EHGLAPKSWTDYLYLSVGGTLSNAGISGQAF+ GPQI+NVHELDVVTGKGE +TCSEEQN
Sbjct  192   EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGKGELLTCSEEQN  251

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             S LFHAVLGGLGQFG+ITRARI+LE AP+RVRWIRVLYSDF  FT+DQEYLISLH  P +
Sbjct  252   SGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQEYLISLHELPAS  311

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
             QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVK +S+ +DGGVLYCLEITKNYD+STADT 
Sbjct  312   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGTDGGVLYCLEITKNYDESTADTT  371

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             DQE++ LLKKL FI SSVFTTDL YVDFLDRVHKAELKLRSKGLW+VPHPWLNLF+PKSR
Sbjct  372   DQEVESLLKKLNFIQSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFIPKSR  431

Query  603   IDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             I +FD+GVFKGILGNKT GPILIYPMNK+KWD R+S VTP+E+VFYLVA LRSA++NG E
Sbjct  432   IADFDKGVFKGILGNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLVAFLRSALDNGEE  491

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQ  316
              Q+L+ L  QNR ILKFC E+GI+ KQYLPHY+TQ+
Sbjct  492   MQSLEYLNHQNRQILKFCDEAGIKAKQYLPHYTTQE  527



>ref|XP_006838693.1| hypothetical protein AMTR_s00002p00248240 [Amborella trichopoda]
 gb|ERN01262.1| hypothetical protein AMTR_s00002p00248240 [Amborella trichopoda]
Length=539

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/449 (70%), Positives = 362/449 (81%), Gaps = 28/449 (6%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEK-----------------------FMYAD  1369
             HSI GQA    GVV++M      +    V E                          YAD
Sbjct  83    HSIQGQAQAPGGVVIEMEALKGCLFNVGVLENESCSFSSSYSVERESVERESGGSLYYAD  142

Query  1368  VWGGELWIDVLKSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDV  1189
             VWGGELWIDVL  TL+HGLAP+SWTDYLYL+VGGTLSNAGISGQAFNHGPQISNV+ELDV
Sbjct  143   VWGGELWIDVLHETLKHGLAPRSWTDYLYLTVGGTLSNAGISGQAFNHGPQISNVYELDV  202

Query  1188  VTGKGESVTCSEEQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFT  1009
             VTGKGE +TCS+ QNSELFH+VLGGLGQFG+ITRARIALE APQRVRWIRVLYSDF  FT
Sbjct  203   VTGKGELLTCSKHQNSELFHSVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSDFNTFT  262

Query  1008  KDQEYLISLHGQPPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSV--KSDGGVL  835
             +DQE+LISLHG+    KFDYVEGFVIVDEGLINNWRSSFFSPRNP+K  S+   S G VL
Sbjct  263   RDQEHLISLHGR---TKFDYVEGFVIVDEGLINNWRSSFFSPRNPIKLQSIVSGSKGTVL  319

Query  834   YCLEITKNYDQSTADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKG  655
             YCLE+TKNYD++TADTVDQE+D LLK L FI  SVFTTDLPY+DFLDRVHKAELKLR+KG
Sbjct  320   YCLEVTKNYDEATADTVDQEVDSLLKTLSFIQGSVFTTDLPYIDFLDRVHKAELKLRAKG  379

Query  654   LWDVPHPWLNLFVPKSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEE  475
             LWDVPHPWLNLF+PKS+I +FD GVFKGILG KTSGPILIYPMNKN+WDE+TSAVTP+E+
Sbjct  380   LWDVPHPWLNLFIPKSKIADFDAGVFKGILGKKTSGPILIYPMNKNRWDEKTSAVTPDED  439

Query  474   VFYLVALLRSAVENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG  295
             VFYLVA LRSA++NG E+Q+L+ LQ QN  IL+FC+E+ IEMKQYLPH++ + +W +H+G
Sbjct  440   VFYLVAFLRSALDNGEETQSLRYLQDQNERILRFCEEANIEMKQYLPHHTKRAQWVQHYG  499

Query  294   EKWERFQHRKLQFDPKHILSTGQLIFTPS  208
              KW  F+ RK  FDPK+IL+ GQ IF+ +
Sbjct  500   PKWAEFEERKATFDPKNILAPGQRIFSAA  528



>ref|XP_010428567.1| PREDICTED: cytokinin dehydrogenase 5 isoform X1 [Camelina sativa]
 ref|XP_010428568.1| PREDICTED: cytokinin dehydrogenase 5 isoform X2 [Camelina sativa]
Length=532

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/422 (75%), Positives = 369/422 (87%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA     GVV++M+      P+PLV    +Y DVWGGELW+DVLK TLE+GLAPK
Sbjct  94    HSINGQAAAGRNGVVVEMNHGVTGTPEPLVRPDELYVDVWGGELWVDVLKKTLEYGLAPK  153

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQAF+HGPQISNV E+DVVTGKGE + CSEE+N++LFH V
Sbjct  154   SWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLEMDVVTGKGEVMRCSEEENTKLFHGV  213

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQ G+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  214   LGGLGQLGIITRARISLEPAPQRVRWIRVLYSSFEVFTEDQEYLISMHGQ---LKFDYVE  270

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S ++TVDQE+++L
Sbjct  271   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSETVDQEVEIL  330

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  331   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  390

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EE+FYLVALLRSA+ +G E+Q L+ L
Sbjct  391   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEIFYLVALLRSALTDGEETQKLEYL  450

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW  HFG+KW+RF+  K +FDP+HIL+TGQ 
Sbjct  451   KDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPRHILATGQR  510

Query  222   IF  217
             IF
Sbjct  511   IF  512



>ref|XP_010471656.1| PREDICTED: cytokinin dehydrogenase 5-like isoform X1 [Camelina 
sativa]
 ref|XP_010471657.1| PREDICTED: cytokinin dehydrogenase 5-like isoform X2 [Camelina 
sativa]
Length=532

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/422 (75%), Positives = 369/422 (87%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA     GVV++M+      P+PL+    MY DVWGGELW+DVL+ TLE+GLAPK
Sbjct  94    HSINGQAAAGRNGVVVEMNHGVTGTPEPLIRPDEMYVDVWGGELWVDVLRKTLEYGLAPK  153

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQAF+HGPQISNV E+DVVTGKGE + CSEE+N++LFH V
Sbjct  154   SWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLEMDVVTGKGEVMRCSEEENTKLFHGV  213

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQ G+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  214   LGGLGQLGIITRARISLEPAPQRVRWIRVLYSSFEVFTEDQEYLISMHGQ---LKFDYVE  270

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S ++TVDQE+++L
Sbjct  271   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSETVDQEVEIL  330

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  331   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  390

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ L
Sbjct  391   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGEETQKLEYL  450

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW  HFG+KW+RF+  K +FDP+HIL+TGQ 
Sbjct  451   KDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKDEFDPRHILATGQR  510

Query  222   IF  217
             IF
Sbjct  511   IF  512



>ref|XP_010416431.1| PREDICTED: cytokinin dehydrogenase 5-like isoform X1 [Camelina 
sativa]
 ref|XP_010416432.1| PREDICTED: cytokinin dehydrogenase 5-like isoform X2 [Camelina 
sativa]
Length=532

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/422 (74%), Positives = 369/422 (87%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA+    GVV++M+      P+PL+    MY DVWGGELW+DVL+ T+E+GLAPK
Sbjct  94    HSINGQAVAGRNGVVVEMNHGVTGTPEPLIRPDEMYVDVWGGELWVDVLRKTVEYGLAPK  153

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQAF+HGPQISNV E+DVVTGKGE + CSEE+N++LFH V
Sbjct  154   SWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLEMDVVTGKGEVMRCSEEENTKLFHGV  213

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQ G+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  214   LGGLGQLGIITRARISLEPAPQRVRWIRVLYSSFEVFTEDQEYLISMHGQ---LKFDYVE  270

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S ++TVDQE+++L
Sbjct  271   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSETVDQEVEIL  330

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  331   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  390

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ L
Sbjct  391   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGEETQKLEYL  450

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+ + I +KQYLPH++TQ+EW  HFG+KW+RF+  K +FDP+HIL+TGQ 
Sbjct  451   KDQNRRILEFCELAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPRHILATGQR  510

Query  222   IF  217
             IF
Sbjct  511   IF  512



>ref|XP_006302113.1| hypothetical protein CARUB_v10020114mg [Capsella rubella]
 gb|EOA35011.1| hypothetical protein CARUB_v10020114mg [Capsella rubella]
Length=537

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/422 (75%), Positives = 368/422 (87%), Gaps = 4/422 (1%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA     GVV++M+      P+PL+    MY DVWGGELW+DVL  TLEHGLAPK
Sbjct  99    HSINGQAAVGRNGVVVEMNHGVIGTPEPLIRPDEMYVDVWGGELWVDVLMKTLEHGLAPK  158

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQAF+HGPQISNV ELDVVTGKGE + CSE++N+ LFH V
Sbjct  159   SWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMRCSEDENTRLFHGV  218

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQ G+ITRARIALE APQRVRWIRVLYS F+ FT+DQEYLIS+HG+    KFDYVE
Sbjct  219   LGGLGQLGIITRARIALEPAPQRVRWIRVLYSSFEVFTEDQEYLISMHGE---LKFDYVE  275

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S ++TV+QE+++L
Sbjct  276   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSETVNQEVEIL  335

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  336   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  395

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+++G E+Q L+ L
Sbjct  396   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALKDGEETQKLEYL  455

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW  HFG+KW+RF+  K +FDP+HIL+TGQ 
Sbjct  456   KDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPRHILATGQR  515

Query  222   IF  217
             IF
Sbjct  516   IF  517



>ref|XP_010932835.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
 ref|XP_010932844.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
Length=535

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/428 (74%), Positives = 359/428 (84%), Gaps = 8/428 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAA----AVPKPLVSEKF--MYADVWGGELWIDVLKSTLEH  1318
             HSINGQA    GVV++MS   A    A   P+ S      Y DVWGGELWID+L  TLE+
Sbjct  94    HSINGQARAQGGVVIEMSYDRAVGHRARSHPVYSPSLGEYYVDVWGGELWIDILNWTLEN  153

Query  1317  G-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             G LAPKSWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+E+DV+TGKGE VTCSEEQNS
Sbjct  154   GGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYEVDVITGKGEIVTCSEEQNS  213

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELFH VLGGLGQFG+ITRAR+ALE APQRVRWIRVLYS+F  FT+DQE LISLHG   ++
Sbjct  214   ELFHGVLGGLGQFGIITRARLALEPAPQRVRWIRVLYSNFTTFTRDQELLISLHGTHRSE  273

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
             +FDYVEGFVIVDEGLINNWRSSFFSPRN V  SS+ ++GGVLYCLE+TKNYD STAD VD
Sbjct  274   RFDYVEGFVIVDEGLINNWRSSFFSPRNSVNISSIGTNGGVLYCLEMTKNYDDSTADFVD  333

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             QE++ LLK+L+FIP+SVFTTDLPYVDFLDRVHKAELKLR+KGLWDVPHPWLNLFVP SRI
Sbjct  334   QEVEALLKRLEFIPASVFTTDLPYVDFLDRVHKAELKLRAKGLWDVPHPWLNLFVPASRI  393

Query  600   DEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVE-NGNE  424
              +FD GVF+GILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLV  LRSA+  +G  
Sbjct  394   ADFDHGVFRGILGNKTSGPILIYPMNKHKWDERSSAVTPDEEVFYLVGFLRSALPYSGES  453

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
             +Q+L+ L  QN  IL FC E+GIE+KQYLPH+ T+ EW  HFG KW+RF   K +FDPK 
Sbjct  454   TQSLEYLSQQNERILAFCDEAGIEVKQYLPHHLTRAEWARHFGTKWDRFLRLKAEFDPKG  513

Query  243   ILSTGQLI  220
             IL +GQ I
Sbjct  514   ILGSGQGI  521



>ref|XP_008796604.1| PREDICTED: cytokinin dehydrogenase 5-like [Phoenix dactylifera]
Length=554

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/430 (73%), Positives = 365/430 (85%), Gaps = 9/430 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS--GAAA---AVPKPLVSEKF--MYADVWGGELWIDVLKSTLE  1321
             HSI+GQA    GVV++MS  G AA   A P+P+ S      Y DVWGGELWID+L  TLE
Sbjct  94    HSIDGQAQAPGGVVIEMSQYGRAAGHRARPRPVYSPSLGEYYVDVWGGELWIDILNWTLE  153

Query  1320  HG-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             +G LAPKSWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTG GE +TCSEE+N
Sbjct  154   NGGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGMGEILTCSEEEN  213

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             SELF+ VLGGLGQFG+ITRARIALE AP+RVRWIRVLYS+F  FT+DQE+LISLH    +
Sbjct  214   SELFYGVLGGLGQFGIITRARIALEPAPRRVRWIRVLYSNFTTFTRDQEHLISLHSAHRS  273

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
             ++FDYVEGFVIVDEGLINNWRSSFFSPRNPVK SS+ ++GGVLYCLE+TKNYD+STA  V
Sbjct  274   ERFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEMTKNYDESTAGLV  333

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             DQE++ LL KL+FIP+SVFTTDLPYVDFLDRVHKAELKLR+KG+WDVPHPWLNLFVP SR
Sbjct  334   DQEVEALLTKLEFIPASVFTTDLPYVDFLDRVHKAELKLRAKGMWDVPHPWLNLFVPGSR  393

Query  603   IDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             I +FD GVF+ ILGNKTSGPILIYPMNK+KWDER+S VTPEEEVFYLVA LRSA+ + +E
Sbjct  394   IADFDHGVFRAILGNKTSGPILIYPMNKHKWDERSSVVTPEEEVFYLVAFLRSALPDSDE  453

Query  423   S-QTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPK  247
             S Q+L+ L  QN  IL FC+E+GI++KQYLPH+ T+ +W  HFG KW RF+  K QFDPK
Sbjct  454   STQSLEYLSQQNERILAFCEEAGIQVKQYLPHHLTRADWARHFGPKWGRFRRLKAQFDPK  513

Query  246   HILSTGQLIF  217
              IL +GQ IF
Sbjct  514   CILGSGQGIF  523



>ref|XP_010907734.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
Length=540

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/433 (72%), Positives = 361/433 (83%), Gaps = 9/433 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAV-----PKPLVSEKF--MYADVWGGELWIDVLKSTLE  1321
             HSINGQA    GVV++MS    AV      +P+ S+     Y DVWGGELWID+L  TLE
Sbjct  94    HSINGQAQAPGGVVIEMSQYGRAVGPRERSRPVYSQSLEEYYVDVWGGELWIDILNWTLE  153

Query  1320  HG-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             +G LAPKSWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE +TCS+EQN
Sbjct  154   NGGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEILTCSKEQN  213

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             SELF+ VLGGLGQFG+ITRARIALE AP+RVRWIRVLYS+F  FT+DQE+LISLH    +
Sbjct  214   SELFYGVLGGLGQFGIITRARIALEPAPRRVRWIRVLYSNFTTFTRDQEHLISLHTAHRS  273

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
             ++FDYVEGFVIVDEGLINNWRSSFFSPRNPVK SS+ S+GGVLYCLE+TKN+D+S A  +
Sbjct  274   ERFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGSNGGVLYCLEMTKNHDESAASLL  333

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             DQE++ LLKKL+F+P+SVF TDLPY DFLDRVHK ELKLR+KG+WDVPHPWLNLFVP SR
Sbjct  334   DQEVEALLKKLEFVPASVFMTDLPYADFLDRVHKGELKLRAKGMWDVPHPWLNLFVPGSR  393

Query  603   IDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             I +FDRGVF+ ILGNKTSGPILIYPMNK+KWDER+S VTP+EEVFY+VA LRSA+ + +E
Sbjct  394   IADFDRGVFRTILGNKTSGPILIYPMNKHKWDERSSVVTPDEEVFYVVAFLRSALPDSDE  453

Query  423   S-QTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPK  247
             S Q+L+ L  QN  IL FC E+GIE+KQYLPH+ T+ EW  HFG KW RF   K QFDP+
Sbjct  454   STQSLEYLSDQNERILAFCDEAGIEVKQYLPHHVTRAEWARHFGAKWGRFLKLKAQFDPE  513

Query  246   HILSTGQLIFTPS  208
              IL  GQ IF P+
Sbjct  514   CILGLGQGIFLPA  526



>ref|XP_008804537.1| PREDICTED: cytokinin dehydrogenase 5-like [Phoenix dactylifera]
Length=538

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/428 (73%), Positives = 354/428 (83%), Gaps = 11/428 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKF------MYADVWGGELWIDVLKSTLEH  1318
             HSINGQA    GVV++MS   AA  +P     +       Y DVWGGELWIDVL  TL++
Sbjct  94    HSINGQARAPGGVVIEMSHDRAAGHRPRSRPVYSPSLGEYYVDVWGGELWIDVLNWTLDN  153

Query  1317  G-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             G  APKSWTDYLYLSVGGTLSNAGISGQ F+HGPQ+SNV+E DVVTGKGE VTCSEEQNS
Sbjct  154   GGRAPKSWTDYLYLSVGGTLSNAGISGQTFHHGPQLSNVYEFDVVTGKGEIVTCSEEQNS  213

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELFH VLGGLGQFG+ITRARIALE APQRVRWIRVLYS+F  FT+DQE LISLHG     
Sbjct  214   ELFHGVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFTTFTRDQELLISLHG---TH  270

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
             +FDYVEGFVIVDEGLINNWRSSFFSPRN V  SS+ ++GGVLYCLE+TKNYD STA  VD
Sbjct  271   RFDYVEGFVIVDEGLINNWRSSFFSPRNSVNISSIGANGGVLYCLEMTKNYDDSTAAFVD  330

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             QE++ LLK+L+FIP+SVFTTDLPYVDFLDRVHKAELKLR+KGLWDVPHPWLNLFVP SRI
Sbjct  331   QEVEALLKRLEFIPASVFTTDLPYVDFLDRVHKAELKLRAKGLWDVPHPWLNLFVPASRI  390

Query  600   DEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAV-ENGNE  424
              +FDRGVF+GILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLV  LRSA+ ++G  
Sbjct  391   ADFDRGVFRGILGNKTSGPILIYPMNKHKWDERSSAVTPDEEVFYLVGFLRSALPDSGES  450

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
             +Q+L+ L  QN  IL FC  +GIE+KQYLPH+ T+ EW  HFG KW+RF   K +FDPK 
Sbjct  451   TQSLEYLSQQNERILAFCDAAGIEVKQYLPHHLTRAEWARHFGAKWDRFIRLKAEFDPKG  510

Query  243   ILSTGQLI  220
             IL +GQ I
Sbjct  511   ILGSGQGI  518



>ref|XP_009408782.1| PREDICTED: cytokinin dehydrogenase 5-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/429 (71%), Positives = 361/429 (84%), Gaps = 5/429 (1%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-GAAAAVPKPLVSEKF--MYADVWGGELWIDVLKSTLEHG-L  1312
             HS NGQA++  GVV+QMS G  A  P P  S      Y DVWGG+LW+DVL  TL +G L
Sbjct  95    HSTNGQALSPGGVVVQMSRGRIAPRPVPAYSPSTGEYYVDVWGGDLWVDVLNWTLANGGL  154

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             APKSWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE +TCSEEQNSELF
Sbjct  155   APKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGELITCSEEQNSELF  214

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             H VLGGLGQFG+ITRARIALE AP RVRWIRVLYSDF AFT+DQE L+SLHG   +++FD
Sbjct  215   HGVLGGLGQFGIITRARIALETAPHRVRWIRVLYSDFAAFTRDQELLVSLHGAHRSERFD  274

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             YVEGFVIVDEGLINNWRSSFFSP+NPVK SSV ++ G+LYCLE+TKNYD S AD++D+ +
Sbjct  275   YVEGFVIVDEGLINNWRSSFFSPKNPVKISSVHANAGLLYCLEMTKNYDSSAADSIDEVV  334

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LL +L +IP+SVFTTDLPYVDFLDRVHKAE++LR+KGLW VPHPWLNLFVP SRI +F
Sbjct  335   EALLGQLGYIPASVFTTDLPYVDFLDRVHKAEMRLRAKGLWAVPHPWLNLFVPASRIADF  394

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAV-ENGNESQT  415
             +RGVF+GILGNK+SGPILIYPMNK+KWD+R+S VTP E+ FYLVA LRSA+ ++G+ +Q+
Sbjct  395   NRGVFRGILGNKSSGPILIYPMNKHKWDDRSSVVTPHEDTFYLVAFLRSALPDSGDPTQS  454

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILS  235
             L+ L  QN+ IL+FC ++GIE+KQYLP + ++ +W  HFG KW RF  RK +FDPK +L+
Sbjct  455   LEYLSRQNKKILEFCDDAGIEIKQYLPDHRSRAKWARHFGPKWGRFLRRKDRFDPKCMLA  514

Query  234   TGQLIFTPS  208
             TGQ I  PS
Sbjct  515   TGQGILPPS  523



>ref|XP_004152677.1| PREDICTED: cytokinin dehydrogenase 5-like [Cucumis sativus]
Length=528

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/445 (70%), Positives = 359/445 (81%), Gaps = 32/445 (7%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAA----------AAVPKPLVSEKFMYADVWGGELWIDVLKS  1330
             HSINGQA T  GVV++MSG            A+ P P+VSEK  + DVWGGELWIDVLK 
Sbjct  99    HSINGQAQTGNGVVIEMSGGGRQHRRVGGRGASPPLPVVSEKGRFVDVWGGELWIDVLKW  158

Query  1329  TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEE  1150
             TLE+GLAP+SWTDYLYLSVGGTLSN GISGQAFNHGPQISNVHELDVVTG GE V CS E
Sbjct  159   TLEYGLAPRSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVHELDVVTGNGEIVKCSNE  218

Query  1149  QNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQP  970
             +N++LFH VLGGLGQFG+ITRARI LE APQRVRWIRVLYS+F+AFTKDQE+LISLH + 
Sbjct  219   ENADLFHGVLGGLGQFGIITRARIVLEPAPQRVRWIRVLYSNFEAFTKDQEWLISLHSKT  278

Query  969   PA-QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSV---KSDGGVLYCLEITKNYDQ  802
              + +KFDYVEGFVIVDEGLINNWRSSFFSP NPVK SS    KS G VLYCLEITKNY +
Sbjct  279   NSNEKFDYVEGFVIVDEGLINNWRSSFFSPANPVKISSFNKNKSHGAVLYCLEITKNYHE  338

Query  801   STADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNL  622
             S++ T+DQE++ L+K+L +IP SVFTTDL YVDFLDRVHKAELKLRSKGLWDVPHPWL  
Sbjct  339   SSSHTLDQEVEALMKELNYIPESVFTTDLGYVDFLDRVHKAELKLRSKGLWDVPHPWL--  396

Query  621   FVPKSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSA  442
                            KGILGN TSGPILIYPMNK+KWD RTSAVTPE++VFYLVALLRSA
Sbjct  397   ---------------KGILGNNTSGPILIYPMNKHKWDPRTSAVTPEDDVFYLVALLRSA  441

Query  441   VENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKL  262
             ++NG  +Q+L+ L  QN  IL+FC E+GIE+KQYLPHY+ ++EW +HFG+KW  FQ RKL
Sbjct  442   LDNGEPTQSLEYLSHQNHQILEFCYENGIEVKQYLPHYTKEEEWADHFGDKWPEFQARKL  501

Query  261   QFDPKHILSTGQLIFTPSFNAMTAS  187
             +FDP HIL+TGQ IF P+F  +  +
Sbjct  502   KFDPHHILATGQRIF-PAFKPVNMA  525



>gb|AAG13068.1|AC023754_6 Similar to cytokinin oxidase [Arabidopsis thaliana]
Length=512

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/422 (72%), Positives = 348/422 (82%), Gaps = 28/422 (7%)
 Frame = -1

Query  1479  HSINGQAMTAA-GVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HSINGQA     GVV++M+      PKPLV    MY DVWGGELW+DVLK TLEHGLAPK
Sbjct  98    HSINGQAAAGRNGVVVEMNHGVTGTPKPLVRPDEMYVDVWGGELWVDVLKKTLEHGLAPK  157

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQAF+HGPQISNV ELDVVTG                   
Sbjct  158   SWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTG-------------------  198

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
                  QFG+ITRARI+LE APQRVRWIRVLYS F+ FT+DQEYLIS+HGQ    KFDYVE
Sbjct  199   -----QFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQ---LKFDYVE  250

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             GFVIVDEGL+NNWRSSFFSPRNPVK SSV S+G VLYCLEITKNY  S ++ VDQE+++L
Sbjct  251   GFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSEIVDQEVEIL  310

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             +KKL FIP+SVFTTDL YVDFLDRVHKAELKLRSK LW+VPHPWLNLFVPKSRI +FD+G
Sbjct  311   MKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRISDFDKG  370

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VFKGILGNKTSGPILIYPMNK+KWDER+SAVTP+EEVFYLVALLRSA+ +G E+Q L+ L
Sbjct  371   VFKGILGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGEETQKLEYL  430

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QNR IL+FC+++ I +KQYLPH++TQ+EW  HFG+KW+RF+  K +FDP+HIL+TGQ 
Sbjct  431   KDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPRHILATGQR  490

Query  222   IF  217
             IF
Sbjct  491   IF  492



>ref|XP_004970152.1| PREDICTED: cytokinin dehydrogenase 5-like [Setaria italica]
Length=538

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/432 (69%), Positives = 345/432 (80%), Gaps = 11/432 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS---GAAA-AVPKPLVSEKFMYADVWGGELWIDVLKSTLEHG-  1315
             HSI+GQA    GVV+ MS   GAAA A+P    +    Y DVWGGELW+DVL  TL HG 
Sbjct  99    HSISGQAQVPGGVVVDMSHGPGAAARALPAYSAALGGHYVDVWGGELWVDVLNWTLSHGG  158

Query  1314  LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSEL  1135
             LAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE VTCSE +N +L
Sbjct  159   LAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDL  218

Query  1134  FHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKF  955
             F   LGGLGQFG+ITRARIALE APQRVRWIR LYS+F  FT DQE LISL      ++F
Sbjct  219   FFGALGGLGQFGIITRARIALERAPQRVRWIRALYSNFSEFTADQERLISLGAG--VRRF  276

Query  954   DYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             DYVEGFV+  EGLINNWRSSFFSP+NPVK SS+K   GVLYCLE+TKNYD +TA +VDQ+
Sbjct  277   DYVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHSGVLYCLEVTKNYDDATAASVDQD  336

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             +D LL +L F+P +VFTTDLPYVDFLDRVHKAELKLR+KG+W+VPHPWLNLFVP SRI +
Sbjct  337   VDALLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRTKGMWEVPHPWLNLFVPASRIAD  396

Query  594   FDRGVFKGILGNKTS---GPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             FDRGVF+GILG +T+   GPILIYPMNK+KWD R+S VTP+EEVFYLVA LRSA+    E
Sbjct  397   FDRGVFRGILGGRTAGAGGPILIYPMNKHKWDPRSSVVTPDEEVFYLVAFLRSALPGVPE  456

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQFDPK  247
             S + + L  QN+ IL FC+E+GI  KQYLP++  Q EW EHFG  +WERF   K +FDP+
Sbjct  457   SLSTEALARQNQMILDFCEEAGIGAKQYLPNHKGQHEWAEHFGAARWERFARLKAEFDPR  516

Query  246   HILSTGQLIFTP  211
              IL+TGQ IF P
Sbjct  517   AILATGQGIFPP  528



>ref|XP_008672378.1| PREDICTED: cytokinin dehydrogenase 4 isoform X1 [Zea mays]
 tpg|DAA57393.1| TPA: hypothetical protein ZEAMMB73_142129 [Zea mays]
Length=541

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/435 (68%), Positives = 342/435 (79%), Gaps = 15/435 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-----GAAAAVPKPLVSEKF--MYADVWGGELWIDVLKSTLE  1321
             HSI+GQA  A GVV+ MS     GAA A   P+ S      Y DVWGGELW+DVL  TL 
Sbjct  100   HSISGQAQAAGGVVVDMSRGRGPGAAVARALPVHSAALGGHYVDVWGGELWVDVLNWTLS  159

Query  1320  HG-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             HG LAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE VTCSE +N
Sbjct  160   HGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETEN  219

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
              +LF  VLGGLGQFG+ITRARIALE AP+RVRWIR LYS+F  FT DQE LISL G    
Sbjct  220   PDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISL-GSGGG  278

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
             ++FDYVEGFV+  EGLINNWRSSFFSP+NPVK +S+K    VLYCLE+TKNYD  TA +V
Sbjct  279   RRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLTSLKHHSSVLYCLEVTKNYDDETAGSV  338

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             DQ++D LL +L F+P +VFTTDLPYVDFLDRVHKAELKLR+KG+W+VPHPWLNLFVP SR
Sbjct  339   DQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASR  398

Query  603   IDEFDRGVFKGILGNKTS---GPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVEN  433
             I +FDRGVF+G+LG +T+   GP+LIYPMNK+KWD R+SAVTP+EEVFYLVA LRSA+  
Sbjct  399   IADFDRGVFRGVLGGRTAGAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPG  458

Query  432   GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQF  256
               ES  L+ L  QN+ IL FC  +GI  KQYLP +  + EW EHFG  +W+RF   K +F
Sbjct  459   APES--LEALARQNQRILDFCAGAGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEF  516

Query  255   DPKHILSTGQLIFTP  211
             DP+ IL+ GQ IF P
Sbjct  517   DPRAILAAGQGIFRP  531



>gb|ADP38079.1| cytokinin dehydrogenase 4 [Zea mays]
Length=541

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/435 (68%), Positives = 342/435 (79%), Gaps = 15/435 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-----GAAAAVPKPLVSEKF--MYADVWGGELWIDVLKSTLE  1321
             HSI+GQA  A GVV+ MS     GAA A   P+ S      Y DVWGGELW+DVL  TL 
Sbjct  100   HSISGQAQAAGGVVVDMSRGRGPGAAVARALPVHSAALGGHYVDVWGGELWVDVLNWTLS  159

Query  1320  HG-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             HG LAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE VTCSE +N
Sbjct  160   HGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETEN  219

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
              +LF  VLGGLGQFG+ITRARIALE AP+RVRWIR LYS+F  FT DQE LISL G    
Sbjct  220   PDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISL-GSGGG  278

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
             ++FDYVEGFV+  EGLINNWRSSFFSP+NPVK +S+K    VLYCLE+TKNYD  TA +V
Sbjct  279   RRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLTSLKHHSSVLYCLEVTKNYDDETAGSV  338

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             DQ++D LL +L F+P +VFTTDLPYVDFLDRVHKAELKLR+KG+W+VPHPWLNLFVP SR
Sbjct  339   DQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASR  398

Query  603   IDEFDRGVFKGILGNKTS---GPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVEN  433
             I +FDRGVF+G+LG +T+   GP+LIYPMNK+KWD R+SAVTP+EEVFYLVA LRSA+  
Sbjct  399   IADFDRGVFRGVLGGRTAGAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPG  458

Query  432   GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQF  256
               ES  L+ L  QN+ IL FC  +GI  KQYLP +  + EW EHFG  +W+RF   K +F
Sbjct  459   APES--LEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEF  516

Query  255   DPKHILSTGQLIFTP  211
             DP+ IL+ GQ IF P
Sbjct  517   DPRAILAAGQGIFRP  531



>ref|XP_002458582.1| hypothetical protein SORBIDRAFT_03g036160 [Sorghum bicolor]
 gb|EES03702.1| hypothetical protein SORBIDRAFT_03g036160 [Sorghum bicolor]
Length=548

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/436 (68%), Positives = 340/436 (78%), Gaps = 15/436 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK------PLVSEKF--MYADVWGGELWIDVLKSTL  1324
             HSI+GQA    GVV+ MS    A  +      P+ S      Y DVWGG+LWIDVL  TL
Sbjct  105   HSISGQAQAPGGVVVDMSHGPGAAARARARALPVYSPALGGHYVDVWGGDLWIDVLNWTL  164

Query  1323  EHG-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQ  1147
              HG LAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE VTCS  +
Sbjct  165   SHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSATE  224

Query  1146  NSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPP  967
             N +LF   LGGLGQFG+ITRARIALE APQRVRWIR LYS+F  FT DQE LISL     
Sbjct  225   NPDLFFGALGGLGQFGIITRARIALERAPQRVRWIRALYSNFTEFTADQERLISLGSGSG  284

Query  966   AQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADT  787
              ++FDYVEGFV+  EGLINNWRSSFFSP+NPVK SS+K   GVLYCLE+TKNYD  TA +
Sbjct  285   GRRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHSGVLYCLEVTKNYDDDTAGS  344

Query  786   VDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKS  607
             VDQ++D LL +L F+P +VFTTDLPYVDFLDRVHKAELKLR+KG+W+VPHPWLNLFVP S
Sbjct  345   VDQDVDALLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPAS  404

Query  606   RIDEFDRGVFKGILGNKTS---GPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVE  436
             RI +FDRGVF+G+LG +T+   GPILIYPMNK+KWD R+S VTP+EEVFYLVA LRSA+ 
Sbjct  405   RIADFDRGVFRGVLGGRTAGAGGPILIYPMNKHKWDPRSSVVTPDEEVFYLVAFLRSALP  464

Query  435   NGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQ  259
                ES  L+ L  QN+ IL FC E+GI  KQYLP++  Q EW EHFG  +WERFQ  K +
Sbjct  465   GAPES--LEALVRQNQRILDFCAEAGISAKQYLPNHKAQHEWAEHFGAARWERFQRLKAE  522

Query  258   FDPKHILSTGQLIFTP  211
             FDP+ IL+TGQ IF P
Sbjct  523   FDPRAILATGQGIFRP  538



>gb|AFW84922.1| hypothetical protein ZEAMMB73_083779 [Zea mays]
Length=534

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/431 (68%), Positives = 337/431 (78%), Gaps = 14/431 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-GAAAAVPKPLVSEKF--MYADVWGGELWIDVLKSTLEHG-L  1312
             HSI+GQA    GVV+ M  G A A   P+ S      Y DVWGGELW+DVL  TL HG L
Sbjct  100   HSISGQAQAPGGVVVDMGHGGAVARALPVHSPALGGHYVDVWGGELWVDVLNWTLSHGGL  159

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             AP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE VTCSE +N +LF
Sbjct  160   APRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLF  219

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
               VLGGLGQFG+ITRARIALE APQRVRWIR LYS+F  FT DQE LISL     +++FD
Sbjct  220   FGVLGGLGQFGIITRARIALERAPQRVRWIRALYSNFTEFTADQERLISLG----SRRFD  275

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             YVEGFV+  EGLINNWRSSFFSP+NPVK SS+K   GVLYCLE+TKNYD +TA +V+Q++
Sbjct  276   YVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHSGVLYCLEVTKNYDDATAGSVEQDV  335

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             D LL +L FIP +VFTTDLPYVDFLDRVHKAELKLR+KG+W+VPHPWLNLFVP SRI +F
Sbjct  336   DALLGELNFIPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADF  395

Query  591   DRGVFKGIL---GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNES  421
             DRGVF+G+L        GPILIYPMNK++WD R+S VTP+E+VFYLVA LRSA+    ES
Sbjct  396   DRGVFRGVLGGGTAGAGGPILIYPMNKHRWDPRSSVVTPDEDVFYLVAFLRSALPGAPES  455

Query  420   QTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQFDPKH  244
               L+ L  QNR +L FC E+GI  KQYLP++    EW EHFG  +WERF   K QFDP+ 
Sbjct  456   --LEALARQNRRVLDFCAEAGIGAKQYLPNHKAPGEWAEHFGAARWERFARLKAQFDPRA  513

Query  243   ILSTGQLIFTP  211
             IL+ GQ IF P
Sbjct  514   ILAAGQGIFRP  524



>ref|NP_001044409.1| Os01g0775400 [Oryza sativa Japonica Group]
 sp|Q5ZAY9.1|CKX5_ORYSJ RecName: Full=Cytokinin dehydrogenase 5; AltName: Full=Cytokinin 
oxidase 5; Short=OsCKX5; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD53232.1| putative cytokinin oxidase [Oryza sativa Japonica Group]
 dbj|BAD52957.1| putative cytokinin oxidase [Oryza sativa Japonica Group]
 dbj|BAF06323.1| Os01g0775400 [Oryza sativa Japonica Group]
 gb|EAY76011.1| hypothetical protein OsI_03936 [Oryza sativa Indica Group]
Length=534

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/431 (69%), Positives = 345/431 (80%), Gaps = 13/431 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS----GAAAAVPKPLVSEKF--MYADVWGGELWIDVLKSTLEH  1318
             HSI+GQA  A GVV+ MS      AA    P+ S      Y DVWGGELWIDVL  TL H
Sbjct  98    HSISGQAQAAGGVVVDMSHGWRAEAAERTLPVYSPALGGHYIDVWGGELWIDVLNWTLAH  157

Query  1317  G-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             G LAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE VTCSE  N 
Sbjct  158   GGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSESNNP  217

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISL-HGQPPA  964
             +LF   LGGLGQ G+ITRARIALE AP RVRWIR LYS+F  FT DQE LISL HG    
Sbjct  218   DLFFGALGGLGQLGIITRARIALEPAPHRVRWIRALYSNFTEFTADQERLISLQHG---G  274

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
             ++FDYVEGFV+  EGLINNWRSSFFSP+NPVK SS+K   GVLYCLE+TKNYD STA TV
Sbjct  275   RRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHSGVLYCLEVTKNYDDSTAVTV  334

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             DQ+++ LL +L FIP +VFTTDLPYVDFLDRVHKAELKLR KG+W+VPHPWLNLFVP SR
Sbjct  335   DQDVEALLGELNFIPGTVFTTDLPYVDFLDRVHKAELKLRGKGMWEVPHPWLNLFVPASR  394

Query  603   IDEFDRGVFKGILGNKTS-GPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGN  427
             I +FDRGVF+G+LG++T+ GPILIYPMN++KWD R+S VTPEE+VFYLVA LRSAV    
Sbjct  395   IADFDRGVFRGVLGSRTAGGPILIYPMNRHKWDPRSSVVTPEEDVFYLVAFLRSAVPGST  454

Query  426   E-SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
             + +Q+L+ L+ QNR+IL+FC E+GI  KQYLP++  Q+EW+ HFG +W RF   K +FDP
Sbjct  455   DPAQSLEALERQNREILEFCDEAGIGAKQYLPNHKAQREWEAHFGARWARFARLKAEFDP  514

Query  249   KHILSTGQLIF  217
             + +L+TGQ IF
Sbjct  515   RAMLATGQGIF  525



>ref|NP_001185960.1| cytokinin dehydrogenase 4b precursor [Zea mays]
 gb|ADP38080.1| cytokinin dehydrogenase 4b [Zea mays]
Length=534

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/431 (67%), Positives = 335/431 (78%), Gaps = 14/431 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-GAAAAVPKPLVSEKF--MYADVWGGELWIDVLKSTLEHG-L  1312
             HSI+GQA    GVV+ M  G A A   P+ S      Y DVWGGELW+DVL  TL HG L
Sbjct  100   HSISGQAQAPGGVVVDMGHGGAVARALPVHSPALGGHYVDVWGGELWVDVLNWTLSHGGL  159

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             AP SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE VTCSE +N +LF
Sbjct  160   APWSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLF  219

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
               VLGGLGQFG+ITRARIALE APQRVRWIR LYS+F  FT DQE LISL     +++FD
Sbjct  220   FGVLGGLGQFGIITRARIALERAPQRVRWIRALYSNFTEFTADQERLISLG----SRRFD  275

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             YVEGFV+  EGLINNWRSSFFSP+NPVK SS+K   GVLYCLE+TKNYD +TA +V+Q++
Sbjct  276   YVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHSGVLYCLEVTKNYDDATAGSVEQDV  335

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             D LL +L FIP +VFTTDLPYVDFLDRVHKAELKLR+KG+W+VPHPWLNLFVP SRI +F
Sbjct  336   DALLGELNFIPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADF  395

Query  591   DRGVFKGIL---GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNES  421
             DRGV +G+L        GPILIYPMNK++WD R+S VTP+E+VFYLVA LRSA+    ES
Sbjct  396   DRGVSRGVLGGGTAGAGGPILIYPMNKHRWDPRSSVVTPDEDVFYLVAFLRSALPGAPES  455

Query  420   QTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFG-EKWERFQHRKLQFDPKH  244
               L+ L  QNR +L FC E+GI  +QYLP++    EW EHFG  +WERF   K QFDP+ 
Sbjct  456   --LEALARQNRRVLDFCAEAGIGARQYLPNHKAPGEWAEHFGAARWERFARLKAQFDPRA  513

Query  243   ILSTGQLIFTP  211
             IL+ GQ IF P
Sbjct  514   ILAAGQGIFRP  524



>emb|CDM84390.1| unnamed protein product [Triticum aestivum]
Length=531

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/430 (69%), Positives = 340/430 (79%), Gaps = 9/430 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS--GAAAAVPKPLVSEKF--MYADVWGGELWIDVLKSTLEHG-  1315
             HSI+GQA    GVV+ MS  G A +   P+ S +    Y DVWGGELWIDVL  TL HG 
Sbjct  97    HSISGQAQVPGGVVVDMSRGGKAPSRALPVYSPELGGHYVDVWGGELWIDVLNWTLSHGG  156

Query  1314  LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSEL  1135
             LAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE+VTCSE +N EL
Sbjct  157   LAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEAVTCSEAKNPEL  216

Query  1134  FHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKF  955
             F   LGGLGQ G+ITRARIALE AP++VRWIR LYS+F  FT DQE LIS       ++F
Sbjct  217   FFGALGGLGQLGIITRARIALEPAPRKVRWIRALYSNFTEFTADQERLISQSQHGGGRRF  276

Query  954   DYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             DYVEGFV+  EGLINNWRSSFFSP+NPVK SS+K   GVLYCLE+TKNYD STA TVDQE
Sbjct  277   DYVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHTGVLYCLEVTKNYDDSTAATVDQE  336

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             +D LL  L F+P +VFTTDLPYVDFLDRVH AELKLR KG+W+VPHPWLNLFVP SRI +
Sbjct  337   VDALLGDLSFLPGTVFTTDLPYVDFLDRVHTAELKLRGKGMWEVPHPWLNLFVPASRIAD  396

Query  594   FDRGVFKGILGNKTS-GPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQ  418
             FDRGVF GILG++TS GPILIYPMNK+KWD RTS VTP+EEVFYLVA LRSA+      Q
Sbjct  397   FDRGVFHGILGSRTSGGPILIYPMNKHKWDPRTSVVTPDEEVFYLVAFLRSALPGA--PQ  454

Query  417   TLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGE-KWERFQHRKLQFDPKHI  241
             +L+ L  QNR IL FC E+GI  +QYLP++ +Q EW+ HFGE +W RF   K QFDP+ +
Sbjct  455   SLEALARQNRQILDFCTEAGIGARQYLPNHKSQPEWEAHFGERRWARFAGLKAQFDPRAM  514

Query  240   LSTGQLIFTP  211
             L+TGQ IF P
Sbjct  515   LATGQGIFPP  524



>ref|XP_003569936.1| PREDICTED: cytokinin dehydrogenase 5 [Brachypodium distachyon]
Length=549

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/443 (66%), Positives = 343/443 (77%), Gaps = 21/443 (5%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS---------------GAAAAVPKPLVSEKFMYADVWGGELWI  1345
             HSI+GQA    GVV+ MS                 A A+P    +    Y DVWGGELWI
Sbjct  99    HSISGQAQVPGGVVVDMSHGWRAADDVHGRRRNSQARALPVYSAALGGHYVDVWGGELWI  158

Query  1344  DVLKSTLEHG-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGES  1168
             DVL  TL HG LAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELD+VTGKGE+
Sbjct  159   DVLNWTLAHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDIVTGKGEA  218

Query  1167  VTCSEEQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLI  988
             VTCS  +N +LF   LGGLGQ G+ITRARIALE AP+RVRWIR LYS+F  FT DQE LI
Sbjct  219   VTCSAAKNPDLFFGALGGLGQLGIITRARIALEPAPRRVRWIRALYSNFTEFTADQEKLI  278

Query  987   SLHGQPPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNY  808
             S HG    ++FDYVEGFV+  EGLINNWRSSFFSP+NPVK SS+K   GVLYCLE+TKNY
Sbjct  279   SQHGG--RRRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHTGVLYCLEVTKNY  336

Query  807   DQSTADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWL  628
             D STA  VDQE+D LL +L F+P +VFTTDLPYVDFLDRVHKAELKLR KG+W+VPHPWL
Sbjct  337   DASTAGNVDQEVDALLGELSFMPGTVFTTDLPYVDFLDRVHKAELKLRGKGMWEVPHPWL  396

Query  627   NLFVPKSRIDEFDRGVFKGILGNKTS-GPILIYPMNKNKWDERTSAVTPEEEVFYLVALL  451
             NLFVP SRI +FDR VF+GILG++TS GPILIYPMNK+KWD R+S VTP+E+VFYLVA L
Sbjct  397   NLFVPASRIADFDRAVFRGILGSRTSGGPILIYPMNKHKWDPRSSVVTPDEDVFYLVAFL  456

Query  450   RSAVENGNE-SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEK-WERF  277
             RSAV   ++ S++L+ L  QNR IL FC E+GIE +QYL ++  + EW+ HFG K W RF
Sbjct  457   RSAVPGVDDPSKSLEALARQNRQILDFCAEAGIEARQYLANHKAEPEWEAHFGAKRWARF  516

Query  276   QHRKLQFDPKHILSTGQLIFTPS  208
                K +FDP+ +L+TGQ IFTP+
Sbjct  517   ARLKAEFDPRAMLATGQGIFTPA  539



>dbj|BAK01307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=532

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/435 (68%), Positives = 342/435 (79%), Gaps = 18/435 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK----PLVSEKF--MYADVWGGELWIDVLKSTLEH  1318
             HSI+GQA    GVV+ MS    + P+    P+ S +    Y DVWGGELWIDVL  TL H
Sbjct  97    HSISGQAQVPGGVVVAMSRGGKSQPQARALPVYSPELGGHYVDVWGGELWIDVLNWTLSH  156

Query  1317  G-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             G LAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE+VTCSE +N 
Sbjct  157   GGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEAVTCSEAKNP  216

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLI--SLHGQPP  967
             ELF   LGGLGQ G+ITRARIALE AP++VRWIR LYS+F  FT DQE LI  S HG   
Sbjct  217   ELFFGALGGLGQLGIITRARIALEPAPRKVRWIRALYSNFTEFTADQERLISQSQHG---  273

Query  966   AQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQ-STAD  790
              ++FDYVEGFV+  EGLINNWRSSFFSP+NPVK SS+K   GVLYCLE+TKNYD  STA 
Sbjct  274   -RRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHTGVLYCLEVTKNYDHDSTAG  332

Query  789   TVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPK  610
             TVDQE+D LL  L F+P +VFTTDLPYVDFLDRVH AELKLR KG+W+VPHPWLNLFVP 
Sbjct  333   TVDQEVDALLGDLNFLPGTVFTTDLPYVDFLDRVHTAELKLRGKGMWEVPHPWLNLFVPA  392

Query  609   SRIDEFDRGVFKGILGNKTS-GPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVEN  433
             SRI +FDRGVF+GILG++TS GPILIYPMNK+KWD R+S VTP+EEVFYLVA LRSA+  
Sbjct  393   SRIADFDRGVFRGILGSRTSGGPILIYPMNKHKWDPRSSVVTPDEEVFYLVAFLRSALPG  452

Query  432   GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEK-WERFQHRKLQF  256
               ES  L+ L  QNR IL FC ++GI  KQYLP++ +Q +W  HFG+K W RF   K QF
Sbjct  453   APES--LEALARQNRQILDFCDDAGIGAKQYLPNHKSQPDWAAHFGDKRWARFAGLKAQF  510

Query  255   DPKHILSTGQLIFTP  211
             DP+ +L+TGQ IF P
Sbjct  511   DPRAMLATGQGIFPP  525



>ref|XP_006646382.1| PREDICTED: cytokinin dehydrogenase 5-like [Oryza brachyantha]
Length=486

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/391 (71%), Positives = 324/391 (83%), Gaps = 7/391 (2%)
 Frame = -1

Query  1377  YADVWGGELWIDVLKSTLEHG-LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVH  1201
             Y DVWGGELWIDVL  TL HG LAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+
Sbjct  90    YIDVWGGELWIDVLNWTLAHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVY  149

Query  1200  ELDVVTGKGESVTCSEEQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDF  1021
             ELDVVTGKGE VTCSE  N +LF   LGGLGQ G+ITRARIALE AP RVRWIR LYS+F
Sbjct  150   ELDVVTGKGEVVTCSESNNPDLFFGALGGLGQLGIITRARIALEPAPSRVRWIRALYSNF  209

Query  1020  QAFTKDQEYLISL-HGQPPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDG  844
               FT DQE LISL HG    ++FDYVEGFV+  EGLINNWRSSFFSP+NPVK SS+K   
Sbjct  210   TEFTADQERLISLQHG---GRRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHS  266

Query  843   GVLYCLEITKNYDQSTADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLR  664
             GVLYCLE+TKNYD STA TVDQ+++ LL +L FIP +VFTTDLPYVDFLDRVHKAELKLR
Sbjct  267   GVLYCLEVTKNYDDSTAGTVDQDVEALLGELNFIPGTVFTTDLPYVDFLDRVHKAELKLR  326

Query  663   SKGLWDVPHPWLNLFVPKSRIDEFDRGVFKGILGNKTS-GPILIYPMNKNKWDERTSAVT  487
              KG+W+VPHPWLNLFVP SRI +FD GVF+G+LG++T+ GPILIYPMNK+KWD R+S VT
Sbjct  327   DKGMWEVPHPWLNLFVPASRIADFDHGVFRGVLGSRTAGGPILIYPMNKHKWDPRSSVVT  386

Query  486   PEEEVFYLVALLRSAVEN-GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEW  310
             PEE+VFYLVA LRSAV    + +++L+ L+ QNR+IL+FC+E+GI  KQYLP++  Q EW
Sbjct  387   PEEDVFYLVAFLRSAVPGAADPAKSLEALERQNREILEFCEEAGIGAKQYLPNHKAQGEW  446

Query  309   KEHFGEKWERFQHRKLQFDPKHILSTGQLIF  217
             + HFG +W RF   K  FDP+ +L+TGQ IF
Sbjct  447   EAHFGARWARFARLKADFDPRAMLATGQGIF  477



>gb|KHG27003.1| Cytokinin dehydrogenase 5 -like protein [Gossypium arboreum]
Length=425

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/332 (81%), Positives = 292/332 (88%), Gaps = 10/332 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAV--------PKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HSINGQA TA GVV+QMSG+            P P V  +  + DVWGGELWIDVL+STL
Sbjct  94    HSINGQAQTANGVVVQMSGSKGGSGMASGRKPPHPRVWPQERFVDVWGGELWIDVLRSTL  153

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             +HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGE +TCSEEQN
Sbjct  154   QHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGELLTCSEEQN  213

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             SE+FHAVLGGLGQFG+ITRARI+LE APQRVRWIRVLYS+F  FT DQEYLISLH QP +
Sbjct  214   SEMFHAVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSNFSIFTSDQEYLISLHEQPAS  273

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
             QKFDYVEGFVIVDEGLINNWRSSFFSP NPVK SS+  +GGVLYCLEI KNY +STA TV
Sbjct  274   QKFDYVEGFVIVDEGLINNWRSSFFSPHNPVKISSLDPNGGVLYCLEIAKNYHESTASTV  333

Query  783   D--QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPK  610
             D  QE++ LLKKL FIP+SVFTTDLPYVDFLDRVHKAELKLRSKGLW+VPHPWLNLFVPK
Sbjct  334   DQMQEVESLLKKLNFIPASVFTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPK  393

Query  609   SRIDEFDRGVFKGILGNKTSGPILIYPMNKNK  514
             S+I +FD+GVFKGILGNKTSGPILIYP+NKNK
Sbjct  394   SKIADFDKGVFKGILGNKTSGPILIYPINKNK  425



>ref|XP_004500977.1| PREDICTED: cytokinin dehydrogenase 5-like isoform X2 [Cicer arietinum]
Length=425

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/325 (81%), Positives = 289/325 (89%), Gaps = 3/325 (1%)
 Frame = -1

Query  1479  HSINGQAMT-AAGVVLQMS--GAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HSINGQA T   GVV++M   G  ++   P V EK MY DVWGGELWI VLK+TLE+GLA
Sbjct  99    HSINGQADTRVKGVVIEMGKGGVESSNNPPRVWEKEMYVDVWGGELWIHVLKATLEYGLA  158

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYLYLSVGGTLSNAGISGQ FNHGPQISNV +LDVVTGKGE +TCSE++NS+LFH
Sbjct  159   PKSWTDYLYLSVGGTLSNAGISGQTFNHGPQISNVFQLDVVTGKGEVLTCSEDRNSDLFH  218

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             AVLGGLGQFG+ITRARIAL+ APQRVRWIRVLYS+F  F KDQE+LISLHG+P  Q+FDY
Sbjct  219   AVLGGLGQFGIITRARIALQPAPQRVRWIRVLYSNFSTFCKDQEFLISLHGKPATQRFDY  278

Query  948   VEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             VEGFVIVDEGLINNWRSSFFSP NPVK SS+ +DGGVLYCLEITKNY Q  AD+VD+EI 
Sbjct  279   VEGFVIVDEGLINNWRSSFFSPSNPVKISSLNADGGVLYCLEITKNYHQGNADSVDEEIQ  338

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LLKKL FIP SVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLF+PKSRI++FD
Sbjct  339   PLLKKLDFIPKSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFIPKSRIEDFD  398

Query  588   RGVFKGILGNKTSGPILIYPMNKNK  514
             +GVFKGILGNKTSGPILIYPMNKNK
Sbjct  399   KGVFKGILGNKTSGPILIYPMNKNK  423



>gb|KHN22222.1| Cytokinin dehydrogenase 5 [Glycine soja]
Length=421

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/332 (77%), Positives = 286/332 (86%), Gaps = 10/332 (3%)
 Frame = -1

Query  1479  HSINGQAMTA--AGVVLQMSGAAAAVPKP--------LVSEKFMYADVWGGELWIDVLKS  1330
             HSINGQA+     GVV++M  + +              V EK MY DVWGG+LWIDVL +
Sbjct  90    HSINGQALIKEKKGVVIEMGKSDSGDNNDHNGDSNIIRVCEKGMYVDVWGGKLWIDVLSA  149

Query  1329  TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEE  1150
             TLE+GLAP SWTDYLYLSVGGTLSNAGISGQ FNHGPQI+NV+ELDVVTGKGE VTCSE+
Sbjct  150   TLEYGLAPMSWTDYLYLSVGGTLSNAGISGQTFNHGPQITNVYELDVVTGKGELVTCSED  209

Query  1149  QNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQP  970
             +NSELFH+VLGGLGQFG+ITRARIALE AP RVRWIRVLYS+F  F KDQEYLISLHG+ 
Sbjct  210   RNSELFHSVLGGLGQFGIITRARIALEPAPHRVRWIRVLYSNFARFCKDQEYLISLHGKA  269

Query  969   PAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTAD  790
               ++FDYVEGFVIVDEGLINNWRSSFF+  NPVK +S+ +DGGVLYCLEITKNYDQ  AD
Sbjct  270   ARERFDYVEGFVIVDEGLINNWRSSFFAASNPVKITSLNADGGVLYCLEITKNYDQGNAD  329

Query  789   TVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPK  610
             +VD+EI  LLKKL FIP+SVFTTDLPYVDFLDRVHKAELKL+SKGLWDVPHPWLNLFVPK
Sbjct  330   SVDEEIQALLKKLNFIPTSVFTTDLPYVDFLDRVHKAELKLKSKGLWDVPHPWLNLFVPK  389

Query  609   SRIDEFDRGVFKGILGNKTSGPILIYPMNKNK  514
             SRI++FD+GVFKGILGNKTSGPILIYPMNKNK
Sbjct  390   SRIEDFDKGVFKGILGNKTSGPILIYPMNKNK  421



>gb|KGN62632.1| hypothetical protein Csa_2G362450 [Cucumis sativus]
Length=434

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/336 (77%), Positives = 287/336 (85%), Gaps = 14/336 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAA----------AAVPKPLVSEKFMYADVWGGELWIDVLKS  1330
             HSINGQA T  GVV++MSG            A+ P P+VSEK  + DVWGGELWIDVLK 
Sbjct  99    HSINGQAQTGNGVVIEMSGGGRQHRRVGGRGASPPLPVVSEKGRFVDVWGGELWIDVLKW  158

Query  1329  TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEE  1150
             TLE+GLAP+SWTDYLYLSVGGTLSN GISGQAFNHGPQISNVHELDVVTG GE V CS E
Sbjct  159   TLEYGLAPRSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVHELDVVTGNGEIVKCSNE  218

Query  1149  QNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQP  970
             +N++LFH VLGGLGQFG+ITRARI LE APQRVRWIRVLYS+F+AFTKDQE+LISLH + 
Sbjct  219   ENADLFHGVLGGLGQFGIITRARIVLEPAPQRVRWIRVLYSNFEAFTKDQEWLISLHSKT  278

Query  969   PA-QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSV---KSDGGVLYCLEITKNYDQ  802
              + +KFDYVEGFVIVDEGLINNWRSSFFSP NPVK SS    KS G VLYCLEITKNY +
Sbjct  279   NSNEKFDYVEGFVIVDEGLINNWRSSFFSPANPVKISSFNKNKSHGAVLYCLEITKNYHE  338

Query  801   STADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNL  622
             S++ T+DQE++ L+K+L +IP SVFTTDL YVDFLDRVHKAELKLRSKGLWDVPHPWLNL
Sbjct  339   SSSHTLDQEVEALMKELNYIPESVFTTDLGYVDFLDRVHKAELKLRSKGLWDVPHPWLNL  398

Query  621   FVPKSRIDEFDRGVFKGILGNKTSGPILIYPMNKNK  514
             FVPKSRI +FDRGVFKGILGN TSGPILIYPMNK+K
Sbjct  399   FVPKSRIADFDRGVFKGILGNNTSGPILIYPMNKHK  434



>ref|XP_004295395.1| PREDICTED: cytokinin dehydrogenase 6-like [Fragaria vesca subsp. 
vesca]
Length=495

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/427 (59%), Positives = 321/427 (75%), Gaps = 15/427 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPL-----VSEKFMYADVWGGELWIDVLKSTLEHG  1315
             HS+ GQ+    GVV+ M     ++ +P+      +  F YADV GGELWI++L  +L +G
Sbjct  70    HSLQGQSQAHRGVVVNME----SLKRPIDIHVNFTGNFSYADVSGGELWINILHESLNYG  125

Query  1314  LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSEL  1135
             LAPKSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L VVTGKGE VTCSE+QN +L
Sbjct  126   LAPKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLQVVTGKGEIVTCSEKQNHDL  185

Query  1134  FHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKF  955
             FH VLGGLGQFG+ITRARI LE AP RV+WIRVLYSDF AFT+DQE+LIS+        F
Sbjct  186   FHGVLGGLGQFGIITRARILLEAAPARVKWIRVLYSDFTAFTRDQEHLISIQ-----NTF  240

Query  954   DYVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQ  778
             +YVEGFVI++  GL+NNWRS  FSP++PV+ S  KSDG  LYCLE+ K ++    D ++Q
Sbjct  241   NYVEGFVIINRTGLLNNWRSYSFSPKDPVQASQFKSDGRTLYCLELAKYFNLDKTDIINQ  300

Query  777   EIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRID  598
             E+D LL +L +IPS++F + + Y DFLDRVH +E+KLRSK LWD+PHPW+NL +PKS+I 
Sbjct  301   EVDKLLSQLSYIPSTLFVSQVTYTDFLDRVHVSEMKLRSKHLWDIPHPWINLLIPKSKIH  360

Query  597   EFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQ  418
              F RGVF  I+   ++GPILIYP+N++KWD RTS VTPEE +FYLVA L SAV +   + 
Sbjct  361   TFARGVFGNIVTATSNGPILIYPVNRSKWDNRTSVVTPEEHIFYLVAFLTSAVPSSTGTD  420

Query  417   TLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHIL  238
              L+++  QN+ IL FC+ + + +KQYLPHY+ Q+EW+ HFG  WE+F  RK  +DP  IL
Sbjct  421   GLEHMLIQNKRILDFCETANLGVKQYLPHYTKQEEWQSHFGSHWEKFVQRKSTYDPLAIL  480

Query  237   STGQLIF  217
             + GQ IF
Sbjct  481   APGQRIF  487



>ref|XP_006843486.1| hypothetical protein AMTR_s00053p00208790 [Amborella trichopoda]
 gb|ERN05161.1| hypothetical protein AMTR_s00053p00208790 [Amborella trichopoda]
Length=514

 Score =   528 bits (1361),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 256/432 (59%), Positives = 328/432 (76%), Gaps = 15/432 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSE--KFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQA    G+V+ M   A    K  V E  K  Y +V GGELWIDVL+ TL+ GLAP
Sbjct  95    HSLRGQAQAPHGIVVNMESLADP-KKRRVHEGGKSPYVEVSGGELWIDVLRQTLKCGLAP  153

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             +SWTDYL+L+VGGTLSNAGISGQAF +GPQISNV++L+VVTGKGE V CS ++N++LFHA
Sbjct  154   RSWTDYLHLTVGGTLSNAGISGQAFRYGPQISNVYQLEVVTGKGEVVNCSAQKNADLFHA  213

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFG+IT+ARIALE AP+ V+WIRVLYSDF  FTKDQE LISL      + FDYV
Sbjct  214   VLGGLGQFGIITKARIALEPAPEMVKWIRVLYSDFSLFTKDQELLISLE-----KGFDYV  268

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EGFVI++  G++NNWRSSFF+P NP++ S   S+G  LYCLEI KN+D + A+  DQE++
Sbjct  269   EGFVIINRNGILNNWRSSFFTPENPIQASRFNSNGRTLYCLEIAKNFDFNNANATDQEVE  328

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LL +L FIPS++F+++LPY+DFLDRVH +E+KLR++GLW+VPHPWLNL +P+S I +F 
Sbjct  329   SLLAQLSFIPSTLFSSELPYLDFLDRVHASEVKLRAQGLWEVPHPWLNLLIPQSTIHDFA  388

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
               +F  +L + ++GPILIYP+NK KWD RTSAVTP E++FYLVA L S+  +     +L+
Sbjct  389   EEIFGKLLTDSSNGPILIYPLNKEKWDNRTSAVTPNEDIFYLVAFLSSSTVD-----SLE  443

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
             +  SQNR IL+FC++ GI MKQYLPHY+T+ EW  HF  +W+ F  RK  +DP  IL+ G
Sbjct  444   HSLSQNRRILEFCEKQGIGMKQYLPHYTTKSEWAAHFSHRWQEFVRRKAAYDPLAILAPG  503

Query  228   QLIFTPSFNAMT  193
             Q IF P  NA  
Sbjct  504   QRIF-PKANAFA  514



>ref|XP_009391556.1| PREDICTED: cytokinin dehydrogenase 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   527 bits (1358),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 249/422 (59%), Positives = 327/422 (77%), Gaps = 9/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V++M        K    E+  Y D  GG LWI+VL   L+HGLAPKS
Sbjct  95    HSLQGQAQADGGIVVRMENLRGCETKVHDGEQ-PYVDASGGALWINVLLECLKHGLAPKS  153

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L++GGTLSNAGISGQAF HGPQISNVH+L++VTGKGE + CS E+N++LF+A L
Sbjct  154   WTDYLHLTIGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGELLNCSAEENADLFYAAL  213

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP+ V+WIRVLYSDF +FT+DQE LISL      + FDY+EG
Sbjct  214   GGLGQFGIITRARIALEPAPKMVKWIRVLYSDFASFTEDQEMLISL-----KETFDYIEG  268

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +P+NPV+ S   SDG +L+CLE+TKN+DQ  A+TV+Q+++ L
Sbjct  269   FVIINRTGLLNNWRSSF-NPQNPVQASEFDSDGRILFCLEMTKNFDQDNAETVNQQVEAL  327

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL++IPS++F +++ Y++FLDRVH +E+KLRSKGLW+VPHPWLNL +P++RI +F   
Sbjct  328   LSKLRYIPSTLFQSEVSYLEFLDRVHVSEVKLRSKGLWEVPHPWLNLLIPRTRIRDFAAQ  387

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPIL+YP+NK+KWD RTSAV P+EE+FYLVA L SA  + ++  +L   
Sbjct  388   VFGKILPDSNNGPILLYPLNKSKWDNRTSAVIPDEEIFYLVAFLSSA-PSSSDHDSLDRA  446

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN  IL FCK++GI MKQYLP+Y+ Q+EW+ HFG++WE F  RK  +DP +IL+ GQ 
Sbjct  447   LKQNDRILDFCKQAGIRMKQYLPYYTMQEEWRAHFGDRWEDFARRKGVYDPLYILAPGQR  506

Query  222   IF  217
             IF
Sbjct  507   IF  508



>ref|XP_010279585.1| PREDICTED: cytokinin dehydrogenase 9-like [Nelumbo nucifera]
Length=548

 Score =   525 bits (1351),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 326/423 (77%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M       PK  V + +  Y DV GGELWI++L  +L++GLAPK
Sbjct  127   HSLQGQAQAHGGVVINMESLQE--PKMQVHTGELPYVDVSGGELWINILHESLKYGLAPK  184

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQISNV++L+VVTGKGE V+CSE+QN++LFH V
Sbjct  185   SWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVYQLEVVTGKGEVVSCSEKQNADLFHGV  244

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+I RARIALE AP+ V+WIRVLYSDF  FT+DQEYLIS         FDY+E
Sbjct  245   LGGLGQFGIIARARIALEPAPKMVKWIRVLYSDFSMFTRDQEYLISAE-----NTFDYIE  299

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRS FF+P++P+K S  KSDG  L+CLE+TKN++    D ++QE++ 
Sbjct  300   GFVIINRTGLLNNWRS-FFNPQDPLKASQFKSDGRTLFCLEMTKNFNPDETDVMNQEVES  358

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L +IPS++F +++ YV+FLDRVH +E+KLRSKGLW+VPHPWLNL +P+SRI +F  
Sbjct  359   LLSQLNYIPSTLFASEVSYVEFLDRVHMSEIKLRSKGLWEVPHPWLNLLIPRSRIHDFAE  418

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GP+LIYP++++KWD RTS V P E++FYLVA L SAV +   +  L++
Sbjct  419   EVFGKILTDTSNGPVLIYPLHRSKWDSRTSTVIPNEDIFYLVAFLSSAVPSSTGTDGLEH  478

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL FC+ + + +KQYLPHY+TQ+EW+ HFG +WE F  RK  +DP  IL+ GQ
Sbjct  479   ILTQNKRILDFCETARLGIKQYLPHYTTQEEWRAHFGPRWETFVQRKSAYDPLAILAPGQ  538

Query  225   LIF  217
              IF
Sbjct  539   KIF  541



>ref|XP_010938664.1| PREDICTED: cytokinin dehydrogenase 4 isoform X1 [Elaeis guineensis]
Length=527

 Score =   523 bits (1348),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 247/422 (59%), Positives = 327/422 (77%), Gaps = 9/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA  + G+V+QM     A  +  V E F Y D  GGELWI+VL  +L+HGLAPKS
Sbjct  107   HSLGGQAQASGGIVIQMQSLREAETRVHVGE-FPYVDASGGELWINVLLESLKHGLAPKS  165

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L VVTG+GE + CS E+N++LFH VL
Sbjct  166   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLQVVTGRGEIMNCSAEENADLFHGVL  225

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP+ V+WIRVLYSDF +FT+DQE LIS       + FDY+EG
Sbjct  226   GGLGQFGIITRARIALERAPEMVKWIRVLYSDFTSFTEDQEMLIS-----AEKTFDYIEG  280

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSS F+P++PV+ S   SDG +L+CLE+TKN++   +D ++QE++ L
Sbjct  281   FVIINRTGLLNNWRSS-FNPQDPVQASQFNSDGRILFCLEMTKNFNPDESDMLNQEVETL  339

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL++IPS +F +++ Y++FLDRVH +E+KLRS+GLW+VPHPWLNLF+P++RI +F + 
Sbjct  340   LSKLRYIPSMLFQSEVSYLEFLDRVHVSEVKLRSQGLWEVPHPWLNLFIPRTRIHDFAKE  399

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + + GPIL+YP+ K+KWD R S V P+EEVFYLVA L SA  + ++  +L++ 
Sbjct  400   VFGKILTDSSHGPILLYPLKKSKWDNRASVVIPDEEVFYLVAFLSSAPPS-SDHDSLEHA  458

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
                N  IL FC+++GI+MKQYLPHY+ ++EWK HFG++WE F  RK  +DP  IL+ GQ 
Sbjct  459   LKLNDKILDFCQKAGIQMKQYLPHYTAKEEWKAHFGDRWEMFAWRKATYDPLAILTPGQR  518

Query  222   IF  217
             IF
Sbjct  519   IF  520



>ref|XP_004303072.1| PREDICTED: cytokinin dehydrogenase 6-like [Fragaria vesca subsp. 
vesca]
Length=529

 Score =   522 bits (1345),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 252/425 (59%), Positives = 323/425 (76%), Gaps = 14/425 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKP---LVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HS++GQ+    GVV+ M     ++ +P   + +  F YADV GGELWI++L  +L +GLA
Sbjct  108   HSLHGQSQAHRGVVVNME----SLKRPDIHVYTGNFPYADVSGGELWINILHESLRYGLA  163

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAGISGQAF HGPQISNV +L+VVTGKGE VTCSE+QN +LFH
Sbjct  164   PKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVRQLEVVTGKGEIVTCSEKQNDDLFH  223

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
              VLGGLGQFG+ITRARI LE AP RV+WIRVLYSDF AFT+DQEYLIS  G+     F+Y
Sbjct  224   GVLGGLGQFGIITRARILLEAAPARVKWIRVLYSDFTAFTRDQEYLIS--GE---NTFNY  278

Query  948   VEGFVIVDEG-LINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             VEGFVI++   L+NNWRSSF SP++PV+ S  KSDG  LYCLE+ K ++    D ++QE+
Sbjct  279   VEGFVIINRTRLLNNWRSSF-SPKDPVQASQFKSDGRTLYCLELAKYFNLDKTDIINQEV  337

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             D LL KL +IPS++F +++ Y DFLDRVH +E+KLRSK LWD+PHPWLNL +PKS+I  F
Sbjct  338   DKLLSKLSYIPSTLFVSEVTYTDFLDRVHVSEMKLRSKDLWDIPHPWLNLLIPKSKIHTF  397

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
              +GVF  IL   ++GPILIYP+N++KWD RTS V PEE  FYLVA L SAV +   +  L
Sbjct  398   AQGVFGNILAETSNGPILIYPVNRSKWDNRTSVVIPEEHTFYLVAFLTSAVPSSTGTDGL  457

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             +++  +N+ IL+FC+ + + +KQYLPHY+ Q+EW+ HFG  WE+F  RK  +DP  IL+ 
Sbjct  458   EHILIRNKRILEFCETANLGVKQYLPHYTKQEEWQAHFGPHWEKFVQRKSTYDPLAILAP  517

Query  231   GQLIF  217
             GQ IF
Sbjct  518   GQRIF  522



>gb|EMS58043.1| Cytokinin dehydrogenase 5 [Triticum urartu]
Length=544

 Score =   521 bits (1342),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 279/444 (63%), Positives = 326/444 (73%), Gaps = 25/444 (6%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS--GAAAAVPKPLVSEKF--MYADVWGGELWIDVLKSTLEHG-  1315
             HSI+GQA    GVV+ MS  G A +   P+ S +    Y DVWGGELWIDVL  TL HG 
Sbjct  97    HSISGQAQVPGGVVVDMSLGGKAPSRALPVYSPELGGHYVDVWGGELWIDVLNWTLSHGG  156

Query  1314  LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSEL  1135
             LAP+SWTDYLYLSVGGTLSNAGISGQAF+HGPQISNV+ELDVVTGKGE+VTCSE +N EL
Sbjct  157   LAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEAVTCSEAKNPEL  216

Query  1134  FHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQ--------------E  997
             F   LGGLGQ G+ITRARIALE AP+++  +R++    Q     +               
Sbjct  217   FFGALGGLGQLGIITRARIALEPAPRKL--VRLVDHSGQVVQPPRFAGSGRSTPTSPSSR  274

Query  996   YLISLHGQPPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEIT  817
                S      A       GFV+  EGLINNWRSSFFSP+NPVK SS+K   GVLYCLE+T
Sbjct  275   RTRSGSSPSTAAGGRSAHGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHTGVLYCLEVT  334

Query  816   KNYDQSTADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPH  637
             KNYD STA TVDQE+D LL  L F+P +VFTTDLPYVDFLDRVH AELKLR KG+W+VPH
Sbjct  335   KNYDDSTAATVDQEVDALLGDLSFLPGTVFTTDLPYVDFLDRVHTAELKLRGKGMWEVPH  394

Query  636   PWLNLFVPKSRIDEFDRGVFKGILGNKTS-GPILIYPMNKNKWDERTSAVTPEEEVFYLV  460
             PWLNLFVP SRI +FDRGVF+GILG++TS GPILIYPMNK+KWD R+S VTP+EEVFYLV
Sbjct  395   PWLNLFVPASRIADFDRGVFRGILGSRTSGGPILIYPMNKHKWDPRSSVVTPDEEVFYLV  454

Query  459   ALLRSAVENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEK-WE  283
             A LRSA+  G  + +L+ L  QNR IL FC E+GI  +QYLP++ +Q EW+ HFGEK W 
Sbjct  455   AFLRSALPGG--AHSLEALARQNRQILDFCAEAGIGARQYLPNHKSQPEWEAHFGEKRWA  512

Query  282   RFQHRKLQFDPKHILSTGQLIFTP  211
             RF   K QFDP+ +L+TGQ IF P
Sbjct  513   RFAGLKAQFDPRAMLATGQGIFFP  536



>ref|XP_009793978.1| PREDICTED: cytokinin dehydrogenase 3 [Nicotiana sylvestris]
Length=533

 Score =   520 bits (1339),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 255/440 (58%), Positives = 319/440 (73%), Gaps = 29/440 (7%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG----------------AAAAVPKPLVSEKFMYADVWGGELW  1348
             HSI GQAM   GVV++M+                  +  +     S    YADV G +LW
Sbjct  105   HSIRGQAMAQNGVVVEMNSLNNNNNNNNNINNNKNGSCGIRVSWDSSLGFYADVGGEQLW  164

Query  1347  IDVLKSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGES  1168
             IDVL++TLEHGL+P SWTDYLYL+VGGTLSNAGISGQ F HGPQISNVHE+DV+TGKGE 
Sbjct  165   IDVLRATLEHGLSPVSWTDYLYLTVGGTLSNAGISGQTFRHGPQISNVHEMDVITGKGEF  224

Query  1167  VTCSEEQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLI  988
             VTCS+ +NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY+DF  FTKDQE+LI
Sbjct  225   VTCSKHKNSELFFAVLGGLGQFGIITRARIVLDKAPTRVKWVRMLYADFSKFTKDQEHLI  284

Query  987   SLHGQPPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNY  808
             S+ G       DYVEG +++++  +NNWRSSFFSP N  K +S+ S  G++YCLE+ K Y
Sbjct  285   SIDG------LDYVEGSLMMEQSSLNNWRSSFFSPSNQTKIASLLSQNGIIYCLEMVKYY  338

Query  807   DQSTADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWL  628
             D  TA+TVD+E+  L+K L F+P  +F  D+ +VDFL+RV   EL+L+SKG WDVPHPWL
Sbjct  339   DDQTANTVDEELKKLVKGLNFLPGFIFKKDVTFVDFLNRVRSGELELQSKGQWDVPHPWL  398

Query  627   NLFVPKSRIDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVAL  454
             NLFVPKS I +F+ GVF  I+   NKT+GPIL+YP ++ KWDER SAV PEEE FY V L
Sbjct  399   NLFVPKSNIMDFNAGVFVDIILRQNKTTGPILVYPTSRKKWDERISAVIPEEETFYCVGL  458

Query  453   LRSAVENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQ  274
             L S+  N       KNL  QN +IL +C ++G+++KQYLPHY T+++W +HFG+KW  FQ
Sbjct  459   LHSSGFN-----DWKNLDDQNEEILNYCDKAGLKIKQYLPHYKTKEDWIKHFGKKWNIFQ  513

Query  273   HRKLQFDPKHILSTGQLIFT  214
              RK QFDPK ILS GQ IF 
Sbjct  514   QRKSQFDPKMILSPGQRIFN  533



>ref|XP_007131444.1| hypothetical protein PHAVU_011G014000g [Phaseolus vulgaris]
 gb|ESW03438.1| hypothetical protein PHAVU_011G014000g [Phaseolus vulgaris]
Length=533

 Score =   520 bits (1338),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 249/422 (59%), Positives = 315/422 (75%), Gaps = 7/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M        +  V     Y DV GGELWI++L  TL +GLAP+S
Sbjct  111   HSLQGQAQAHGGVVINMESLKVPEMQVHVGNSPPYVDVSGGELWINILHETLRYGLAPRS  170

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQAF HGPQISNV +L++VTG GE V CS+E N ELFH+VL
Sbjct  171   WTDYLHLTVGGTLSNAGVSGQAFKHGPQISNVQQLEIVTGTGELVNCSKEHNGELFHSVL  230

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI LE AP  V+WIRVLYSDF AFT+DQE LIS       Q FDY+EG
Sbjct  231   GGLGQFGIITRARIILEPAPTMVKWIRVLYSDFTAFTRDQERLIS-----SEQTFDYIEG  285

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +P++PV+ S  KSDG  L+CLE+ K ++    D  +QE++  
Sbjct  286   FVIINRTGLLNNWRSSF-NPQDPVQASHFKSDGRTLFCLEMAKYFNVEEIDAANQEVEEH  344

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F+T++ YVDFLDRVH +E+KLRSKGLWD+PHPWLNL +PKS+I  F   
Sbjct  345   LSRLSYIPSTLFSTEVTYVDFLDRVHVSEVKLRSKGLWDIPHPWLNLLIPKSQIHNFAEV  404

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL   ++GP+LIYP+NK+KWD RTS V PEE++FYLVA L SAV + N +  L+ +
Sbjct  405   VFGKILTETSNGPVLIYPVNKSKWDNRTSVVIPEEDIFYLVAFLTSAVPSSNGTDGLEYI  464

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              SQN+ IL+FC+ S + +KQYLPHY+TQQEW+ HFG +WE F  RK  +DP  IL+ GQ 
Sbjct  465   LSQNKRILEFCETSQLGVKQYLPHYTTQQEWRAHFGPQWETFLQRKSVYDPLAILAPGQR  524

Query  222   IF  217
             IF
Sbjct  525   IF  526



>gb|KDO83251.1| hypothetical protein CISIN_1g008291mg [Citrus sinensis]
Length=571

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 249/423 (59%), Positives = 324/423 (77%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M       PK  V +E   Y DV GGELWI++L  ++++GLAPK
Sbjct  150   HSLQGQAQAHQGVVINMESLQG--PKMQVYAENSFYVDVSGGELWINILHESVKYGLAPK  207

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE + CSE+QNSELFH+V
Sbjct  208   SWTDYLHLTVGGTLSNAGISGQAFQHGPQISNVHQLEVVTGKGEIINCSEKQNSELFHSV  267

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP  V+WIRVLYSDF  F +DQEYLIS       + FDY+E
Sbjct  268   LGGLGQFGIITRARISLEPAPDMVKWIRVLYSDFATFARDQEYLIS-----AEKTFDYIE  322

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFV+V+  GL+NNWRSSF  P++PV+ S  KSDG  L+CLE+ K  ++   D V+QE++ 
Sbjct  323   GFVMVNRTGLLNNWRSSF-DPQDPVQASQFKSDGQTLFCLELAKYINKDEKDLVNQEVES  381

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
              L  L +IPS++F +++ Y++FLDRVH +E+KLRSKGLW+VPHPWLNLF+P+S+I +F R
Sbjct  382   SLSVLNYIPSTLFLSEVSYIEFLDRVHVSEVKLRSKGLWEVPHPWLNLFIPQSKIHDFAR  441

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL   ++GPILIYP+NK+KWD RTS V PEE+VFYLVA L SAV +   +  L++
Sbjct  442   EVFGNILAETSNGPILIYPLNKSKWDNRTSVVIPEEDVFYLVAFLSSAVPSSKGTDGLEH  501

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL++C+ + + +KQYLPHY+TQ++W+ HFG +WE F  RK  +DP  IL+ GQ
Sbjct  502   ILTQNKRILEYCETARLGVKQYLPHYTTQEQWRSHFGPQWEVFVQRKSTYDPLAILAPGQ  561

Query  225   LIF  217
              IF
Sbjct  562   RIF  564



>ref|XP_006438909.1| hypothetical protein CICLE_v10031210mg [Citrus clementina]
 gb|ESR52149.1| hypothetical protein CICLE_v10031210mg [Citrus clementina]
Length=530

 Score =   518 bits (1334),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 248/423 (59%), Positives = 323/423 (76%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M       PK  V +E   Y DV GGELWI++L  ++++GLAPK
Sbjct  109   HSLQGQAQAHQGVVINMESLQG--PKMQVYAENSFYVDVSGGELWINILHESVKYGLAPK  166

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE + CSE+QNSELFH+V
Sbjct  167   SWTDYLHLTVGGTLSNAGISGQAFQHGPQISNVHQLEVVTGKGEIINCSEKQNSELFHSV  226

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP  V+WIRVLYSDF  F +DQEYLIS       + FDY+E
Sbjct  227   LGGLGQFGIITRARISLEPAPDMVKWIRVLYSDFVTFARDQEYLIS-----AEKTFDYIE  281

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVIV+  GL+NNWRSSF  P++PV+ S  KS G  L+CLE+ K  ++   D V+QE++ 
Sbjct  282   GFVIVNRTGLLNNWRSSF-DPQDPVQASQFKSGGQTLFCLELAKYINKDEKDLVNQEVES  340

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
              L  L +IPS++F +++ Y++FLDRVH +E+KLRSKGLW+VPHPWLNLF+P+S+I +F +
Sbjct  341   SLSVLNYIPSTLFLSEVSYIEFLDRVHVSEVKLRSKGLWEVPHPWLNLFIPQSKIHDFAK  400

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL   ++GPILIYP+NK+KWD RTS V PEE+VFYLVA L SAV +   +  L++
Sbjct  401   EVFGNILAETSNGPILIYPLNKSKWDNRTSVVIPEEDVFYLVAFLSSAVPSSKGTDGLEH  460

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL++C+ + + +KQYLPHY+TQ++W+ HFG +WE F  RK  +DP  IL+ GQ
Sbjct  461   ILTQNKRILEYCETAHLGVKQYLPHYTTQEQWRSHFGPQWEVFVQRKSTYDPLAILAPGQ  520

Query  225   LIF  217
              IF
Sbjct  521   RIF  523



>dbj|BAK52671.1| cytokinin oxidase [Petunia x hybrida]
Length=550

 Score =   519 bits (1336),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 246/424 (58%), Positives = 320/424 (75%), Gaps = 9/424 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSE--KFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQA    GV++ M          +V    KF Y DV  GELWI++L  TL++GLAP
Sbjct  126   HSLQGQAQARGGVIINMESLQQGQEMQVVYNRGKFPYVDVSAGELWINILHETLKYGLAP  185

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE   CS+EQN++LFH 
Sbjct  186   KSWTDYLHLTVGGTLSNAGISGQAFKHGPQISNVHQLEVVTGKGEVKICSQEQNADLFHG  245

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFG+ITRARI+LE AP+ V+WIRVLYSDF  F +DQE+L+S      A+ FDY+
Sbjct  246   VLGGLGQFGIITRARISLERAPKMVKWIRVLYSDFSTFARDQEHLMS-----AAKTFDYI  300

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EG VI ++  LINNWR+SF  P++P + S   SDG  LYCLE+TKN     ADT+ +E+D
Sbjct  301   EGLVIKNKTDLINNWRASF-DPQDPAQASHFVSDGRTLYCLELTKNLYPENADTIGKELD  359

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LL +L +IPS++F T++PY++FLDRVH +ELKLRSKGLWD+PHPWLNL VPKS+I +F 
Sbjct  360   DLLSQLNYIPSTLFMTEVPYIEFLDRVHASELKLRSKGLWDLPHPWLNLLVPKSKIQQFA  419

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             +GVF  IL +  +GP+L+YP+ K+KWD RTS VTP+E++ YLVA L  A  + N + +L+
Sbjct  420   KGVFDNILKDTNNGPVLVYPIQKSKWDNRTSFVTPDEDIIYLVAFLSHANPSSNGTDSLE  479

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
             ++ +QN+ IL F + + + +KQYLPHY+TQ++W+ HFG KWE F  RKL +DP  IL+ G
Sbjct  480   HILTQNKRILDFSEAAHLGVKQYLPHYATQEQWRTHFGPKWEVFVQRKLTYDPLAILAPG  539

Query  228   QLIF  217
             Q IF
Sbjct  540   QRIF  543



>ref|XP_002304773.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|EEE79752.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=517

 Score =   517 bits (1331),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 321/423 (76%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M       PK  V +    Y D  GGELWID+L+  LE+GLAPK
Sbjct  96    HSLQGQAQAHQGVVINMESLQG--PKMHVYTGNNPYVDASGGELWIDILRECLEYGLAPK  153

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAG+SGQAF HGPQISNVH+++VVTGKGE + CSE+QNS+LFH+V
Sbjct  154   SWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVHQMEVVTGKGEVLNCSEKQNSDLFHSV  213

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP  V+WIRVLYSDF  F  DQE LI          FDY+E
Sbjct  214   LGGLGQFGIITRARISLEPAPDMVKWIRVLYSDFTTFATDQERLIG-----AENTFDYIE  268

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF +P++PV+ S   SDG  LYCLE+ K +++  AD +++E+  
Sbjct  269   GFVIINRTGLLNNWRSSF-NPQDPVQASQFHSDGRTLYCLELAKYFNRDRADALNEEVGN  327

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L++I S++F T++PY++FLDRVH +E+KLRSKGLW+VPHPWLNL +PKS+I++F  
Sbjct  328   LLSQLRYITSTLFQTEVPYIEFLDRVHVSEVKLRSKGLWEVPHPWLNLLIPKSKINDFAD  387

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GP+LIYP+NK+KWD RTSAV PEE +FYLVA L SAV +   +  L++
Sbjct  388   EVFGNILTDTSNGPVLIYPVNKSKWDNRTSAVIPEENIFYLVAFLTSAVPSSTGTDGLEH  447

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL+FC+ + + MKQYLPHY+T +EWK HFG +WE F  RK  +DP  IL+ GQ
Sbjct  448   ILTQNKRILEFCEIARLGMKQYLPHYTTHEEWKAHFGPQWEVFSQRKSTYDPLAILAPGQ  507

Query  225   LIF  217
              IF
Sbjct  508   RIF  510



>ref|XP_009417944.1| PREDICTED: cytokinin dehydrogenase 4-like [Musa acuminata subsp. 
malaccensis]
Length=525

 Score =   517 bits (1332),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 249/422 (59%), Positives = 325/422 (77%), Gaps = 9/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M        +    E+  Y D  GGELWI+VL   L+HGLAPKS
Sbjct  103   HSLQGQAQADGGVVIHMESLRGGGTRVHAGER-PYVDASGGELWINVLLECLKHGLAPKS  161

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L++GGTLSNAGISGQAF HGPQISNVH+L++VTGKGE +TCS E+N+ LFHA L
Sbjct  162   WTDYLHLTIGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGELLTCSTEENAALFHAAL  221

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFGVITRARIALE AP+ V+WIRVLYSDF +FT+DQE LIS       + FDY+EG
Sbjct  222   GGLGQFGVITRARIALEPAPEMVKWIRVLYSDFSSFTEDQEKLIS-----ARETFDYIEG  276

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSS F+P++PV+ S   SDG +L+CLE+TKN+++  AD + Q ++ L
Sbjct  277   FVIINRTGLLNNWRSS-FNPQDPVQASRFDSDGRILFCLEMTKNFNRDEADVMHQRVEAL  335

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L++IPS++F +++ Y++FLDRVH +E+KLRSKGLW+VPHPWLNL +P++RI +F   
Sbjct  336   LSRLRYIPSTLFQSEVTYLEFLDRVHVSEVKLRSKGLWEVPHPWLNLLIPRTRIKDFAEE  395

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPIL+YP++++KWD RTSAV P+EEVFYLVA L SA+ + +     + L
Sbjct  396   VFGKILTDSNNGPILLYPLHRSKWDNRTSAVIPDEEVFYLVAFLSSALSSSDHDNLERAL  455

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
             + QN  IL FC ++GI+MKQYLPHY+TQ+EWK HFG++WE F HRK  +DP  IL+ GQ 
Sbjct  456   K-QNDKILDFCNKAGIQMKQYLPHYTTQEEWKAHFGDRWELFAHRKGIYDPLSILAPGQR  514

Query  222   IF  217
             IF
Sbjct  515   IF  516



>ref|XP_010938665.1| PREDICTED: cytokinin dehydrogenase 4 isoform X2 [Elaeis guineensis]
Length=531

 Score =   517 bits (1332),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 247/426 (58%), Positives = 327/426 (77%), Gaps = 13/426 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA  + G+V+QM     A  +  V E F Y D  GGELWI+VL  +L+HGLAPKS
Sbjct  107   HSLGGQAQASGGIVIQMQSLREAETRVHVGE-FPYVDASGGELWINVLLESLKHGLAPKS  165

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVT----GKGESVTCSEEQNSELF  1132
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L VVT    G+GE + CS E+N++LF
Sbjct  166   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLQVVTVLCAGRGEIMNCSAEENADLF  225

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             H VLGGLGQFG+ITRARIALE AP+ V+WIRVLYSDF +FT+DQE LIS       + FD
Sbjct  226   HGVLGGLGQFGIITRARIALERAPEMVKWIRVLYSDFTSFTEDQEMLIS-----AEKTFD  280

Query  951   YVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             Y+EGFVI++  GL+NNWRSSF +P++PV+ S   SDG +L+CLE+TKN++   +D ++QE
Sbjct  281   YIEGFVIINRTGLLNNWRSSF-NPQDPVQASQFNSDGRILFCLEMTKNFNPDESDMLNQE  339

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             ++ LL KL++IPS +F +++ Y++FLDRVH +E+KLRS+GLW+VPHPWLNLF+P++RI +
Sbjct  340   VETLLSKLRYIPSMLFQSEVSYLEFLDRVHVSEVKLRSQGLWEVPHPWLNLFIPRTRIHD  399

Query  594   FDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQT  415
             F + VF  IL + + GPIL+YP+ K+KWD R S V P+EEVFYLVA L SA  + ++  +
Sbjct  400   FAKEVFGKILTDSSHGPILLYPLKKSKWDNRASVVIPDEEVFYLVAFLSSAPPS-SDHDS  458

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILS  235
             L++    N  IL FC+++GI+MKQYLPHY+ ++EWK HFG++WE F  RK  +DP  IL+
Sbjct  459   LEHALKLNDKILDFCQKAGIQMKQYLPHYTAKEEWKAHFGDRWEMFAWRKATYDPLAILT  518

Query  234   TGQLIF  217
              GQ IF
Sbjct  519   PGQRIF  524



>ref|XP_008796239.1| PREDICTED: cytokinin dehydrogenase 9-like [Phoenix dactylifera]
Length=528

 Score =   517 bits (1331),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 246/422 (58%), Positives = 325/422 (77%), Gaps = 9/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+QM        +  V +   Y D  GGELWIDVL  +L+HGLAPKS
Sbjct  108   HSLQGQAQAPGGIVIQMESLREPETRVHVGDS-PYLDASGGELWIDVLLESLKHGLAPKS  166

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQ F HGPQISNVH+L VVTG+GE V CS E+N++LF+ VL
Sbjct  167   WTDYLHLTVGGTLSNAGISGQVFRHGPQISNVHQLQVVTGEGEIVNCSAEENADLFYGVL  226

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+IT ARIALE AP+ V+WIRVLYSDF +FT+DQE LIS       + FDY+EG
Sbjct  227   GGLGQFGIITSARIALEPAPKMVKWIRVLYSDFTSFTEDQEMLISAE-----KTFDYIEG  281

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FV+++  GL+NNWRSSF +P++PV+ S   SDG +L+CLE+TKN++   +D ++QE+  L
Sbjct  282   FVMINRTGLLNNWRSSF-NPQDPVQASQFNSDGRILFCLEMTKNFNPDESDVMNQEVGTL  340

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL++IPS++F +++ Y++FLDRVH +E+KLRS+GLW+VPHPWLNLF+P++RI +F + 
Sbjct  341   LSKLRYIPSTLFRSEVSYLEFLDRVHVSEVKLRSQGLWEVPHPWLNLFIPRTRIHDFAKE  400

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPIL+YP+NK+KWD RTSAV P+EEVFYLVA L SA  + + + +L+  
Sbjct  401   VFGKILPDSSNGPILLYPLNKSKWDNRTSAVIPDEEVFYLVAFLSSAPPSSDHA-SLELA  459

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN  IL FC+++GI++KQYLPHY+T++EWK HFG  WE F  RK  +DP  IL+ GQ 
Sbjct  460   LKQNDKILDFCEKAGIQVKQYLPHYTTKEEWKAHFGASWEIFARRKAIYDPLAILTPGQR  519

Query  222   IF  217
             IF
Sbjct  520   IF  521



>ref|XP_011088157.1| PREDICTED: cytokinin dehydrogenase 6-like [Sesamum indicum]
Length=526

 Score =   516 bits (1330),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 249/432 (58%), Positives = 323/432 (75%), Gaps = 14/432 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM---SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQA    G+V+ M   SG    V +     KF Y DV  GELWI++L   L++GLA
Sbjct  105   HSLQGQAQAPQGIVINMESLSGQEMQVHR----GKFPYVDVPAGELWINILHECLKYGLA  160

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE V CSEE+N++LFH
Sbjct  161   PKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVVVCSEEKNADLFH  220

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             AVLGGLGQFG+ITRARI+LE AP+ V+WIRVLYSDF  F +DQE+LIS         FDY
Sbjct  221   AVLGGLGQFGIITRARISLEPAPKMVKWIRVLYSDFSTFARDQEHLISAE-----NTFDY  275

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             +EG VIV++ GLINNWR+SF +P +P + S   SDG  L+CLE+TKN++   A  +++EI
Sbjct  276   IEGLVIVNKTGLINNWRASF-NPEDPEQASQFVSDGRTLFCLELTKNFNPDEATKINKEI  334

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
               LL +L +IPS++F T++ YV+FLDRVH AELKLRSKGLW++PHPWLNL VP+S+I  F
Sbjct  335   KSLLSQLSYIPSTLFVTEVSYVEFLDRVHAAELKLRSKGLWELPHPWLNLLVPRSKIHSF  394

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
               GVF  IL +  +GP+L+YP+NK+KWD RTS VTPEE++FYLVA L  AV +  E+  L
Sbjct  395   AEGVFGSILTDTNNGPVLVYPVNKSKWDNRTSFVTPEEDIFYLVAFLPHAVPSSTENNGL  454

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             ++L S N+ IL FC+ + + +KQYLP+Y+TQ+EW+ H+G +WE    RK  +DP  IL+ 
Sbjct  455   QHLLSINKRILNFCEAAHLGVKQYLPYYTTQEEWRSHYGPRWEVLVQRKSAYDPLAILAP  514

Query  231   GQLIFTPSFNAM  196
             GQ IF  + + +
Sbjct  515   GQRIFQKAISVL  526



>ref|XP_010670377.1| PREDICTED: cytokinin dehydrogenase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=527

 Score =   516 bits (1329),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 251/429 (59%), Positives = 319/429 (74%), Gaps = 9/429 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFM--YADVWGGELWIDVLKSTLEHGLAP  1306
             HS++GQA    G+V+ M G+  A P  +V    +  Y DV GGELWI++L   L++GL P
Sbjct  103   HSLHGQAQAHQGIVIDM-GSLRAYPIKVVQTGVVHPYVDVSGGELWINILHKCLKYGLTP  161

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYL+LSVGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGES+ CS++QN+ELFH+
Sbjct  162   KSWTDYLHLSVGGTLSNAGISGQAFLHGPQISNVHQLEVVTGKGESLNCSKKQNAELFHS  221

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFG+ITRARI+LE AP+ V+WIRVLYSDF  F +DQE LIS         FDY+
Sbjct  222   VLGGLGQFGIITRARISLESAPKTVKWIRVLYSDFDTFVRDQEQLIS----SEQATFDYI  277

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EGFVI++  GL+NNWR+SF SP++PV+ S   SDG  L+CLE+ K +     +  DQEI 
Sbjct  278   EGFVIINRTGLLNNWRTSF-SPQDPVQASQFSSDGKTLFCLELAKYFKHEEVNLADQEIK  336

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
             +LL +L +I S++F  ++ Y+DFLDRVH +E+KLRSKGLW+VPHPWLNL VPKS I +F 
Sbjct  337   MLLSQLSYISSTLFIAEVSYIDFLDRVHVSEIKLRSKGLWEVPHPWLNLLVPKSSIHKFA  396

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
               VF  IL + ++GPILIYP+NK+KWD +TS V PEE++FYLV  L SAV +   S  L 
Sbjct  397   ERVFGNILKDTSNGPILIYPVNKSKWDNKTSVVIPEEDIFYLVGFLSSAVPSSTGSDGLD  456

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
             ++ SQN+ IL FC+ S + +KQYL HYSTQ+EWK HFG KWE F+ RK  +DP  IL+ G
Sbjct  457   HILSQNKKILDFCESSNLGVKQYLAHYSTQEEWKSHFGPKWEVFKQRKSTYDPLGILAPG  516

Query  228   QLIFTPSFN  202
               IF  S +
Sbjct  517   HRIFQKSIS  525



>ref|XP_006482960.1| PREDICTED: cytokinin dehydrogenase 6-like [Citrus sinensis]
Length=530

 Score =   516 bits (1329),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 323/423 (76%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M       PK  V +E   Y DV GGELWI++L  ++++GLAPK
Sbjct  109   HSLQGQAQAHQGVVINMESLQG--PKMQVYAENSFYVDVSGGELWINILHESVKYGLAPK  166

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE + CSE+QNSELFH+V
Sbjct  167   SWTDYLHLTVGGTLSNAGISGQAFQHGPQISNVHQLEVVTGKGEIINCSEKQNSELFHSV  226

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP  V+WIRVLYSDF  F +DQEYLIS       + FDY+E
Sbjct  227   LGGLGQFGIITRARISLEPAPDMVKWIRVLYSDFVTFARDQEYLIS-----AEKTFDYIE  281

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVIV+  GL+NNWRSSF  P++PV+ S  KS G  L+CLE+ K  ++   D V+QE++ 
Sbjct  282   GFVIVNRTGLLNNWRSSF-DPQDPVQASQFKSGGQTLFCLELAKYINKDEKDLVNQEVES  340

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
              L  L +IPS++F +++ Y++FLDRVH +E+KL+SKGLW+VPHPWLNLF+P+S+I +F +
Sbjct  341   SLSVLNYIPSTLFLSEVSYIEFLDRVHVSEVKLQSKGLWEVPHPWLNLFIPQSKIHDFAK  400

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL   ++GPILIYP+NK+KWD RTS V PEE+VFYLVA L SAV +   +  L++
Sbjct  401   EVFGNILAETSNGPILIYPLNKSKWDNRTSVVIPEEDVFYLVAFLSSAVPSSKGTDGLEH  460

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL++C+ + + +KQYLPHY+TQ++W+ HFG +WE F  RK  +DP  IL+ GQ
Sbjct  461   ILTQNKRILEYCETAHLGVKQYLPHYTTQEQWRSHFGPQWEVFVQRKSTYDPLAILAPGQ  520

Query  225   LIF  217
              IF
Sbjct  521   RIF  523



>ref|XP_009610079.1| PREDICTED: cytokinin dehydrogenase 3 [Nicotiana tomentosiformis]
Length=534

 Score =   516 bits (1330),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 252/440 (57%), Positives = 319/440 (73%), Gaps = 30/440 (7%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG-----------------AAAAVPKPLVSEKFMYADVWGGEL  1351
             HSI GQAMT  GVV++M+                      +     S    YADV G +L
Sbjct  105   HSIRGQAMTQNGVVVEMNSLNNNNNNNNNNNNNNNNGNGGIRVSWDSSLGFYADVGGEQL  164

Query  1350  WIDVLKSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGE  1171
             WIDVL++TLEHGL+P +WTDYLYL+VGGTLSNAGISGQ F HGPQISNVHE+D++TGKGE
Sbjct  165   WIDVLRATLEHGLSPVTWTDYLYLTVGGTLSNAGISGQTFRHGPQISNVHEMDIITGKGE  224

Query  1170  SVTCSEEQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYL  991
              VTCS+ +NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY+DF  FTKDQE+L
Sbjct  225   FVTCSKHKNSELFFAVLGGLGQFGIITRARIVLDKAPTRVKWVRMLYADFSKFTKDQEHL  284

Query  990   ISLHGQPPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKN  811
             IS+ G       DYVEG +++++  +NNWRSSFFSP N  K +S+ S  G++YCLE+ K 
Sbjct  285   ISIDG------LDYVEGSLMMEQRSLNNWRSSFFSPSNQTKIASLLSQNGIIYCLEMVKY  338

Query  810   YDQSTADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPW  631
             YD  TA TVD+E+  L+K L F+P  +F  D+ +VDFL+RV + EL+L+SKG WDVPHPW
Sbjct  339   YDDQTASTVDEELKKLVKGLNFLPGFIFKKDVTFVDFLNRVRRGELELKSKGQWDVPHPW  398

Query  630   LNLFVPKSRIDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVA  457
             LNLFVPKS I +F+ GVF  I+   NKT+GPIL+YP ++ KWD+R SAV PEEE FY V 
Sbjct  399   LNLFVPKSNIMDFNAGVFVDIILRQNKTTGPILVYPTSRKKWDDRMSAVIPEEETFYCVG  458

Query  456   LLRSAVENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERF  277
             LL S+  N       K+L  QN +IL +C ++G+++KQYLPHY T+++W +HFG+KW  F
Sbjct  459   LLHSSGFN-----DWKSLDDQNEEILNYCDKAGLKIKQYLPHYKTKEDWIKHFGKKWNIF  513

Query  276   QHRKLQFDPKHILSTGQLIF  217
             Q RK QFDPK ILS GQ IF
Sbjct  514   QQRKSQFDPKMILSPGQRIF  533



>ref|XP_002513118.1| Cytokinin dehydrogenase, putative [Ricinus communis]
 gb|EEF49621.1| Cytokinin dehydrogenase, putative [Ricinus communis]
Length=530

 Score =   516 bits (1329),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 321/423 (76%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS++GQA    GVV+ M       PK  V + K  Y DV GGELWI++L+ +L+HGLAPK
Sbjct  109   HSLHGQAQAHRGVVINMESLQG--PKMQVHAGKHPYVDVSGGELWINILRESLKHGLAPK  166

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAG+SGQAF HGPQISNVH+L+V+TG GE V CSE+QN +LFH V
Sbjct  167   SWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVHQLEVITGTGEVVNCSEKQNGDLFHGV  226

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP  V+WIRVLYSDF  F +DQE LIS         FDY+E
Sbjct  227   LGGLGQFGIITRARISLEPAPDMVKWIRVLYSDFNTFARDQESLIS-----AENTFDYIE  281

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF +P++P++ S  +SDG  L+CLE+ K + +   D +++EI  
Sbjct  282   GFVIINRTGLLNNWRSSF-NPQDPLQASQFESDGRTLFCLELAKYFKKDKTDKLNEEIMN  340

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L++IPS++F +++PY++FLDRVH +E+KLRSKGLW+VPHPWLNL VPKS+I  F  
Sbjct  341   LLSQLRYIPSTLFLSEVPYIEFLDRVHVSEVKLRSKGLWEVPHPWLNLLVPKSKIHNFAE  400

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GPILIYP+NK+KWD RTS V PEE++FYLVA L SAV +   +  LK+
Sbjct  401   EVFGNILTDTSNGPILIYPVNKSKWDNRTSVVIPEEDIFYLVAFLSSAVPSSTGTDGLKH  460

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QNR IL+FC  + +  KQYLPHY++Q+EWK HFG +W+ F  RK  +DP  IL+ GQ
Sbjct  461   ILTQNRRILEFCDTARLGFKQYLPHYTSQEEWKAHFGPQWKVFAQRKSAYDPLAILAPGQ  520

Query  225   LIF  217
              IF
Sbjct  521   RIF  523



>ref|XP_002270841.2| PREDICTED: cytokinin dehydrogenase 9 [Vitis vinifera]
Length=546

 Score =   516 bits (1330),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/422 (58%), Positives = 321/422 (76%), Gaps = 9/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+ M  +       + +  F Y DV GGELWI++L  +L++GLAPKS
Sbjct  126   HSLQGQAQAHQGIVINME-SLQGTEMQVYTGNFPYVDVSGGELWINILHESLKYGLAPKS  184

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNVH L+VVTGKGE + CS+ QN +LFH+VL
Sbjct  185   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHWLEVVTGKGEVINCSKNQNGDLFHSVL  244

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ V+WIRVLYSDF  F +DQEYLIS         FDY+EG
Sbjct  245   GGLGQFGIITRARISLEPAPKMVKWIRVLYSDFSTFARDQEYLIS-----AENTFDYIEG  299

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +P++PV+ S  +SDG +L+CLE+TKN+     + ++QE++ L
Sbjct  300   FVIINRTGLLNNWRSSF-NPQDPVQASQFESDGKILFCLELTKNFKVDNTN-INQEVESL  357

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F +++PY+DFLDRVH +E+KL SKGLW+VPHPWLNL VPKS+I  F   
Sbjct  358   LSQLSYIPSTLFLSEVPYIDFLDRVHVSEVKLHSKGLWEVPHPWLNLLVPKSKIHNFAEE  417

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+NK+KWD RTSAV PEE++FYLVA L SAV +   +  L+ +
Sbjct  418   VFGKILKDTSNGPILIYPVNKSKWDNRTSAVIPEEDIFYLVAFLSSAVPSSTGTDGLEYI  477

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              S+N+ IL FCK + + +KQYLPHY+TQ+EW+ HFG +WE F  RK  +DP  IL+ G  
Sbjct  478   LSRNKRILDFCKTARLGVKQYLPHYTTQEEWRTHFGPRWEAFAQRKSAYDPLAILAPGHR  537

Query  222   IF  217
             IF
Sbjct  538   IF  539



>emb|CBI28611.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   518 bits (1335),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 249/429 (58%), Positives = 324/429 (76%), Gaps = 12/429 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+ M  +       + +  F Y DV GGELWI++L  +L++GLAPKS
Sbjct  139   HSLQGQAQAHQGIVINME-SLQGTEMQVYTGNFPYVDVSGGELWINILHESLKYGLAPKS  197

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNVH L+VVTGKGE + CS+ QN +LFH+VL
Sbjct  198   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHWLEVVTGKGEVINCSKNQNGDLFHSVL  257

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ V+WIRVLYSDF  F +DQEYLIS         FDY+EG
Sbjct  258   GGLGQFGIITRARISLEPAPKMVKWIRVLYSDFSTFARDQEYLIS-----AENTFDYIEG  312

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +P++PV+ S  +SDG +L+CLE+TKN+     + ++QE++ L
Sbjct  313   FVIINRTGLLNNWRSSF-NPQDPVQASQFESDGKILFCLELTKNFKVDNTN-INQEVESL  370

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F +++PY+DFLDRVH +E+KL SKGLW+VPHPWLNL VPKS+I  F   
Sbjct  371   LSQLSYIPSTLFLSEVPYIDFLDRVHVSEVKLHSKGLWEVPHPWLNLLVPKSKIHNFAEE  430

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+NK+KWD RTSAV PEE++FYLVA L SAV +   +  L+ +
Sbjct  431   VFGKILKDTSNGPILIYPVNKSKWDNRTSAVIPEEDIFYLVAFLSSAVPSSTGTDGLEYI  490

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              S+N+ IL FCK + + +KQYLPHY+TQ+EW+ HFG +WE F  RK  +DP  IL+ G  
Sbjct  491   LSRNKRILDFCKTARLGVKQYLPHYTTQEEWRTHFGPRWEAFAQRKSAYDPLAILAPGHR  550

Query  222   IF---TPSF  205
             IF   TP F
Sbjct  551   IFRKATPFF  559



>ref|XP_011042115.1| PREDICTED: cytokinin dehydrogenase 6-like [Populus euphratica]
Length=517

 Score =   515 bits (1326),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 246/423 (58%), Positives = 319/423 (75%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M       PK  V +    Y D  GGELWID+L+  LE+GLAPK
Sbjct  96    HSLQGQAQAHQGVVINMESLQG--PKMHVYTGNNPYVDASGGELWIDILRECLEYGLAPK  153

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAG+SGQAF HGPQISNVH+++VVTGKGE + CSE+QNS+LFH+V
Sbjct  154   SWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVHQMEVVTGKGEVLNCSEKQNSDLFHSV  213

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP  V+WIRVLYSDF  F  DQE LI          FDY+E
Sbjct  214   LGGLGQFGIITRARISLEPAPDMVKWIRVLYSDFTTFATDQERLIG-----AESTFDYIE  268

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++   L+NNWRSSF  P++PV+ S  +SDG  LYCLE+ K +++  AD +++E+  
Sbjct  269   GFVIINRTSLLNNWRSSF-DPQDPVQASQFQSDGRTLYCLELAKYFNRDRADALNEEVGN  327

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L++I S++F T++PY++FLDRVH +E+KLRSKGLW+VPHPWLNL +PKS+I+EF  
Sbjct  328   LLSQLRYITSTLFQTEVPYIEFLDRVHVSEVKLRSKGLWEVPHPWLNLLIPKSKINEFAD  387

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GP+LIYP+NK+KWD RTSAV PE  +FYLVA L SAV +   +  L++
Sbjct  388   EVFGNILTDTSNGPVLIYPVNKSKWDNRTSAVIPEANIFYLVAFLTSAVPSSTGTDGLEH  447

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL+FC+ + + MKQYLPHY+T +EWK HFG +WE F  RK  +DP  IL+ GQ
Sbjct  448   ILTQNKRILEFCEIARLGMKQYLPHYTTHEEWKAHFGPRWEVFSQRKSTYDPLAILAPGQ  507

Query  225   LIF  217
              IF
Sbjct  508   RIF  510



>ref|XP_010262099.1| PREDICTED: cytokinin dehydrogenase 3-like [Nelumbo nucifera]
Length=529

 Score =   515 bits (1327),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 258/434 (59%), Positives = 324/434 (75%), Gaps = 20/434 (5%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-------SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLE  1321
             HS+ GQAM   GVV+ M       +G    V +   S    YADV G +LWIDVL +TLE
Sbjct  105   HSVRGQAMAHNGVVVDMRSLNNDSNGNRINVARS--SSLGWYADVGGEQLWIDVLLATLE  162

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             HGLAP+SWTDYLYL+VGGTLSNAGISGQ+F HGPQISNV E+DV+TG+GE V CS   NS
Sbjct  163   HGLAPRSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVFEMDVITGRGELVRCSRNTNS  222

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELF+AVLGGLGQFG+ITRARIALE AP +VRW+R+LY DF AFT+DQE+LIS+HG    +
Sbjct  223   ELFYAVLGGLGQFGIITRARIALELAPTKVRWVRMLYHDFSAFTRDQEHLISIHGG--IK  280

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
               DYVEG +++ +   NNWRSSFFS  +  + +S+ +  G+LY LE+ K YD  TAD VD
Sbjct  281   GLDYVEGSLVMPQSPANNWRSSFFSSADHSRIASLANQYGILYSLEVAKYYDDLTADGVD  340

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
              E++ LLK L FIP  +F  D+ YVDFL+RV   ELKL+S+GLWDVPHPWLNLFVP+SRI
Sbjct  341   GELESLLKGLSFIPGLIFAKDVSYVDFLNRVRSGELKLQSQGLWDVPHPWLNLFVPRSRI  400

Query  600   DEFDRGVFKGILG--NKTSGPILIYPMNKNKWDERTSAVTPE--EEVFYLVALLRSAVEN  433
              +FD GVF+GIL   NKTSGPIL+YPMN++KWD+R SAV P+  +++FY V LL+S+  +
Sbjct  401   FDFDSGVFRGILKKQNKTSGPILVYPMNRSKWDDRMSAVIPDDVDDIFYSVGLLQSSGMH  460

Query  432   GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFD  253
               E      L++QN++IL FC+++GI++KQYLPHY ++ EW  H G KWE F+  K +FD
Sbjct  461   DWEY-----LENQNKEILMFCEKAGIKVKQYLPHYRSKAEWVNHLGPKWETFKAWKNKFD  515

Query  252   PKHILSTGQLIFTP  211
             PK ILS GQ IFTP
Sbjct  516   PKAILSPGQRIFTP  529



>ref|XP_002284560.2| PREDICTED: cytokinin dehydrogenase 1-like [Vitis vinifera]
 emb|CBI33379.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   516 bits (1328),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 252/434 (58%), Positives = 326/434 (75%), Gaps = 13/434 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M    A  PK +V + K  YADV GGELWI++L  +L+HGLAPK
Sbjct  123   HSVQGQAQAHRGVVVNMESLQA--PKTIVHTGKMPYADVSGGELWINILHESLKHGLAPK  180

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKG+ +TCSE QN++LF+ V
Sbjct  181   SWTDYLHLTVGGTLSNAGISGQAFRHGPQINNVYQLEVVTGKGDIITCSETQNADLFYGV  240

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP+ V+WIRVLYS+F  F+KDQE+LIS         FDY+E
Sbjct  241   LGGLGQFGIITRARISLEPAPKMVKWIRVLYSEFSIFSKDQEHLISF-----KNSFDYIE  295

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+N WRSSF +P  P++ S   SDG  LYCLE+ K ++      V+Q I+ 
Sbjct  296   GFVIINRTGLLNTWRSSF-NPGEPLQASQFNSDGRTLYCLEMAKYFNPDETHIVNQVIES  354

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L +IPS++F +++PYVDFLDRVH +E+KLR+KGLW+VPHPWLNL +PKSRI +F +
Sbjct  355   LLSELSYIPSTLFLSEVPYVDFLDRVHVSEIKLRAKGLWEVPHPWLNLLIPKSRIHDFAK  414

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL +  +GPILIYP+NK+KW+ RTS VTP+E++FYLVA L SAV +   +  L++
Sbjct  415   EVFGNILRDTGNGPILIYPVNKSKWNNRTSLVTPQEDIFYLVAFLSSAVPSSTGTDGLEH  474

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN  IL FC+ + + MKQYLPHYSTQ +W+ HFG KWE F  RK  +DP  IL+ GQ
Sbjct  475   ILTQNERILDFCEGARLGMKQYLPHYSTQDKWQAHFGPKWEVFVKRKSTYDPLAILAPGQ  534

Query  225   LIFTPSFNAMTASW  184
              IF     A + SW
Sbjct  535   RIFQ---KATSFSW  545



>ref|XP_006421171.1| hypothetical protein CICLE_v10006491mg [Citrus clementina]
 gb|ESR34411.1| hypothetical protein CICLE_v10006491mg [Citrus clementina]
Length=545

 Score =   514 bits (1325),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 246/422 (58%), Positives = 322/422 (76%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M      V K    E   Y DV GGELWI++L  TL+HGLAPKS
Sbjct  124   HSLQGQAQAHQGVVINMPSLQKPVMKVHTGE-LPYVDVSGGELWINILHETLKHGLAPKS  182

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKG+ +TCSE+QN++LFH VL
Sbjct  183   WTDYLHLTVGGTLSNAGISGQAFLHGPQINNVYQLEVVTGKGDVLTCSEQQNADLFHGVL  242

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ VRWIRVLYS+F  FTKDQE+LIS         FDY+EG
Sbjct  243   GGLGQFGIITRARISLEPAPKMVRWIRVLYSEFSIFTKDQEHLIS-----SESSFDYIEG  297

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +PR+P++ S   SDG VLYCLE+ K+++   A  +D++ + L
Sbjct  298   FVIINRTGLLNNWRSSF-NPRDPLQASKFNSDGKVLYCLEMAKHFNPDEAGIMDKKTESL  356

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL FIPS++F +D+ YVDFLDRVH +E+KLR KGLW+VPHPWLNL +PKS+I +F + 
Sbjct  357   LSKLSFIPSTLFQSDVSYVDFLDRVHVSEIKLREKGLWEVPHPWLNLLIPKSKISDFAQQ  416

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GP+LIYP+NK+KW+ +TS VTP+E++FYLVA L SA+ +   +  L+++
Sbjct  417   VFGEILKDNSNGPVLIYPVNKSKWNRKTSFVTPDEDIFYLVAFLSSALPSSRGTDGLEHI  476

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL     + + +KQYLPHYSTQ+EW+ HFG +W+ F  RK  +DP  IL+ GQ 
Sbjct  477   NNQNQRILDVSTRANLGIKQYLPHYSTQKEWQAHFGPQWKLFVQRKYAYDPLAILAPGQR  536

Query  222   IF  217
             IF
Sbjct  537   IF  538



>ref|XP_007008757.1| Cytokinin oxidase/dehydrogenase 6 isoform 1 [Theobroma cacao]
 gb|EOY17567.1| Cytokinin oxidase/dehydrogenase 6 isoform 1 [Theobroma cacao]
Length=530

 Score =   514 bits (1323),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 323/423 (76%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M       PK  V + KF Y DV GGELWI++L+ +L HGLAPK
Sbjct  109   HSLQGQAQAHRGVVINMESLQG--PKMQVHAGKFPYVDVSGGELWINILRESLRHGLAPK  166

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE V CSE+QNS+LF++V
Sbjct  167   SWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVVNCSEKQNSDLFYSV  226

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP+ V+WIRVLY+DF  F +DQE LIS  G+     FDY+E
Sbjct  227   LGGLGQFGIITRARISLEPAPEMVKWIRVLYTDFATFARDQEKLIS--GE---STFDYIE  281

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF +P++PV+ S  KSDG  L+CLE+ K ++      V+QEI  
Sbjct  282   GFVIINRTGLLNNWRSSF-NPQDPVQASQFKSDGRTLFCLELAKYFNPEEMAVVNQEIKN  340

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
              L +L  IPS++F +++PY++FLDRVH +E+KLRSKGLW+VPHPWLNL VP+S++  F +
Sbjct  341   SLSQLNHIPSTLFMSEVPYIEFLDRVHISEIKLRSKGLWEVPHPWLNLLVPRSKVHSFAQ  400

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GPILIYP+NK+KWD RTSAV PEE+VFYLVA L SAV +   +  L +
Sbjct  401   EVFGNILTDTSNGPILIYPVNKSKWDNRTSAVIPEEDVFYLVAFLSSAVPSSTGTDGLDH  460

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             +  QN+ IL+FC+ + + +KQYLPHYSTQ EW+ H+G +WE F  RK  +DP  +L+ GQ
Sbjct  461   ILIQNKRILEFCEIARLGVKQYLPHYSTQGEWQAHYGPQWELFVQRKSTYDPLALLAPGQ  520

Query  225   LIF  217
              IF
Sbjct  521   RIF  523



>ref|XP_010242231.1| PREDICTED: cytokinin dehydrogenase 3 isoform X1 [Nelumbo nucifera]
Length=529

 Score =   513 bits (1321),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 252/433 (58%), Positives = 322/433 (74%), Gaps = 19/433 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM--------SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS+ GQA    GVV+ M        +G+   V +   S    YADV   +LW+DVL +TL
Sbjct  104   HSVRGQATAHKGVVVDMRSLDNDHNNGSRIIVDRSSPSVNNWYADVGCEQLWVDVLHATL  163

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             EHGLAP+SWTDYLYL+VGGTLSNAGISGQ+F HGPQISNV+E+DVVTG+GE VTCS + N
Sbjct  164   EHGLAPRSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVYEMDVVTGRGELVTCSPQTN  223

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISL-HGQPP  967
             SELF+AVLGGLGQFG+ITRARIALE AP +VRW+R+LY DF AFT+DQE+LIS  +G   
Sbjct  224   SELFYAVLGGLGQFGIITRARIALEPAPTKVRWVRLLYHDFIAFTRDQEHLISFNNGSEG  283

Query  966   AQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADT  787
              +  DYVEG +++++   NNWRSSFFSP +  +  S+ ++ G+LY LE+ K YD    D 
Sbjct  284   IKGLDYVEGSLVMNQSPANNWRSSFFSPDDHSRIISLANEHGILYSLEVAKYYD----DE  339

Query  786   VDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKS  607
             VD E++ LLK L FIP  +F  D+ Y+DFL+RV   EL+L+S+GLWDVPHPWLNLFVPKS
Sbjct  340   VDGELEALLKGLSFIPDLIFAKDVSYIDFLNRVRSGELELQSQGLWDVPHPWLNLFVPKS  399

Query  606   RIDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVEN  433
             RI +FD G FKGIL   NK SGPIL+YPMN+NKWD+R SAV PEE++FY + LL  +   
Sbjct  400   RILDFDSGAFKGILRQNNKISGPILVYPMNRNKWDDRMSAVIPEEDIFYSIGLLLQS---  456

Query  432   GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFD  253
              + +   ++L+ QN +IL+FC+++GI++KQYLP Y T+ EW  HFG KW+ F+ RK +FD
Sbjct  457   -SGTHDWEHLEEQNTEILRFCEKAGIKIKQYLPRYQTKAEWVNHFGPKWDTFKQRKTKFD  515

Query  252   PKHILSTGQLIFT  214
             PK ILS GQ +FT
Sbjct  516   PKAILSPGQGVFT  528



>ref|NP_001243813.1| cytokinin dehydrogenase 3-like [Glycine max]
 gb|AFB18642.1| cytokinin dehydrogenase 3 [Glycine max]
Length=535

 Score =   513 bits (1321),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 250/431 (58%), Positives = 327/431 (76%), Gaps = 18/431 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-------GAAAAVPK-PLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS +GQAM   G+V+ M+       G A +V K PL+     YADV G +LWIDVL +TL
Sbjct  105   HSTHGQAMARDGIVVDMASLRKQRNGVAISVSKDPLMGH---YADVGGEQLWIDVLHATL  161

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             E+GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQISNVHE+DV+TGKGE VTCS ++N
Sbjct  162   EYGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEMDVITGKGEFVTCSSQKN  221

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
              ELFHAVLGGLGQFGVI RARIALE AP+RV+W+R+LYSDF AFTKDQE LIS++G+   
Sbjct  222   LELFHAVLGGLGQFGVIARARIALEPAPKRVKWVRLLYSDFSAFTKDQERLISINGRKQK  281

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
                D++EG +++++G INNWRSSFF   +  + +S+ ++  +LYCLE+ K YD+ T   V
Sbjct  282   NALDFLEGMLLMNQGPINNWRSSFFPLSDHPRIASLITEHSILYCLEVAKYYDEQTELNV  341

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             D+EI+VLL+ L +IP   +  ++ YV+FL+RV   ELKL+S+GLW+VPHPWLNLF+PKS+
Sbjct  342   DKEIEVLLQGLAYIPGFNYEKNVSYVEFLNRVRSGELKLQSQGLWEVPHPWLNLFIPKSQ  401

Query  603   IDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             I +F+ GVFK I+   N +SGP+L+YPMN+NKWD+R SA  P+E+VFY V  L S+    
Sbjct  402   ILDFNSGVFKDIVLKRNISSGPVLVYPMNRNKWDDRMSASIPDEDVFYTVGFLHSS----  457

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
                 T K   +QNR+IL+FC+++GI +KQYLP++STQ++W  HFG KW +F  RK QFDP
Sbjct  458   -GFDTWKAYDAQNREILEFCRDAGIMVKQYLPNHSTQEDWTNHFGAKWMKFLERKHQFDP  516

Query  249   KHILSTGQLIF  217
             + ILS GQ IF
Sbjct  517   RMILSPGQKIF  527



>ref|XP_002514119.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF48073.1| gulonolactone oxidase, putative [Ricinus communis]
Length=529

 Score =   513 bits (1320),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 244/433 (56%), Positives = 321/433 (74%), Gaps = 20/433 (5%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM----------SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKS  1330
             HSINGQAM   GVV+ M          +G       PL+     YADV G +LWIDVL +
Sbjct  104   HSINGQAMAPDGVVVDMMHLRSIIEKTNGGVTVSKDPLLG---FYADVGGEQLWIDVLNA  160

Query  1329  TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEE  1150
             T+EHGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQISNV+E+DVVTG+GE VTCS  
Sbjct  161   TIEHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVYEMDVVTGRGELVTCSGH  220

Query  1149  QNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQP  970
             +NS+LF+AVLGGLGQFG+ITRARIALE AP++V+W+R+LYSDF  FTKDQE LIS++G+ 
Sbjct  221   RNSDLFYAVLGGLGQFGIITRARIALEPAPKKVKWVRMLYSDFSEFTKDQERLISINGRK  280

Query  969   PAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTAD  790
              +   DYVEG +++++G  NNWRSSFF   +  +  S+ +  G++YCLE+ K YD +T  
Sbjct  281   QSNALDYVEGSLLMNQGPPNNWRSSFFPSSDIPRIMSLVTQHGIIYCLEVAKYYDDATQH  340

Query  789   TVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPK  610
             ++  E+ ++ K L F    +F  D+PYVDFLDRV   E+KL+S+GLWDVPHPWLNLF+PK
Sbjct  341   SMSMELQLMFKGLSFADGFMFEKDVPYVDFLDRVRSGEIKLQSQGLWDVPHPWLNLFLPK  400

Query  609   SRIDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVE  436
             S I +F+ GVF+ I+   N T+GP+L+YPMN+NKWD+RTSAV P+E+VFY V  L S+  
Sbjct  401   SSISDFNSGVFRDIVLKRNVTTGPVLVYPMNRNKWDDRTSAVIPDEDVFYTVGFLHSS--  458

Query  435   NGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQF  256
               ++ QT  +   QN+D+L +C ++GI++KQY PHY+T++EW +HFG KW  F  RK +F
Sbjct  459   GFDDWQTYDD---QNKDLLNYCDKAGIKVKQYFPHYTTKEEWTDHFGSKWRTFVERKAKF  515

Query  255   DPKHILSTGQLIF  217
             DPK +LS GQ IF
Sbjct  516   DPKRMLSPGQRIF  528



>ref|XP_007219000.1| hypothetical protein PRUPE_ppa004120mg [Prunus persica]
 gb|EMJ20199.1| hypothetical protein PRUPE_ppa004120mg [Prunus persica]
Length=529

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 244/422 (58%), Positives = 319/422 (76%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA T  GVV+ M        + + +    Y DV GGELWI++L  +L++GLAPKS
Sbjct  108   HSLQGQAQTQRGVVINMESLEGPEIQ-VYTGSSPYVDVSGGELWINILHESLKYGLAPKS  166

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L++GGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE + CSEEQN +LFH+VL
Sbjct  167   WTDYLHLTIGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVINCSEEQNEDLFHSVL  226

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP RV+WIRVLYSDF AFT+DQE+LIS         FDYVEG
Sbjct  227   GGLGQFGIITRARISLEAAPARVKWIRVLYSDFAAFTQDQEHLIS-----SENTFDYVEG  281

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF S ++PV+ S  KSDG  L+CLE+ K ++    D +++E++  
Sbjct  282   FVIINRTGLLNNWRSSFNS-KDPVQASQFKSDGRTLFCLELAKYFNLDKTDLINEEVENF  340

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +I S++F +++ Y+DFLDRVH +E+KLRSK LWDVPHPWLNL +PKS+I  F   
Sbjct  341   LSRLSYIRSTLFMSEVAYIDFLDRVHVSEIKLRSKDLWDVPHPWLNLLIPKSKIHTFAEE  400

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL   ++GPILIYP+N++KWD RTS V PEE +FYLVA L SAV +   +  L+++
Sbjct  401   VFGSILTATSNGPILIYPVNRSKWDNRTSVVIPEEHIFYLVAFLTSAVPSSTGTDGLEHI  460

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL+FC+ + + +KQYLPHY+T++EW+ HFG +WE F  RK  +DP  IL+ GQ 
Sbjct  461   LTQNKRILEFCETAHLGVKQYLPHYTTKKEWQAHFGPRWEAFVQRKSAYDPLAILAPGQR  520

Query  222   IF  217
             IF
Sbjct  521   IF  522



>gb|KDP40485.1| hypothetical protein JCGZ_24484 [Jatropha curcas]
Length=503

 Score =   511 bits (1315),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 244/423 (58%), Positives = 323/423 (76%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M       PK  + + K+ Y DV GGELWI++L  ++++GLAPK
Sbjct  82    HSLQGQAQAHQGVVINMESLQG--PKMQIHAGKYPYIDVSGGELWINILHESVKYGLAPK  139

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQISNV++L+VVTGKGE V CSE+QN +LFH V
Sbjct  140   SWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVYQLEVVTGKGEVVNCSEKQNGDLFHGV  199

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRA+I+LE AP +V+WIRVLYSDF  F  DQE+LIS         FDY+E
Sbjct  200   LGGLGQFGIITRAQISLEPAPDKVKWIRVLYSDFATFASDQEHLIS-----AEITFDYIE  254

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF +P++PV+ S  +SDG  L+CLE+ K ++    D +++E+ +
Sbjct  255   GFVIINRTGLLNNWRSSF-NPQDPVQASQFESDGRTLFCLELAKYFNTDKTDVMNEEVKL  313

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L++IPS++F +++PYV+FLDRVH +E+KLRSKGLW+VPHPWLNL VPKS+I  F  
Sbjct  314   LLSQLRYIPSTLFLSEVPYVEFLDRVHVSEVKLRSKGLWEVPHPWLNLLVPKSKIHNFAE  373

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GPILIYP+NK+KWD RTSAV PEE++FYLVA L SAV +   +  L++
Sbjct  374   EVFGNILTDTSNGPILIYPVNKSKWDNRTSAVIPEEDIFYLVAFLSSAVPSSTGTDGLEH  433

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QNR IL+FC  + + +KQYLPHY+  ++W+ HFG +WE F  RK  +DP  IL+ GQ
Sbjct  434   ILTQNRRILEFCGTAHLGVKQYLPHYTKHEDWQAHFGPQWEIFVRRKSTYDPLAILAPGQ  493

Query  225   LIF  217
              IF
Sbjct  494   RIF  496



>ref|XP_006292397.1| hypothetical protein CARUB_v10018610mg [Capsella rubella]
 gb|EOA25295.1| hypothetical protein CARUB_v10018610mg [Capsella rubella]
Length=541

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 249/430 (58%), Positives = 318/430 (74%), Gaps = 24/430 (6%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGA--------AAAVPKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS+ GQA T  G+V++M           +  VP P       Y DV GGELWID+L  TL
Sbjct  109   HSLQGQAQTRHGIVIRMESPHPKKLQVHSVDVPAP-------YVDVCGGELWIDILHETL  161

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             ++GLAPKSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L++VTGKGE + CSE QN
Sbjct  162   KYGLAPKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGEILNCSERQN  221

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             S+LFHAVLGGLGQFG+ITRARIALE AP  V+WIRVLY DF AFTKDQE LI+       
Sbjct  222   SDLFHAVLGGLGQFGIITRARIALEAAPTMVKWIRVLYQDFSAFTKDQERLIA-----AD  276

Query  963   QKFDYVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADT  787
              K DY+EGFVI++  GL+NNWR S F+P +P K S  KSDG  LYCLE+ K +     D 
Sbjct  277   NKLDYIEGFVIINRTGLLNNWRLS-FTPEDPFKASQFKSDGRTLYCLEVAKYFKLDNKDE  335

Query  786   VDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKS  607
             + Q ++  L +L +I S++FT+++ Y  FLDRVH +E+KLRSKG W+VPHPWLNL VP+S
Sbjct  336   IIQGVNETLSELSYISSTLFTSEVTYEAFLDRVHVSEVKLRSKGQWEVPHPWLNLLVPRS  395

Query  606   RIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGN  427
              ++EF +GVF  IL + ++GP+++YP+NK KWD RTSAVTPEEEVFYLVA+L SAV    
Sbjct  396   TVNEFAKGVFGNILTDTSNGPVIVYPVNKAKWDNRTSAVTPEEEVFYLVAILTSAVPGNK  455

Query  426   ESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPK  247
             +   ++++  +N+ IL+F + +GI +KQYLPHY+T++EW+ HFG KWE F  RK ++DP 
Sbjct  456   DG--VEHILKRNQRILEFSEAAGIGLKQYLPHYTTREEWRSHFGSKWEEFVRRKSRYDPL  513

Query  246   HILSTGQLIF  217
              IL+ GQ IF
Sbjct  514   AILAPGQRIF  523



>ref|XP_008811766.1| PREDICTED: cytokinin dehydrogenase 4-like [Phoenix dactylifera]
Length=535

 Score =   511 bits (1317),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 244/422 (58%), Positives = 320/422 (76%), Gaps = 9/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M    A   + + +  F Y D  GGELWI VL  +L+HGLAPKS
Sbjct  107   HSLQGQAQAPGGVVVHMKYLRATETQ-VHAGDFPYVDASGGELWIHVLLESLKHGLAPKS  165

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L VVTG GE   CS ++N++LF  VL
Sbjct  166   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLQVVTGTGEITNCSTKENADLFFGVL  225

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP+ V+WIRVLYSDF +FT+DQE LIS       + FDY+EG
Sbjct  226   GGLGQFGIITRARIALEPAPKMVKWIRVLYSDFTSFTEDQEMLIS-----EEKTFDYIEG  280

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSS F+P++PV+     SDG +L+CLE+TKN++    + ++QE++ L
Sbjct  281   FVIINRTGLLNNWRSS-FNPKDPVQAGQFNSDGKILFCLEMTKNFNPDETEMMNQEVETL  339

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL++IPS++F +++ Y++FLDRVH +E+KLRS+GLW+VPHPWLNL +P++RI EF + 
Sbjct  340   LSKLRYIPSTLFQSEVSYMEFLDRVHVSEVKLRSQGLWEVPHPWLNLLIPRTRIHEFAKE  399

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             V   IL + ++GPIL+YP+N++KWD RTSAV P+EEVFYLVA L SA  + ++  +L++ 
Sbjct  400   VLGKILTDSSNGPILLYPLNRSKWDNRTSAVIPDEEVFYLVAFLSSA-PSLSDHDSLEHA  458

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN  IL FCK++GI MKQYLPHY+T++EWK HFG  WE F  RK  +DP  IL+ G  
Sbjct  459   LKQNDKILDFCKKAGIRMKQYLPHYTTKEEWKAHFGASWEIFARRKAIYDPLSILAPGHR  518

Query  222   IF  217
             IF
Sbjct  519   IF  520



>ref|XP_006654329.1| PREDICTED: cytokinin dehydrogenase 9-like [Oryza brachyantha]
Length=521

 Score =   511 bits (1316),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 244/424 (58%), Positives = 322/424 (76%), Gaps = 16/424 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK--PLVSEKFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQ+  A G+V+ M    +   +  P  S    Y D  GGELWI+VL  TL++GLAP
Sbjct  100   HSLYGQSQAAGGIVISMESLQSNRMRVHPGASP---YVDASGGELWINVLHETLKYGLAP  156

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYL+L+VGGTLSNAG+SGQ F HGPQISNV+EL++VTG+G+ +TCS EQNS+LFHA
Sbjct  157   KSWTDYLHLTVGGTLSNAGVSGQTFRHGPQISNVNELEIVTGRGDIITCSPEQNSDLFHA  216

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
              LGGLGQFG+ITRARI LE AP+ VRWIRVLYSDF +FT DQE LIS       + FDY+
Sbjct  217   ALGGLGQFGIITRARIPLEPAPEMVRWIRVLYSDFTSFTADQEMLISAE-----KTFDYI  271

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EGFVI++  G++NNWRSSF +P++PV+ S  +SDG VL+CLE+TKN++ + AD ++QE++
Sbjct  272   EGFVIINRTGILNNWRSSF-NPQDPVQASQFESDGKVLFCLEMTKNFNPNDADIMEQEVN  330

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LL KL +IP S+F TD+ Y++FLDRVH +E+KLR+KG+W+VPHPWLN+ +P+SRI +F 
Sbjct  331   TLLSKLTYIPPSLFHTDVTYIEFLDRVHSSEMKLRAKGMWEVPHPWLNIIIPRSRIHKFA  390

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             R VF  IL +  +GPIL+YP+NK++WD RTSA+ P+EEVFYLVA L SA+   N   TL 
Sbjct  391   REVFGKILKDSNNGPILLYPVNKSRWDNRTSAIIPDEEVFYLVAFLSSALGPHNIKHTL-  449

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
                  N  I++F  ++GI +KQYLP+Y+ +QEW+ HFG +W+ FQ RK  +DP  IL+ G
Sbjct  450   ---DLNNKIIEFSDKAGIGVKQYLPNYTREQEWQSHFGARWDTFQQRKKAYDPLTILAPG  506

Query  228   QLIF  217
             Q IF
Sbjct  507   QRIF  510



>ref|XP_006411418.1| hypothetical protein EUTSA_v10016470mg [Eutrema salsugineum]
 gb|ESQ52871.1| hypothetical protein EUTSA_v10016470mg [Eutrema salsugineum]
Length=551

 Score =   512 bits (1318),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 245/422 (58%), Positives = 318/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA+   GVV+ M    +   K    ++  Y DV GGELWI++L+ TL+ GL+PKS
Sbjct  125   HSLQGQALAHQGVVINMESLRSPDIKIYKGQQ-PYVDVSGGELWINILRETLKSGLSPKS  183

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE VTCSE++NSELF++VL
Sbjct  184   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKRNSELFYSVL  243

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIAL  AP  V+WIRVLYSDF AF++DQE+LIS         FDYVEG
Sbjct  244   GGLGQFGIITRARIALRPAPHMVKWIRVLYSDFSAFSRDQEHLIS-----KENTFDYVEG  298

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++   L+NNWRSSF SP +  + S  KSDG  LYCLE+ K +    A++++QE + L
Sbjct  299   FVIINRTDLLNNWRSSF-SPNDSTQASQFKSDGKTLYCLEVAKYFIPEEANSMNQETEKL  357

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F++++PY++FLDRVH AE KLR+KGLW+VPHPWLNL +PKSRI +F   
Sbjct  358   LSELNYIPSTLFSSEVPYIEFLDRVHIAERKLRAKGLWEVPHPWLNLLIPKSRIFDFATE  417

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+N++KW++RTS +TP E++ YLVA L SAV N +    L+ L
Sbjct  418   VFNNILTSNSNGPILIYPVNQSKWNKRTSLITPNEDILYLVAFLPSAVPNSSGKNDLEYL  477

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ +L FC    I +KQYLPHY TQ EWK HFG++WE F  RK  +DP  IL+ GQ 
Sbjct  478   LKQNQRVLSFCAAENINVKQYLPHYETQTEWKSHFGDRWETFAKRKYAYDPLAILAPGQR  537

Query  222   IF  217
             IF
Sbjct  538   IF  539



>gb|EPS70157.1| hypothetical protein M569_04602 [Genlisea aurea]
Length=520

 Score =   510 bits (1314),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 250/427 (59%), Positives = 312/427 (73%), Gaps = 13/427 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSE--KFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQA    G+V+ M   A      +V +  KF Y DV  GELWIDVL   L+HGLAP
Sbjct  93    HSLQGQAQAPQGIVISMESLAGNGIMQVVVQGGKFPYVDVSAGELWIDVLNECLKHGLAP  152

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE V CS E+N++LFH 
Sbjct  153   KSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVVICSGEKNADLFHG  212

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFGVITRARI+LE APQ+V+WIRVLYS+F  FT+DQE LIS   +     FDY+
Sbjct  213   VLGGLGQFGVITRARISLEPAPQKVKWIRVLYSEFSTFTRDQERLISAAEE---DTFDYI  269

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNY---DQSTADTVDQ  778
             EG VI++  GL+NNWRSS F P +P + S   SDG  L+CLE+ KN+   D + A  VD+
Sbjct  270   EGLVIINRTGLVNNWRSSSFDPDDPEQASQFISDGKTLFCLEMAKNFNPDDAAEAQVVDE  329

Query  777   EIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRID  598
             EI  LL  L +IP ++F T++PYVDFLDRVH AE KLR KGLW++PHPWLNL VPKS I+
Sbjct  330   EIKSLLSMLNYIPWTLFITEVPYVDFLDRVHAAEQKLRLKGLWELPHPWLNLLVPKSGIE  389

Query  597   EFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQ  418
              F  GVF  I+ +  +GPIL+YP+N++KWD RTS VTP+E++ YLVA L    EN     
Sbjct  390   RFAEGVFGDIITDTNNGPILVYPLNRSKWDNRTSFVTPDEDIVYLVAFLTHPTENNR---  446

Query  417   TLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHIL  238
              L++L + NR +L FC+E  + +KQYLPHY+ ++EW+ HFG +WE F  RKL +DP  IL
Sbjct  447   -LEDLLNLNRRVLAFCEEEHLGIKQYLPHYTKEEEWRAHFGPRWEAFVRRKLDYDPLAIL  505

Query  237   STGQLIF  217
             + GQ IF
Sbjct  506   APGQRIF  512



>ref|NP_181682.1| cytokinin dehydrogenase 1 [Arabidopsis thaliana]
 sp|O22213.1|CKX1_ARATH RecName: Full=Cytokinin dehydrogenase 1; AltName: Full=Cytokinin 
oxidase 1; Short=AtCKX1; Short=CKO 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAB84333.1| putative cytokinin oxidase [Arabidopsis thaliana]
 gb|AEC09992.1| cytokinin dehydrogenase 1 [Arabidopsis thaliana]
Length=575

 Score =   512 bits (1319),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 243/422 (58%), Positives = 319/422 (76%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA+   GVV++M    +   + +   K  Y DV GGE+WI++L+ TL++GL+PKS
Sbjct  125   HSLQGQALAHQGVVIKMESLRSPDIR-IYKGKQPYVDVSGGEIWINILRETLKYGLSPKS  183

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE VTCSE++NSELF +VL
Sbjct  184   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKRNSELFFSVL  243

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP  V+WIRVLYSDF AF++DQEYLIS       + FDYVEG
Sbjct  244   GGLGQFGIITRARISLEPAPHMVKWIRVLYSDFSAFSRDQEYLIS-----KEKTFDYVEG  298

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++   L+NNWRSSF SP +  + S  KSDG  LYCLE+ K ++   A ++DQE   L
Sbjct  299   FVIINRTDLLNNWRSSF-SPNDSTQASRFKSDGKTLYCLEVVKYFNPEEASSMDQETGKL  357

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F++++PY++FLDRVH AE KLR+KGLW+VPHPWLNL +PKS I +F   
Sbjct  358   LSELNYIPSTLFSSEVPYIEFLDRVHIAERKLRAKGLWEVPHPWLNLLIPKSSIYQFATE  417

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPILIYP+N++KW + TS +TP E++FYLVA L SAV N +    L+ L
Sbjct  418   VFNNILTSNNNGPILIYPVNQSKWKKHTSLITPNEDIFYLVAFLPSAVPNSSGKNDLEYL  477

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ ++ FC  + + +KQYLPHY TQ+EWK HFG++WE F  RK  +DP  IL+ GQ 
Sbjct  478   LKQNQRVMNFCAAANLNVKQYLPHYETQKEWKSHFGKRWETFAQRKQAYDPLAILAPGQR  537

Query  222   IF  217
             IF
Sbjct  538   IF  539



>dbj|BAM74647.1| cytokinin oxidase/dehydrogenase [Torenia fournieri]
Length=533

 Score =   510 bits (1314),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 315/423 (74%), Gaps = 8/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFM-YADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    G+V+ M          + S K + Y DV  GELWI+VL+ +L+HGL+PK
Sbjct  110   HSLQGQAQALQGIVINMESLGLQEKMQVYSGKSLPYVDVSAGELWINVLRESLKHGLSPK  169

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQISNV++L+VVTGKG  V CSEE+N++LFHAV
Sbjct  170   SWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVYQLEVVTGKGAVVVCSEEKNADLFHAV  229

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFGVITRARI LE AP+ V+WIRVLYSDF  FT+DQE+LIS         FDY+E
Sbjct  230   LGGLGQFGVITRARIPLEPAPKMVKWIRVLYSDFSTFTRDQEHLIS-----AENTFDYIE  284

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             G  IV+  GL+NNWRSSF +P +PV+ S   SDG  L+CLE+TKN++   A  VD+EI  
Sbjct  285   GLAIVNRTGLVNNWRSSF-NPEDPVRASQFVSDGRTLFCLELTKNFNPDEAADVDKEIKS  343

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L +IPS++F T++ Y+DFLDRVH AE KLRSKGLWD+PHPWLNL VPKS++  F  
Sbjct  344   LLSQLNYIPSTLFVTEVSYIDFLDRVHLAEHKLRSKGLWDIPHPWLNLLVPKSKMHVFAE  403

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
             GVF  I+ +  +GP+L+YP+NK+KWD RTS VTP+E++FY+VA L  AV +     +L+ 
Sbjct  404   GVFGKIVTDTNNGPVLVYPVNKSKWDNRTSFVTPDEDIFYVVAFLPHAVPSSTGENSLEY  463

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             L S N+ IL F +E+ + +KQYLPHY +Q+EW+ HFG +WE F  RK  +DP  IL+ GQ
Sbjct  464   LLSVNQRILDFVEEADLGVKQYLPHYKSQEEWQRHFGSRWEVFARRKSDYDPLAILAPGQ  523

Query  225   LIF  217
              IF
Sbjct  524   GIF  526



>ref|XP_009391555.1| PREDICTED: cytokinin dehydrogenase 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=546

 Score =   511 bits (1315),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 249/453 (55%), Positives = 327/453 (72%), Gaps = 40/453 (9%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V++M        K    E+  Y D  GG LWI+VL   L+HGLAPKS
Sbjct  95    HSLQGQAQADGGIVVRMENLRGCETKVHDGEQ-PYVDASGGALWINVLLECLKHGLAPKS  153

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L++GGTLSNAGISGQAF HGPQISNVH+L++VTGKGE + CS E+N++LF+A L
Sbjct  154   WTDYLHLTIGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGELLNCSAEENADLFYAAL  213

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP+ V+WIRVLYSDF +FT+DQE LISL      + FDY+EG
Sbjct  214   GGLGQFGIITRARIALEPAPKMVKWIRVLYSDFASFTEDQEMLISL-----KETFDYIEG  268

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD------  781
             FVI++  GL+NNWRSS F+P+NPV+ S   SDG +L+CLE+TKN+DQ  A+TV+      
Sbjct  269   FVIINRTGLLNNWRSS-FNPQNPVQASEFDSDGRILFCLEMTKNFDQDNAETVNQVKLLH  327

Query  780   -------------------------QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAE  676
                                      Q+++ LL KL++IPS++F +++ Y++FLDRVH +E
Sbjct  328   TTSPPMHVRIGSSPQKSSPPPPLWLQQVEALLSKLRYIPSTLFQSEVSYLEFLDRVHVSE  387

Query  675   LKLRSKGLWDVPHPWLNLFVPKSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTS  496
             +KLRSKGLW+VPHPWLNL +P++RI +F   VF  IL +  +GPIL+YP+NK+KWD RTS
Sbjct  388   VKLRSKGLWEVPHPWLNLLIPRTRIRDFAAQVFGKILPDSNNGPILLYPLNKSKWDNRTS  447

Query  495   AVTPEEEVFYLVALLRSAVENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQ  316
             AV P+EE+FYLVA L SA  + ++  +L     QN  IL FCK++GI MKQYLP+Y+ Q+
Sbjct  448   AVIPDEEIFYLVAFLSSA-PSSSDHDSLDRALKQNDRILDFCKQAGIRMKQYLPYYTMQE  506

Query  315   EWKEHFGEKWERFQHRKLQFDPKHILSTGQLIF  217
             EW+ HFG++WE F  RK  +DP +IL+ GQ IF
Sbjct  507   EWRAHFGDRWEDFARRKGVYDPLYILAPGQRIF  539



>ref|XP_008349298.1| PREDICTED: cytokinin dehydrogenase 6-like [Malus domestica]
Length=529

 Score =   509 bits (1312),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 318/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ+    GVV+ M        + + +    Y D  GGELWI++L+ +L++GLAPKS
Sbjct  108   HSLQGQSQAHQGVVINMESLKVXQIQ-IHTGSSPYVDASGGELWINILRESLKYGLAPKS  166

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L++GGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE V CSEEQN +LFH+VL
Sbjct  167   WTDYLHLTIGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVVNCSEEQNEDLFHSVL  226

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP RV+WIRVLYSDF AFT+DQE+L+S         FDY+EG
Sbjct  227   GGLGQFGIITRARISLEAAPARVKWIRVLYSDFTAFTQDQEHLMS-----AENTFDYIEG  281

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF S ++PV+ S  KSDG  L+CLE+ K ++      +D+EI+  
Sbjct  282   FVIINRTGLLNNWRSSFNS-KDPVQASQFKSDGKTLFCLELAKYFNLDKTKIIDEEIENS  340

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +I S++F +++ Y+DFLDRVH +E+KLRSK LWDVPHPWLNL +PKS+I  F + 
Sbjct  341   LSQLSYIRSTLFVSEVAYIDFLDRVHXSEIKLRSKDLWDVPHPWLNLLIPKSKIHTFAKE  400

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL   ++GP+LIYP N++KWD RTS V PEE++FYLVA L SAV +   +  L+++
Sbjct  401   VFGNILTETSNGPVLIYPANRSKWDNRTSVVIPEEDIFYLVAFLTSAVPSSTVTDGLEHI  460

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL+FC+ + + +KQYLPHY+TQ+EWK HFG +WE F  RK  +DP  IL+ GQ 
Sbjct  461   LTQNQRILEFCETAQLGVKQYLPHYATQEEWKAHFGPRWEDFVQRKSAYDPLAILAPGQR  520

Query  222   IF  217
             IF
Sbjct  521   IF  522



>ref|XP_009368087.1| PREDICTED: cytokinin dehydrogenase 6-like [Pyrus x bretschneideri]
Length=529

 Score =   509 bits (1312),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 316/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ+    GVV+ M        + + +    Y D  GGELWI++L  +L++GLAPKS
Sbjct  108   HSLQGQSQAHRGVVINMESLKGPQIQ-IHTGSSPYVDASGGELWINILHESLKYGLAPKS  166

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L++GGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE V CSEEQN +LFH+VL
Sbjct  167   WTDYLHLTIGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVVNCSEEQNEDLFHSVL  226

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP RV+WIRVLYSDF AFT+DQE+L+S        KFDY+EG
Sbjct  227   GGLGQFGIITRARISLEAAPARVKWIRVLYSDFTAFTQDQEHLMS-----AENKFDYIEG  281

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF S ++PV+ S  KSDG  L+CLE+ K ++    D + +E+D  
Sbjct  282   FVIINRTGLLNNWRSSFNS-KDPVQASQFKSDGKTLFCLELAKYFNLDRTDLITEEVDNS  340

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +I S++F +++ Y+DFLDRVH +E+KLRSK LWD+PHPWLNL +PKS+I  F + 
Sbjct  341   LSQLSYIRSTLFVSEVAYIDFLDRVHVSEIKLRSKDLWDIPHPWLNLLIPKSKIHTFAKE  400

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL   ++GP+LIYP N++KWD RTS V PEE++FYLVA L SAV +   +  L+++
Sbjct  401   VFGNILTETSNGPVLIYPANRSKWDSRTSVVIPEEDIFYLVAFLTSAVPSSTGTDGLEHI  460

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL FC+ + + +KQYLPHY+TQ EWK HFG +WE F  RK  +DP  IL+ GQ 
Sbjct  461   LTQNKRILAFCETAKLGVKQYLPHYATQDEWKAHFGPRWEDFAQRKSAYDPLAILAPGQR  520

Query  222   IF  217
             IF
Sbjct  521   IF  522



>ref|XP_009408848.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=533

 Score =   509 bits (1311),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 250/433 (58%), Positives = 316/433 (73%), Gaps = 16/433 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS----GAAAAVPKPLVSEKFM-YADVWGGELWIDVLKSTLEHG  1315
             HSI GQA+   GVV+ M+    G A  +     +   + Y D  G +LWIDVL  TL+HG
Sbjct  107   HSIRGQALAPGGVVVDMASLGHGRADRISVSFDNAPLVWYVDAGGEQLWIDVLHETLKHG  166

Query  1314  LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSEL  1135
             LAP+SWTDYLYL+VGGTLSNAG+SGQAF HGPQISNV+ELDV+TGKGE +TCS E  S+L
Sbjct  167   LAPRSWTDYLYLTVGGTLSNAGVSGQAFRHGPQISNVYELDVITGKGEMITCSHENKSDL  226

Query  1134  FHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKF  955
             F+ VLGGLGQFG+ITRARIALE APQRVRW+R++Y+ F +F++DQE LIS+      Q F
Sbjct  227   FYGVLGGLGQFGIITRARIALEPAPQRVRWVRLIYTHFVSFSRDQELLISMMD----QGF  282

Query  954   DYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQ-STADTVDQ  778
             DYVEG +++D  LI NWRSSFFS  N  K   + ++ G +YCLE    Y + + A  VDQ
Sbjct  283   DYVEGSLLMDHTLITNWRSSFFSKTNSEKIRGLAAEFGAIYCLEGAVYYHELAMASRVDQ  342

Query  777   EIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRID  598
             ++ +LL++L F+P   FT D+ YV FLDRVH  E+KLRS GLW+VPHPWLN+FVPKSRI 
Sbjct  343   KLHLLLQRLSFVPGFAFTNDVSYVGFLDRVHDGEVKLRSMGLWEVPHPWLNIFVPKSRIQ  402

Query  597   EFDRGVFKGIL-GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNES  421
             +F+ GVFKGIL  N ++GP+LIYPM KNKW +  SAVTP+EEVFY + LLRSA+     +
Sbjct  403   DFEVGVFKGILMPNNSTGPVLIYPMIKNKWHDEMSAVTPDEEVFYSIGLLRSAI-----T  457

Query  420   QTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHI  241
                ++L +QN DIL FC   GI+ KQYLPHY++Q++WK HFG KW+ F   K ++DPK +
Sbjct  458   DDWQDLDNQNDDILGFCHREGIQFKQYLPHYASQRDWKNHFGRKWDTFVEMKRRYDPKAL  517

Query  240   LSTGQLIFTPSFN  202
             LS GQ IFT S  
Sbjct  518   LSPGQRIFTSSLT  530



>ref|XP_006491496.1| PREDICTED: cytokinin dehydrogenase 1-like [Citrus sinensis]
Length=549

 Score =   510 bits (1313),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 245/422 (58%), Positives = 322/422 (76%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M      V K    E   Y DV GGELWI++L  TL++GLAPKS
Sbjct  128   HSLQGQAQAHQGVVINMPSLQEPVMKVHTGE-LPYVDVSGGELWINILHETLKNGLAPKS  186

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKG+ +TCSE+QN++LFH VL
Sbjct  187   WTDYLHLTVGGTLSNAGISGQAFLHGPQINNVYKLEVVTGKGDVLTCSEQQNADLFHGVL  246

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ VRWIRVLYS+F  FTKDQE+LIS         FDY+EG
Sbjct  247   GGLGQFGIITRARISLEPAPKMVRWIRVLYSEFSIFTKDQEHLIS-----SESSFDYIEG  301

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +PR+P++ S   SDG VLYCLE+ K+++   A  +D++ + L
Sbjct  302   FVIINRTGLLNNWRSSF-NPRDPLQASKFNSDGKVLYCLEMAKHFNPDEAGIMDKKTESL  360

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL FIPS++F +D+ YVDFLDRVH +E+KLR KGLW+VPHPWLNL +PKS+I +F + 
Sbjct  361   LSKLSFIPSTLFQSDVSYVDFLDRVHVSEIKLREKGLWEVPHPWLNLLIPKSKISDFAQQ  420

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+NK+KW+ +TS VTP+E++FYLVA L SA+ +   +  L+++
Sbjct  421   VFGEILKDNSNGPILIYPVNKSKWNRKTSFVTPDEDIFYLVAFLSSALPSSRGTDGLEHI  480

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +Q++ IL     + + +KQYLPHYSTQ+EW+ HFG +W+ F  RK  +DP  IL+ GQ 
Sbjct  481   NNQHQRILDVSTRANLGIKQYLPHYSTQKEWQAHFGPQWKLFVQRKYAYDPLAILAPGQR  540

Query  222   IF  217
             IF
Sbjct  541   IF  542



>ref|XP_007008758.1| Cytokinin oxidase/dehydrogenase 6 isoform 2 [Theobroma cacao]
 gb|EOY17568.1| Cytokinin oxidase/dehydrogenase 6 isoform 2 [Theobroma cacao]
Length=531

 Score =   509 bits (1311),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 251/424 (59%), Positives = 323/424 (76%), Gaps = 11/424 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M       PK  V + KF Y DV GGELWI++L+ +L HGLAPK
Sbjct  109   HSLQGQAQAHRGVVINMESLQG--PKMQVHAGKFPYVDVSGGELWINILRESLRHGLAPK  166

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVT-GKGESVTCSEEQNSELFHA  1126
             SWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVT GKGE V CSE+QNS+LF++
Sbjct  167   SWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTAGKGEVVNCSEKQNSDLFYS  226

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFG+ITRARI+LE AP+ V+WIRVLY+DF  F +DQE LIS  G+     FDY+
Sbjct  227   VLGGLGQFGIITRARISLEPAPEMVKWIRVLYTDFATFARDQEKLIS--GE---STFDYI  281

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EGFVI++  GL+NNWRSSF +P++PV+ S  KSDG  L+CLE+ K ++      V+QEI 
Sbjct  282   EGFVIINRTGLLNNWRSSF-NPQDPVQASQFKSDGRTLFCLELAKYFNPEEMAVVNQEIK  340

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
               L +L  IPS++F +++PY++FLDRVH +E+KLRSKGLW+VPHPWLNL VP+S++  F 
Sbjct  341   NSLSQLNHIPSTLFMSEVPYIEFLDRVHISEIKLRSKGLWEVPHPWLNLLVPRSKVHSFA  400

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             + VF  IL + ++GPILIYP+NK+KWD RTSAV PEE+VFYLVA L SAV +   +  L 
Sbjct  401   QEVFGNILTDTSNGPILIYPVNKSKWDNRTSAVIPEEDVFYLVAFLSSAVPSSTGTDGLD  460

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
             ++  QN+ IL+FC+ + + +KQYLPHYSTQ EW+ H+G +WE F  RK  +DP  +L+ G
Sbjct  461   HILIQNKRILEFCEIARLGVKQYLPHYSTQGEWQAHYGPQWELFVQRKSTYDPLALLAPG  520

Query  228   QLIF  217
             Q IF
Sbjct  521   QRIF  524



>gb|KHN39533.1| Cytokinin dehydrogenase 6 [Glycine soja]
Length=533

 Score =   509 bits (1311),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 244/425 (57%), Positives = 313/425 (74%), Gaps = 7/425 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M   +    +    E   Y DV GGELWI++L  TL +G  P+S
Sbjct  111   HSLQGQAQAHGGVVINMESLSVPEMQVHTGESSPYVDVSGGELWINILHETLRYGFTPRS  170

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQAF HGPQISNV +L++VTG GE V CSEEQN ELFH+VL
Sbjct  171   WTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVQKLEIVTGTGEVVNCSEEQNGELFHSVL  230

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI LE AP  V+WIRVLY+DF AF +DQE LI        + FDYVEG
Sbjct  231   GGLGQFGIITRARIFLEPAPAMVKWIRVLYADFTAFIRDQEKLIF-----AEKAFDYVEG  285

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNW SSF +P++PV+ S  KSDG  L+CLE+ K Y+      V+QE++  
Sbjct  286   FVIINRTGLLNNWSSSF-NPQDPVQASEFKSDGRTLFCLELAKYYNLEETLLVNQEVEKH  344

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F T++ YVDFLDRVH +E+KLRSKGLWDVPHPWLNLF+PK++I  F   
Sbjct  345   LSRLNYIPSTLFLTEVTYVDFLDRVHTSEVKLRSKGLWDVPHPWLNLFIPKTKIHHFAEV  404

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  I+   ++GP+LIYP+NK+KWD RTS V PEE++FYLVA L SAV + N    L+++
Sbjct  405   VFGNIVKETSNGPVLIYPVNKSKWDNRTSVVIPEEDIFYLVAFLASAVPSSNGPDGLEHI  464

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              S+N+ IL++C+ + + +KQYLPHYSTQ+EW  HFG +WE F+ RK  +DP  IL+ GQ 
Sbjct  465   LSRNKKILEYCERANLGVKQYLPHYSTQEEWTAHFGSQWEIFKKRKSLYDPLAILAPGQG  524

Query  222   IFTPS  208
             IF  S
Sbjct  525   IFQKS  529



>ref|XP_002879935.1| ATCKX1/CKX1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56194.1| ATCKX1/CKX1 [Arabidopsis lyrata subsp. lyrata]
Length=564

 Score =   510 bits (1314),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 321/422 (76%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ++   GVV++M    +   + +   K  Y DV GGELWI++L+ TL++GL+PKS
Sbjct  125   HSLQGQSLAHQGVVIKMESLRSPDIR-IYKGKQPYVDVSGGELWINILRETLKYGLSPKS  183

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE VTCSE++NSELF +VL
Sbjct  184   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKKNSELFFSVL  243

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE APQ V+WIRVLYSDF AF++DQE+LIS       + FDYVEG
Sbjct  244   GGLGQFGIITRARISLEPAPQMVKWIRVLYSDFSAFSRDQEHLIS-----KEKTFDYVEG  298

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++   L+NNWRSSF SP +  + S  KSDG  LYCLE+ K ++   A+++ QE   L
Sbjct  299   FVIINRTDLLNNWRSSF-SPNDSTQASRFKSDGKTLYCLEVVKYFNPEEANSMHQETGKL  357

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F++++PY++FLDRVH AE KLR+KGLW+VPHPWLNL +PK  I +F   
Sbjct  358   LSELNYIPSTLFSSEVPYIEFLDRVHIAERKLRAKGLWEVPHPWLNLLIPKRNIFQFATE  417

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPILIYP+N++KW++ TS +TP E++FYLVA L SAV N +    L++L
Sbjct  418   VFNNILTSNNNGPILIYPVNQSKWNKHTSLITPNEDIFYLVAFLPSAVPNSSGKNDLEHL  477

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ ++ FC  + + +KQYLPHY TQQEWK HFG +WE F  RK  +DP+ IL+ GQ 
Sbjct  478   LKQNQRVISFCGAANLNVKQYLPHYETQQEWKSHFGNRWETFAQRKHAYDPQGILAPGQR  537

Query  222   IF  217
             IF
Sbjct  538   IF  539



>ref|XP_008797779.1| PREDICTED: cytokinin dehydrogenase 6-like [Phoenix dactylifera]
Length=543

 Score =   509 bits (1311),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 318/442 (72%), Gaps = 19/442 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFM----------YADVWGGELWIDVLKS  1330
             HS+ GQA+   GVV++M+            E  +          Y D  G + WIDVL+ 
Sbjct  107   HSVRGQALAPHGVVIEMTSMRRGGGGDGDGEPRIRVSPAGSVSGYVDAGGEQFWIDVLRE  166

Query  1329  TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEE  1150
             TL++GLAP SWTDYLYL+VGGTLSNAG+SGQAF HGPQISNV+ELDV+TGKGE VTCSE+
Sbjct  167   TLKYGLAPMSWTDYLYLTVGGTLSNAGVSGQAFLHGPQISNVYELDVITGKGEMVTCSED  226

Query  1149  QNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQP  970
                +LF AVLGGLGQFG+ITRARIALE APQ VRW+R++Y++F+AF +DQE LISL    
Sbjct  227   HEPDLFFAVLGGLGQFGIITRARIALEPAPQMVRWVRLIYTNFEAFARDQEKLISLDDG-  285

Query  969   PAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTAD  790
               + F+YVEG +++D  + NNWRSSFFS R+  + SS+ +  G +YCLE  + YD++   
Sbjct  286   -NKGFNYVEGSILMDHHVGNNWRSSFFSERDLERISSLAAQYGAVYCLEGARYYDKAMVH  344

Query  789   TVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPK  610
              VDQE++ LL+ L F+P   FT D+ Y+ FL+RV   ELKLRS+GLW+VPHPWLN+FVP+
Sbjct  345   MVDQELEWLLEGLSFMPGFAFTNDVTYIRFLNRVRDGELKLRSQGLWNVPHPWLNIFVPR  404

Query  609   SRIDEFDRGVFKGIL-GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVEN  433
             SRI +FDRGVFK IL  + ++GPILIYPM++NKWD R SAV P+EE+FY + LLRS V  
Sbjct  405   SRIIDFDRGVFKSILRHDNSTGPILIYPMDRNKWDRRMSAVIPDEEIFYSIGLLRSGV--  462

Query  432   GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFD  253
                    + L++QN++IL FC ++GI  KQYLPHY+TQ +W EHFG KWE    RK ++D
Sbjct  463   ----HAWERLENQNKEILHFCNQAGISHKQYLPHYTTQADWMEHFGSKWETIVERKRRYD  518

Query  252   PKHILSTGQLIFTPSFNAMTAS  187
             PK +LS GQ IFT S  A  +S
Sbjct  519   PKSLLSPGQQIFTSSMAAHNSS  540



>ref|XP_003538221.1| PREDICTED: cytokinin dehydrogenase 6 [Glycine max]
Length=552

 Score =   509 bits (1312),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 244/425 (57%), Positives = 313/425 (74%), Gaps = 7/425 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M   +    +    E   Y DV GGELWI++L  TL +G  P+S
Sbjct  130   HSLQGQAQAHGGVVINMESLSVPEMQVHTGESSPYVDVSGGELWINILHETLRYGFTPRS  189

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQAF HGPQISNV +L++VTG GE V CSEEQN ELFH+VL
Sbjct  190   WTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVQKLEIVTGTGEVVNCSEEQNGELFHSVL  249

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI LE AP  V+WIRVLY+DF AF +DQE LI        + FDYVEG
Sbjct  250   GGLGQFGIITRARIFLEPAPAMVKWIRVLYADFTAFIRDQEKLIF-----AEKAFDYVEG  304

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNW SSF +P++PV+ S  KSDG  L+CLE+ K Y+      V+QE++  
Sbjct  305   FVIINRTGLLNNWSSSF-NPQDPVQASEFKSDGRTLFCLELAKYYNLEETLLVNQEVEKH  363

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F T++ YVDFLDRVH +E+KLRSKGLWDVPHPWLNLF+PK++I  F   
Sbjct  364   LSRLNYIPSTLFLTEVTYVDFLDRVHTSEVKLRSKGLWDVPHPWLNLFIPKTKIHHFAEV  423

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  I+   ++GP+LIYP+NK+KWD RTS V PEE++FYLVA L SAV + N    L+++
Sbjct  424   VFGNIVKETSNGPVLIYPVNKSKWDNRTSVVIPEEDIFYLVAFLASAVPSSNGPDGLEHI  483

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              S+N+ IL++C+ + + +KQYLPHYSTQ+EW  HFG +WE F+ RK  +DP  IL+ GQ 
Sbjct  484   LSRNKKILEYCERANLGVKQYLPHYSTQEEWTAHFGSQWEIFKKRKSLYDPLAILAPGQG  543

Query  222   IFTPS  208
             IF  S
Sbjct  544   IFQKS  548



>ref|XP_010269658.1| PREDICTED: cytokinin dehydrogenase 1-like [Nelumbo nucifera]
Length=544

 Score =   509 bits (1311),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 240/427 (56%), Positives = 317/427 (74%), Gaps = 8/427 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS  GQA    G+V+ M        K + + K  + DV GGELWID+L  TL HGLAPKS
Sbjct  123   HSTQGQAQAHKGIVINMESLQRRKMK-VHAGKLPFVDVSGGELWIDILHETLRHGLAPKS  181

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNV++L+VVTGKGE V+CSE QN +LF+ VL
Sbjct  182   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVYQLEVVTGKGEVVSCSENQNEDLFYGVL  241

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRA IALE AP+ V+WIRVLYSDF  F KDQEYLIS         FDY+EG
Sbjct  242   GGLGQFGIITRATIALEPAPKMVKWIRVLYSDFSIFVKDQEYLISAE-----NTFDYIEG  296

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +P++P++ S   SDG  L+CLE+TKN++    D ++QE++ L
Sbjct  297   FVIINRTGLLNNWRSSF-NPQDPLQASRFNSDGRTLFCLEMTKNFNPDETDAMNQEVESL  355

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F +++ Y++FLDRVH +ELKL+SKGLW++PHPWLNL +P+S+I EF   
Sbjct  356   LSQLNYIPSTLFVSEVSYLEFLDRVHVSELKLQSKGLWEIPHPWLNLLIPRSKIQEFAAE  415

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GP+L+YP+N++KW+ RTS V P E++FYLVA L SA  +    + L+++
Sbjct  416   VFGNILTDTSNGPVLVYPLNRSKWNNRTSTVIPNEDIFYLVAFLSSAAPSSTRMEGLEHI  475

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               Q++ IL FC+ +   MKQYLPHY+ Q+EW+ HFG +WE F  RK  +DP  IL+ GQ 
Sbjct  476   LFQHKRILDFCEATQNGMKQYLPHYTIQEEWRAHFGPRWEVFAQRKSAYDPLAILAPGQK  535

Query  222   IFTPSFN  202
             IF  + N
Sbjct  536   IFKKATN  542



>ref|XP_009784170.1| PREDICTED: cytokinin dehydrogenase 6-like isoform X2 [Nicotiana 
sylvestris]
Length=530

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 321/422 (76%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GV++ M        + +   +F Y DV  GELWI++L  TL++GLAPKS
Sbjct  109   HSLQGQAQARRGVIINMESLQGQEMQ-VYRGQFPYVDVSAGELWINILHETLKYGLAPKS  167

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE + CS+EQN++LFHAVL
Sbjct  168   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVLICSKEQNADLFHAVL  227

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ V+WIRVLYSDF  F +DQE+LIS      A+ FDY+EG
Sbjct  228   GGLGQFGIITRARISLERAPRMVKWIRVLYSDFSTFARDQEHLIS-----AAKTFDYIEG  282

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
              VI ++ GL+NNWR+SF  P++PV+ S   SDG  LYCLE+TKN     +DTV+QEI+ L
Sbjct  283   LVIKNKTGLMNNWRASF-DPQDPVQASHFVSDGRTLYCLELTKNLYPEKSDTVNQEIEDL  341

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F +++PY++FLDRVH +ELKLRSKGLWD+PHPWLNL VPKS+I  F + 
Sbjct  342   LSQLSYIPSTLFMSEVPYIEFLDRVHASELKLRSKGLWDLPHPWLNLLVPKSKIQHFAKE  401

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GP+L+YP++K+K D RTS V+P E++ YLVA L  A  + + + +L+++
Sbjct  402   VFGNILKDTNNGPVLVYPIHKSKLDNRTSFVSPNEDIIYLVAFLSHANPSSSGTDSLEHV  461

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL FC  + + +KQYLPHY+TQ++W+ HFG KWE F  RK  +DP  +L+ GQ 
Sbjct  462   LTQNKRILDFCDVAHLGVKQYLPHYTTQEQWRTHFGPKWEVFVQRKSAYDPLAMLAPGQR  521

Query  222   IF  217
             IF
Sbjct  522   IF  523



>ref|XP_003542331.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=535

 Score =   508 bits (1309),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/431 (58%), Positives = 324/431 (75%), Gaps = 18/431 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-------GAAAAVPK-PLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS +GQAM   GVV+ M+       G A +V K PL+     YADV G +LWIDVL +TL
Sbjct  105   HSTHGQAMARDGVVVDMANLRKQRNGVAISVSKDPLMGH---YADVGGEQLWIDVLHTTL  161

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             +HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQISNVHE+DV+TGKGE VTCS ++N
Sbjct  162   KHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEMDVITGKGEFVTCSSQKN  221

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
              ELFHAVLGGLGQFGVI RARIALE AP+RV+W+R+LYSDF AFTKDQE LIS++G+   
Sbjct  222   LELFHAVLGGLGQFGVIARARIALEPAPKRVKWVRLLYSDFFAFTKDQERLISINGRKQK  281

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
                D++EG +++++G INNWRSSFF   +  + SS+ ++  +LYCLE+ K YD+ T   V
Sbjct  282   NALDFLEGMLLMNQGPINNWRSSFFPLSDHPRISSLITEHSILYCLEVAKYYDEQTEINV  341

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             D+EI VLL+ L +IP   +  ++ YV+FL+RV   ELKL+S+GLWDVPHPWLNLF+PKS+
Sbjct  342   DKEIQVLLQGLAYIPGFYYEKNVSYVEFLNRVRSGELKLQSQGLWDVPHPWLNLFIPKSQ  401

Query  603   IDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             I +F+  VFK I+   N +SGP+L+YP N+NKWD+R SA  P+EEVFY V  L S+    
Sbjct  402   ILDFNSRVFKDIVLKRNISSGPVLVYPTNRNKWDDRMSASIPDEEVFYTVGFLHSS----  457

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
                 T K   +QN +IL+FC+++GI++KQYLP++STQ++W  HFG KW +F  RK QFDP
Sbjct  458   -GFDTWKAYDAQNSEILEFCRDAGIKVKQYLPNHSTQEDWTNHFGAKWIKFLERKHQFDP  516

Query  249   KHILSTGQLIF  217
             + ILS GQ IF
Sbjct  517   RMILSPGQKIF  527



>ref|XP_008375236.1| PREDICTED: cytokinin dehydrogenase 6-like [Malus domestica]
Length=529

 Score =   508 bits (1308),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 317/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ+    GVV+ M        + + +    Y D  GGELWI++L+ +L++GLAPKS
Sbjct  108   HSLQGQSQAHRGVVINMESLKGPQIQ-IHTGSSPYVDASGGELWINILRESLKYGLAPKS  166

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L++GGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE V CSEEQN +LFH+VL
Sbjct  167   WTDYLHLTIGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVVNCSEEQNEDLFHSVL  226

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI LE AP RV+WIRVLYSDF AFT+DQE+L+S         FDY+EG
Sbjct  227   GGLGQFGIITRARIFLEAAPARVKWIRVLYSDFTAFTQDQEHLMS-----AENTFDYIEG  281

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF S ++PV+ S  KSDG  L+CLE+ K ++    D + +E+D  
Sbjct  282   FVIINRTGLLNNWRSSFNS-KDPVQASQFKSDGKTLFCLELAKYFNLDKXDLITEEVDNS  340

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +I S++F +++ Y+DFLDRVH +E+KLRSK LWDVPHPWLNL +PKS+I  F + 
Sbjct  341   LSQLSYIRSTLFVSEVAYIDFLDRVHVSEIKLRSKDLWDVPHPWLNLLIPKSKIHSFAKE  400

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL   ++GP+LIYP N++KWD RTS V PEE++FYLVA L SAV + + +  L+++
Sbjct  401   VFGNILTETSNGPVLIYPANRSKWDXRTSVVIPEEDIFYLVAFLTSAVPSSSGTDGLEHI  460

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL+FC+ + + +KQYLPHY+TQ EWK HFG +WE F  RK  +DP  IL+ GQ 
Sbjct  461   LTQNKRILEFCETAKLGVKQYLPHYATQDEWKAHFGPRWEDFXQRKSAYDPLAILAPGQR  520

Query  222   IF  217
             IF
Sbjct  521   IF  522



>ref|XP_007149023.1| hypothetical protein PHAVU_005G034000g [Phaseolus vulgaris]
 gb|ESW21017.1| hypothetical protein PHAVU_005G034000g [Phaseolus vulgaris]
Length=538

 Score =   508 bits (1309),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 246/428 (57%), Positives = 319/428 (75%), Gaps = 10/428 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA +  GVV+ M   +  VP+  V + +  Y DV GGELWI++L  TL +GL P+
Sbjct  117   HSLQGQAQSHGGVVINME--SLRVPEMQVYTGESPYVDVSGGELWINILHETLRYGLTPR  174

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSN G+SGQAF HGPQISNV +L++VTG GE V CSEEQN +LFH V
Sbjct  175   SWTDYLHLTVGGTLSNGGVSGQAFRHGPQISNVQKLEIVTGTGEVVNCSEEQNGDLFHGV  234

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+IT+ARI LE AP  V+WIRVLY+DF AFT+DQE LI        + FDYVE
Sbjct  235   LGGLGQFGIITKARIVLEPAPTMVKWIRVLYADFTAFTRDQEKLIF-----AEKAFDYVE  289

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF +P++PV+ S  KSDG  L+CLE+ K Y+      V+Q+++ 
Sbjct  290   GFVIINRTGLLNNWRSSF-NPQDPVQASKFKSDGRTLFCLELAKYYNLEETLVVNQKVEK  348

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
              L  L  IPS++F T++ YVDFLDRVH +E+KLRSKGLWDVPHPWLNLF+PK++I  F  
Sbjct  349   HLSHLNHIPSTLFQTEVTYVDFLDRVHISEIKLRSKGLWDVPHPWLNLFIPKTKIHHFAE  408

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  I+   ++GP+LIYP+NK+KWD RTS V PEE++FYLVA L SAV + N    L+N
Sbjct  409   VVFGNIVTETSNGPVLIYPVNKSKWDNRTSVVMPEEDIFYLVAFLASAVPSSNGPDGLEN  468

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + SQN+ IL++C+ S + +KQYLPHY+T++ W+ HFG +W+ FQHRK  +DP  +L+ GQ
Sbjct  469   ILSQNKKILEYCERSHLGVKQYLPHYTTEEAWRVHFGSQWQIFQHRKSVYDPLAMLAPGQ  528

Query  225   LIFTPSFN  202
              IF  S N
Sbjct  529   QIFQKSIN  536



>ref|XP_006645310.1| PREDICTED: cytokinin dehydrogenase 4-like [Oryza brachyantha]
Length=527

 Score =   508 bits (1307),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 242/431 (56%), Positives = 328/431 (76%), Gaps = 9/431 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQ+  A G+V++M S AA A    +      + +V GGELWI+VL  TL+HGLAP+
Sbjct  103   HSLLGQSQAAGGIVVKMESLAAGATAVRVHGGPSPHVEVPGGELWINVLHETLKHGLAPR  162

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAG+SGQAF HGPQ+SNV++L++VTG+G+ VTCS E+NS+LF+A 
Sbjct  163   SWTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGDVVTCSHEENSDLFYAA  222

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARIALE AP+ VRWIRVLYSDF+ FT+DQE LI+       + FDY+E
Sbjct  223   LGGLGQFGIITRARIALEPAPKMVRWIRVLYSDFETFTEDQEMLITAE-----KTFDYIE  277

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  G++NNWRSS F P++PV+ S  +SDG VLYCLE+TKN++   A  ++QE+  
Sbjct  278   GFVIINRTGILNNWRSS-FKPQDPVQASQFQSDGRVLYCLEMTKNFNHDEAGIMEQEVGA  336

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L++I S++F TD+ Y++FLDRVH +ELKLR++GLW+VPHPWLNL +P+S I +F R
Sbjct  337   LLSRLRYISSTLFYTDVTYLEFLDRVHTSELKLRAQGLWEVPHPWLNLLIPRSTIHKFAR  396

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL +  +GPIL+YP+N+ KWD RTS V P+EE+FYLV  L SA  + +   ++++
Sbjct  397   EVFGKILKDSNNGPILLYPVNRTKWDNRTSVVIPDEEIFYLVGFLSSA-PSASGHGSVQH  455

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
               + N  I+ FC+++GI MKQYL  Y+TQQ+WK HFG +WE F+ RK  +DP  IL+ GQ
Sbjct  456   AMNLNNQIVDFCEKNGIGMKQYLAPYTTQQQWKAHFGARWETFERRKHTYDPLAILAPGQ  515

Query  225   LIFTPSFNAMT  193
              IFT +   M+
Sbjct  516   RIFTKASLPMS  526



>gb|KDO49370.1| hypothetical protein CISIN_1g009793mg [Citrus sinensis]
Length=525

 Score =   508 bits (1307),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 242/425 (57%), Positives = 313/425 (74%), Gaps = 8/425 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVP-KPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQAM   GVV++M           +      YADV G +LWIDVL +TLEHGLAP 
Sbjct  104   HSVRGQAMADGGVVVEMMALKNYRNGNGITVGSGFYADVAGEQLWIDVLNATLEHGLAPA  163

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQ F +GPQISNV+ELDVVTGKGE +TCS  +NSELF+A 
Sbjct  164   SWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYELDVVTGKGELMTCSALKNSELFYAA  223

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARIALE AP+RV+W+R+LYSDF +F++DQEYLIS++G+   Q  DY+E
Sbjct  224   LGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSSFSRDQEYLISMNGRRQKQALDYLE  283

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             G +I+D+G ++NWRSSFF P +  K  S      ++YCLE+ K YD  T  T+ +E+  L
Sbjct  284   GTLIMDQGSLDNWRSSFFPPSDHPKIISQVKTHAIIYCLEVAKYYDDHTQSTLHKELQTL  343

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
              K L ++P  +F  D+ YV+FL+RV   ELKL S+GLW+VPHPWLNLF+PKSRI +F++G
Sbjct  344   FKGLSYLPGFMFEKDVSYVEFLNRVRSGELKLESQGLWEVPHPWLNLFLPKSRISDFNKG  403

Query  582   VFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             VF+ I+   N T+GP+L+YPMN+NKWD+R SAV P+E+VFY V  L S+  +  E+    
Sbjct  404   VFRDIVLKRNITTGPVLVYPMNRNKWDDRMSAVIPDEDVFYTVGFLHSSGFDEWEA----  459

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
                 QN++ILKFC+ +GI++KQYLP++  ++EW +HFG KW  F  RK  FDPK ILS G
Sbjct  460   -FDDQNKEILKFCENAGIKVKQYLPYHRNKEEWIKHFGSKWNTFAQRKAHFDPKMILSPG  518

Query  228   QLIFT  214
             Q IF 
Sbjct  519   QRIFN  523



>ref|XP_010921880.1| PREDICTED: cytokinin dehydrogenase 9-like [Elaeis guineensis]
Length=530

 Score =   508 bits (1307),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 241/422 (57%), Positives = 319/422 (76%), Gaps = 9/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M     A    + +    Y D  GGELWI+VL  +L+HGLAPKS
Sbjct  107   HSLQGQAQAPGGVVIDME-YLRATETQVHAGDLPYVDASGGELWINVLLESLKHGLAPKS  165

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L++GGTLSNAGISGQAF HGPQISNVH+L VVTG+GE + CS ++N++LF+ VL
Sbjct  166   WTDYLHLTIGGTLSNAGISGQAFRHGPQISNVHQLQVVTGRGEVMNCSTKENADLFYGVL  225

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+IT ARIALE AP+ V+WIRVLYSDF  FT+DQE LIS       + FDY+EG
Sbjct  226   GGLGQFGIITSARIALEPAPKMVKWIRVLYSDFTNFTEDQEMLIS-----EEKTFDYIEG  280

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF + ++P++ S   SDG +L+CLE+TKN++    D ++QE++ L
Sbjct  281   FVIINRTGLLNNWRSSF-NQKDPIQASQFNSDGRILFCLEMTKNFNPDETDVMNQEVETL  339

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL++IPS++F +++ YV+FLDRVH +ELKLRS+GLW+VPHPWLNL +P++RI +F + 
Sbjct  340   LSKLRYIPSTLFQSEVSYVEFLDRVHISELKLRSQGLWEVPHPWLNLLIPRTRIHDFAKE  399

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  I+ +++ GPIL+YP+N++KWD RTSAV P+EEVFYLVA L SA  + ++  +L++ 
Sbjct  400   VFGKIITDRSHGPILLYPLNRSKWDNRTSAVIPDEEVFYLVAFLSSA-PSSSDHDSLEHA  458

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN  IL FCK++GI MKQYLPHY+T +EWK HFG  WE F  RK  +DP  IL+    
Sbjct  459   LEQNDKILDFCKKAGIRMKQYLPHYTTMEEWKAHFGATWEIFARRKAIYDPLSILAPVHR  518

Query  222   IF  217
             IF
Sbjct  519   IF  520



>ref|XP_009354403.1| PREDICTED: cytokinin dehydrogenase 6-like [Pyrus x bretschneideri]
Length=529

 Score =   508 bits (1307),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 243/423 (57%), Positives = 319/423 (75%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQ+    GVV+ M   +  VP+  + +    Y D  GGELWI++L+ +L++GLAPK
Sbjct  108   HSLQGQSQAHQGVVINME--SLKVPQIQIHTGSSPYVDASGGELWINILRESLKYGLAPK  165

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L++GGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE V CSEEQN +LFH+V
Sbjct  166   SWTDYLHLTIGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVVNCSEEQNEDLFHSV  225

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP RV+WIRVLYSDF AFT+DQE+L+S         FDY+E
Sbjct  226   LGGLGQFGIITRARISLEAAPARVKWIRVLYSDFTAFTQDQEHLMS-----AENTFDYIE  280

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF S ++PV+ S  KSDG  L+CLE+ K ++      +D EI+ 
Sbjct  281   GFVIINRTGLLNNWRSSFNS-KDPVQASQFKSDGKTLFCLELAKYFNLDKTKIIDAEIEN  339

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
              L +L +I S++F +++ Y+DFLDRVH +E+KLRSK LWDVPHPWLNL +PK +I  F +
Sbjct  340   SLSQLSYIRSTLFLSEVAYIDFLDRVHVSEIKLRSKDLWDVPHPWLNLLIPKGKIHTFAK  399

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL   ++GP+LIYP N++KWD RTS V PEE++FYLVA L SAV +   +  L++
Sbjct  400   EVFGNILTETSNGPVLIYPANRSKWDNRTSVVIPEEDIFYLVAFLTSAVPSSTVTDGLEH  459

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL+FC+ + + +KQYLPHY+TQ+EWK HFG +WE F  RK  +DP  IL+ GQ
Sbjct  460   ILTQNQRILEFCETAQLGVKQYLPHYATQEEWKAHFGPRWEDFVQRKSAYDPLAILAPGQ  519

Query  225   LIF  217
              IF
Sbjct  520   RIF  522



>ref|XP_010106427.1| Cytokinin dehydrogenase 1 [Morus notabilis]
 gb|EXC10466.1| Cytokinin dehydrogenase 1 [Morus notabilis]
Length=517

 Score =   507 bits (1306),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 243/423 (57%), Positives = 318/423 (75%), Gaps = 9/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M        + +   K  Y DV GGELWI++L  TL+HGLAPKS
Sbjct  90    HSLQGQAQAHRGVVISMESLKYPEMR-IYPGKSPYVDVSGGELWINILHETLKHGLAPKS  148

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQAF HGPQISNVH+L+VVTGKG+ V CS+E+N +LFH+VL
Sbjct  149   WTDYLHLTVGGTLSNAGVSGQAFQHGPQISNVHQLEVVTGKGDVVNCSKEENEDLFHSVL  208

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP  V+WIRVLYSDF  FT+DQE+LIS         FDY+EG
Sbjct  209   GGLGQFGIITRARISLESAPAIVKWIRVLYSDFAMFTRDQEWLIS-----AENTFDYIEG  263

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSS F+P++P +    KSDG  L+CLE+ K ++    +  +QE+++L
Sbjct  264   FVIINRTGLLNNWRSS-FNPQDPAQAGQFKSDGRTLFCLELAKYFNPDETEMANQEVEIL  322

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +I S++F +++ YV+FLDRVH +E+KLRSKGLW+VPHPWLNL +PKS+I  F + 
Sbjct  323   LGQLNYISSTLFQSEVTYVEFLDRVHISEVKLRSKGLWEVPHPWLNLLIPKSKIHTFAKQ  382

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTP-EEEVFYLVALLRSAVENGNESQTLKN  406
             VF  IL   ++GP+LIYP+NK+KWD RTS V P EEEVFYLVA L SA+ +   +  L +
Sbjct  383   VFGNILTQTSNGPVLIYPVNKSKWDNRTSVVIPEEEEVFYLVAFLSSAIPSSTGNDGLDH  442

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL+FC+ + + +KQYLPHY+TQ+EW+ HFG +WE F  RK  +DP  ILS GQ
Sbjct  443   ILTQNKRILEFCETAHLGVKQYLPHYTTQEEWRAHFGTRWEVFAQRKSVYDPLAILSPGQ  502

Query  225   LIF  217
              IF
Sbjct  503   RIF  505



>ref|XP_006475463.1| PREDICTED: cytokinin dehydrogenase 3-like [Citrus sinensis]
Length=525

 Score =   507 bits (1306),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 241/425 (57%), Positives = 313/425 (74%), Gaps = 8/425 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVP-KPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQAM   GVV++M           +      YADV G +LWIDVL +TLEHGLAP 
Sbjct  104   HSVRGQAMADGGVVVEMMALKNYRNGNGITVGSGFYADVAGEQLWIDVLNATLEHGLAPA  163

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQ F +GPQISNV+ELDV+TGKGE +TCS  +NSELF+A 
Sbjct  164   SWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYELDVITGKGELMTCSALKNSELFYAA  223

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARIALE AP+RV+W+R+LYSDF +F++DQEYLIS++G+   Q  DY+E
Sbjct  224   LGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSSFSRDQEYLISMNGRRQKQALDYLE  283

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             G +I+D+G ++NWRSSFF P +  K  S      ++YCLE+ K YD  T  T+ +E+  L
Sbjct  284   GTLIMDQGSLDNWRSSFFPPSDHPKIISQVKTHAIIYCLEVAKYYDDHTQSTLHKELQTL  343

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
              K L ++P  +F  D+ YV+FL+RV   ELKL S+GLW+VPHPWLNLF+PKSRI +F++G
Sbjct  344   FKGLSYLPGFMFEKDVSYVEFLNRVRSGELKLESQGLWEVPHPWLNLFLPKSRISDFNKG  403

Query  582   VFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             VF+ I+   N T+GP+L+YPMN+NKWD+R SAV P+E+VFY V  L S+  +  E+    
Sbjct  404   VFRDIVLKRNITTGPVLVYPMNRNKWDDRMSAVIPDEDVFYTVGFLHSSGFDEWEA----  459

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
                 QN++ILKFC+ +GI++KQYLP++  ++EW +HFG KW  F  RK  FDPK ILS G
Sbjct  460   -FDDQNKEILKFCENAGIKVKQYLPYHRNKEEWIKHFGSKWNTFAQRKAHFDPKMILSPG  518

Query  228   QLIFT  214
             Q IF 
Sbjct  519   QRIFN  523



>gb|KHN11723.1| Cytokinin dehydrogenase 6 [Glycine soja]
Length=534

 Score =   508 bits (1307),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 244/425 (57%), Positives = 314/425 (74%), Gaps = 10/425 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFM---YADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQA    G+V+ M        +  V E      Y DV GGELWI++L  TL +GLA
Sbjct  109   HSLQGQAQAHGGLVINMESLKVPEMQIHVDEGNKSPPYVDVSGGELWINILHETLRYGLA  168

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             P+SWTDYL+L+VGGTLSNAG+SGQ F HGPQISNV +L++VTG GE + CS E N +LFH
Sbjct  169   PRSWTDYLHLTVGGTLSNAGVSGQTFRHGPQISNVQQLEIVTGTGEVLNCSAENNGDLFH  228

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
              VLGGLGQFG+ITRARI LE AP  V+WIRVLYSDF AFT+DQE LIS       + FDY
Sbjct  229   GVLGGLGQFGIITRARIVLEPAPTMVKWIRVLYSDFTAFTRDQERLIS-----AEKTFDY  283

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             +EGFVI++  GL+NNWR SF +PR+PV+ S  KSDG  L+CLE+ K ++    D  +QE+
Sbjct  284   IEGFVIINRTGLLNNWRLSF-NPRDPVQASHFKSDGRTLFCLEMAKYFNVEEIDAANQEV  342

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             +  L +L +IPS++F+T++ +VDFLDRVH +E+KLRSKGLWDVPHPWLNL +PKS+I  F
Sbjct  343   EEHLSRLSYIPSTLFSTEVTFVDFLDRVHISEVKLRSKGLWDVPHPWLNLLIPKSQILNF  402

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
              + VF  IL   ++GP+LIYP+NK+KWD RTS V PEE++FYLVA L SAV + N +  L
Sbjct  403   AQVVFGNILSETSNGPVLIYPVNKSKWDNRTSVVIPEEDIFYLVAFLTSAVPSSNGTDGL  462

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             +++ SQN+ IL+FC+ + + +KQYLPHY+TQQEW+ HFG +WE F  RK  +DP  IL+ 
Sbjct  463   EHILSQNKRILEFCERAQLGVKQYLPHYNTQQEWRAHFGPQWETFLQRKSVYDPLAILAP  522

Query  231   GQLIF  217
             GQ IF
Sbjct  523   GQRIF  527



>ref|XP_003605865.1| Cytokinin oxidase [Medicago truncatula]
 gb|AES88062.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=528

 Score =   507 bits (1305),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 240/422 (57%), Positives = 317/422 (75%), Gaps = 7/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ+ T  G+V++M        +  V     Y DV GGELWI++L  TL++GLAP+S
Sbjct  106   HSLQGQSQTHGGIVIKMESLKVPEMQIHVGNSSPYVDVSGGELWINILHETLKYGLAPRS  165

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQAF HGPQISNV +L++VTG GE V CSE+QN ELF +VL
Sbjct  166   WTDYLHLTVGGTLSNAGVSGQAFKHGPQISNVQQLEIVTGTGEVVNCSEKQNEELFQSVL  225

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI LE AP  V+WIRVLYSDF  FT+DQE LIS         FDY+EG
Sbjct  226   GGLGQFGIITRARILLEPAPSMVKWIRVLYSDFTEFTRDQERLIS-----EENAFDYIEG  280

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +P++PV+ S  KSDG  L+CLE+ K ++    + V+Q+++  
Sbjct  281   FVIINRTGLLNNWRSSF-NPQDPVQASHFKSDGKTLFCLELAKYFNFQQINIVNQDVERH  339

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +I S++F T++ YV+FLDRVH +E+KLRSKGLWDVPHPWLNLF+PKS+I  F + 
Sbjct  340   LSRLNYIRSTLFQTEVTYVEFLDRVHVSEVKLRSKGLWDVPHPWLNLFIPKSKIHSFAQF  399

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL   ++GP+LIYP+ K+KWD RTS V P+E++FYLVA L SAV + N +  L+++
Sbjct  400   VFGNILTQTSNGPVLIYPVKKSKWDNRTSVVIPDEDIFYLVAFLTSAVPSSNGTDGLEHI  459

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              SQN+ IL++C+   + +KQYLPH++TQ+EW++HFG KWE F  RK  +DP  IL+ GQ 
Sbjct  460   LSQNKRILEYCQRENLGVKQYLPHHNTQEEWRDHFGTKWEIFSQRKFVYDPFAILAPGQR  519

Query  222   IF  217
             IF
Sbjct  520   IF  521



>ref|XP_007154651.1| hypothetical protein PHAVU_003G136400g [Phaseolus vulgaris]
 gb|ESW26645.1| hypothetical protein PHAVU_003G136400g [Phaseolus vulgaris]
Length=535

 Score =   507 bits (1306),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 249/431 (58%), Positives = 327/431 (76%), Gaps = 18/431 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-------GAAAAVPK-PLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS +GQAM   GVV+ M+       G + +V K PL+     YADV G +LWIDVL ++L
Sbjct  105   HSHHGQAMARDGVVVDMATLRKQRNGVSISVSKDPLIGH---YADVGGEQLWIDVLHASL  161

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             EHGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQISNVHE+DV+TGKGE VTCS ++N
Sbjct  162   EHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEMDVITGKGEFVTCSTQKN  221

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
              ELF+AVLGG GQFGVI RARIALE AP+RV+W+R+LYSDF AFTKDQE LIS++G+   
Sbjct  222   LELFNAVLGGFGQFGVIARARIALETAPKRVKWVRLLYSDFSAFTKDQERLISINGRKQK  281

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
                D++EG +++++G INNWRSSFF   +  + +S+ ++ G+LYCLE+ K YD  T   V
Sbjct  282   NALDFLEGMLLMNQGPINNWRSSFFPLSDHPRIASLITEHGILYCLEVAKYYDDQTEKNV  341

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             D+EI VLL+ L +IP   +  ++ YV+FL+RV   ELKL+S+GLW+VPHPWLNLF+PKS+
Sbjct  342   DKEIHVLLQGLAYIPGFYYEKNVSYVEFLNRVRSGELKLQSQGLWEVPHPWLNLFLPKSQ  401

Query  603   IDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             I +F+ GVF  I+   N +SGP+L+YPMN+NKWD+R SA  P+E+VFY V  L S+   G
Sbjct  402   ILDFNSGVFMDIILKRNISSGPVLVYPMNRNKWDDRMSASIPDEDVFYTVGFLHSS---G  458

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
              +S   K   +QNR+IL+FC+++GI++KQYLP++STQ++W  HFG KW +F  RK QFDP
Sbjct  459   FDS--WKAHDAQNREILEFCRDAGIKVKQYLPNHSTQEDWTNHFGTKWLKFLERKHQFDP  516

Query  249   KHILSTGQLIF  217
             + ILS GQ IF
Sbjct  517   RMILSPGQKIF  527



>ref|XP_002876723.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52982.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=528

 Score =   507 bits (1305),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 248/426 (58%), Positives = 315/426 (74%), Gaps = 14/426 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPL----VSEKFMYADVWGGELWIDVLKSTLEHGL  1312
             HS+ GQA T  GVV+ M       P+ L    V     Y DV GGELWI++L  TL++GL
Sbjct  105   HSLQGQAQTRHGVVIHMESLH---PQKLQVYSVDAPAPYVDVSGGELWINILHETLKYGL  161

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             APKSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L++VTGKGE + CS+ QNS+LF
Sbjct  162   APKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGEILNCSKRQNSDLF  221

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
               VLGGLGQFG+ITRARIALE AP  V+WIRVLY DF AF KDQE LIS        KFD
Sbjct  222   DGVLGGLGQFGIITRARIALEPAPTMVKWIRVLYLDFSAFAKDQEQLIS-----ADNKFD  276

Query  951   YVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             Y+EGFVI++  GL+NNWR SF +P  P++ S  KSDG  LYCLE+ K   Q   D ++QE
Sbjct  277   YIEGFVIINRTGLLNNWRLSF-TPEEPLEASQFKSDGRTLYCLELAKYLKQDNKDVINQE  335

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             +   L +L ++ S++F+T++ Y  FLDRVH +E+KLRSKG W+VPHPWLNL VP+S I E
Sbjct  336   VKETLSELSYVSSTLFSTEVTYEAFLDRVHVSEVKLRSKGQWEVPHPWLNLLVPRSTIKE  395

Query  594   FDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQT  415
             F +GVF  IL + ++GP+++YP+NK+KWD +TSAVTPEEEVFYLVA+L SAV    +   
Sbjct  396   FAKGVFGNILTDTSNGPVIVYPVNKSKWDNQTSAVTPEEEVFYLVAILTSAVPGKEDGGG  455

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILS  235
             ++ +  +NR IL+F +E+GI +KQYLPHY+T++EW+ HFG KW  F  RK ++DP  IL+
Sbjct  456   VEQILKRNRRILEFSEEAGIGLKQYLPHYTTREEWRSHFGAKWGEFVRRKSRYDPLAILA  515

Query  234   TGQLIF  217
              GQ IF
Sbjct  516   PGQRIF  521



>ref|NP_001055371.2| Os05g0374200 [Oryza sativa Japonica Group]
 sp|Q75K78.1|CKX9_ORYSJ RecName: Full=Cytokinin dehydrogenase 9; AltName: Full=Cytokinin 
oxidase 9; Short=OsCKX9; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|AAT01339.1| putative cytokinin dehydrogenase [Oryza sativa Japonica Group]
 gb|AAT58842.1| putative cytokinin dehydrogenase [Oryza sativa Japonica Group]
 gb|EEE63503.1| hypothetical protein OsJ_18319 [Oryza sativa Japonica Group]
 dbj|BAF17285.2| Os05g0374200 [Oryza sativa Japonica Group]
Length=521

 Score =   506 bits (1304),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 241/424 (57%), Positives = 323/424 (76%), Gaps = 16/424 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK--PLVSEKFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQ+  A G+++ M    +   +  P VS    Y D  GGELWI+VL  TL++GLAP
Sbjct  100   HSLYGQSQAAEGIIISMESLQSNTMRVNPGVSP---YVDASGGELWINVLHETLKYGLAP  156

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYL+L+VGGTLSNAG+SGQ F HGPQISNV+EL++VTG+G+ +TCS EQNS+LFHA
Sbjct  157   KSWTDYLHLTVGGTLSNAGVSGQTFRHGPQISNVNELEIVTGRGDVITCSPEQNSDLFHA  216

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
              LGGLGQFGVITRARI LE AP+ VRW+RVLY DF +FT+DQE LIS       + FDY+
Sbjct  217   ALGGLGQFGVITRARIPLEPAPKMVRWLRVLYLDFTSFTEDQEMLISAE-----KTFDYI  271

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EGFVI++  G++NNWRSSF +P++PV+ S  +SDG VL+CLE+TKN++   AD ++QE++
Sbjct  272   EGFVIINRTGILNNWRSSF-NPQDPVRSSQFESDGKVLFCLEMTKNFNPDEADVMEQEVN  330

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LL +L+++PSS+F TD+ Y++FLDRVH +E+KLR+KG+W+VPHPWLN+ +P+S I +F 
Sbjct  331   TLLSQLRYMPSSLFHTDVTYIEFLDRVHSSEMKLRAKGMWEVPHPWLNIIIPRSMIHKFA  390

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             + VF  IL +  +GPIL+YP+NK++WD RTS V P+EEVFYLVA L SA+   N   TL 
Sbjct  391   KEVFGKILKDSNNGPILLYPVNKSRWDNRTSVVIPDEEVFYLVAFLSSALGPHNIKHTL-  449

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
                  N  I++F  ++GI +KQYLP+Y+T+QEW+ HFG +W+ FQ RK  +DP  IL+ G
Sbjct  450   ---DLNYRIIEFSDKAGIGVKQYLPNYTTEQEWQSHFGARWDTFQQRKKAYDPLAILAPG  506

Query  228   QLIF  217
             Q IF
Sbjct  507   QRIF  510



>gb|AII20187.1| cytokinin oxidase/dehydrogenase-like 7 [Nicotiana tabacum]
Length=552

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 241/423 (57%), Positives = 320/423 (76%), Gaps = 8/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M S  A A+     +++  + DV  GELWI++L  +L+ GL PK
Sbjct  127   HSLEGQAQAYQGVVINMESLRAPAMRFHTGNQELTFVDVSAGELWINILHESLKLGLTPK  186

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKGE +TCSEEQN++LF+ V
Sbjct  187   SWTDYLHLAVGGTLSNAGISGQAFKHGPQINNVYQLEVVTGKGEVITCSEEQNADLFYGV  246

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARIALE AP++V+WIRVLYSDF  F+ DQE+LISL        FDY+E
Sbjct  247   LGGLGQFGIITRARIALEPAPKKVKWIRVLYSDFSTFSYDQEHLISLE-----NSFDYIE  301

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRS+F +P++P+      S+G VLYCLE+ K ++       DQ +DV
Sbjct  302   GFVIINRTGLLNNWRSTF-NPKDPLLAKEFSSEGKVLYCLEVAKYFNPEETTKTDQNVDV  360

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL KL +I S++F +++ YVDFLDRVH +E+KLR KGLWD+PHPWLNL +PKS+I +F R
Sbjct  361   LLSKLNYIQSTLFQSEVSYVDFLDRVHVSEMKLREKGLWDIPHPWLNLLIPKSKIHDFAR  420

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + + GPILIYP+NK+KW + TS VTP+E+VFYL+A L SA+ +   +  L++
Sbjct  421   EVFGKILTDTSHGPILIYPVNKSKWRKGTSMVTPDEDVFYLIAFLSSAMSSSTGNDGLRH  480

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +Q++ IL FC+E+ I MKQYLP+Y  ++EWK+HFG +WE F  RK  +DP  IL+ GQ
Sbjct  481   ILAQSKRILNFCEETNIGMKQYLPNYKNKEEWKDHFGHQWEAFARRKSTYDPLAILAPGQ  540

Query  225   LIF  217
              IF
Sbjct  541   RIF  543



>ref|XP_011037797.1| PREDICTED: cytokinin dehydrogenase 6-like [Populus euphratica]
Length=530

 Score =   506 bits (1303),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 242/423 (57%), Positives = 321/423 (76%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M   +  V K  V S  + Y D  GGELWID+L+  L++GLAPK
Sbjct  109   HSLQGQAQAHQGVVINME--SLQVHKMHVYSGNYPYVDASGGELWIDILRECLKYGLAPK  166

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAG+SGQAF HGPQISNV++L+VVTGKGE + CSE+QNS+LFH V
Sbjct  167   SWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVNQLEVVTGKGEVLNCSEKQNSDLFHGV  226

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP +V+WIRVLYSDF  F  DQE LI          FDY+E
Sbjct  227   LGGLGQFGIITRARISLEPAPDKVKWIRVLYSDFTTFATDQERLIG-----AESTFDYIE  281

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++   L+NNWRSSF  P++PV+ S  +SDG  LYCLE+ K +++   D +++E+  
Sbjct  282   GFVIINRTSLLNNWRSSF-DPQDPVQASQFQSDGRTLYCLELAKYFNRDRIDALNEEVGN  340

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L+++ S++F T++ Y++FLDRVH +E+KLRSKGLW+VPHPWLNL +PK++I++F  
Sbjct  341   LLSQLRYMASTLFLTEVSYLEFLDRVHVSEVKLRSKGLWEVPHPWLNLLIPKTKINDFAD  400

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GPILIYP+NK+KWD RTSAV PEE++FYLVA L SA+ +   +  L++
Sbjct  401   EVFGNILTDTSNGPILIYPVNKSKWDNRTSAVLPEEDIFYLVAFLNSAMPSSMGTDGLEH  460

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL+FC+ + + MKQYLPHY+TQ EW+ HFG +WE F  RK  +DP  IL+ GQ
Sbjct  461   ILTQNKRILEFCETARLGMKQYLPHYNTQGEWRAHFGPRWEVFAQRKSTYDPLAILAPGQ  520

Query  225   LIF  217
              IF
Sbjct  521   RIF  523



>ref|NP_001244909.1| cytokinin oxidase/dehydrogenase-like 2 [Solanum lycopersicum]
 dbj|BAM09005.1| cytokinin oxidase/dehydrogenase-like [Solanum lycopersicum]
Length=533

 Score =   506 bits (1304),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 243/424 (57%), Positives = 318/424 (75%), Gaps = 9/424 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSE--KFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQA T  GV++ M          +     KF Y DV  GELWI++L  TL +GLAP
Sbjct  109   HSLQGQAQTRGGVIINMESLQQDQEMQVYYNGVKFPYVDVSAGELWINILHETLRYGLAP  168

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE + CS+EQN++LFHA
Sbjct  169   KSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVLICSQEQNADLFHA  228

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFG+IT+ARI+LE AP+ V+WIRVLYSDF AF +DQE LIS       + FDY+
Sbjct  229   VLGGLGQFGIITKARISLERAPKMVKWIRVLYSDFSAFARDQERLIS-----ALKTFDYI  283

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EG VI ++ GL+NNWR+SF  P++PV+ S   SDG  LYCLE+TKN      DTV+QEI+
Sbjct  284   EGLVIKNKTGLLNNWRTSF-DPQDPVQASHFVSDGRTLYCLELTKNLYPENFDTVNQEIE  342

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LL +L +IPS++F +++PY+DFLDRVH +EL LRSKGLWD+PHPWLNL VPKS+I  F 
Sbjct  343   DLLSQLSYIPSTLFMSEVPYIDFLDRVHASELILRSKGLWDLPHPWLNLLVPKSKIQHFA  402

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
               VF  IL +  +GP+L+YP++K+K D RTS V P+E++ YLVA L  A  + + + +L+
Sbjct  403   NEVFGNILSDTNNGPVLVYPIHKSKVDNRTSFVCPDEDIIYLVAFLSHANPSSSGTDSLQ  462

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
             ++ +QN+ IL FC+ S + +KQYLPHY+TQ++W++HFG KW+ F  RK  +DP  +L+ G
Sbjct  463   HVLTQNKRILDFCEVSHLGVKQYLPHYTTQEQWRKHFGPKWDVFVQRKSVYDPLAMLAPG  522

Query  228   QLIF  217
             Q IF
Sbjct  523   QNIF  526



>ref|XP_009590336.1| PREDICTED: cytokinin dehydrogenase 6-like [Nicotiana tomentosiformis]
Length=530

 Score =   506 bits (1303),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 243/425 (57%), Positives = 319/425 (75%), Gaps = 14/425 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM---SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQA    GV++ M    G    V +     +F Y DV  GELWI++L  TL++GLA
Sbjct  109   HSLQGQAQARRGVIINMESFQGQGMQVHR----GQFPYVDVSAGELWINILHETLKYGLA  164

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE + CS+EQN++LFH
Sbjct  165   PKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVLICSKEQNADLFH  224

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             AVLGGLGQFG+ITRARI+LE AP+ V+WIRVLYSDF  F +DQE+LIS      A+ FDY
Sbjct  225   AVLGGLGQFGIITRARISLERAPKMVKWIRVLYSDFSTFARDQEHLIS-----AAKTFDY  279

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             +EG VI ++ GL+NNWR+SF  P++PV+ S   SDG  LYCLE+T+N     +DTV+QEI
Sbjct  280   IEGLVIKNKTGLMNNWRTSF-DPQDPVQASHFVSDGRTLYCLELTRNLYPEKSDTVNQEI  338

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
               LL +L +IPS++F +++PY++FLDRVH +ELKLRSKGLWD+PHPWLNL VPKS+I  F
Sbjct  339   KDLLSQLSYIPSTLFMSEVPYIEFLDRVHASELKLRSKGLWDLPHPWLNLLVPKSKIQHF  398

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
              + VF  IL +  +GP+L+YP++K+K D RTS V+P  ++ YLVA L  A  + N + +L
Sbjct  399   AKEVFGNILRDTNNGPVLVYPIHKSKLDNRTSFVSPNNDIIYLVAFLSHANPSSNGTDSL  458

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             + + +QN+ IL FC  + + +KQYLPHY+TQ++W+ HFG KWE F  RK  +DP  +L+ 
Sbjct  459   EYVLTQNKRILDFCDVAHLGVKQYLPHYTTQEQWRTHFGPKWEVFIQRKSAYDPLAMLAP  518

Query  231   GQLIF  217
             GQ IF
Sbjct  519   GQRIF  523



>gb|KHN35852.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=514

 Score =   505 bits (1301),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 246/438 (56%), Positives = 309/438 (71%), Gaps = 21/438 (5%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG--------------AAAAVPKPLVSEKFMYADVWGGELWID  1342
             HS  GQAM   GVV+ M+G              +    P       + YADV G +LWID
Sbjct  81    HSTRGQAMVRDGVVVDMAGFRERGNGEGIRVVMSVVVDPNNKNGYGYYYADVGGEQLWID  140

Query  1341  VLKSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVT  1162
             VL +TLEHGLAP SWTDYLYL+VGGTLSNAGISGQ F +GPQI+ V ++DV+TGKGE VT
Sbjct  141   VLNATLEHGLAPMSWTDYLYLTVGGTLSNAGISGQTFRYGPQITTVRQMDVITGKGEFVT  200

Query  1161  CSEEQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISL  982
             CS++ NSELFHAVLGGLGQFG+ITRARIAL  AP+RV+W+R+LY+DF AFTKDQE LIS+
Sbjct  201   CSQQTNSELFHAVLGGLGQFGIITRARIALAPAPKRVKWVRLLYNDFSAFTKDQEQLISI  260

Query  981   HGQPPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQ  802
               +      DY+EG +++ +G INNWRSSFF   +  +  S+ +   VLYCLE+ K YD 
Sbjct  261   TRRKQNIALDYLEGLLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVAKYYDG  320

Query  801   STADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNL  622
                + VD+E+ VLL+ L +IP   +  D+ YV+FL+RV   ELKL+S+GLWDVPHPWLNL
Sbjct  321   QNENNVDKELKVLLQGLSYIPGFYYEKDVSYVEFLNRVRSGELKLQSQGLWDVPHPWLNL  380

Query  621   FVPKSRIDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLR  448
             F+PKS+I EFD GVFK I+   N T+GP+L+YPMN+NKWD R SA  P+E++FY V  L 
Sbjct  381   FIPKSQIMEFDSGVFKNIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYTVGFLH  440

Query  447   SAVENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHR  268
             S+          K   +QN++IL+FC +SGI++KQYLPHY TQ++W  HFG KW  F  R
Sbjct  441   SS-----GFDNWKAYDAQNKEILQFCNDSGIKVKQYLPHYRTQEDWTNHFGPKWRTFVER  495

Query  267   KLQFDPKHILSTGQLIFT  214
             K QFDPK ILS GQ IF 
Sbjct  496   KHQFDPKMILSPGQRIFN  513



>ref|XP_006451484.1| hypothetical protein CICLE_v10007992mg [Citrus clementina]
 gb|ESR64724.1| hypothetical protein CICLE_v10007992mg [Citrus clementina]
Length=525

 Score =   506 bits (1302),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 313/425 (74%), Gaps = 8/425 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVP-KPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQAM   GVV++M           +      YADV G +LWIDVL +TLEHGLAP 
Sbjct  104   HSVRGQAMADGGVVVEMMALKNYRNGNGITVGSGFYADVAGEQLWIDVLNATLEHGLAPA  163

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYLYL+VGGTLSNAGISGQ F +GPQISNV+ELDV++GKGE +TCS  +NSELF+A 
Sbjct  164   SWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYELDVISGKGELMTCSALKNSELFYAA  223

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARIALE AP+RV+W+R+LYSDF +F++DQEYLIS++G+   Q  DY+E
Sbjct  224   LGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSSFSRDQEYLISMNGRRQKQALDYLE  283

Query  942   GFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             G +I+D+G ++NWRSSFF P +  K  S      ++YCLE+ K YD  T  T+ +E+  L
Sbjct  284   GTLIMDQGSLDNWRSSFFPPSDHPKIISQVKTHAIIYCLEVAKYYDDHTQSTLHKELQTL  343

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
              K L ++P  +F  D+ YV+FL+RV   ELKL S+GLW+VPHPWLNLF+PKSRI +F++G
Sbjct  344   FKGLSYLPGFMFEKDVSYVEFLNRVRSGELKLESQGLWEVPHPWLNLFLPKSRISDFNKG  403

Query  582   VFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             VF+ I+   N T+GP+L+YPMN+NKWD+R SAV P+E+VFY V  L S+  +  E+    
Sbjct  404   VFRDIVLKRNITTGPVLVYPMNRNKWDDRMSAVIPDEDVFYTVGFLHSSGFDEWEA----  459

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
                 QN++ILKFC+ +GI++KQYLP++  ++EW +HFG KW  F  RK  FDPK ILS G
Sbjct  460   -FDDQNKEILKFCENAGIKVKQYLPYHRNKEEWIKHFGSKWNTFAQRKAHFDPKMILSPG  518

Query  228   QLIFT  214
             Q IF 
Sbjct  519   QRIFN  523



>ref|XP_008445865.1| PREDICTED: cytokinin dehydrogenase 6 [Cucumis melo]
Length=547

 Score =   506 bits (1304),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 239/423 (57%), Positives = 319/423 (75%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS++GQA    GVV+ M       P+  V +  F Y DV GGELWI++L  +L++GL PK
Sbjct  126   HSLHGQAQAHQGVVINMKSLQG--PQMQVHTRNFTYIDVSGGELWINILHESLKYGLTPK  183

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L++VTGKG+ V CS+EQNS+LF++V
Sbjct  184   SWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGDVVNCSKEQNSDLFYSV  243

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRA+I LE AP  V+WIRVLY DF  F+++QE LIS         FDY+E
Sbjct  244   LGGLGQFGIITRAKILLEPAPTMVKWIRVLYLDFTTFSREQELLISAQN-----TFDYIE  298

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF +P++PV+ S  KSDG +LYCLE+ K +  +  + +DQE+  
Sbjct  299   GFVIINRTGLLNNWRSSF-NPQDPVQASQFKSDGKILYCLELAKYFHHTEGNIIDQEVMR  357

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L +IPS++F +++ YV+FLDRV  + +KL+SKGLW+VPHPWLNL +PKS+I +F  
Sbjct  358   LLSQLSYIPSTLFISEVTYVEFLDRVQVSAVKLQSKGLWEVPHPWLNLLIPKSKIKKFAE  417

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
             GVF  IL   ++GP+LIYP+NK+KWD RTS + PEEE+FYLVA L SAV +   + +L+ 
Sbjct  418   GVFGNILKETSNGPVLIYPVNKSKWDNRTSVIIPEEEIFYLVAFLTSAVPSSRGNDSLEY  477

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN  IL+FCK + + +KQYLPHY+T++EW+ HFG  WE +  RK  +DP  IL+ GQ
Sbjct  478   ILTQNMRILEFCKTANLGVKQYLPHYTTRKEWQAHFGPMWETYVQRKAAYDPLAILAPGQ  537

Query  225   LIF  217
              IF
Sbjct  538   RIF  540



>emb|CBI27904.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   504 bits (1299),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 246/428 (57%), Positives = 315/428 (74%), Gaps = 18/428 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-----SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHG  1315
             HS+ GQAM   GVV+ M     SGA   +          YADV G +LWIDVL++TLEHG
Sbjct  75    HSLGGQAMAPNGVVVDMTSLKNSGAGIGIKVTKNPVSGSYADVGGHQLWIDVLQATLEHG  134

Query  1314  LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSEL  1135
             LAP SWTDYLYL+VGGTLSNAG SGQ F HGPQISNVHE+D++TGKGE VTCS+E NS+L
Sbjct  135   LAPVSWTDYLYLTVGGTLSNAGGSGQTFRHGPQISNVHEMDIITGKGELVTCSKETNSDL  194

Query  1134  FHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKF  955
             F+AVLGGLGQFG+ITRARI LE AP+RV+W+R+LY DF  F++DQE+LIS++G       
Sbjct  195   FYAVLGGLGQFGIITRARIPLEPAPKRVKWVRMLYDDFSTFSEDQEHLISING------L  248

Query  954   DYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             DY+EG +I  +   NNWRSSFFS       SS+ +  G++Y +E+ K YD  T+ TVD+E
Sbjct  249   DYLEGSLITKQSPPNNWRSSFFSKSQYPIISSLLTKNGIIYSIEVVKYYDDLTSHTVDEE  308

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             +  L K L+F+P  VFT D+  VDFLDRVH  EL+L++KGLWDVPHPWLNLFVPKSRI +
Sbjct  309   LQELFKGLRFLPGLVFTKDVTLVDFLDRVHNGELQLQAKGLWDVPHPWLNLFVPKSRISD  368

Query  594   FDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNES  421
             F+ GVF+ I+   N+T GP+L+YPM +NKWD   SA  P+E++FY + LL S+  +  E 
Sbjct  369   FNSGVFRDIILKTNQTVGPLLVYPMIRNKWDNGMSAAIPDEDIFYSIGLLHSSGADDWEP  428

Query  420   QTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHI  241
                  L++QN++ILKFC ++GI++KQYLP Y+T+ +W  HFG KW+ F+ RK QFDPK+I
Sbjct  429   -----LENQNKEILKFCDKAGIKIKQYLPRYTTKADWMNHFGPKWKIFEDRKAQFDPKNI  483

Query  240   LSTGQLIF  217
             LS GQ IF
Sbjct  484   LSPGQRIF  491



>ref|XP_002279519.1| PREDICTED: cytokinin dehydrogenase 3 [Vitis vinifera]
Length=521

 Score =   505 bits (1301),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 246/428 (57%), Positives = 315/428 (74%), Gaps = 18/428 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-----SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHG  1315
             HS+ GQAM   GVV+ M     SGA   +          YADV G +LWIDVL++TLEHG
Sbjct  102   HSLGGQAMAPNGVVVDMTSLKNSGAGIGIKVTKNPVSGSYADVGGHQLWIDVLQATLEHG  161

Query  1314  LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSEL  1135
             LAP SWTDYLYL+VGGTLSNAG SGQ F HGPQISNVHE+D++TGKGE VTCS+E NS+L
Sbjct  162   LAPVSWTDYLYLTVGGTLSNAGGSGQTFRHGPQISNVHEMDIITGKGELVTCSKETNSDL  221

Query  1134  FHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKF  955
             F+AVLGGLGQFG+ITRARI LE AP+RV+W+R+LY DF  F++DQE+LIS++G       
Sbjct  222   FYAVLGGLGQFGIITRARIPLEPAPKRVKWVRMLYDDFSTFSEDQEHLISING------L  275

Query  954   DYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             DY+EG +I  +   NNWRSSFFS       SS+ +  G++Y +E+ K YD  T+ TVD+E
Sbjct  276   DYLEGSLITKQSPPNNWRSSFFSKSQYPIISSLLTKNGIIYSIEVVKYYDDLTSHTVDEE  335

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             +  L K L+F+P  VFT D+  VDFLDRVH  EL+L++KGLWDVPHPWLNLFVPKSRI +
Sbjct  336   LQELFKGLRFLPGLVFTKDVTLVDFLDRVHNGELQLQAKGLWDVPHPWLNLFVPKSRISD  395

Query  594   FDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNES  421
             F+ GVF+ I+   N+T GP+L+YPM +NKWD   SA  P+E++FY + LL S+  +  E 
Sbjct  396   FNSGVFRDIILKTNQTVGPLLVYPMIRNKWDNGMSAAIPDEDIFYSIGLLHSSGADDWEP  455

Query  420   QTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHI  241
                  L++QN++ILKFC ++GI++KQYLP Y+T+ +W  HFG KW+ F+ RK QFDPK+I
Sbjct  456   -----LENQNKEILKFCDKAGIKIKQYLPRYTTKADWMNHFGPKWKIFEDRKAQFDPKNI  510

Query  240   LSTGQLIF  217
             LS GQ IF
Sbjct  511   LSPGQRIF  518



>ref|XP_003539919.1| PREDICTED: cytokinin dehydrogenase 6-like [Glycine max]
Length=538

 Score =   506 bits (1303),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 246/426 (58%), Positives = 313/426 (73%), Gaps = 13/426 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV----SEKFMYADVWGGELWIDVLKSTLEHGL  1312
             HS+ GQA    GVV+ M   +  VP+  V         Y DV GGELWI++L  TL +GL
Sbjct  114   HSLQGQAQAHGGVVINME--SLKVPEMQVHVDVGNSPPYVDVSGGELWINILHETLRYGL  171

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             AP+SWTDYL+L+VGGTLSNAG+SGQAF HGPQISNV +L++VTG GE V CS E N +LF
Sbjct  172   APRSWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVQQLEIVTGTGEVVNCSAENNGDLF  231

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             H+VLGGLGQFG+ITRARI LE AP  V+WIRVLYSDF AFT+DQE LIS         FD
Sbjct  232   HSVLGGLGQFGIITRARIVLEPAPAMVKWIRVLYSDFTAFTRDQERLIS-----AENTFD  286

Query  951   YVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             Y+EGFVI++  GL+NNWR SF +P++PV+ S  KSDG  L+CLE+ K ++    D  +QE
Sbjct  287   YIEGFVIINRTGLLNNWRLSF-NPQDPVQASHFKSDGRTLFCLEMAKYFNVEEIDAANQE  345

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             ++  L +L +IPS++F+T++ +VDFLDRVH +E+KLRSKGLWDVPHPWLNL +PKS+I  
Sbjct  346   VEEHLSRLSYIPSTLFSTEVTFVDFLDRVHISEVKLRSKGLWDVPHPWLNLLIPKSQIHN  405

Query  594   FDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQT  415
             F   VF  IL   ++GP+LIYP+NK+KWD RTS V PEE +FYLVA L SAV +   +  
Sbjct  406   FAEVVFGNILTETSNGPVLIYPVNKSKWDNRTSVVIPEEAIFYLVAFLTSAVPSSTGTDG  465

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILS  235
             L+++ SQN+ IL+FC+ + + +KQYLPHY+TQQEW+ HFG  WE F  RK  +DP  IL+
Sbjct  466   LEHILSQNKRILEFCESAQLGVKQYLPHYNTQQEWRAHFGPHWETFLQRKSVYDPLAILA  525

Query  234   TGQLIF  217
              GQ IF
Sbjct  526   PGQRIF  531



>ref|XP_003534923.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=546

 Score =   506 bits (1303),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 246/437 (56%), Positives = 309/437 (71%), Gaps = 21/437 (5%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG--------------AAAAVPKPLVSEKFMYADVWGGELWID  1342
             HS  GQAM   GVV+ M+G              +    P       + YADV G +LWID
Sbjct  113   HSTRGQAMVRDGVVVDMAGFRERGNGEGIRVVMSVVVDPNNKNGYGYYYADVGGEQLWID  172

Query  1341  VLKSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVT  1162
             VL +TLEHGLAP SWTDYLYL+VGGTLSNAGISGQ F +GPQI+ V ++DV+TGKGE VT
Sbjct  173   VLNATLEHGLAPMSWTDYLYLTVGGTLSNAGISGQTFRYGPQITTVRQMDVITGKGEFVT  232

Query  1161  CSEEQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISL  982
             CS++ NSELFHAVLGGLGQFG+ITRARIAL  AP+RV+W+R+LY+DF AFTKDQE LIS+
Sbjct  233   CSQQTNSELFHAVLGGLGQFGIITRARIALAPAPKRVKWVRLLYNDFSAFTKDQEQLISI  292

Query  981   HGQPPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQ  802
               +      DY+EG +++ +G INNWRSSFF   +  +  S+ +   VLYCLE+ K YD 
Sbjct  293   TRRKQNIALDYLEGLLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVAKYYDG  352

Query  801   STADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNL  622
                + VD+E+ VLL+ L +IP   +  D+ YV+FL+RV   ELKL+S+GLWDVPHPWLNL
Sbjct  353   QNENNVDKELKVLLQGLSYIPGFYYEKDVSYVEFLNRVRSGELKLQSQGLWDVPHPWLNL  412

Query  621   FVPKSRIDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLR  448
             F+PKS+I EFD GVFK I+   N T+GP+L+YPMN+NKWD R SA  P+E++FY V  L 
Sbjct  413   FIPKSQIMEFDSGVFKNIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYTVGFLH  472

Query  447   SAVENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHR  268
             S+          K   +QN++IL+FC +SGI++KQYLPHY TQ++W  HFG KW  F  R
Sbjct  473   SS-----GFDNWKAYDAQNKEILQFCNDSGIKVKQYLPHYRTQEDWTNHFGPKWRTFVER  527

Query  267   KLQFDPKHILSTGQLIF  217
             K QFDPK ILS GQ IF
Sbjct  528   KHQFDPKMILSPGQRIF  544



>gb|EAY97807.1| hypothetical protein OsI_19727 [Oryza sativa Indica Group]
Length=521

 Score =   505 bits (1300),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 240/424 (57%), Positives = 323/424 (76%), Gaps = 16/424 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK--PLVSEKFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQ+  A G+++ M    +   +  P VS    Y D  GGELWI+VL  TL++GLAP
Sbjct  100   HSLYGQSQAAEGIIISMESLQSNTMRVNPGVSP---YVDASGGELWINVLHETLKYGLAP  156

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYL+L+VGGTLSNAG+SGQ F HGPQISNV+EL++VTG+G+ +TCS +QNS+LFHA
Sbjct  157   KSWTDYLHLTVGGTLSNAGVSGQTFRHGPQISNVNELEIVTGRGDVITCSPKQNSDLFHA  216

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
              LGGLGQFGVITRARI LE AP+ VRW+RVLY DF +FT+DQE LIS       + FDY+
Sbjct  217   ALGGLGQFGVITRARIPLEPAPKMVRWLRVLYLDFTSFTEDQEMLISAE-----KTFDYI  271

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EGFVI++  G++NNWRSSF +P++PV+ S  +SDG VL+CLE+TKN++   AD ++QE++
Sbjct  272   EGFVIINRTGILNNWRSSF-NPQDPVRSSQFESDGKVLFCLEMTKNFNPDEADVMEQEVN  330

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LL +L+++PSS+F TD+ Y++FLDRVH +E+KLR+KG+W+VPHPWLN+ +P+S I +F 
Sbjct  331   TLLSQLRYMPSSLFHTDVTYIEFLDRVHSSEMKLRAKGMWEVPHPWLNIIIPRSMIHKFA  390

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             + VF  IL +  +GPIL+YP+NK++WD RTS V P+EEVFYLVA L SA+   N   TL 
Sbjct  391   KEVFGKILKDSNNGPILLYPVNKSRWDNRTSVVIPDEEVFYLVAFLSSALGPHNIKHTL-  449

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
                  N  I++F  ++GI +KQYLP+Y+T+QEW+ HFG +W+ FQ RK  +DP  IL+ G
Sbjct  450   ---DLNYRIIEFSDKAGIGVKQYLPNYTTEQEWQSHFGARWDTFQQRKKAYDPLAILAPG  506

Query  228   QLIF  217
             Q IF
Sbjct  507   QRIF  510



>ref|XP_003534375.1| PREDICTED: cytokinin dehydrogenase 6-like [Glycine max]
Length=534

 Score =   505 bits (1300),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 244/425 (57%), Positives = 313/425 (74%), Gaps = 10/425 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFM---YADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQA    G+V+ M        +  V E      Y DV GGELWI++L  TL +GLA
Sbjct  109   HSLQGQAQAHGGLVINMESLKVPEMQIHVDEGNKSPPYVDVSGGELWINILHETLRYGLA  168

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             P+SWTDYL+L+VGGTLSNAG+SGQ F HGPQISNV +L++VTG GE + CS E N +LFH
Sbjct  169   PRSWTDYLHLTVGGTLSNAGVSGQTFRHGPQISNVQQLEIVTGTGEVLNCSAENNGDLFH  228

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
              VLGGLGQFG+ITRARI LE AP  V+WIRVLYSDF AFT+DQE LIS       + FDY
Sbjct  229   GVLGGLGQFGIITRARIVLEPAPTMVKWIRVLYSDFTAFTRDQERLIS-----AEKTFDY  283

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             +EGFVI++  GL+NNWR SF +PR+PV+ S  KSDG  L+CLE+ K  +    D  +QE+
Sbjct  284   IEGFVIINRTGLLNNWRLSF-NPRDPVQASHFKSDGRTLFCLEMAKYLNVEEIDAANQEV  342

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             +  L +L +IPS++F+T++ +VDFLDRVH +E+KLRSKGLWDVPHPWLNL +PKS+I  F
Sbjct  343   EEHLSRLSYIPSTLFSTEVTFVDFLDRVHISEVKLRSKGLWDVPHPWLNLLIPKSQILNF  402

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
              + VF  IL   ++GP+LIYP+NK+KWD RTS V PEE++FYLVA L SAV + N +  L
Sbjct  403   AQVVFGNILSETSNGPVLIYPVNKSKWDNRTSVVIPEEDIFYLVAFLTSAVPSSNGTDGL  462

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             +++ SQN+ IL+FC+ + + +KQYLPHY+TQQEW+ HFG +WE F  RK  +DP  IL+ 
Sbjct  463   EHILSQNKRILEFCERAQLGVKQYLPHYNTQQEWRAHFGPQWETFLLRKSVYDPLAILAP  522

Query  231   GQLIF  217
             GQ IF
Sbjct  523   GQRIF  527



>ref|XP_007138720.1| hypothetical protein PHAVU_009G231700g [Phaseolus vulgaris]
 gb|ESW10714.1| hypothetical protein PHAVU_009G231700g [Phaseolus vulgaris]
Length=539

 Score =   505 bits (1301),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 246/434 (57%), Positives = 311/434 (72%), Gaps = 18/434 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG----------AAAAVPKPLVSEKFMYADVWGGELWIDVLKS  1330
             HS  GQAM   GVV+ M+G            +    P V   F YADV G +LWIDVL +
Sbjct  109   HSTRGQAMARGGVVVDMAGFRERGSGVGIKVSNTVDPSVGY-FHYADVGGEQLWIDVLHA  167

Query  1329  TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEE  1150
             TL+HGLAP SWTDYLYL+VGGTLSNAGISGQ F +GPQIS V E+DV+TGKGE+VTCS +
Sbjct  168   TLQHGLAPLSWTDYLYLTVGGTLSNAGISGQTFRYGPQISTVREMDVITGKGETVTCSPQ  227

Query  1149  QNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQP  970
              NSELFH VLGGLGQFG+ITRARIAL  AP+RV+WIR+LY DF +FTKDQE LIS++G+ 
Sbjct  228   TNSELFHGVLGGLGQFGIITRARIALAPAPKRVKWIRLLYKDFSSFTKDQEQLISMNGRK  287

Query  969   PAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTAD  790
                  DYVEG +++ +G INNWRSSFF   +  +  S+ +   VLYCLE+ K YD  + +
Sbjct  288   QNIGVDYVEGSLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVAKYYDGQSEN  347

Query  789   TVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPK  610
              VD+E+ VLL+ L +IP   +  D+ YV+FL+RV   ELKL+S+GLWDVPHPWLNLF+PK
Sbjct  348   NVDKELQVLLQGLSYIPGFYYEKDVSYVEFLNRVRSGELKLQSQGLWDVPHPWLNLFIPK  407

Query  609   SRIDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVE  436
             S+I +FD GVFK I+   N T+GP+L+YPMN+NKWD R SA  P+E++FY V  L S+  
Sbjct  408   SQIMDFDSGVFKDIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYTVGFLHSS--  465

Query  435   NGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQF  256
                     K   +QN++IL+FC ++G+++KQYLPHY TQ++W  HFG KW  F  RK QF
Sbjct  466   ---GFDNWKAYDTQNKEILQFCNDAGMKIKQYLPHYRTQEDWTNHFGPKWRSFVERKQQF  522

Query  255   DPKHILSTGQLIFT  214
             DP+ ILS GQ IF 
Sbjct  523   DPRMILSPGQRIFN  536



>ref|XP_010067774.1| PREDICTED: cytokinin dehydrogenase 6-like [Eucalyptus grandis]
 gb|KCW65970.1| hypothetical protein EUGRSUZ_G03270 [Eucalyptus grandis]
Length=548

 Score =   505 bits (1301),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 237/422 (56%), Positives = 316/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M    + + + +   KF Y DV  G+LWI++L+ ++ HGLAPKS
Sbjct  127   HSLQGQAQAYRGVVVNMKCLQSPIMQ-VHGGKFPYVDVSAGDLWINILRESMRHGLAPKS  185

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+V+TGKGE V CS  QN +LFH+VL
Sbjct  186   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVITGKGEVVKCSANQNEDLFHSVL  245

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+IT+ARI+LE AP +V+WIR+LYSDF  FT+DQE+LIS         FDY+EG
Sbjct  246   GGLGQFGIITQARISLEPAPDKVKWIRMLYSDFDTFTRDQEHLIS-----SENTFDYIEG  300

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF SP++P++ S  KSDG  L+CLE+ K ++    DT+ +E++ L
Sbjct  301   FVIINRTGLLNNWRSSF-SPQDPLQASHFKSDGRTLFCLEVAKYFNLGQTDTIIEEVERL  359

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L  L +I S++F +++ Y+DFLDRVH +E+KLRSKGLW+VPHPWLNL +P+S++  F   
Sbjct  360   LSPLNYISSTLFLSEVSYIDFLDRVHVSEVKLRSKGLWEVPHPWLNLLIPRSKVHRFAEE  419

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+NK+KWD RTS V PEE++FYL+A L SAV +     +L ++
Sbjct  420   VFGNILKDTSNGPILIYPVNKSKWDNRTSVVIPEEDIFYLMAFLSSAVPSSTGPDSLDHI  479

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ IL FC+ + + +KQYLPHY+ Q++WK HFG  WE F  RK  +DP  IL+ GQ 
Sbjct  480   LYQNKRILDFCESAHLGVKQYLPHYTRQEDWKAHFGPHWEAFVRRKSAYDPLRILAPGQR  539

Query  222   IF  217
             IF
Sbjct  540   IF  541



>ref|XP_004143695.1| PREDICTED: cytokinin dehydrogenase 6-like [Cucumis sativus]
 ref|XP_004173066.1| PREDICTED: cytokinin dehydrogenase 6-like [Cucumis sativus]
Length=547

 Score =   505 bits (1301),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 238/423 (56%), Positives = 319/423 (75%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS++GQA    GVV+ M       P+  V +  F Y DV GGELWI++L  +L++GL PK
Sbjct  126   HSLHGQAQAHQGVVINMESLQG--PQMQVHTRNFTYIDVSGGELWINILHESLKYGLTPK  183

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L++VTGKG+ V CS+EQNS+LF++V
Sbjct  184   SWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGDVVNCSKEQNSDLFYSV  243

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRA+I LE AP  V+WIRVLY DF  F+++QE LIS         FDY+E
Sbjct  244   LGGLGQFGIITRAKILLEPAPTMVKWIRVLYLDFTTFSREQELLISAQN-----TFDYIE  298

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF +P++PV+ S  KSDG +LYCLE+ K +  +  + ++QE+  
Sbjct  299   GFVIINRTGLLNNWRSSF-NPQDPVQASQFKSDGKILYCLELAKYFHHTEGNIINQEVTR  357

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L +IPS++F +++ YV+FLDRV  + +KL+SKGLW+VPHPWLNL +PKS+I +F  
Sbjct  358   LLSQLSYIPSTLFISEVTYVEFLDRVQVSAVKLQSKGLWEVPHPWLNLLIPKSKIKKFAE  417

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
             GVF  IL   ++GP+LIYP+NK+KWD RTS V PEEE+FYLVA L SAV +   + +L+ 
Sbjct  418   GVFGNILKETSNGPVLIYPVNKSKWDNRTSVVIPEEEIFYLVAFLTSAVPSSRGNDSLEY  477

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN  IL+FC+ + + +KQYLPHY+T++EW+ HFG  WE +  RK  +DP  IL+ GQ
Sbjct  478   ILTQNMRILEFCQTANLGVKQYLPHYTTRKEWQAHFGPMWETYLQRKAAYDPLAILAPGQ  537

Query  225   LIF  217
              IF
Sbjct  538   RIF  540



>ref|XP_011075363.1| PREDICTED: cytokinin dehydrogenase 1 [Sesamum indicum]
Length=541

 Score =   505 bits (1300),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 244/423 (58%), Positives = 316/423 (75%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPK-PLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M   +  VPK    + +  Y DV  GELWI++L  +L+ GLAPK
Sbjct  119   HSLEGQAQAYQGVVISME--SLRVPKMSFHTGRDPYVDVSAGELWINILHESLKKGLAPK  176

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTG+GE  TCSEEQN++LFHAV
Sbjct  177   SWTDYLHLTVGGTLSNAGISGQAFQHGPQINNVYQLEVVTGRGEVATCSEEQNTDLFHAV  236

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+IT+ARIAL+ AP+ V+WIR LYSDF  FTKDQE LIS         FDYVE
Sbjct  237   LGGLGQFGIITQARIALQPAPKMVKWIRALYSDFSIFTKDQELLIS-----SKNAFDYVE  291

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF +P++PV+ +   SDG +L+CLE+ K Y+   ++ +DQEI+ 
Sbjct  292   GFVIINRTGLLNNWRSSF-NPKDPVQANQFTSDGKILFCLEVAKYYNPEESECIDQEIET  350

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL  L +I S++F +++ YVDFLDRVH +E+KLR KGLW+VPHPWLNL +P+S I EF +
Sbjct  351   LLSALNYIRSTLFQSEVSYVDFLDRVHVSEIKLREKGLWEVPHPWLNLLIPRSSIHEFAQ  410

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GP+LIYP+NK++W   TS +TP+E+VFYLVA L SAV +      L++
Sbjct  411   EVFGNILKDTSNGPVLIYPVNKSRWINSTSLITPQEDVFYLVAFLSSAVPSSTGKDGLEH  470

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL FC    + +KQYLPHYST +EWK HFG  WE F  RKL +DP  IL+ GQ
Sbjct  471   ILTQNKKILHFCGRPHLGIKQYLPHYSTPEEWKAHFGTHWEVFYRRKLAYDPLAILTPGQ  530

Query  225   LIF  217
              IF
Sbjct  531   RIF  533



>ref|NP_001105526.1| cytokinin oxidase 2 precursor [Zea mays]
 emb|CAE55200.1| cytokinin oxidase 2 [Zea mays]
 tpg|DAA55878.1| TPA: cytokinin oxidase 2 [Zea mays]
Length=519

 Score =   504 bits (1297),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 241/422 (57%), Positives = 321/422 (76%), Gaps = 12/422 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ+  A G+V++M     A  +  V + F+  D  GGELWI+VL+ TL+HGLAPKS
Sbjct  100   HSLMGQSQAAQGIVVRMESLRGA--RLQVHDGFV--DAPGGELWINVLRETLKHGLAPKS  155

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQAF HGPQ+SNV++L++VTG+G+ VTCS E NS+LF+A L
Sbjct  156   WTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGDVVTCSPEDNSDLFYAAL  215

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP+ VRWIRVLYSDF++FT+DQE LI          FDY+EG
Sbjct  216   GGLGQFGIITRARIALEPAPEMVRWIRVLYSDFESFTEDQEMLIMAE-----NSFDYIEG  270

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  G++NNWR+S F P++PV+ S  +SDG VLYCLE+TKN++    DT++QE+ VL
Sbjct  271   FVIINRTGILNNWRAS-FKPQDPVQASHFQSDGRVLYCLELTKNFNSGDTDTMEQEVAVL  329

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L+FI S++F TD+ Y++FLDRVH +ELKLR++ LW+VPHPWLNL +P+S I  F   
Sbjct  330   LSRLRFIQSTLFHTDVTYLEFLDRVHTSELKLRAQSLWEVPHPWLNLLIPRSSIRRFATE  389

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPIL+YP+NK+KWD +TS V P+EE+FYLV  L SA        ++ + 
Sbjct  390   VFGRILKDSNNGPILLYPVNKSKWDNKTSVVIPDEEIFYLVGFLSSAPSLSGHG-SIAHA  448

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              S N  I++FC+E+ I MKQYL HY+TQ++WK HFG +WE F+ RK ++DP  IL+ GQ 
Sbjct  449   MSLNSQIVEFCEEADIGMKQYLAHYTTQEQWKTHFGARWETFERRKHRYDPLAILAPGQR  508

Query  222   IF  217
             IF
Sbjct  509   IF  510



>gb|AFW83998.1| cytokinin oxidase 3, mRNA [Zea mays]
Length=502

 Score =   503 bits (1295),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 241/425 (57%), Positives = 324/425 (76%), Gaps = 13/425 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMY---ADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQ+  A G+V++M       P+  V++  +     D  GGELWI+VL+ TL+HGLA
Sbjct  78    HSLMGQSQAAQGIVVRMESLRG--PRLQVNDAGVSPPSVDAPGGELWINVLRETLKHGLA  135

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAG+SGQAF HGPQ+SNV++L++VTG+G+ VTCS + N++LF+
Sbjct  136   PKSWTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGDVVTCSPDDNADLFY  195

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             A LGGLGQFG+ITRARIALE AP+ VRWIRVLYSDF++FT+DQE LI          FDY
Sbjct  196   AALGGLGQFGIITRARIALEPAPKMVRWIRVLYSDFESFTEDQEMLIMAE-----NSFDY  250

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             VEGFVI++  G++NNWR+SF  P++PV+ S  +SDG VLYCLE+TKN++    DT++QE+
Sbjct  251   VEGFVIINRTGVLNNWRASF-KPQDPVEASHFQSDGRVLYCLELTKNFNSDDTDTMEQEV  309

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
              VLL +L+FI S++F TD+ Y++FLDRVH +ELKLR++GLW+VPHPWLNL +P+S I  F
Sbjct  310   TVLLSRLRFIQSTLFHTDVTYLEFLDRVHTSELKLRAQGLWEVPHPWLNLLIPRSSIRRF  369

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
              + VF  IL +  +GPIL+YP+NK+KWD RTS V P+EE+FYLV  L SA        ++
Sbjct  370   AKEVFGKILKDSNNGPILLYPVNKSKWDNRTSVVIPDEEIFYLVGFLSSAPSLSGYG-SI  428

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
              +  + N+ I++FC+E+GI MKQYL  Y+TQQ+WK HFG +WE F+ RK ++DP  IL+ 
Sbjct  429   AHSMNLNKQIVEFCEEAGIGMKQYLAPYTTQQQWKAHFGARWETFERRKHRYDPLAILAP  488

Query  231   GQLIF  217
             GQ IF
Sbjct  489   GQRIF  493



>gb|AFK79777.1| cytokinin oxidase/dehydrogenase, partial [Hordeum vulgare subsp. 
vulgare]
Length=477

 Score =   502 bits (1293),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 324/438 (74%), Gaps = 15/438 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-------SEKFMYADVWGGELWIDVLKSTLE  1321
             HS+ GQ+  A G+V++M        +  V            Y D  GG LWI+VL  TL+
Sbjct  47    HSLLGQSQAAGGIVVRMESLGGIGARMRVVHAGEGGGRASAYVDAPGGALWINVLHETLK  106

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             HGLAPKSWTDYL+L+VGGTLSNAG+SGQAF  GPQ+SNV++L++VTG+G+ VTCS E+NS
Sbjct  107   HGLAPKSWTDYLHLTVGGTLSNAGVSGQAFRQGPQVSNVNQLEIVTGRGDVVTCSPEENS  166

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             +LF+  LGGLGQFG+ITRARIALE AP+ VRWIRVLYSDF +FT+DQE LIS      A+
Sbjct  167   DLFYGALGGLGQFGIITRARIALEPAPKMVRWIRVLYSDFASFTEDQEALIST-----AK  221

Query  960   KFDYVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
              FDY+EGFVI++  G++NNWR+SF  P++PV+ S  +SDG VLYCLE+TKN+D   AD +
Sbjct  222   TFDYIEGFVIINRTGILNNWRTSF-KPQDPVQASHFQSDGKVLYCLEMTKNFDPDEADIM  280

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             +QE+ VLL +L++I S++F TD+ Y++FLDRVH +ELKLR++GLW+VPHPWLNL +P+S 
Sbjct  281   EQEVGVLLSRLRYIQSTLFHTDVTYLEFLDRVHSSELKLRAQGLWEVPHPWLNLLIPRSS  340

Query  603   IDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             I  F R VF  IL +  +GPIL+YP+N++KWD RTS V P+EE+FYLV  L SA  +G+ 
Sbjct  341   IHRFAREVFGKILKDSNNGPILLYPVNRSKWDNRTSVVIPDEEIFYLVGFLSSA-PSGSG  399

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
               ++++  + N  I+ FC ++G+ MKQYL  Y+TQQ+WK HFG +WE F+ RK  +DP  
Sbjct  400   HGSVEHAVTLNDKIVDFCDKAGVGMKQYLAPYTTQQQWKAHFGARWETFERRKHMYDPLA  459

Query  243   ILSTGQLIFTPSFNAMTA  190
             IL+ GQ IF  +   M++
Sbjct  460   ILAPGQRIFPKASLPMSS  477



>ref|XP_003547474.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=543

 Score =   504 bits (1299),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 244/434 (56%), Positives = 310/434 (71%), Gaps = 18/434 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG-----------AAAAVPKPLVSEKFMYADVWGGELWIDVLK  1333
             HS  GQAM   GVV+ M+G             ++V     +  + YADV G +LWIDVL 
Sbjct  113   HSTRGQAMAREGVVVDMAGFRERGNGVGIRVVSSVDPNNKNGYYYYADVGGEQLWIDVLH  172

Query  1332  STLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSE  1153
             +TLEHGLAP SWTDYLYL++GGTLSNAGISGQ F +GPQI+ V E+DV+TGKGE VTCS+
Sbjct  173   ATLEHGLAPMSWTDYLYLTLGGTLSNAGISGQTFRYGPQITTVREMDVITGKGEFVTCSQ  232

Query  1152  EQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQ  973
             + NSELFHAVLGGLGQFG+ITRARIAL  AP+RV+W+R+LY+DF AFTKDQE LIS+ G+
Sbjct  233   QTNSELFHAVLGGLGQFGIITRARIALAPAPKRVKWVRLLYNDFSAFTKDQEQLISVTGR  292

Query  972   PPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTA  793
                   DY+EG +++ +G INNWRSSFF   +  +  S+ +   VLYCLE+ K YD    
Sbjct  293   KQNVSLDYLEGLLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVAKYYDGQNE  352

Query  792   DTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  613
             + VD+E+ VLL+ L +IP   +  D+ Y +FL+RV   ELKL+S+GLWDVPHPWLNLF+P
Sbjct  353   NNVDKELQVLLQGLSYIPGFYYEKDVSYFEFLNRVRSGELKLQSQGLWDVPHPWLNLFIP  412

Query  612   KSRIDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAV  439
             KS+I EFD GVFK I+   N T+GP+L+YPMN+NKWD R SA  P+E++FY V  L S+ 
Sbjct  413   KSQIMEFDSGVFKNIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYTVGFLHSS-  471

Query  438   ENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQ  259
                      K   +QN++IL+FC  +GI++KQYLPHY TQ++W  HFG KW  F  RK Q
Sbjct  472   ----GFDNWKAYDAQNKEILQFCNVAGIKVKQYLPHYRTQEDWANHFGPKWRTFVERKHQ  527

Query  258   FDPKHILSTGQLIF  217
             FDP+ ILS GQ IF
Sbjct  528   FDPRMILSPGQRIF  541



>ref|XP_010090055.1| Cytokinin dehydrogenase 3 [Morus notabilis]
 gb|EXB38852.1| Cytokinin dehydrogenase 3 [Morus notabilis]
Length=529

 Score =   504 bits (1297),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 247/432 (57%), Positives = 315/432 (73%), Gaps = 18/432 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-------SGAAAAVP-KPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS++GQAM   GVV+ M       SG    V   P +     YADV G +LWIDVL +TL
Sbjct  106   HSVHGQAMAQNGVVVNMAALKTYRSGTGIVVSGDPSLG---YYADVGGEQLWIDVLHATL  162

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             EHG AP SWTDYLYL+VGGTLSNAGISGQ F +GPQISNV+ELDV+TGKGE VTCS  +N
Sbjct  163   EHGFAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYELDVITGKGEFVTCSVHKN  222

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             SELF+A LGGLGQFG+I RARIALE AP+RV+W+R+LYSDF AF++DQE LI ++G+   
Sbjct  223   SELFYAALGGLGQFGIIVRARIALEPAPKRVKWVRMLYSDFSAFSRDQERLIKINGRKDK  282

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
                DY+EG +++++G  NNWRSSFF   +  +  S  ++  ++YCLE+ K YD  +  TV
Sbjct  283   NALDYLEGSLLMNQGSPNNWRSSFFPRSDHSRIISKVTEHKIIYCLEVAKLYDDRSKTTV  342

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             D+ + VLL+ L F P  +F  D+ YVDF+DRV   ELKL+S+GLW+VPHPWLNLF+PKSR
Sbjct  343   DKVLQVLLQGLSFEPGFMFEKDVAYVDFVDRVRGGELKLQSQGLWEVPHPWLNLFIPKSR  402

Query  603   IDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             + +F+ GVF+ I+   N T+GP+L+YPMN+NKWD+RTSAV P+E+VFY V  L S+  + 
Sbjct  403   VSDFNAGVFREIVLKRNITTGPVLLYPMNRNKWDDRTSAVIPDEDVFYTVGFLHSSGFDD  462

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
              ES        QN+DIL+FC++ GIE+KQYLPHY TQ++W +HFG KW  F  RK  FDP
Sbjct  463   WES-----FDQQNKDILQFCEDVGIEVKQYLPHYKTQEDWMKHFGSKWRTFNERKSMFDP  517

Query  249   KHILSTGQLIFT  214
             K ILS GQ IF 
Sbjct  518   KKILSPGQRIFN  529



>ref|XP_009784168.1| PREDICTED: cytokinin dehydrogenase 6-like isoform X1 [Nicotiana 
sylvestris]
Length=532

 Score =   504 bits (1297),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 242/424 (57%), Positives = 321/424 (76%), Gaps = 10/424 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GV++ M        + +   +F Y DV  GELWI++L  TL++GLAPKS
Sbjct  109   HSLQGQAQARRGVIINMESLQGQEMQ-VYRGQFPYVDVSAGELWINILHETLKYGLAPKS  167

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE + CS+EQN++LFHAVL
Sbjct  168   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVLICSKEQNADLFHAVL  227

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ V+WIRVLYSDF  F +DQE+LIS      A+ FDY+EG
Sbjct  228   GGLGQFGIITRARISLERAPRMVKWIRVLYSDFSTFARDQEHLIS-----AAKTFDYIEG  282

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQ--EID  769
              VI ++ GL+NNWR+SF  P++PV+ S   SDG  LYCLE+TKN     +DTV+Q  EI+
Sbjct  283   LVIKNKTGLMNNWRASF-DPQDPVQASHFVSDGRTLYCLELTKNLYPEKSDTVNQMQEIE  341

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LL +L +IPS++F +++PY++FLDRVH +ELKLRSKGLWD+PHPWLNL VPKS+I  F 
Sbjct  342   DLLSQLSYIPSTLFMSEVPYIEFLDRVHASELKLRSKGLWDLPHPWLNLLVPKSKIQHFA  401

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             + VF  IL +  +GP+L+YP++K+K D RTS V+P E++ YLVA L  A  + + + +L+
Sbjct  402   KEVFGNILKDTNNGPVLVYPIHKSKLDNRTSFVSPNEDIIYLVAFLSHANPSSSGTDSLE  461

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
             ++ +QN+ IL FC  + + +KQYLPHY+TQ++W+ HFG KWE F  RK  +DP  +L+ G
Sbjct  462   HVLTQNKRILDFCDVAHLGVKQYLPHYTTQEQWRTHFGPKWEVFVQRKSAYDPLAMLAPG  521

Query  228   QLIF  217
             Q IF
Sbjct  522   QRIF  525



>ref|XP_006368582.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|ERP65151.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=530

 Score =   504 bits (1297),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 242/423 (57%), Positives = 319/423 (75%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M   +  V K  V S  + Y D  GGELW+D+L+  L++GLAPK
Sbjct  109   HSLQGQAQAHQGVVINME--SLQVHKMHVYSGNYPYVDASGGELWMDILRECLKYGLAPK  166

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAG+SGQAF HGPQISNV++L+VVTGKGE + CSE+QNS+LFH V
Sbjct  167   SWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVNQLEVVTGKGEVLNCSEKQNSDLFHGV  226

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP  V+WIRVLYSDF  F  DQE LI          FDY+E
Sbjct  227   LGGLGQFGIITRARISLEPAPDMVKWIRVLYSDFTTFVTDQERLIG-----AESTFDYIE  281

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++   L+NNWRSSF  P++PV+ S  +SDG  LYCLE+ K +++   D +++E+  
Sbjct  282   GFVIINRTSLLNNWRSSF-DPQDPVQASQFQSDGRTLYCLELAKYFNRDRIDALNEEVGN  340

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L ++ S++F T++ Y++FLDRVH +E+KLRSKGLW+VPHPWLNL +PKS+I++F  
Sbjct  341   LLSQLSYMASTLFLTEVSYLEFLDRVHVSEVKLRSKGLWEVPHPWLNLLIPKSKINDFAD  400

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GPILIYP+NK+KWD RTSAV PEE++FYLVA L SA+ +   +  L++
Sbjct  401   EVFGNILTDTSNGPILIYPVNKSKWDNRTSAVLPEEDIFYLVAFLNSAMPSSMGTDGLEH  460

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + +QN+ IL+FC+ + + MKQYLPHY+TQ EW+ HFG +WE F  RK  +DP  IL+ GQ
Sbjct  461   ILTQNKRILEFCETARLGMKQYLPHYNTQGEWRAHFGPRWEVFAQRKSTYDPLAILAPGQ  520

Query  225   LIF  217
              IF
Sbjct  521   RIF  523



>emb|CBI37291.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   501 bits (1291),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 250/432 (58%), Positives = 322/432 (75%), Gaps = 25/432 (6%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-------SGAAAAVPK-PLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS+ GQAM + GVV++M        G+   V K P+      YADV G + WIDVL++TL
Sbjct  49    HSLRGQAMASHGVVVEMRSLNNCSCGSGIRVTKNPIWGS---YADVGGEQQWIDVLQATL  105

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             +HGLAP SWTDYLYL++GGTLSNAGISGQ F HGPQISNV+E+DV+TGKGE VTCS++ N
Sbjct  106   KHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTN  165

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             SELF AVLGGLGQFG+ITRARIALE AP+RV+WI++LY DF  F++DQE+LIS++G    
Sbjct  166   SELFFAVLGGLGQFGIITRARIALEPAPERVKWIQMLYDDFSTFSRDQEHLISING----  221

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
                DY+EG + +     NNWRSS FSP    + SS+ S  G++YCLE+ K YD+ T+ TV
Sbjct  222   --LDYLEGSLSMQNSPPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTV  278

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             D+E+ VLLK L F+P  VFT D+  VDFL+RVH  EL LR+KGLWDVPHPWLNLFVP+S 
Sbjct  279   DEELQVLLKGLNFLPGFVFTKDVSLVDFLNRVHSGELNLRAKGLWDVPHPWLNLFVPRSS  338

Query  603   IDEFDRGVFKGILG--NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             I +F+ GVF+ IL   N+T+GP L+YPM +NKWD+RTSAV P+E++FY V +L S+  + 
Sbjct  339   ISDFNSGVFRDILPKINQTTGPFLVYPMIRNKWDDRTSAVIPDEDIFYTVGVLHSSGADD  398

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
              E      L++QN++ILKFC ++GI++K+YL  Y+T+++W  HFG KW  F+ RK QFDP
Sbjct  399   WEP-----LENQNKEILKFCDKAGIKIKRYLSRYTTKEDWMNHFGPKWRTFEDRKAQFDP  453

Query  249   KHILSTGQLIFT  214
             K ILS GQ IF 
Sbjct  454   KMILSPGQQIFN  465



>ref|XP_003565050.1| PREDICTED: cytokinin dehydrogenase 4 [Brachypodium distachyon]
Length=523

 Score =   503 bits (1296),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 239/433 (55%), Positives = 328/433 (76%), Gaps = 12/433 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFM--YADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQ+  A G+V++M      +   +VS + +  Y D  GGELWI+VL  TL+HGLAP
Sbjct  100   HSLMGQSQAAGGIVVKMESLGGGMR--VVSSRGVSPYVDAPGGELWINVLHETLKHGLAP  157

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYL+L+VGGTLSNAG+SGQAF  GPQ+SNV++L++VTG+G+ VTCS E+NS+LF+ 
Sbjct  158   KSWTDYLHLTVGGTLSNAGVSGQAFRQGPQVSNVNQLEIVTGRGDVVTCSPEENSDLFYG  217

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
              LGGLGQFG+ITRARIALE AP+ VRWIRVLYSDF +FT+DQE +IS       + FDY+
Sbjct  218   ALGGLGQFGIITRARIALEPAPRMVRWIRVLYSDFTSFTEDQEMMISAE-----KTFDYI  272

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EGFVI++  G++NNWR+SF  P++PV+ S  +SDG VLYCLE+TKN++   AD+++QE+ 
Sbjct  273   EGFVIINRTGILNNWRTSF-KPQDPVQASQFQSDGRVLYCLEMTKNFNHDEADSMEQEVG  331

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
             VLL +L++I S++F TD+ Y++FLDRVH +ELKLR++GLW+VPHPWLNL +P+S I +F 
Sbjct  332   VLLSRLRYIQSTLFHTDVTYLEFLDRVHSSELKLRAQGLWEVPHPWLNLLIPRSTIHKFA  391

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             + VF  IL +  +GPIL+YP+NK+KWD RTS V P+EE+FYLV  L SA        +++
Sbjct  392   KEVFGKILKDSNNGPILLYPVNKSKWDNRTSVVIPDEEIFYLVGFLSSAPSLSGHG-SVE  450

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
             +  + N  I+ FC+++G+ MKQYL  Y+TQQ+WK HFG +WE F+ RK  +DP  IL+ G
Sbjct  451   HAVNLNNQIVDFCEKAGVGMKQYLAPYTTQQQWKAHFGARWETFERRKHMYDPLAILAPG  510

Query  228   QLIFTPSFNAMTA  190
             Q IF  +   M++
Sbjct  511   QRIFPKASLPMSS  523



>dbj|BAG16373.1| cytokinin oxidase family protein [Brassica oleracea var. italica]
Length=524

 Score =   503 bits (1296),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 319/422 (76%), Gaps = 13/422 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA+   GVV+ M        K +  EK  Y DV GGELWI++LK TL+HGL+PKS
Sbjct  112   HSLQGQALAHQGVVINMESLQNPDIK-IYREKQPYVDVSGGELWINILKETLKHGLSPKS  170

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE VTCSE+ N ELFH+VL
Sbjct  171   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKLNPELFHSVL  230

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+L  AP  V+WIRVLYS+F  F++DQE+LIS       + FDYVEG
Sbjct  231   GGLGQFGIITRARISLGPAPHMVKWIRVLYSNFSTFSRDQEHLIS-----KKKGFDYVEG  285

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FV ++   L+NNWRSS FSP +  + S  KSDG  LYCLE  K +++  A++++QE + L
Sbjct  286   FVSINRTDLLNNWRSS-FSPNDSTEASQFKSDGKTLYCLEAVKYFNKEEANSMNQETEKL  344

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F++ +PY++FLDRVH  E+KLR+KGLW+VPHPWLNL VPKS I EF   
Sbjct  345   LSELSYIPSTLFSSVVPYIEFLDRVHHGEIKLRAKGLWEVPHPWLNLLVPKSSIIEFATE  404

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPILIYP+N++KW+++TS +TP E++FYLVA L SAV+N      L++L
Sbjct  405   VFNNILTSNNNGPILIYPVNQSKWNKQTSLITPSEDIFYLVAFLPSAVQND-----LEHL  459

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ +L FC+E+ +++KQYLPHY TQ+EW+ HFG +WE F   K ++DP  IL+ G  
Sbjct  460   LRQNQRVLNFCEEANMDVKQYLPHYETQREWRSHFGNRWETFAKMKHEYDPLAILAPGHR  519

Query  222   IF  217
             IF
Sbjct  520   IF  521



>gb|KFK36997.1| hypothetical protein AALP_AA4G199000 [Arabis alpina]
Length=551

 Score =   504 bits (1298),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 241/422 (57%), Positives = 317/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA+   GVV+ M    +   K +   +  Y DV GGELWI++L+ TL++GL+PKS
Sbjct  125   HSLQGQALAHQGVVINMKSLRSHDIK-IYKGRQPYVDVSGGELWINILRETLKYGLSPKS  183

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF +GPQI+NV++L+VVTGKGE VTCSE++NSELF++VL
Sbjct  184   WTDYLHLTVGGTLSNAGISGQAFKNGPQINNVYQLEVVTGKGEVVTCSEKRNSELFYSVL  243

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+L  AP  V+WIRVLYS+F AF+KDQE+LIS         FDY+EG
Sbjct  244   GGLGQFGIITRARISLRPAPHMVKWIRVLYSEFSAFSKDQEHLIS-----KENAFDYLEG  298

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI +   L+NNWRSSF SP +  + S  KSDG  LYCLE+ K ++   A++++QE + L
Sbjct  299   FVIFNRTDLLNNWRSSF-SPNDSTQASQFKSDGKTLYCLEVAKYFNPEEANSMNQETEKL  357

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++FT+++ Y++FLDRVH AE KLR+KGLW+VPHPWLNL + KS I +F  G
Sbjct  358   LSELHYIPSTLFTSEVSYIEFLDRVHIAEKKLRAKGLWEVPHPWLNLLISKSSIFDFATG  417

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  I+ +  +GPILIYP+N++KW++ TS +TP E++ YLVA L S + N +   +L+ L
Sbjct  418   VFNNIVTSNNNGPILIYPVNQSKWNKHTSMITPNEDILYLVAFLSSVMPNSSGKNSLEYL  477

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ I+ FC+E  + +KQYLPHY TQQEWK HFG KWE F  RK  +DP  ILS GQ 
Sbjct  478   MKQNQRIINFCEEKNLNVKQYLPHYETQQEWKSHFGNKWETFSKRKYAYDPLAILSPGQR  537

Query  222   IF  217
             IF
Sbjct  538   IF  539



>dbj|BAM74650.1| cytokinin oxidase/dehydrogenase [Torenia fournieri]
Length=565

 Score =   504 bits (1299),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 243/422 (58%), Positives = 311/422 (74%), Gaps = 7/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA T  GVV+ M        +  V +   Y DV  GELWI++L  +L+ GL PKS
Sbjct  138   HSLQGQAQTHQGVVINMMSLREPEMRFHVGKHETYVDVSAGELWINILHESLKRGLTPKS  197

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTG+GE VTCS+EQNS+LFHAVL
Sbjct  198   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLNVVTGRGEVVTCSKEQNSDLFHAVL  257

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFGVI  ARIALE AP+  +WIR LY+DF  FT DQE+LIS  G      FDYVEG
Sbjct  258   GGLGQFGVIAEARIALEPAPKMGKWIRALYTDFTQFTNDQEHLISSPGS-----FDYVEG  312

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +PR+PV+ ++  S+G +LYCLE+ K +D    + +D+EID L
Sbjct  313   FVIINRTGLLNNWRSSF-NPRDPVQANTFTSEGKILYCLEVAKYFDPEEINHIDEEIDTL  371

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +I S++F +++ Y+DFLDRVH +E+KLR KGLWDVPHPWLNL VP S I+EF + 
Sbjct  372   LSELNYIKSTLFQSEVSYIDFLDRVHMSEMKLREKGLWDVPHPWLNLLVPSSSINEFAKE  431

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  I+ + ++GPILIYP+NK++W + TS +TPEE+VFYLV  L SA         L+++
Sbjct  432   VFGNIVKDTSNGPILIYPVNKSRWIKGTSLITPEEDVFYLVGFLSSAAPYSKGKDGLEHI  491

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN  IL +CK+  + +KQYLPHYSTQQEWK HF   W+ F  RKL +DP  IL+ GQ 
Sbjct  492   LLQNNKILNYCKKPRLGIKQYLPHYSTQQEWKSHFATHWDVFSRRKLIYDPLAILAPGQR  551

Query  222   IF  217
             IF
Sbjct  552   IF  553



>gb|AFW83999.1| LOW QUALITY PROTEIN: cytokinin oxidase 3 [Zea mays]
Length=525

 Score =   503 bits (1295),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 241/425 (57%), Positives = 324/425 (76%), Gaps = 13/425 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMY---ADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQ+  A G+V++M       P+  V++  +     D  GGELWI+VL+ TL+HGLA
Sbjct  101   HSLMGQSQAAQGIVVRMESLRG--PRLQVNDAGVSPPSVDAPGGELWINVLRETLKHGLA  158

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAG+SGQAF HGPQ+SNV++L++VTG+G+ VTCS + N++LF+
Sbjct  159   PKSWTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGDVVTCSPDDNADLFY  218

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             A LGGLGQFG+ITRARIALE AP+ VRWIRVLYSDF++FT+DQE LI          FDY
Sbjct  219   AALGGLGQFGIITRARIALEPAPKMVRWIRVLYSDFESFTEDQEMLIMAE-----NSFDY  273

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             VEGFVI++  G++NNWR+SF  P++PV+ S  +SDG VLYCLE+TKN++    DT++QE+
Sbjct  274   VEGFVIINRTGVLNNWRASF-KPQDPVEASHFQSDGRVLYCLELTKNFNSDDTDTMEQEV  332

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
              VLL +L+FI S++F TD+ Y++FLDRVH +ELKLR++GLW+VPHPWLNL +P+S I  F
Sbjct  333   TVLLSRLRFIQSTLFHTDVTYLEFLDRVHTSELKLRAQGLWEVPHPWLNLLIPRSSIRRF  392

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
              + VF  IL +  +GPIL+YP+NK+KWD RTS V P+EE+FYLV  L SA        ++
Sbjct  393   AKEVFGKILKDSNNGPILLYPVNKSKWDNRTSVVIPDEEIFYLVGFLSSAPSLSGYG-SI  451

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
              +  + N+ I++FC+E+GI MKQYL  Y+TQQ+WK HFG +WE F+ RK ++DP  IL+ 
Sbjct  452   AHSMNLNKQIVEFCEEAGIGMKQYLAPYTTQQQWKAHFGARWETFERRKHRYDPLAILAP  511

Query  231   GQLIF  217
             GQ IF
Sbjct  512   GQRIF  516



>ref|XP_002263646.1| PREDICTED: cytokinin dehydrogenase 3 [Vitis vinifera]
Length=522

 Score =   503 bits (1295),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 250/432 (58%), Positives = 322/432 (75%), Gaps = 25/432 (6%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-------SGAAAAVPK-PLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS+ GQAM + GVV++M        G+   V K P+      YADV G + WIDVL++TL
Sbjct  104   HSLRGQAMASHGVVVEMRSLNNCSCGSGIRVTKNPIWGS---YADVGGEQQWIDVLQATL  160

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             +HGLAP SWTDYLYL++GGTLSNAGISGQ F HGPQISNV+E+DV+TGKGE VTCS++ N
Sbjct  161   KHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTN  220

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             SELF AVLGGLGQFG+ITRARIALE AP+RV+WI++LY DF  F++DQE+LIS++G    
Sbjct  221   SELFFAVLGGLGQFGIITRARIALEPAPERVKWIQMLYDDFSTFSRDQEHLISING----  276

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
                DY+EG + +     NNWRSS FSP    + SS+ S  G++YCLE+ K YD+ T+ TV
Sbjct  277   --LDYLEGSLSMQNSPPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTV  333

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             D+E+ VLLK L F+P  VFT D+  VDFL+RVH  EL LR+KGLWDVPHPWLNLFVP+S 
Sbjct  334   DEELQVLLKGLNFLPGFVFTKDVSLVDFLNRVHSGELNLRAKGLWDVPHPWLNLFVPRSS  393

Query  603   IDEFDRGVFKGILG--NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             I +F+ GVF+ IL   N+T+GP L+YPM +NKWD+RTSAV P+E++FY V +L S+  + 
Sbjct  394   ISDFNSGVFRDILPKINQTTGPFLVYPMIRNKWDDRTSAVIPDEDIFYTVGVLHSSGADD  453

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
              E      L++QN++ILKFC ++GI++K+YL  Y+T+++W  HFG KW  F+ RK QFDP
Sbjct  454   WEP-----LENQNKEILKFCDKAGIKIKRYLSRYTTKEDWMNHFGPKWRTFEDRKAQFDP  508

Query  249   KHILSTGQLIFT  214
             K ILS GQ IF 
Sbjct  509   KMILSPGQQIFN  520



>ref|NP_191903.3| cytokinin oxidase/dehydrogenase 6 [Arabidopsis thaliana]
 sp|Q9LY71.2|CKX6_ARATH RecName: Full=Cytokinin dehydrogenase 6; AltName: Full=Cytokinin 
oxidase 6; Short=AtCKX6; Short=AtCKX7; Short=CKO6; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE80482.1| cytokinin oxidase/dehydrogenase 6 [Arabidopsis thaliana]
Length=533

 Score =   503 bits (1295),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 244/426 (57%), Positives = 315/426 (74%), Gaps = 13/426 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPL----VSEKFMYADVWGGELWIDVLKSTLEHGL  1312
             HS+ GQA T  G+V+ M       P+ L    V     Y DV GGELWI++L  TL++GL
Sbjct  109   HSLQGQAQTRHGIVIHMESLH---PQKLQVYSVDSPAPYVDVSGGELWINILHETLKYGL  165

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             APKSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L++VTGKGE + C++ QNS+LF
Sbjct  166   APKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGEILNCTKRQNSDLF  225

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             + VLGGLGQFG+ITRARIALE AP  V+WIRVLY DF AF KDQE LIS  G     KFD
Sbjct  226   NGVLGGLGQFGIITRARIALEPAPTMVKWIRVLYLDFAAFAKDQEQLISAQGH----KFD  281

Query  951   YVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             Y+EGFVI++  GL+N+WR SF +   P++ S  K DG  LYCLE+ K   Q   D ++QE
Sbjct  282   YIEGFVIINRTGLLNSWRLSF-TAEEPLEASQFKFDGRTLYCLELAKYLKQDNKDVINQE  340

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             +   L +L ++ S++FTT++ Y  FLDRVH +E+KLRSKG W+VPHPWLNL VP+S+I+E
Sbjct  341   VKETLSELSYVTSTLFTTEVAYEAFLDRVHVSEVKLRSKGQWEVPHPWLNLLVPRSKINE  400

Query  594   FDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQT  415
             F RGVF  IL + ++GP+++YP+NK+KWD +TSAVTPEEEVFYLVA+L SA         
Sbjct  401   FARGVFGNILTDTSNGPVIVYPVNKSKWDNQTSAVTPEEEVFYLVAILTSASPGSAGKDG  460

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILS  235
             ++ +  +NR IL+F +E+GI +KQYLPHY+T++EW+ HFG+KW  F  RK ++DP  IL+
Sbjct  461   VEEILRRNRRILEFSEEAGIGLKQYLPHYTTREEWRSHFGDKWGEFVRRKSRYDPLAILA  520

Query  234   TGQLIF  217
              G  IF
Sbjct  521   PGHRIF  526



>ref|XP_009141995.1| PREDICTED: cytokinin dehydrogenase 1-like [Brassica rapa]
 emb|CDY06917.1| BnaA04g23980D [Brassica napus]
Length=536

 Score =   503 bits (1296),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 236/422 (56%), Positives = 316/422 (75%), Gaps = 7/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA+   GVV+ M     +    +   K  Y DV GGELWID+L+ TL +GL+PKS
Sbjct  108   HSLQGQALAHQGVVINMESLLPSHDIKIYKGKQPYVDVSGGELWIDILRETLRYGLSPKS  167

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE VTCSE++NSELF +VL
Sbjct  168   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKRNSELFQSVL  227

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+L  AP  V+WIR LYSDF AF++DQE+LIS         FDYVEG
Sbjct  228   GGLGQFGIITRARISLGPAPLMVKWIRTLYSDFSAFSRDQEHLIS-----KKNAFDYVEG  282

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++   ++NNWRSSF +P +  + S  KSDG  LYCLE+ K ++   A +++QE++ L
Sbjct  283   FVIINRTDILNNWRSSF-TPNDSTEASQFKSDGKTLYCLEVVKYFNSEEAHSMNQEMEKL  341

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +I S++F++++PY++FLDRVH AE+KLR KGLW+VPHPWLNL +PKSRI EF   
Sbjct  342   LSELSYIQSTLFSSEVPYIEFLDRVHIAEIKLREKGLWEVPHPWLNLLIPKSRIFEFATK  401

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  I+ +  +GP LIYP+N++KW++ TS +TP E++FYLVA L SA+   +    L+ L
Sbjct  402   VFNNIVTSNHNGPTLIYPVNQSKWNKHTSLITPNEDIFYLVAFLPSAIPKPSGESDLEYL  461

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ +L FC E+ +++KQYLPHY TQ+EW+ HFG +WE F  RK ++DP  +L+ GQ 
Sbjct  462   LRQNQRVLSFCAEANLDVKQYLPHYETQKEWRSHFGNRWETFAKRKHKYDPLAVLAPGQR  521

Query  222   IF  217
             IF
Sbjct  522   IF  523



>ref|NP_001244908.1| cytokinin oxidase/dehydrogenase-like 7 precursor [Solanum lycopersicum]
 dbj|BAM09009.1| cytokinin oxidase/dehydrogenase-like [Solanum lycopersicum]
Length=537

 Score =   503 bits (1296),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 241/422 (57%), Positives = 319/422 (76%), Gaps = 7/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+ M        K  ++E+  Y DV  GELWI+VL  +L+ GLAPKS
Sbjct  113   HSLEGQAQAYQGLVINMKSLQELEMKFKINEELSYVDVSAGELWINVLHESLKLGLAPKS  172

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKGE +TCSEEQN++LFH VL
Sbjct  173   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEVVTGKGEVITCSEEQNADLFHGVL  232

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+IT+ARIALE AP++V+WIRVLYSDF AF+ DQE LIS         FDY+EG
Sbjct  233   GGLGQFGIITKARIALETAPKQVKWIRVLYSDFAAFSNDQEDLIS-----SQSTFDYIEG  287

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRS+F +P++P++ S+  S+G VL+CLE+ K ++     + DQ+ID+L
Sbjct  288   FVIINSTGLLNNWRSTF-NPKDPLQASNFSSEGRVLFCLEVAKYFNPEDTYSTDQDIDIL  346

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL +I S++F +++ YV+FLDRVH +E+KL+ KGLWDVPHPWLNL +PKSRI EF + 
Sbjct  347   LSKLSYIRSTLFLSEVSYVEFLDRVHVSEMKLQEKGLWDVPHPWLNLLIPKSRILEFAQE  406

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GP+LIYP+NK+KW + TS VTP+E+VFYL+A L SA+        L+++
Sbjct  407   VFGKILTDTSNGPLLIYPVNKSKWRKGTSMVTPDEDVFYLIAFLSSAMPFSTGKDGLEHI  466

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN  IL FC+++ I MKQYLP++ TQ+EWK HFG  W+ F  RK  +DP  IL+ GQ 
Sbjct  467   IDQNNRILSFCEKTRIGMKQYLPNHKTQEEWKHHFGPHWDTFARRKSTYDPLAILAPGQR  526

Query  222   IF  217
             IF
Sbjct  527   IF  528



>ref|XP_010912967.1| PREDICTED: cytokinin dehydrogenase 6 [Elaeis guineensis]
Length=536

 Score =   503 bits (1295),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 245/436 (56%), Positives = 317/436 (73%), Gaps = 13/436 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS----GAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGL  1312
             HS+ GQA+   GVV++M+    G     P+  VS +  Y D  G + WIDVL+ TL++GL
Sbjct  107   HSLRGQALAPHGVVIEMTSMRNGGCDGEPRLSVSPEGSYVDAGGEQFWIDVLQETLKYGL  166

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             AP+SWTDYLYL+VGGTLSNAG+SGQAF HGPQIS+V+ELDV+TGKGE VTCSE+Q  +LF
Sbjct  167   APRSWTDYLYLTVGGTLSNAGVSGQAFLHGPQISSVYELDVITGKGEMVTCSEDQEPDLF  226

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
              AVLGGLGQFG+ITRARIALE APQ VRW+R++Y +F+AF +DQE LISL      + F+
Sbjct  227   FAVLGGLGQFGIITRARIALEPAPQMVRWVRLIYMNFEAFARDQEKLISLDDG--KKGFN  284

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             YVEG +++   + NNWRSSFF  R+  + SS+ +  G +YCLE  + YD++    VD+E+
Sbjct  285   YVEGSILMHHNVGNNWRSSFFPERDLGRISSLAAQHGAVYCLEGARYYDKAMVHMVDKEL  344

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LL+ L F+P   F  D+ Y  FL+RV   ELKLRS+GLW+VPHPWLN+FVP+SRI +F
Sbjct  345   ESLLEALSFMPGFAFKNDVTYTRFLNRVRDGELKLRSQGLWNVPHPWLNIFVPRSRIIDF  404

Query  591   DRGVFKGILGNKTS-GPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQT  415
             DRG+FK IL +  S GPILIYPMN+NKWD RTSAV P+EE+FY + LL S V        
Sbjct  405   DRGIFKSILRHDNSMGPILIYPMNRNKWDRRTSAVIPDEEIFYSIGLLWSGV------HA  458

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILS  235
              + L+ QN++IL FC ++GI  KQYLPHY+TQ +W +HFG KW+ F  RK ++DPK +LS
Sbjct  459   WEWLEDQNKEILHFCNQAGINHKQYLPHYTTQADWMKHFGSKWDIFVERKRRYDPKALLS  518

Query  234   TGQLIFTPSFNAMTAS  187
              GQ IFT S    + S
Sbjct  519   PGQQIFTSSMADNSCS  534



>ref|NP_001275006.1| cytokinin oxidase/dehydrogenase [Solanum tuberosum]
 gb|ACP40987.1| cytokinin oxidase/dehydrogenase [Solanum tuberosum]
Length=533

 Score =   503 bits (1294),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 242/424 (57%), Positives = 315/424 (74%), Gaps = 9/424 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSE--KFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQA    GV++ M          +     +F Y DV  GELWI++L  TL++GLAP
Sbjct  109   HSLQGQAQARGGVIINMESLRQDQEMQVYYRGVQFPYVDVSAGELWINILHETLKYGLAP  168

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             KSWTDYL+L+VGGTLSNAGISGQAF HGPQISNV +L+VVTGKGE + CS+EQN++LFHA
Sbjct  169   KSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVRQLEVVTGKGEVLICSQEQNADLFHA  228

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFG+ITRARI+LE AP+ V+WIRVLYSDF  F +DQE LIS      ++ FDY+
Sbjct  229   VLGGLGQFGIITRARISLERAPKMVKWIRVLYSDFSTFARDQERLIS-----ASKTFDYI  283

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EG VI ++ GL+NNWR+SF  P++PV+ S   SDG  LYCLE+TKN      DTV+QEI+
Sbjct  284   EGLVIKNKTGLLNNWRTSF-DPQDPVQASHFVSDGRTLYCLELTKNLYPEKFDTVNQEIE  342

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LL +L +IPS++F +++PY+DFLDRVH +EL LRSKGLWD+PHPWLNL VPKS+I  F 
Sbjct  343   DLLSQLSYIPSTLFMSEVPYIDFLDRVHASELILRSKGLWDLPHPWLNLLVPKSKIQHFA  402

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
               VF  IL +  +GP+L+YP+ K+K D RTS V P+E++ YLVA L  A  + N + +L+
Sbjct  403   NEVFGNILSDTNNGPVLVYPIQKSKVDNRTSFVCPDEDIIYLVAFLSHANPSSNGTDSLQ  462

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
             ++ +QN+ IL FC+ S + +KQYLPHY+TQ++W+ HFG KWE F  RK  +DP  +L+ G
Sbjct  463   HVLTQNKRILDFCEVSHLGVKQYLPHYTTQEQWRTHFGPKWEVFVQRKSVYDPLAMLAPG  522

Query  228   QLIF  217
             Q IF
Sbjct  523   QNIF  526



>emb|CDX79932.1| BnaA05g02240D [Brassica napus]
Length=533

 Score =   502 bits (1293),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 241/425 (57%), Positives = 321/425 (76%), Gaps = 19/425 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKP---LVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQA+   GVV+ M     ++P P   +      Y DV GGELWI++L+ TL+HGL+
Sbjct  112   HSLQGQALAHQGVVINME----SLPSPDIKIYKGTQPYVDVSGGELWINILRETLKHGLS  167

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE+VTCS++ N ELFH
Sbjct  168   PKSWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEAVTCSKKLNPELFH  227

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             +VLGGLGQFG+ITRARI+L  AP  V+WIRVLYSDF  F++DQE+LIS       + FD+
Sbjct  228   SVLGGLGQFGIITRARISLGPAPHMVKWIRVLYSDFSTFSRDQEHLIS-----KKKGFDF  282

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             VEG V ++   L+NNWRSS F+P +  + S  KSDG  LYCLE+ K +++  A++++QEI
Sbjct  283   VEGSVTINRTDLLNNWRSS-FTPNDSTEASQFKSDGKTLYCLEVVKYFNKEEANSMNQEI  341

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             D LL +L +IPS++F++ +PY++FLDRVH  E+KLR+KGLW+VPHPWLNL VPKS I EF
Sbjct  342   DSLLSELSYIPSTLFSSVVPYIEFLDRVHLGEIKLRAKGLWEVPHPWLNLLVPKSSIFEF  401

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
                VF  IL +  +GPILIYP+N++KW++RTS +TP E++FYLVA L SAV+N      L
Sbjct  402   ATEVFNNILTSNNNGPILIYPVNQSKWNKRTSLITPSEDIFYLVAFLPSAVQND-----L  456

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             ++L  QN+ +L FC E+ +++KQYLPHY TQ+EW+ HFG KWE F   K ++DP  IL+ 
Sbjct  457   EHLLRQNQRVLNFCAEAKMDVKQYLPHYETQREWRSHFGNKWETFAKMKHEYDPLAILAP  516

Query  231   GQLIF  217
             G  IF
Sbjct  517   GHRIF  521



>ref|XP_010505935.1| PREDICTED: cytokinin dehydrogenase 1 [Camelina sativa]
Length=577

 Score =   504 bits (1297),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 239/423 (57%), Positives = 319/423 (75%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSE-KFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA+   GVV++M       P   + + K  Y DV GGELWI++L+ TL++GL+PK
Sbjct  125   HSLQGQALAHQGVVIKMESLRN--PNIRIHKGKQPYVDVSGGELWINILRETLKYGLSPK  182

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF +GPQI+NV++L++VTGKGE VTCSE++NSELF++V
Sbjct  183   SWTDYLHLTVGGTLSNAGISGQAFKYGPQINNVYQLEIVTGKGEVVTCSEKRNSELFYSV  242

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP  V+WIRVLYSDF  F++DQE+LIS       + FDYVE
Sbjct  243   LGGLGQFGIITRARISLEPAPHMVKWIRVLYSDFSVFSRDQEHLIS-----KEKTFDYVE  297

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++   L+NNWRSSF  P +  + S  KSDG  LYCLE+ K ++   A+++ +E   
Sbjct  298   GFVIINRTDLLNNWRSSF-RPNDSTEASKFKSDGKTLYCLEVVKYFNTEEANSMHKETGK  356

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L +IPS++FT+++PY++FLDRVH AE KLR+KGLW+VPHPWLNL +PKS I +F  
Sbjct  357   LLSELNYIPSTLFTSEVPYIEFLDRVHIAERKLRAKGLWEVPHPWLNLLIPKSSISKFAT  416

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  I+ +  +GPILIYP+N++KW+++TS +TP E++FYLVA L SAV   +    L+ 
Sbjct  417   EVFHNIITSNNNGPILIYPVNQSKWNKQTSLITPNEDIFYLVAFLPSAVPKSSGKNDLEY  476

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             L  QN+ ++ FC  + + +KQYLPHY TQQEWK HFG++WE F  RK  +DP  IL+ GQ
Sbjct  477   LLKQNQRVMNFCTTANLHVKQYLPHYETQQEWKSHFGKRWETFSQRKHAYDPLTILAPGQ  536

Query  225   LIF  217
              IF
Sbjct  537   RIF  539



>emb|CAE55201.1| cytokinin oxidase 3 [Zea mays]
Length=525

 Score =   501 bits (1291),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 324/425 (76%), Gaps = 13/425 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMY---ADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQ+  A G+V++M       P+  V++  +     D  GGELWI+VL+ TL+HGLA
Sbjct  101   HSLMGQSQAAQGIVVRMESLRG--PRLQVNDGGVSPPSVDAPGGELWINVLRETLKHGLA  158

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAG+SGQAF HGPQ+SNV++L++VTG+G+ VTCS + N++LF+
Sbjct  159   PKSWTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGDVVTCSPDDNADLFY  218

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             A LGGLGQFG+ITRARIALE AP+ VRWIRVLYSDF++FT+DQE LI          FDY
Sbjct  219   AALGGLGQFGIITRARIALEPAPKMVRWIRVLYSDFESFTEDQEMLIMAE-----NSFDY  273

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             VEGFVI++  G++NNWR+SF  P++PV+ S  +SDG VLYCLE+TKN++    DT++QE+
Sbjct  274   VEGFVIINRTGVLNNWRASF-KPQDPVEASHFQSDGRVLYCLELTKNFNSDDTDTMEQEV  332

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
              VLL +L+FI S++F TD+ Y++FLDRVH +ELKLR++GLW+VPHPWLNL +P+S I  F
Sbjct  333   TVLLSRLRFIQSTLFHTDVTYLEFLDRVHTSELKLRAQGLWEVPHPWLNLLIPRSSIRRF  392

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
              + VF  IL +  +GPIL+YP+N++KWD RTS V P+EE+FYLV  L SA        ++
Sbjct  393   AKEVFGKILKDSNNGPILLYPVNRSKWDNRTSVVIPDEEIFYLVGFLSSAPSLSGYG-SI  451

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
              +  + N+ I++FC+E+GI MKQYL  Y+TQQ+WK HFG +WE F+ RK ++DP  IL+ 
Sbjct  452   AHSMNLNKQIVEFCEEAGIGMKQYLAPYTTQQQWKAHFGARWETFERRKHRYDPLAILAP  511

Query  231   GQLIF  217
             GQ IF
Sbjct  512   GQRIF  516



>ref|XP_006293839.1| hypothetical protein CARUB_v10022823mg [Capsella rubella]
 gb|EOA26737.1| hypothetical protein CARUB_v10022823mg [Capsella rubella]
Length=626

 Score =   505 bits (1301),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 246/438 (56%), Positives = 324/438 (74%), Gaps = 10/438 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSE-KFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA+   GVV++M    +  P   + E K  Y DV GGELWI++L+ TL++GL+PK
Sbjct  185   HSLQGQALAHQGVVIKMESLRS--PDIRIYEGKQPYVDVSGGELWINILRETLKYGLSPK  242

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE VTCSE++NSELF++V
Sbjct  243   SWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKRNSELFYSV  302

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI LE AP  V+WIRVLYSDF AF++DQE+LIS       + FDYVE
Sbjct  303   LGGLGQFGIITRARIFLEPAPHMVKWIRVLYSDFSAFSRDQEHLIS-----KEKTFDYVE  357

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++   L+NNWRSSF SP +  + S  KSDG  LYCLE+ K ++   A +++QE   
Sbjct  358   GFVIINRTDLLNNWRSSF-SPNDSTQASKFKSDGKTLYCLEVVKYFNPEEASSMNQETSK  416

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L +I S++F++++PY++FLDRVH AE KLR+KGLW+VPHPWLNL +PKS I  F  
Sbjct  417   LLSELNYIRSTLFSSEVPYIEFLDRVHIAERKLRAKGLWEVPHPWLNLLIPKSSIFRFAT  476

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  I+ +  +GPILIYP+N++KW + TS +TP E+VFYLVA L SAV N +    L+ 
Sbjct  477   EVFNNIIRSNNNGPILIYPVNQSKWIKHTSLITPNEDVFYLVAFLPSAVPNSSGKNDLEY  536

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             L  QN+ ++ FC+ + + +KQYLPHY TQQEWK HF ++WE F  RK  +DP  IL+ GQ
Sbjct  537   LLKQNQRVMNFCRAANLHVKQYLPHYETQQEWKSHFSKRWETFAERKHVYDPLAILAPGQ  596

Query  225   LIFTPSFNAMTASW*QLA  172
              IF  +     +S  QL+
Sbjct  597   RIFQKTTTTTHSSPIQLS  614



>ref|XP_007012819.1| Cytokinin oxidase [Theobroma cacao]
 gb|EOY30438.1| Cytokinin oxidase [Theobroma cacao]
Length=524

 Score =   501 bits (1289),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 238/426 (56%), Positives = 315/426 (74%), Gaps = 9/426 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKP--LVSEKFMYADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQAM   GVV+ M+            +S    YAD+ G +LWIDVL +TLE GLAP
Sbjct  102   HSVRGQAMANNGVVVDMASMKKHRNGSGIRISSDGCYADIGGEQLWIDVLNATLERGLAP  161

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
              SWTDYLYL+VGGTLSNAGISGQ F +GPQISNV+E+DV+TG  +  TCS E+NSELF+A
Sbjct  162   VSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYEMDVITGTADFHTCSPEKNSELFYA  221

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
             VLGGLGQFG+ITRARI LE AP+RV+W+R+LY+DF AFT+DQE LIS++G+      DY+
Sbjct  222   VLGGLGQFGIITRARIPLEPAPKRVKWVRMLYNDFSAFTRDQELLISINGRKDNNALDYL  281

Query  945   EGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             EG +++D+G  +NWRSSFF P +  K  S+ ++  ++YCLE+ K+YD  T  TVD+E+  
Sbjct  282   EGSLMMDQGSPDNWRSSFFPPADHPKIMSLITEHRIIYCLEVVKHYDDQTKSTVDKELQQ  341

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LLK L + P  +F  D+ Y +FL+RV   ELKL+S+GLWDVPHPWLNLF+PKS+I +F+ 
Sbjct  342   LLKGLSYTPGLMFEKDVLYAEFLNRVRSGELKLKSQGLWDVPHPWLNLFIPKSQIADFND  401

Query  585   GVFKGILGNK--TSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
             GVFKGI+  +  T+GP+L+YPMN+ KWD+R SAV P+EE+FY V +L S+  +  E+   
Sbjct  402   GVFKGIVLERSITTGPVLLYPMNRKKWDDRMSAVIPDEEIFYTVGILHSSGFDDWEA---  458

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
                  QN++I++FC ++GI +KQYLPHY+ ++EW +HFG KW+ FQ  K QFDPK ILS 
Sbjct  459   --FDDQNKEIMQFCDKAGIGVKQYLPHYTAKEEWIQHFGSKWKTFQQSKHQFDPKMILSP  516

Query  231   GQLIFT  214
             GQ IF 
Sbjct  517   GQRIFN  522



>dbj|BAF00384.1| cytokinin oxidase -like protein [Arabidopsis thaliana]
Length=520

 Score =   501 bits (1289),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 243/426 (57%), Positives = 315/426 (74%), Gaps = 13/426 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPL----VSEKFMYADVWGGELWIDVLKSTLEHGL  1312
             HS+ GQA T  G+V+ M       P+ L    V     Y DV GGELWI++L  TL++GL
Sbjct  96    HSLQGQAQTRHGIVIHMESLH---PQKLQVYSVDSPAPYVDVSGGELWINILHETLKYGL  152

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             APKSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L++VTGKGE + C++ QNS+LF
Sbjct  153   APKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGEILNCTKRQNSDLF  212

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             + VLGGLGQFG+ITRARIALE AP  V+WIRVLY DF AF KDQE LIS  G     KFD
Sbjct  213   NGVLGGLGQFGIITRARIALEPAPTMVKWIRVLYLDFAAFAKDQEQLISAQGH----KFD  268

Query  951   YVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             Y+EGFVI++  GL+N+WR SF +   P++ S  K DG  L+CLE+ K   Q   D ++QE
Sbjct  269   YIEGFVIINRTGLLNSWRLSF-TAEEPLEASQFKFDGRTLHCLELAKYLKQDNKDVINQE  327

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             +   L +L ++ S++FTT++ Y  FLDRVH +E+KLRSKG W+VPHPWLNL VP+S+I+E
Sbjct  328   VKETLSELSYVTSTLFTTEVAYEAFLDRVHVSEVKLRSKGQWEVPHPWLNLLVPRSKINE  387

Query  594   FDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQT  415
             F RGVF  IL + ++GP+++YP+NK+KWD +TSAVTPEEEVFYLVA+L SA         
Sbjct  388   FARGVFGNILTDTSNGPVIVYPVNKSKWDNQTSAVTPEEEVFYLVAILTSASPGSAGKDG  447

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILS  235
             ++ +  +NR IL+F +E+GI +KQYLPHY+T++EW+ HFG+KW  F  RK ++DP  IL+
Sbjct  448   VEEILRRNRRILEFSEEAGIGLKQYLPHYTTREEWRSHFGDKWGEFVRRKSRYDPLAILA  507

Query  234   TGQLIF  217
              G  IF
Sbjct  508   PGHRIF  513



>emb|CDP03155.1| unnamed protein product [Coffea canephora]
Length=527

 Score =   501 bits (1289),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 251/429 (59%), Positives = 314/429 (73%), Gaps = 17/429 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAA------AAVPKPLVSEKFMYADVWGGELWIDVLKSTLEH  1318
             HSI GQAM   GVV++MS  +        +          YADV G +LWIDVL++TL++
Sbjct  105   HSIRGQAMAPNGVVIEMSSLSDYTSNGTKIKVSWSPSLGYYADVGGEQLWIDVLRTTLDY  164

Query  1317  GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSE  1138
             GLAP SWTDYLYL+VGGTLSNAGISGQ F HGPQISNVHELDV+TGKGE +TCS+  NSE
Sbjct  165   GLAPVSWTDYLYLTVGGTLSNAGISGQTFRHGPQISNVHELDVITGKGEFITCSKHMNSE  224

Query  1137  LFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQK  958
             L++AVLGGLGQFG+ITRARI L+ AP RV+W+R++Y DF +FT+DQEYLIS++       
Sbjct  225   LYYAVLGGLGQFGIITRARIVLDKAPTRVKWLRIMYDDFSSFTRDQEYLISIND----NG  280

Query  957   FDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQ  778
              DYVEG +I+ +   NNWRSSFFS  +  K SS+ ++ G+LYC+E+ K YD +TA TVDQ
Sbjct  281   LDYVEGSLILQQSSPNNWRSSFFSASHQSKISSLLTERGILYCMEVVKYYDDNTAATVDQ  340

Query  777   EIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRID  598
             E+++LL+ L +IP  +F  D  +V FL+RV   EL+L+SKGLWDVPHPWLNLFVPKSRI 
Sbjct  341   ELELLLEGLHYIPGFLFKKDDSFVGFLNRVRSGELELQSKGLWDVPHPWLNLFVPKSRIM  400

Query  597   EFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             +F+ GVF  IL   NK +GPIL+YP +K  WDER SAV P+E+ FY V LL S   +   
Sbjct  401   DFNAGVFVDILLKQNKATGPILVYPTSKKMWDERMSAVVPDEDTFYCVGLLHSGTLD---  457

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
                 KNL  QN ++L+FC ++GIE+KQYLPHY T+Q+W  HFG KW  FQ RK +FDPK 
Sbjct  458   --DWKNLDDQNNELLEFCDKNGIEIKQYLPHYKTRQDWMNHFGSKWSTFQERKARFDPKV  515

Query  243   ILSTGQLIF  217
             ILS GQ IF
Sbjct  516   ILSPGQKIF  524



>ref|XP_004251670.1| PREDICTED: cytokinin dehydrogenase 3 [Solanum lycopersicum]
Length=527

 Score =   501 bits (1289),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 243/430 (57%), Positives = 311/430 (72%), Gaps = 16/430 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG------AAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEH  1318
             HSI GQAM   GV+++MS           V     S+   YADV G +LWIDVL +TLE+
Sbjct  106   HSIRGQAMAKNGVIVEMSSLNNNNNENCGVRVSWDSDLGFYADVGGEQLWIDVLHNTLEY  165

Query  1317  GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSE  1138
             GLAP SWTDYLYL+VGGTLSNAGISGQ F +GPQISNVHE+DV+TGKGE +TCS++ NSE
Sbjct  166   GLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVHEMDVITGKGELMTCSKDMNSE  225

Query  1137  LFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQK  958
             LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY DF  FTKDQE+LIS+H       
Sbjct  226   LFFGVLGGLGQFGIITRARIVLDKAPTRVKWVRMLYDDFSKFTKDQEHLISIHN----NG  281

Query  957   FDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQ  778
              DYVEG +++++  +NNWRSSF+SP N  K +S+ S   ++YCLEI K YD   A+T+D+
Sbjct  282   LDYVEGSLMMEQSSLNNWRSSFYSPSNQTKIASLLSKNKIMYCLEIVKYYDDQNANTIDK  341

Query  777   EIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRID  598
             E+  L+K LK++   +F  D+ +V+FL+RV   EL+L+SKG+WDVPHPWLNLFVPKS I 
Sbjct  342   ELKKLVKGLKYVGGFMFKKDVSFVEFLNRVRSGELELQSKGMWDVPHPWLNLFVPKSSIM  401

Query  597   EFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
              F+  VF  I+   NKT+GPIL+YP ++ +WD+R SA+ PEEE FY V LL S+    NE
Sbjct  402   HFNAAVFVDIILRQNKTNGPILVYPTSRKRWDDRMSAIIPEEETFYCVGLLHSS-SGYNE  460

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
              + L N   QN +IL +C + G+ +KQYLPHY T+++W +HFG+KW  FQ RK  FDPK 
Sbjct  461   CKILDN---QNEEILNYCDKVGLNIKQYLPHYKTKEDWIKHFGKKWNIFQQRKDLFDPKM  517

Query  243   ILSTGQLIFT  214
             ILS GQ IF 
Sbjct  518   ILSPGQRIFN  527



>ref|NP_001105163.1| cytokinin oxidase 3 precursor [Zea mays]
 emb|CAE55202.1| cytokinin oxidase 3 [Zea mays]
Length=525

 Score =   500 bits (1288),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 323/425 (76%), Gaps = 13/425 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMY---ADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQ+  A G+V++M       P+  V++  +     D  GGELWI+VL+ TL+HGLA
Sbjct  101   HSLMGQSQAAQGIVVRMESLRG--PRLQVNDAGVSPPSVDAPGGELWINVLRETLKHGLA  158

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAG+SGQAF HGPQ+SNV++L++VTG+G+ VTCS + N++LF+
Sbjct  159   PKSWTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGDVVTCSPDDNADLFY  218

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             A LG LGQFG+ITRARIALE AP+ VRWIRVLYSDF++FT+DQE LI          FDY
Sbjct  219   AALGDLGQFGIITRARIALEPAPKMVRWIRVLYSDFESFTEDQEMLIMAE-----NSFDY  273

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             VEGFVI++  G++NNWR+SF  P++PV+ S  +SDG VLYCLE+TKN++    DT++QE+
Sbjct  274   VEGFVIINRTGVLNNWRASF-KPQDPVEASHFQSDGRVLYCLELTKNFNSDDTDTMEQEV  332

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
              VLL +L+FI S++F TD+ Y++FLDRVH +ELKLR++GLW+VPHPWLNL +P+S I  F
Sbjct  333   TVLLSRLRFIQSTLFHTDVTYLEFLDRVHTSELKLRAQGLWEVPHPWLNLLIPRSSIRRF  392

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
              + VF  IL +  +GPIL+YP+NK+KWD RTS V P+EE+FYLV  L SA        ++
Sbjct  393   AKEVFGKILKDSNNGPILLYPVNKSKWDNRTSVVIPDEEIFYLVGFLSSAPSLSGYG-SI  451

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
              +  + N+ I++FC+E+GI MKQYL  Y+TQQ+WK HFG +WE F+ RK ++DP  IL+ 
Sbjct  452   AHSMNLNKQIVEFCEEAGIGMKQYLAPYTTQQQWKAHFGARWETFERRKHRYDPLAILAP  511

Query  231   GQLIF  217
             GQ IF
Sbjct  512   GQRIF  516



>ref|XP_010090224.1| Cytokinin dehydrogenase 1 [Morus notabilis]
 gb|EXB39093.1| Cytokinin dehydrogenase 1 [Morus notabilis]
Length=542

 Score =   501 bits (1289),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 238/422 (56%), Positives = 318/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M        +    E+  YADV GG+LWI++L  TL +GLAPKS
Sbjct  104   HSLQGQAQAHQGVVINMESLQEQEIQIYTGEQ-PYADVSGGQLWINILHETLRYGLAPKS  162

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYLYL+VGGTLSNAGISGQAF HGPQISNV++L+VVTGKGE VTCSE QN++LF+AVL
Sbjct  163   WTDYLYLTVGGTLSNAGISGQAFKHGPQISNVYQLEVVTGKGEVVTCSENQNADLFYAVL  222

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ ++WIRVLYSDF +F+KDQE+LIS         F+Y+EG
Sbjct  223   GGLGQFGIITRARISLEPAPKMIKWIRVLYSDFSSFSKDQEHLIS-----SQDSFNYIEG  277

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+N WRSSF  P++P++ S   S+G  LYCLE+   +  +  D+V+++++ L
Sbjct  278   FVIINRTGLLNTWRSSF-DPKDPIRASQFNSEGRTLYCLEMALYFSPNEVDSVNKKLERL  336

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +I S++F +++ Y++FL+RVH +E KLR KGLW++PHPWLNL VPKS+I++F   
Sbjct  337   LSELSYIHSTLFLSEVSYLEFLNRVHFSERKLRQKGLWEIPHPWLNLLVPKSKINQFAEE  396

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL   ++GPILIYP+NK+KW+ +TS VTP+E++ YLVA L SA         L+N+
Sbjct  397   VFGNILNYSSNGPILIYPVNKSKWNNKTSLVTPDEDIVYLVAFLSSATPFSTGKDGLENI  456

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL++C E+ +  KQYLPHYSTQ+EW+ HFG KW+ FQ RKL +DP  IL+ GQ 
Sbjct  457   LTQNKRILEYCAEARLGTKQYLPHYSTQEEWRAHFGPKWKAFQQRKLAYDPLAILAPGQR  516

Query  222   IF  217
             IF
Sbjct  517   IF  518



>ref|XP_006351290.1| PREDICTED: cytokinin dehydrogenase 1-like [Solanum tuberosum]
Length=536

 Score =   500 bits (1288),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 240/422 (57%), Positives = 319/422 (76%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ+    G+V+ M        K  + E+  Y DV  GELWI+VL  +L+ GLAPKS
Sbjct  113   HSLEGQSQAYQGLVINMKSLQELEMKFKI-EELSYVDVSAGELWINVLHESLKLGLAPKS  171

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKGE +TCSEEQN++LFH VL
Sbjct  172   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEVVTGKGEVITCSEEQNADLFHGVL  231

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+IT+ARIALE AP++V+WIRVLYSDF  F+ DQE LIS         FDY+EG
Sbjct  232   GGLGQFGIITKARIALETAPKQVKWIRVLYSDFATFSNDQENLIS-----SQNTFDYIEG  286

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRS+F +P++P+  S+  S+G VL+CLE+ K ++     + DQ+ID+L
Sbjct  287   FVIINSTGLLNNWRSTF-NPKDPLLASNFSSEGRVLFCLEVAKYFNPEDTYSTDQDIDIL  345

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL +I S++F +++ YV+FLDRVH +E+KL+ KGLWDVPHPWLNL +PKSRI EF + 
Sbjct  346   LSKLHYIRSTLFLSEVSYVEFLDRVHVSEMKLQEKGLWDVPHPWLNLLIPKSRILEFAQE  405

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+NK+KW + TS VTP+E+VFYL+A L SA+        L+++
Sbjct  406   VFGKILTDTSNGPILIYPVNKSKWRKGTSMVTPDEDVFYLIAFLSSAMPFSTGKDGLEHI  465

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ +L FC+++ I MKQYLP++ TQ+EWK HFG +WE F  RK  +DP  IL+ GQ 
Sbjct  466   MNQNKRVLSFCEKTRIGMKQYLPNHKTQEEWKHHFGSQWEAFARRKSTYDPLAILAPGQR  525

Query  222   IF  217
             IF
Sbjct  526   IF  527



>ref|XP_008459369.1| PREDICTED: cytokinin dehydrogenase 3-like [Cucumis melo]
Length=524

 Score =   500 bits (1287),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 243/430 (57%), Positives = 308/430 (72%), Gaps = 14/430 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAA--AVPKPLVSEKF-----MYADVWGGELWIDVLKSTLE  1321
             HS+ GQAM   GVV+ MS        P  +VS +       Y DV G +LWIDVL  TL 
Sbjct  98    HSVRGQAMAKNGVVIDMSALRRNRKTPGIVVSCRRWTTGEFYVDVGGEQLWIDVLNETLG  157

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             +G+ P SWTDYLY++VGGTLSNAGISGQ+F +GPQ+SNV E+DVVTGKG  +TCS ++N 
Sbjct  158   YGMTPVSWTDYLYITVGGTLSNAGISGQSFRYGPQVSNVVEMDVVTGKGNMMTCSPKKNC  217

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELFHAVLGGLGQFG+I RARIALE AP RV+W+R+LY++F AFTKDQE+LISL+G+    
Sbjct  218   ELFHAVLGGLGQFGIIARARIALEPAPIRVKWVRMLYTNFAAFTKDQEHLISLNGRKQMN  277

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
               DY+EG V++     +NWRSSFF P +  +  S+ +   ++YCLE+ K YD  T  TVD
Sbjct  278   ALDYLEGLVLLHHNKPDNWRSSFFPPSDHSRIISLANQNSIIYCLEVVKYYDHHTQSTVD  337

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             ++++VLL+ L +     F  D+ YV+FL+RV   ELKL+SKGLWDVPHPWLNLFVP+SRI
Sbjct  338   KDLEVLLQGLDYESGFKFEKDVTYVEFLNRVRTGELKLQSKGLWDVPHPWLNLFVPRSRI  397

Query  600   DEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGN  427
              +F+ GVFK I+   N T GPILIYPMN++KWDER S V P+EEVFY +  L     N +
Sbjct  398   MDFNSGVFKDIVLRRNITKGPILIYPMNRSKWDERNSTVIPDEEVFYTIGFL-----NSS  452

Query  426   ESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPK  247
                  K  + QN +IL++C +SGIE+KQYLPHY TQ +W +HFG KW  FQH K +FDPK
Sbjct  453   GFDDWKKFEEQNEEILEYCGKSGIEIKQYLPHYKTQTQWIQHFGSKWTNFQHNKFKFDPK  512

Query  246   HILSTGQLIF  217
             +ILS GQ IF
Sbjct  513   NILSPGQKIF  522



>ref|XP_004142714.1| PREDICTED: cytokinin dehydrogenase 1-like [Cucumis sativus]
 ref|XP_004162818.1| PREDICTED: cytokinin dehydrogenase 1-like [Cucumis sativus]
 gb|KGN54512.1| hypothetical protein Csa_4G343590 [Cucumis sativus]
Length=542

 Score =   500 bits (1288),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 238/422 (56%), Positives = 318/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HSI GQA    GVV+ M        K + + +  Y DV  GELWI++L  TL+ GLAPKS
Sbjct  120   HSIQGQAQAYNGVVISMESFKGTEMK-INAGELPYVDVSAGELWINILHETLKQGLAPKS  178

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNV++L+VVTGKGE V CSE QN++LFHAVL
Sbjct  179   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVYQLEVVTGKGEVVVCSENQNADLFHAVL  238

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ V+W+RVLYSDF  FT+DQEYLIS +      +FDY+EG
Sbjct  239   GGLGQFGIITRARISLEKAPKMVKWMRVLYSDFSKFTRDQEYLISSN-----DRFDYIEG  293

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FV+++  GL+NNWRSSF +P+ P++ S   SDG + +CLEI K ++    D ++++++ L
Sbjct  294   FVLINRTGLLNNWRSSF-NPKEPLQASKFNSDGKIFFCLEIAKYFNPDEIDFMNKKVESL  352

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             + +L +IPS++FT+++ Y+DFLDRVH +E KLR+KGLW++PHPWLNL +PKS+I +F + 
Sbjct  353   MSELSYIPSTLFTSEVTYLDFLDRVHVSENKLRAKGLWEIPHPWLNLLIPKSQIHDFAQE  412

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPI+IYP+NK+KW+ RTS VTP+E++FYLVA L SAV +   +  L+++
Sbjct  413   VFGNILKDTSNGPIIIYPVNKSKWNNRTSLVTPDEDIFYLVAFLSSAVPSSVGTDCLEHI  472

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ IL +C E     KQYLPHYS Q+EW+ HFG KW+    RK  +DP  IL+ GQ 
Sbjct  473   LEQNQRILDYCIEFLPGFKQYLPHYSNQEEWRSHFGPKWQTILQRKSIYDPLAILAPGQR  532

Query  222   IF  217
             IF
Sbjct  533   IF  534



>ref|XP_002456917.1| hypothetical protein SORBIDRAFT_03g045410 [Sorghum bicolor]
 gb|EES02037.1| hypothetical protein SORBIDRAFT_03g045410 [Sorghum bicolor]
Length=523

 Score =   499 bits (1286),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 237/422 (56%), Positives = 315/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ+  A G+V++M          +      + D  GGELWI+VL+ TL+HGLAPKS
Sbjct  100   HSLMGQSQAAQGIVVRMESLRRGARLQVHGGVSPFVDAPGGELWINVLRQTLKHGLAPKS  159

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQAF HGPQ+SNV++L++VTG+G+ VTCS E NS+LF+  L
Sbjct  160   WTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGDVVTCSPEDNSDLFYGAL  219

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+I RARIALE AP+ VRWIRVLYSDF+ FT+DQE LI          FDY+EG
Sbjct  220   GGLGQFGIIIRARIALEPAPKMVRWIRVLYSDFETFTEDQEMLIMAE-----NSFDYIEG  274

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  G++NNWR+SF  P++PV+ S  KSDG VLYCLE+TKN++   AD ++QE+ V+
Sbjct  275   FVIINRTGILNNWRASF-KPQDPVQASHFKSDGRVLYCLELTKNFNSDDADIMEQEVTVV  333

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L+FI S++F TD+ Y++FLDRVH +ELKLR++GLW+VPHPWLNL +P+S I  F + 
Sbjct  334   LSRLRFIQSTLFHTDVTYLEFLDRVHTSELKLRAQGLWEVPHPWLNLLIPRSSIRRFAKE  393

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPIL+YP+NK+KWD RTS V P+EE+FYLV  L SA        ++ + 
Sbjct  394   VFGKILKDSNNGPILLYPVNKSKWDNRTSVVIPDEEIFYLVGFLSSAPSLSGHG-SIAHA  452

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              + N  I++FC+E+ I MKQYL  Y+TQQ+WK HFG +WE F+ RK ++DP  IL+ GQ 
Sbjct  453   MNLNNQIVEFCEEADIGMKQYLAPYTTQQQWKAHFGARWETFERRKHRYDPLAILAPGQR  512

Query  222   IF  217
             IF
Sbjct  513   IF  514



>gb|KHN32384.1| Cytokinin dehydrogenase 6 [Glycine soja]
Length=535

 Score =   500 bits (1287),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 244/423 (58%), Positives = 310/423 (73%), Gaps = 13/423 (3%)
 Frame = -1

Query  1470  NGQAMTAAGVVLQMSGAAAAVPKPLV----SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             +GQA    GVV+ M   +  VP+  V         Y DV GGELWI++L  TL +GLAP+
Sbjct  114   HGQAQAHGGVVINME--SLKVPEMQVHVDVGNSPPYVDVSGGELWINILHETLRYGLAPR  171

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAG+SGQAF HGPQISNV  L++VTG GE V CS E N +LFH+V
Sbjct  172   SWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVQLLEIVTGTGEVVNCSAENNGDLFHSV  231

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI LE AP  V+WIRVLYSDF AFT+DQE LIS         FDY+E
Sbjct  232   LGGLGQFGIITRARIVLEPAPAMVKWIRVLYSDFTAFTRDQERLIS-----AENTFDYIE  286

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWR SF +P++PV+ S  KSDG  L+CLE+ K ++    D  +QE++ 
Sbjct  287   GFVIINRTGLLNNWRLSF-NPQDPVQASHFKSDGRTLFCLEMAKYFNVEEIDAANQEVEE  345

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
              L +L +IPS++F+T++ +VDFLDRVH +E+KLRSKGLWDVPHPWLNL +PKS+I  F  
Sbjct  346   HLSRLSYIPSTLFSTEVTFVDFLDRVHISEVKLRSKGLWDVPHPWLNLLIPKSQIHNFAE  405

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL   ++GP+LIYP+NK+KWD RTS V PEE +FYLVA L SAV +   +  L++
Sbjct  406   VVFGNILTETSNGPVLIYPVNKSKWDNRTSVVIPEEAIFYLVAFLTSAVPSSTGTDGLEH  465

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + SQN+ IL+FC+ + + +KQYLPHY+TQQEW+ HFG  WE F  RK  +DP  IL+ GQ
Sbjct  466   ILSQNKRILEFCESAQLGVKQYLPHYNTQQEWRAHFGPHWETFLQRKSVYDPLAILAPGQ  525

Query  225   LIF  217
              IF
Sbjct  526   RIF  528



>ref|XP_006402274.1| hypothetical protein EUTSA_v10005878mg [Eutrema salsugineum]
 gb|ESQ43727.1| hypothetical protein EUTSA_v10005878mg [Eutrema salsugineum]
Length=536

 Score =   500 bits (1287),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 242/431 (56%), Positives = 316/431 (73%), Gaps = 23/431 (5%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGA--------AAAVPKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS+ GQA T  G+V+ M           +   P P       Y DV GGELWI++L  TL
Sbjct  109   HSLQGQAQTRHGIVIHMESLQPQKLQVHSVGAPTP-------YVDVSGGELWINILHETL  161

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             + GLAPKSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE + CSE QN
Sbjct  162   KSGLAPKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEILNCSERQN  221

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             S+LFH VLGGLGQFG+ITRARIALE AP  V+W+RVLY DF AF KDQE LIS       
Sbjct  222   SDLFHGVLGGLGQFGIITRARIALEPAPAMVKWMRVLYLDFSAFAKDQERLIS-----AD  276

Query  963   QKFDYVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQS-TAD  790
             ++FDY+EGFVI++  GL+NNWR SF +P +P++ S  KSDG  LYCLE+ K +      D
Sbjct  277   KRFDYIEGFVIINRTGLLNNWRLSF-TPEDPLQASQFKSDGRTLYCLEVGKYFKMDDNKD  335

Query  789   TVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPK  610
              ++QE+   L +L ++ S++F+T++ Y +FLDRVH +E KLRSKG W+VPHPWLNL VP+
Sbjct  336   VMNQEVKEWLSELSYVSSTLFSTEVTYEEFLDRVHVSEKKLRSKGQWEVPHPWLNLLVPR  395

Query  609   SRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             SR+++F +GVF  IL + ++GP+++YP+NK+KWD RTSAVTPEEE+FYLVA+L SAV   
Sbjct  396   SRVNDFAKGVFGSILTDTSNGPVIVYPVNKSKWDNRTSAVTPEEEIFYLVAILTSAVPGS  455

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
                  ++++  +N+ IL+F +  G  +KQYLPHY+T++EW+ HFG KWE F  RK ++DP
Sbjct  456   TGKDGVEHILKRNQRILEFSQAQGFGLKQYLPHYTTRREWRSHFGPKWEDFVRRKSRYDP  515

Query  249   KHILSTGQLIF  217
               +L+ GQ IF
Sbjct  516   LAMLAPGQRIF  526



>dbj|BAL04493.1| cytokinin oxidase [Pisum sativum]
Length=536

 Score =   500 bits (1287),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 242/425 (57%), Positives = 317/425 (75%), Gaps = 8/425 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+ M        K    E F Y DV GG+LWI+VL  TL++GLAP+S
Sbjct  114   HSLQGQAQAHGGIVINMESLKVEEIKVYGGE-FPYVDVSGGDLWINVLNETLKYGLAPRS  172

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQAF HGPQISNV ++++VTG GE V CSE+QN+ELF++VL
Sbjct  173   WTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVLKMEIVTGTGEVVNCSEKQNNELFYSVL  232

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+IT+ARI LE AP  V+WIRVLYSDF AFT+DQE LI        + FDY+EG
Sbjct  233   GGLGQFGIITKARIKLEPAPVMVKWIRVLYSDFTAFTRDQEQLIF-----AEKAFDYIEG  287

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI +  GL+NNWR SF +P++PV+ S  KSDG  L+CLE+ K ++   +  V+QE++  
Sbjct  288   FVIKNRTGLVNNWRLSF-NPQDPVQASKFKSDGRTLFCLELAKYFNLEESSEVNQEVEKH  346

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L  L +I S++F T++ Y+DFLDRVH +E+KLRSKGLWDVPHPWLNLF+PKS+I  F   
Sbjct  347   LSHLNYIQSTIFQTEVTYIDFLDRVHISEVKLRSKGLWDVPHPWLNLFIPKSKIHNFADT  406

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  I+   ++GPILIYP+NK+KWDERTS V P+E++FYLVA L SA+ + N  + L+++
Sbjct  407   VFGNIVKETSNGPILIYPVNKSKWDERTSVVIPDEDIFYLVAFLASAIPSSNGGEGLEHI  466

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              SQN+ IL++C+   + +KQYL HYSTQ+EW+ H+G KWE F+ RK  +DP  IL+ GQ 
Sbjct  467   LSQNKRILEYCEREDLGVKQYLAHYSTQEEWQTHYGPKWEIFKQRKSIYDPLAILAPGQG  526

Query  222   IFTPS  208
             IF  S
Sbjct  527   IFQKS  531



>ref|XP_007162153.1| hypothetical protein PHAVU_001G128800g [Phaseolus vulgaris]
 gb|ESW34147.1| hypothetical protein PHAVU_001G128800g [Phaseolus vulgaris]
Length=572

 Score =   501 bits (1290),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 238/428 (56%), Positives = 321/428 (75%), Gaps = 8/428 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+ M        K  + E F Y DV GGELWI++L  TL++GLAPKS
Sbjct  150   HSLQGQAQAHGGLVINMESLQGPEIKVHIGE-FPYVDVSGGELWINILHETLKYGLAPKS  208

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+N+ +L+V+TGKGE VTCS  +N++LFH VL
Sbjct  209   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNIFQLEVITGKGEVVTCSGNRNADLFHGVL  268

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ V+WIRVLYS+F  FTKDQE+LISL        FDY+EG
Sbjct  269   GGLGQFGIITRARISLETAPKMVKWIRVLYSEFSTFTKDQEHLISL-----KNTFDYIEG  323

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI+++ G++NNWRSSF  P++P++ S   SDG   YCLE+ K ++   A+ ++Q I+ L
Sbjct  324   FVIINKTGILNNWRSSF-DPKSPLQASQFNSDGRTFYCLEMAKYFNPDEAELMNQSINHL  382

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL +I  ++F +++ YV+FLDRVH +E KLR+KGLW+VPHPWLNL +P+S I +F  G
Sbjct  383   LSKLSYIQPTLFRSEVSYVEFLDRVHVSEKKLRAKGLWEVPHPWLNLLIPRSEIHDFAEG  442

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+N+ +W+ +TS VTPEE+VFYLVA L SAV N   + +L+++
Sbjct  443   VFGNILKDTSNGPILIYPVNQTRWNSKTSLVTPEEDVFYLVAFLSSAVPNCTGANSLEHI  502

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              SQN+ I++F   + +++KQYLPHYSTQ+EW+ HFG +WE F  RK  +DP  +L+ G  
Sbjct  503   VSQNKRIIEFYTSAQLKVKQYLPHYSTQEEWQAHFGSQWEVFVERKKAYDPLALLAPGHR  562

Query  222   IFTPSFNA  199
             IF  + +A
Sbjct  563   IFQKAVSA  570



>ref|XP_008464594.1| PREDICTED: cytokinin dehydrogenase 1 isoform X1 [Cucumis melo]
Length=542

 Score =   499 bits (1286),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 239/422 (57%), Positives = 318/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HSI GQA    GVV+ M        K + + +  Y DV  GELWI++L  TL+ GLAPKS
Sbjct  120   HSIQGQAQAYNGVVISMESFKGTEMK-INAGELPYVDVSAGELWINILHETLKQGLAPKS  178

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNV++L+VVTGKGE V CSE QN++LFHAVL
Sbjct  179   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVYQLEVVTGKGEVVVCSENQNADLFHAVL  238

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ V+WIRVLYSDF  FT+DQEYLIS + Q     FDY+EG
Sbjct  239   GGLGQFGIITRARISLEKAPKMVKWIRVLYSDFSKFTRDQEYLISSNDQ-----FDYIEG  293

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FV ++  GL+NNWRSSF +P+ P++ S   SDG + +CLE+ K ++    D ++++++ L
Sbjct  294   FVFINRTGLLNNWRSSF-NPKEPLQASKFNSDGKIFFCLEMAKYFNPDEIDFMNKKVESL  352

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             + +L +IPS++FT+++ Y+DFLDRVH +E KLR+KGLW+VPHPWLNL +PKS+I +F + 
Sbjct  353   MSELSYIPSTLFTSEVTYLDFLDRVHVSENKLRAKGLWEVPHPWLNLLIPKSQIHDFAQE  412

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPI+IYP+NK+KW+ RTS VTP+E++FYLVA L SAV +   +  L+++
Sbjct  413   VFGNILKDTSNGPIIIYPVNKSKWNNRTSLVTPDEDIFYLVAFLSSAVPSSVGTDGLEHI  472

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ IL +C +    +KQYLPHYS Q+EW+ HFG KW+    RK  +DP  IL+ GQ 
Sbjct  473   LEQNQRILDYCIDFLPGVKQYLPHYSNQEEWRSHFGPKWQTILQRKSIYDPLAILAPGQR  532

Query  222   IF  217
             IF
Sbjct  533   IF  534



>gb|KHN14944.1| Cytokinin dehydrogenase 1 [Glycine soja]
Length=545

 Score =   499 bits (1286),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 236/422 (56%), Positives = 316/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+ M        K + + +  Y DV GGELWI++L  TL+HGLAPKS
Sbjct  123   HSLQGQAQVHGGLVINMESLQGPEIK-VYNGELPYVDVSGGELWINILHETLKHGLAPKS  181

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+N+ +L+V+TGKGE VTCS  +N++LF+ VL
Sbjct  182   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNIFQLEVITGKGEVVTCSGNRNADLFYGVL  241

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP  V+WIRVLYS+F  FT DQEYLISL+       FDY+EG
Sbjct  242   GGLGQFGIITRARISLEPAPMMVKWIRVLYSEFSTFTMDQEYLISLN-----NTFDYIEG  296

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  G++NNWRSSF  P+NP++ S   SDG  LYCLE+ K ++   A+ ++Q +D L
Sbjct  297   FVIINRTGILNNWRSSF-DPKNPLQASQFSSDGKTLYCLEMAKYFNPDEAEAMNQSVDQL  355

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL +IPS++F +++ YV+FLDRVH +E KLR++GLW+VPHPWLNL +P+S I +F   
Sbjct  356   LSKLSYIPSTLFLSEVSYVEFLDRVHVSENKLRAQGLWEVPHPWLNLLIPRSEIHDFAEE  415

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+N+ +W+ +TS VTPEE+VFYLVALL SA+ N   + +L+++
Sbjct  416   VFGNILKDTSNGPILIYPVNQTRWNSKTSLVTPEEDVFYLVALLSSALPNSTGADSLEHI  475

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN  I+ F   + + +KQYLPHYSTQ+EW+ HFG +WE F  RK  +DP  +L+ G  
Sbjct  476   LAQNNRIIDFYTGAQLRVKQYLPHYSTQEEWQVHFGSRWEAFVERKRAYDPLALLAPGHR  535

Query  222   IF  217
             IF
Sbjct  536   IF  537



>ref|XP_010242232.1| PREDICTED: cytokinin dehydrogenase 3 isoform X2 [Nelumbo nucifera]
Length=525

 Score =   499 bits (1284),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 249/433 (58%), Positives = 318/433 (73%), Gaps = 23/433 (5%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM--------SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS+ GQA    GVV+ M        +G+   V +   S    YADV   +LW+DVL +TL
Sbjct  104   HSVRGQATAHKGVVVDMRSLDNDHNNGSRIIVDRSSPSVNNWYADVGCEQLWVDVLHATL  163

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             EHGLAP+SWTDYLYL+VGGTLSNAGISGQ+F HGPQISNV+E+DVVTG+GE VTCS + N
Sbjct  164   EHGLAPRSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVYEMDVVTGRGELVTCSPQTN  223

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISL-HGQPP  967
             SELF+AVLGGLGQFG+ITRARIALE AP +VRW+R+LY DF AFT+DQE+LIS  +G   
Sbjct  224   SELFYAVLGGLGQFGIITRARIALEPAPTKVRWVRLLYHDFIAFTRDQEHLISFNNGSEG  283

Query  966   AQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADT  787
              +  DYVEG +++++   NNWRSSFFSP +  +  S+ ++ G+LY LE+ K YD    D 
Sbjct  284   IKGLDYVEGSLVMNQSPANNWRSSFFSPDDHSRIISLANEHGILYSLEVAKYYD----DE  339

Query  786   VDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKS  607
             VD E++ LLK L FIP  +F  D+ Y+DFL+RV   EL+L+S+GLWDVPHPWLNLFVPKS
Sbjct  340   VDGELEALLKGLSFIPDLIFAKDVSYIDFLNRVRSGELELQSQGLWDVPHPWLNLFVPKS  399

Query  606   RIDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVEN  433
             RI +FD G FKGIL   NK SGPIL+YPMN+NK     SAV PEE++FY + LL  +   
Sbjct  400   RILDFDSGAFKGILRQNNKISGPILVYPMNRNK----MSAVIPEEDIFYSIGLLLQS---  452

Query  432   GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFD  253
              + +   ++L+ QN +IL+FC+++GI++KQYLP Y T+ EW  HFG KW+ F+ RK +FD
Sbjct  453   -SGTHDWEHLEEQNTEILRFCEKAGIKIKQYLPRYQTKAEWVNHFGPKWDTFKQRKTKFD  511

Query  252   PKHILSTGQLIFT  214
             PK ILS GQ +FT
Sbjct  512   PKAILSPGQGVFT  524



>emb|CDY14777.1| BnaC04g47740D [Brassica napus]
Length=546

 Score =   499 bits (1286),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 233/422 (55%), Positives = 320/422 (76%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA+   GVV+ M    +   K +   K  Y DV GGELWI++L+ TL++GL+PKS
Sbjct  111   HSLQGQALAHQGVVINMESLRSHDIK-IYKGKQPYVDVSGGELWINILRETLKYGLSPKS  169

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE VTCSE++NSELF +VL
Sbjct  170   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKRNSELFQSVL  229

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+L  AP  V+WIR LYSDF AF++DQE+LIS         FDYVEG
Sbjct  230   GGLGQFGIITRARISLGPAPLMVKWIRALYSDFSAFSRDQEHLIS-----KENAFDYVEG  284

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++   ++NNWRSSF +P +  + +  KSDG  LYCLE+ K ++   A++++QE + +
Sbjct  285   FVIINRTDILNNWRSSF-TPNDSTEANQFKSDGKTLYCLEVVKYFNSKEANSMNQETEKV  343

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F++++PY++FLDRVH AE+KLR+KGLW+VPHPWLNL +PKS I +F   
Sbjct  344   LSELSYIPSTLFSSEVPYIEFLDRVHIAEIKLRAKGLWEVPHPWLNLLIPKSSISDFATK  403

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  I+ +  +GPILIYP+N++KW++ TS +TP E++FYLVA L SA+   + +  L+ L
Sbjct  404   VFNSIVTSNHNGPILIYPVNQSKWNKHTSLITPNEDIFYLVAFLPSAIPKPSGANDLEYL  463

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ +L FC E+ +++KQYLP Y TQ+EW+ HFG +WE F  RK ++DP  IL+ GQ 
Sbjct  464   LRQNQRVLSFCAEANLDVKQYLPLYETQKEWRSHFGNRWETFAKRKYKYDPLAILAPGQR  523

Query  222   IF  217
             +F
Sbjct  524   VF  525



>emb|CDY23844.1| BnaC04g01930D [Brassica napus]
Length=596

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 241/422 (57%), Positives = 317/422 (75%), Gaps = 13/422 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA+   GVV+ M        K +  EK  Y DV GGELWI++LK TL+HGL+PKS
Sbjct  112   HSLQGQALAHQGVVINMESLQNPDIK-IYREKQPYVDVSGGELWINILKETLKHGLSPKS  170

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE VTCSE+ N ELFH+VL
Sbjct  171   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKLNPELFHSVL  230

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+L  AP  V+WIRVLYS+F  F++DQE+LIS       + FDYVEG
Sbjct  231   GGLGQFGIITRARISLGPAPHMVKWIRVLYSNFSTFSRDQEHLIS-----KMKGFDYVEG  285

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FV ++   L+NNWRSS FSP +  + S  KSDG  LYCLE  K +++   ++++QE + L
Sbjct  286   FVSINRTDLLNNWRSS-FSPNDSTEASQFKSDGKTLYCLEAVKYFNKEETNSMNQETEKL  344

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F++ +PY++FLDRVH  E+KLR+KGLW+VPHPWLNL VPKS I EF   
Sbjct  345   LSELSYIPSTLFSSVVPYIEFLDRVHHGEIKLRAKGLWEVPHPWLNLLVPKSSIIEFSTE  404

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPILIYP+N++KW+++TS +TP E++FYLVA L SAV+N      L++L
Sbjct  405   VFNNILTSNNNGPILIYPVNQSKWNKQTSLITPSEDIFYLVAFLPSAVQND-----LEHL  459

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ +L FC E+ +++KQYLPHY TQ+EW+ HFG +WE F   K ++DP  IL+ G  
Sbjct  460   LRQNQRVLNFCAEAKMDVKQYLPHYETQREWRSHFGNRWETFAKMKHEYDPLAILAPGHR  519

Query  222   IF  217
             IF
Sbjct  520   IF  521



>emb|CDP13849.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   495 bits (1274),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 234/422 (55%), Positives = 314/422 (74%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS  GQA    G+V+ M      V +   + +  Y DV  G+LWI++L  +L+HGLAPKS
Sbjct  16    HSTRGQAQADQGIVINMESLGGQVMQ-FNTGQLPYVDVSAGDLWINILHESLKHGLAPKS  74

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKG+ V CSE+Q+++LFH+VL
Sbjct  75    WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGDVVNCSEKQHADLFHSVL  134

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+IT+ARI+LE AP+ V+WIRVLYSDF  F++DQE LIS         FDY+EG
Sbjct  135   GGLGQFGIITKARISLEPAPKMVKWIRVLYSDFSTFSRDQELLIS-----AEHTFDYIEG  189

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
              VI++   ++N+WRSSF SP++P + S   SDG  L+CLE+TKN++    DT ++E++ L
Sbjct  190   LVIINRTDVLNSWRSSF-SPQDPAQASKFISDGRTLFCLELTKNFNPDEVDTANKEVENL  248

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL +I S++  T++ YV+FLDRVH +ELKLRSKG+WDVPHPWLNL +P+S+I  F +G
Sbjct  249   LSKLSYIQSTLLMTEVSYVEFLDRVHTSELKLRSKGMWDVPHPWLNLLIPRSKIKYFAQG  308

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  SGP+LIYP+NK+KWD RTS V PEE++FY+VA L  AV +   +  L++ 
Sbjct  309   VFGNILKDTKSGPVLIYPVNKSKWDNRTSFVFPEEDIFYMVAFLFHAVPSSAGTNGLEHF  368

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              + N+ IL FC  + + +KQYL HY+TQ++W+ HFG++WE F  RK  +DP  IL+ GQ 
Sbjct  369   LTLNKRILDFCAVAHLGVKQYLAHYTTQEQWQAHFGQRWEVFTQRKSTYDPLAILAPGQR  428

Query  222   IF  217
             IF
Sbjct  429   IF  430



>gb|KHN13439.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=424

 Score =   494 bits (1273),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 240/428 (56%), Positives = 305/428 (71%), Gaps = 18/428 (4%)
 Frame = -1

Query  1458  MTAAGVVLQMSG-----------AAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGL  1312
             M   GVV+ M+G             ++V     +  + YADV G +LWIDVL +TLEHGL
Sbjct  1     MAREGVVVDMAGFRERGNGVGIRVVSSVDPNNKNGYYYYADVGGEQLWIDVLHATLEHGL  60

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             AP SWTDYLYL++GGTLSNAGISGQ F +GPQI+ V E+DV+TGKGE VTCS++ NSELF
Sbjct  61    APMSWTDYLYLTLGGTLSNAGISGQTFRYGPQITTVREMDVITGKGEFVTCSQQTNSELF  120

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             HAVLGGLGQFG+ITRARIAL  AP+RV+W+R+LY+DF AFTKDQE LIS+ G+      D
Sbjct  121   HAVLGGLGQFGIITRARIALAPAPKRVKWVRLLYNDFSAFTKDQEQLISITGRKQNVSLD  180

Query  951   YVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             Y+EG +++ +G INNWRSSFF   +  +  S+ +   VLYCLE+ K YD    + VD+E+
Sbjct  181   YLEGLLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVAKYYDGQNENNVDKEL  240

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
              VLL+ L +IP   +  D+ Y +FL+RV   ELKL+S+GLWDVPHPWLNLF+PKS+I EF
Sbjct  241   QVLLQGLSYIPGFYYEKDVSYFEFLNRVRSGELKLQSQGLWDVPHPWLNLFIPKSQIMEF  300

Query  591   DRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQ  418
             D GVFK I+   N T+GP+L+YPMN+NKWD R SA  P+E++FY V  L S+        
Sbjct  301   DSGVFKNIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYTVGFLHSS-----GFD  355

Query  417   TLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHIL  238
               K   +QN++IL+FC  +GI++KQYLPHY TQ++W  HFG KW  F  RK QFDPK IL
Sbjct  356   NWKAYDAQNKEILQFCNVAGIKVKQYLPHYRTQEDWANHFGPKWRTFVERKHQFDPKMIL  415

Query  237   STGQLIFT  214
             S GQ IF 
Sbjct  416   SPGQRIFN  423



>ref|XP_003553393.1| PREDICTED: cytokinin dehydrogenase 1-like isoform X1 [Glycine 
max]
Length=545

 Score =   499 bits (1284),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 236/422 (56%), Positives = 315/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+ M        K + + +  Y DV GGELWI++L  TL+HGLAPKS
Sbjct  123   HSLQGQAQVHGGLVINMESLQGPEIK-VYNGELPYVDVSGGELWINILHETLKHGLAPKS  181

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+N+ +L+V+TGKGE VTCS  +N++LF+ VL
Sbjct  182   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNIFQLEVITGKGEVVTCSGNRNADLFYGVL  241

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP  V+WIRVLYS+F  FT DQEYLISL+       FDY+EG
Sbjct  242   GGLGQFGIITRARISLEPAPMMVKWIRVLYSEFSTFTMDQEYLISLN-----NTFDYIEG  296

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  G++NNWRSSF  P+NP++ S   SDG  LYCLE+ K ++   A+ ++Q +D L
Sbjct  297   FVIINRTGILNNWRSSF-DPKNPLQASQFSSDGKTLYCLEMAKYFNPDEAEAMNQSVDQL  355

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL +IPS++F +++ YV+FLDRVH +E KLR++GLW+VPHPWLNL +P+S I +F   
Sbjct  356   LSKLSYIPSTLFLSEVSYVEFLDRVHVSENKLRAQGLWEVPHPWLNLLIPRSEIHDFAEE  415

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+N+ +W+ R S VTPEE+VFYLVALL SA+ N   + +L+++
Sbjct  416   VFGNILKDTSNGPILIYPVNQTRWNSRPSLVTPEEDVFYLVALLSSALPNSTGADSLEHI  475

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN  I+ F   + + +KQYLPHYSTQ+EW+ HFG +WE F  RK  +DP  +L+ G  
Sbjct  476   LAQNNKIIDFYTGAQLRVKQYLPHYSTQEEWQVHFGSRWEAFVERKRAYDPLALLAPGHR  535

Query  222   IF  217
             IF
Sbjct  536   IF  537



>ref|XP_003635659.1| PREDICTED: cytokinin dehydrogenase 3-like, partial [Vitis vinifera]
Length=418

 Score =   494 bits (1272),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 246/430 (57%), Positives = 318/430 (74%), Gaps = 23/430 (5%)
 Frame = -1

Query  1476  SINGQAMTAAGVVLQMS-------GAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEH  1318
             S+ GQAM   GVV++M        G+   V K  +S    YAD  G +LWIDVL++TL+H
Sbjct  1     SLRGQAMAPHGVVVEMRSLNNCSRGSGIRVTKNPISGS--YADAGGEQLWIDVLQATLKH  58

Query  1317  GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSE  1138
             GLAP SWTDYLYL++GGTLSNAGISGQ F HGPQISNV+E+DV+TGKGE VTCS++ NSE
Sbjct  59    GLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTNSE  118

Query  1137  LFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQK  958
             LF AVLGGLGQFG+I RARIAL+ AP+RV+WI++LY DF  F++DQE+LIS++G      
Sbjct  119   LFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISING------  172

Query  957   FDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQ  778
              DY+EG +++     NNWRSS FSP    + SS+ S  G++YCLE+ K YD+ T+ TVD+
Sbjct  173   LDYLEGSLLMQNSSPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDE  231

Query  777   EIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRID  598
             E+  LLK L F+P  VFT D+  VDFL+RVH  EL LR+KGLWDVPHPWLNLFVP SRI 
Sbjct  232   ELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVPGSRIS  291

Query  597   EFDRGVFKGILG--NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
             +F+ GVF+ IL   N+T+G  L+YP+ +NKWD+RTSAV P+E++FY V LL S+  +  E
Sbjct  292   DFNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDWE  351

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
                   L++QN++ILKFC ++GI++K+YL  Y+T+++W  HFG KW  F+ RK QFDPK 
Sbjct  352   P-----LENQNKEILKFCDKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFDPKM  406

Query  243   ILSTGQLIFT  214
             ILS GQ IF 
Sbjct  407   ILSPGQQIFN  416



>ref|XP_010672924.1| PREDICTED: cytokinin dehydrogenase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=542

 Score =   498 bits (1283),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 237/423 (56%), Positives = 321/423 (76%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-SEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQ+    G+V+ M       PK  V + +  Y +V GGELWI++L  TL+HGLAPK
Sbjct  121   HSLQGQSQNHGGIVINMESLEE--PKMHVKAGELPYVEVSGGELWINILHETLKHGLAPK  178

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKG+ V CSE+QN++LF+ V
Sbjct  179   SWTDYLHLTVGGTLSNAGISGQAFRHGPQINNVYQLEVVTGKGDIVNCSEKQNADLFYGV  238

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP+ V+W RVLYSDF  FTKDQE LIS         FDY+E
Sbjct  239   LGGLGQFGIITRARISLEPAPKMVKWNRVLYSDFNLFTKDQEQLIS-----SDNTFDYIE  293

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRS+F SP+ P++ S   S+G  LYCLE+ K ++   A+ ++Q+++ 
Sbjct  294   GFVIINRTGLVNNWRSTF-SPKEPLQASQFSSEGKTLYCLEMAKYFNPEDANIINQKVEY  352

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             +L KL +IP +VF +++ YVDFL+RVH +E+KLR KGLWDVPHPWLNL VPKS+I  F  
Sbjct  353   ILSKLNYIPYTVFQSEVSYVDFLNRVHISEIKLREKGLWDVPHPWLNLLVPKSKIYNFAE  412

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GPILIYP+N+++W+++TS VTP E+VFYL+A+L SA+ + + S  L+N
Sbjct  413   EVFGNILTDTSNGPILIYPVNQSRWNDKTSLVTPAEDVFYLIAILTSALPSSSGSDRLEN  472

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + ++N+ IL FC+++ + +KQYLPHY+TQ  W+ HFG KW+ F  RK  +DP  IL+ GQ
Sbjct  473   ILTKNKGILDFCEKAKLGVKQYLPHYNTQDHWRAHFGPKWDVFARRKSTYDPLSILTPGQ  532

Query  225   LIF  217
              IF
Sbjct  533   RIF  535



>ref|XP_009767664.1| PREDICTED: cytokinin dehydrogenase 1-like [Nicotiana sylvestris]
Length=552

 Score =   498 bits (1283),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 238/423 (56%), Positives = 316/423 (75%), Gaps = 8/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M S  A A+     +++  + DV  GELWI++L  +L+ GL PK
Sbjct  127   HSLEGQAQAYQGVVINMESLRAPAMRFHTGNQELTFVDVSAGELWINILHESLKLGLTPK  186

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKGE +TCSEEQN++LF+ V
Sbjct  187   SWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEVVTGKGEVITCSEEQNADLFYGV  246

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARIALE AP++V+WIRVLYSDF  F+ DQE+LISL        FDY+E
Sbjct  247   LGGLGQFGIITRARIALEPAPKKVKWIRVLYSDFSTFSYDQEHLISLE-----NSFDYIE  301

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRS+F +P++P+      S+G VLYCLE+ K ++       DQ +D 
Sbjct  302   GFVIINRTGLLNNWRSTF-NPKDPLLAKEFSSEGKVLYCLEVAKYFNPEETTKTDQNVDA  360

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL KL +I S++F +++ YVDFLDRVH +E+KL+ KGLWDVPHPWLNL +PK+RI +F +
Sbjct  361   LLSKLNYIQSTLFQSEVSYVDFLDRVHVSEMKLQEKGLWDVPHPWLNLLIPKTRIHDFAQ  420

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + + GPILIYP+NK+KW + TS VTPEE+V YL+A L SA+ +      ++ 
Sbjct  421   EVFGKILTDTSHGPILIYPVNKSKWRKGTSLVTPEEDVMYLIAFLSSAMPSSTGKDGVEY  480

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + ++N+ IL FC+++ I MKQYLPHY+TQ++WK HFG +WE F  RK  +DP  IL+ G 
Sbjct  481   ILNKNKKILNFCRKAHIGMKQYLPHYTTQEDWKSHFGFQWETFNRRKSTYDPLAILAPGH  540

Query  225   LIF  217
              IF
Sbjct  541   RIF  543



>ref|XP_002439706.1| hypothetical protein SORBIDRAFT_09g018640 [Sorghum bicolor]
 gb|EES18136.1| hypothetical protein SORBIDRAFT_09g018640 [Sorghum bicolor]
Length=522

 Score =   497 bits (1280),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 243/425 (57%), Positives = 318/425 (75%), Gaps = 15/425 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV---SEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQ   A G+V++M     ++P   +   S    Y D  GGELWI+VL  TL++GLA
Sbjct  100   HSLRGQCQAAGGIVIKME----SLPNDRMQVQSGASPYVDASGGELWINVLHETLKYGLA  155

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L++GGTLSNAG+SGQ F HGPQISNV+EL++VTGKG+ +TCS E+NS+LFH
Sbjct  156   PKSWTDYLHLTIGGTLSNAGVSGQTFRHGPQISNVNELEIVTGKGDIITCSPERNSDLFH  215

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             A LGGLGQFG+ITRARI LE AP+ VRWIRVLYSDF +F +DQE LIS       + FDY
Sbjct  216   AALGGLGQFGIITRARIVLEPAPKMVRWIRVLYSDFTSFAEDQEMLISAE-----RTFDY  270

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             +EGFVI++  G++NNWRSS FSP++PV  S  KSDG VL+CLE+TKNY+   +D ++QE+
Sbjct  271   IEGFVIINRTGILNNWRSS-FSPQDPVWASQFKSDGRVLFCLEMTKNYNPEESDNMEQEV  329

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LL +L+ +P S+F TD+ Y++FLDRVH +E+KLR+KG+W+VPHPWLNL VPKS I  F
Sbjct  330   NSLLHQLRHMPPSLFHTDVTYIEFLDRVHSSEVKLRAKGMWEVPHPWLNLMVPKSSIHTF  389

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
              R VF  IL +  SGPIL+YP+NK +WD RTS V P+EEVFYLV  L S+V + +    +
Sbjct  390   AREVFGKILKDSNSGPILLYPVNKFRWDNRTSVVIPDEEVFYLVGFL-SSVPSSSGPHGV  448

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             ++  + N  I++F  ++GI +KQYLP+Y+T QEWK HF  +WE FQ RK  +DP  IL+ 
Sbjct  449   EHALNLNNQIIEFSGKAGIRVKQYLPNYNTAQEWKAHFEARWETFQRRKNAYDPLAILAP  508

Query  231   GQLIF  217
             GQ IF
Sbjct  509   GQGIF  513



>ref|XP_004513273.1| PREDICTED: cytokinin dehydrogenase 6-like [Cicer arietinum]
Length=665

 Score =   502 bits (1293),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 240/423 (57%), Positives = 315/423 (74%), Gaps = 8/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS++GQA T  G+V+ M S     +   ++     Y DV GGELWI++L  +L +GL P+
Sbjct  242   HSLSGQAQTHGGIVINMESLKVYEMNVDVIGNDSPYIDVSGGELWINILHESLRYGLTPR  301

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAG+SGQAF HGPQISNV +L++VTG GE V CS++QN ELFH+V
Sbjct  302   SWTDYLHLTVGGTLSNAGVSGQAFKHGPQISNVQQLEIVTGTGEVVNCSKDQNGELFHSV  361

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI LE AP  V+WIRVLYSDF AFT DQE LIS         FDY+E
Sbjct  362   LGGLGQFGIITRARILLEPAPSMVKWIRVLYSDFTAFTNDQERLIS-----EENAFDYIE  416

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF +P++P++ +  KSDG  L+CLE+ K ++    D V+QE++ 
Sbjct  417   GFVIINRTGLLNNWRSSF-NPQDPLQATHFKSDGKTLFCLELAKYFNFQEMDIVNQEVER  475

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
              L  L +I S++F T++ YV+FLDRVH +E+KLRSKGLWDVPHPWLNLF+PKS+I  F +
Sbjct  476   HLSHLNYIQSTLFQTEVTYVEFLDRVHVSEIKLRSKGLWDVPHPWLNLFIPKSKIHSFAQ  535

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL   ++GP+LIYP+NK+KWD RTS V P+E++FYLVA L SA  + N S +L++
Sbjct  536   LVFGNILTQTSNGPVLIYPVNKSKWDNRTSVVIPDEDIFYLVAFLSSADTSSNGSDSLEH  595

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + SQN+ IL+ C+ + + +KQYLP Y+TQ EW+ HFG  WE F+ RK  +DP  IL+ GQ
Sbjct  596   ILSQNKRILEVCERANLGVKQYLPQYNTQDEWRAHFGTHWEGFRQRKFVYDPFAILAPGQ  655

Query  225   LIF  217
              IF
Sbjct  656   RIF  658



>ref|XP_010517646.1| PREDICTED: cytokinin dehydrogenase 1-like [Camelina sativa]
Length=574

 Score =   499 bits (1284),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 238/422 (56%), Positives = 317/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA+   GVV++M        + +   K  Y DV GGE WI++L+ TL++GL+PKS
Sbjct  125   HSLQGQALAHQGVVIKMESLRNPDIR-IHKGKQPYVDVSGGESWINILRETLKYGLSPKS  183

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF +GPQI+NV++L++VTGKGE VTCSE++NSELF++VL
Sbjct  184   WTDYLHLTVGGTLSNAGISGQAFKYGPQINNVYQLEIVTGKGEVVTCSEKRNSELFYSVL  243

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE A   V+WIRVLYSDF  F++DQE+LIS       + FDYVEG
Sbjct  244   GGLGQFGIITRARISLEPALHMVKWIRVLYSDFSVFSRDQEHLIS-----KEKTFDYVEG  298

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++   L+NNWRSSF  P +  + S  KSDG  LYCLE+ K ++   A+++ QE   L
Sbjct  299   FVIINRTDLLNNWRSSF-RPNDSTEASKFKSDGKTLYCLEVVKYFNTEEANSMHQETGKL  357

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F++++PY++FLDRVH AE KLR+KGLW+VPHPWLNL +PKS I +F   
Sbjct  358   LSELNYIPSTLFSSEVPYIEFLDRVHIAERKLRAKGLWEVPHPWLNLLIPKSSISKFATE  417

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPILIYP+N++KW+++TS +TP E++FYLVA L SAV   +    L+ L
Sbjct  418   VFNNILTSNNNGPILIYPVNQSKWNKQTSLITPNEDIFYLVAFLPSAVPKSSGKNDLEYL  477

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ ++ FCK + + +KQYLPHY TQQEWK HFG++WE F  RK  +DP  IL+ GQ 
Sbjct  478   LKQNQRVMNFCKTARLHVKQYLPHYETQQEWKSHFGKRWETFSQRKHAYDPLTILAPGQK  537

Query  222   IF  217
             IF
Sbjct  538   IF  539



>dbj|BAG16379.1| cytokinin oxidase family protein [Brassica rapa var. perviridis]
Length=524

 Score =   497 bits (1280),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 239/425 (56%), Positives = 320/425 (75%), Gaps = 19/425 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKP---LVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQA+   GVV+ M     ++P P   +      Y DV GGELWI++LK TL+HGL+
Sbjct  103   HSLQGQALAHQGVVINME----SLPSPDIKIYKGTQPYVDVSGGELWINILKETLKHGLS  158

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE+VTCS++ N ELFH
Sbjct  159   PKSWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEAVTCSKKLNPELFH  218

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             +VLGGLGQFG+ITRARI+L  AP  V+WIRVLYSDF  F++DQE+LIS       + FD+
Sbjct  219   SVLGGLGQFGIITRARISLGPAPHMVKWIRVLYSDFSTFSRDQEHLIS-----KKKGFDF  273

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             VEG V ++   L+NNWRSS F+P +  + S  KSDG  LYCLE+ K +++  A++++QE 
Sbjct  274   VEGSVTINRTDLLNNWRSS-FTPNDSTEASQFKSDGKTLYCLEVVKYFNKEEANSMNQET  332

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LL +L +IPS++F++ +PY++FLDRVH  E+KLR+KGLW+VPHPWLNL VPKS I EF
Sbjct  333   EKLLSELSYIPSTLFSSVVPYIEFLDRVHLGEIKLRAKGLWEVPHPWLNLLVPKSSIFEF  392

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
                VF  IL +  +GPILIYP+N++KW++RTS +TP E++FYLVA L SA++N      L
Sbjct  393   ATEVFNNILTSNNNGPILIYPVNQSKWNKRTSLITPSEDIFYLVAFLPSALQND-----L  447

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             ++L  QN+ +L FC+E+ + +KQYLPHY TQ+EW+ HFG KWE F   K ++DP  IL+ 
Sbjct  448   EHLLRQNQRVLNFCEEAKMNVKQYLPHYETQREWRSHFGNKWETFAKIKHEYDPLAILAP  507

Query  231   GQLIF  217
             G  IF
Sbjct  508   GHRIF  512



>ref|XP_009630860.1| PREDICTED: cytokinin dehydrogenase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=513

 Score =   497 bits (1279),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 240/422 (57%), Positives = 317/422 (75%), Gaps = 12/422 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M        K    E   Y DV  GELWI++LK +L+ GLAPKS
Sbjct  94    HSLEGQAQAYQGVVISMESLQTPAMKFKTGE-LPYVDVSAGELWINILKESLKLGLAPKS  152

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV +L+VVTGKGE +TCSEEQN++LFH VL
Sbjct  153   WTDYLHLTVGGTLSNAGISGQAFRHGPQINNVQQLEVVTGKGEVITCSEEQNADLFHGVL  212

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP++V+WIRVLYSDF  F+ DQE+LIS         FDY+EG
Sbjct  213   GGLGQFGIITRARIALEIAPKQVKWIRVLYSDFSIFSNDQEHLISTQ-----DTFDYIEG  267

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI+++ GL+NNWRS+ F+P++PV  S+  S+G VL+CLEI K ++    D++DQ IDV+
Sbjct  268   FVIINQTGLLNNWRSA-FNPKDPVLASNFSSEGRVLFCLEIAKYFNPEVTDSIDQNIDVI  326

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL +I S++F +++ Y +FLDRVH +E+KL+     +V HPWLNL +PKSRI EF + 
Sbjct  327   LSKLNYIRSTLFLSEVSYAEFLDRVHVSEMKLQE----NVSHPWLNLLIPKSRILEFAQQ  382

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GP+LIYP+NK+KW + TS VTP+E+VFYL+A L SA+ +   +  L+++
Sbjct  383   VFGKILTDTSNGPLLIYPVNKSKWRKGTSMVTPDEDVFYLIAFLSSAMSSSTGNDGLRHI  442

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL FC+E+ I MKQYLP+Y T++EWK+HFG +WE F  RK  +DP  IL+ GQ 
Sbjct  443   LAQNKRILNFCEETNIGMKQYLPNYKTKEEWKDHFGHQWEAFARRKSTYDPLAILAPGQR  502

Query  222   IF  217
             IF
Sbjct  503   IF  504



>ref|XP_002308930.2| hypothetical protein POPTR_0006s04650g [Populus trichocarpa]
 gb|EEE92453.2| hypothetical protein POPTR_0006s04650g [Populus trichocarpa]
Length=539

 Score =   498 bits (1281),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 235/422 (56%), Positives = 314/422 (74%), Gaps = 9/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+ M        +    E   Y D  G ELWI++L  TL++GLAPKS
Sbjct  123   HSLQGQAQAHQGIVINMESLQGPEMQVHTGE-LPYVDASGSELWINILHETLKYGLAPKS  181

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+N+++L+VVTGKGE+VTCSE +N++LF+ VL
Sbjct  182   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNIYQLEVVTGKGEAVTCSENKNADLFYGVL  241

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ V+WIR LY +F  F+ DQE+LIS         FDY+EG
Sbjct  242   GGLGQFGIITRARISLEPAPKMVKWIRALYDEFSKFSSDQEHLIS------KNSFDYIEG  295

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
              VI++  GL+NNWRSSF +P++P++ S   S+G  LYCLEI K ++ + +D ++QE + L
Sbjct  296   LVIINRTGLLNNWRSSF-NPKDPLQASQFISEGKTLYCLEIAKYFNPNESDAMNQETESL  354

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F +++ YV+FLDRVH +E+KLR+KGLWD+PHPWLNL +PK++I EF + 
Sbjct  355   LSELSYIPSTLFLSEVSYVEFLDRVHLSEIKLRAKGLWDIPHPWLNLLIPKNKIFEFAQE  414

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+NK+KWD RTS +TPEE+ FYLVA L SA+ +      L ++
Sbjct  415   VFGNILTDSSNGPILIYPVNKSKWDNRTSLITPEEDTFYLVAFLSSAMPSSTGRDGLFHI  474

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL FC  + +  KQYLPHYSTQ+EW+ HFG KWE F  RK  +DP  IL+ GQ 
Sbjct  475   LAQNQRILGFCSSTSLGAKQYLPHYSTQEEWQTHFGPKWEVFVLRKSTYDPLAILAPGQR  534

Query  222   IF  217
             IF
Sbjct  535   IF  536



>ref|XP_010523657.1| PREDICTED: cytokinin dehydrogenase 6 [Tarenaya hassleriana]
Length=527

 Score =   497 bits (1279),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 243/425 (57%), Positives = 311/425 (73%), Gaps = 8/425 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M             E   Y DV GGELWI++L+ TL +GL PKS
Sbjct  106   HSLQGQAQAYHGVVINMESLKDQNMYVHGGES-PYVDVSGGELWINILRETLRYGLTPKS  164

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE V  SE+QNS+LF  VL
Sbjct  165   WTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEVVNSSEKQNSDLFRGVL  224

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP  V+WIRVLY DF AF +DQE LIS        KFDYVEG
Sbjct  225   GGLGQFGIITRARIALEPAPIMVKWIRVLYLDFNAFARDQECLIS-----ADSKFDYVEG  279

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +P++P++ S  KSDG  LYCLE+ K +     D ++QE++  
Sbjct  280   FVIINRTGLLNNWRSSF-TPQDPLQASLFKSDGKRLYCLELAKYFKLDKKDAINQEVNES  338

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +I S++F +++ Y +FLDRVH +E++LRSKGLW+VPHPWLNL VP+S+I+ F  G
Sbjct  339   LSELSYISSTLFLSEVTYEEFLDRVHMSEIELRSKGLWEVPHPWLNLLVPRSKINTFAEG  398

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+NK KWD  TSAV PEEE+FYLVA L SA+ + +    L+++
Sbjct  399   VFGNILTDTSNGPILIYPVNKTKWDNGTSAVIPEEEIFYLVAFLSSAIASSSGKDNLEHI  458

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
               QN+ IL+FC  + + +KQYL HY+T++EW+ HFG +WE F  RK  +DP  +L+ GQ 
Sbjct  459   LKQNQKILEFCAAACLGVKQYLAHYTTKEEWRAHFGTRWETFVRRKFTYDPLAMLAPGQR  518

Query  222   IFTPS  208
             IF  S
Sbjct  519   IFQKS  523



>ref|XP_004971217.1| PREDICTED: cytokinin dehydrogenase 4-like [Setaria italica]
Length=522

 Score =   496 bits (1278),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 236/422 (56%), Positives = 316/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ+  A G+V++M        +        + D  GGELWI+VL  TL++GLAPKS
Sbjct  99    HSLMGQSQAAGGIVVRMESLRGDRLQVHDGSMSPFVDAPGGELWINVLHETLKYGLAPKS  158

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQAF HGPQ+SNV++L++VTG+G+ VTCS E+NS+LF+A L
Sbjct  159   WTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGDVVTCSPEENSDLFYAAL  218

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP+ VRWIRVLYSDF +FT+DQE LI          FDY+EG
Sbjct  219   GGLGQFGIITRARIALEPAPKMVRWIRVLYSDFASFTEDQEMLIM-----AKNTFDYIEG  273

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  G++NNWR+S F P++PV+ S  +SDG VLYCLE+TKN++ + A T++QE+  L
Sbjct  274   FVIINRTGILNNWRTS-FKPQDPVQASRFQSDGRVLYCLELTKNFNSNDAGTMEQEVTAL  332

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL++I S++F TD+ Y++FLDRVH +E+KLR++GLW+VPHPWLNL +P+S I  F + 
Sbjct  333   LSKLRYIRSTLFHTDVTYLEFLDRVHTSEVKLRAQGLWEVPHPWLNLLIPRSSIHRFAKE  392

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPIL+YP+NK+KWD RTS V P+EE+FYLV  L SA        ++ + 
Sbjct  393   VFGKILKDSNNGPILLYPVNKSKWDNRTSVVIPDEEIFYLVGFLSSAPSLSGHG-SVAHA  451

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              + N  I++FC+E+ I MKQYL  Y+TQQ+WK HFG +WE F+ RK  +DP  IL+ GQ 
Sbjct  452   MNLNNQIVEFCEEADIGMKQYLAPYTTQQQWKAHFGARWETFERRKHTYDPLAILAPGQR  511

Query  222   IF  217
             IF
Sbjct  512   IF  513



>ref|XP_009609443.1| PREDICTED: cytokinin dehydrogenase 1-like [Nicotiana tomentosiformis]
Length=552

 Score =   498 bits (1281),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 237/423 (56%), Positives = 318/423 (75%), Gaps = 8/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M S  A A+     +++  + DV  GELWI++L  +L+ GL PK
Sbjct  127   HSLEGQAQAYQGVVINMESLRAPAMRFHTGNQELPFVDVSAGELWINILHESLKLGLTPK  186

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKGE +TCSEE+N++LF+ V
Sbjct  187   SWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEVVTGKGEVITCSEEKNADLFYGV  246

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARIALE AP++V+WIRVLYSDF  F+ DQE+LIS         FDY+E
Sbjct  247   LGGLGQFGIITRARIALEPAPKKVKWIRVLYSDFSTFSYDQEHLIS-----SENSFDYIE  301

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRS+F +P++P+      S+G VLYCLE+ K ++       DQ +DV
Sbjct  302   GFVIINRTGLLNNWRSTF-NPKDPLLAKEFSSEGKVLYCLEVAKYFNPEETTKTDQNVDV  360

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL KL +I S++F +++ YVDFL+RVH +E+KL+ KGLWD+PHPWLNL +PKS+I +F R
Sbjct  361   LLSKLNYIQSTLFQSEVSYVDFLNRVHVSEMKLQEKGLWDIPHPWLNLLIPKSKIHDFAR  420

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + + GPILIYP+NK+KW + TS VTPEE+V YL+A L SA+ +      ++ 
Sbjct  421   EVFGKILTDTSHGPILIYPVNKSKWRKGTSVVTPEEDVMYLIAFLSSAMPSSTGKDGVEY  480

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             + ++N+ IL FC+++ I MKQYLPHY+TQ++WK HFG +WE F+ RK  +DP  IL+ GQ
Sbjct  481   ILNKNKKILNFCRKAHIGMKQYLPHYTTQEDWKGHFGPQWETFKRRKSTYDPLAILAPGQ  540

Query  225   LIF  217
              IF
Sbjct  541   RIF  543



>dbj|BAK52672.1| cytokinin oxidase [Petunia x hybrida]
Length=535

 Score =   497 bits (1279),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 252/442 (57%), Positives = 316/442 (71%), Gaps = 32/442 (7%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-------------------GAAAAVPKPLVSEKFMYADVWGG  1357
             HSI GQAM   GVV++M+                   G    +     S    YADV G 
Sbjct  104   HSIRGQAMAQDGVVVEMNSLKNNNNNNNNNNNNNNKNGIYNGIRVSWDSSLGYYADVGGE  163

Query  1356  ELWIDVLKSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGK  1177
             +LWIDVL++TLEHGLAP SWTDYLYL+VGGTLSNAGISGQ F HGPQISNVHE+DV+TGK
Sbjct  164   QLWIDVLRATLEHGLAPVSWTDYLYLTVGGTLSNAGISGQTFKHGPQISNVHEMDVITGK  223

Query  1176  GESVTCSEEQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQE  997
             GE VTCS+  NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY+DF  FTKDQE
Sbjct  224   GELVTCSKHMNSELFFAVLGGLGQFGIITRARIVLDKAPTRVKWVRILYADFSKFTKDQE  283

Query  996   YLISLHGQPPAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEIT  817
             +LIS+ G       DYVEG +++ +  +NNWRSSFFSP N  K +S+ S+ G++YCLE+ 
Sbjct  284   HLISIDG------LDYVEGSLMMKQSPLNNWRSSFFSPSNQTKIASLLSENGIIYCLEMV  337

Query  816   KNYDQSTADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPH  637
             K YD  +++T+D+E+  LLK L  +P  +F  D  YVDFL+RV   EL+L+SKGLWDVPH
Sbjct  338   KYYDDQSSNTIDKELKKLLKGLNNLPGFIFKKDATYVDFLNRVRSGELELQSKGLWDVPH  397

Query  636   PWLNLFVPKSRIDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYL  463
             PWLNLFVPKS I +F+ GVF  I+   N T+GPIL+YP ++ KWD+R SAV PEEE FY 
Sbjct  398   PWLNLFVPKSSIMDFNAGVFVDIILKQNMTAGPILVYPTSRKKWDDRMSAVIPEEETFYC  457

Query  462   VALLRSAVENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWE  283
             V LL S+    N+ QT   L  QN +ILK+C ++G+++KQYLPHY  +++W +HF +KW 
Sbjct  458   VGLLHSS--GFNDWQT---LDEQNEEILKYCDKAGLKIKQYLPHYKRKEDWIKHFSKKWN  512

Query  282   RFQHRKLQFDPKHILSTGQLIF  217
              FQ RK QFDPK +LS GQ IF
Sbjct  513   IFQQRKTQFDPKMLLSPGQRIF  534



>emb|CDP14175.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   493 bits (1269),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 235/422 (56%), Positives = 311/422 (74%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GV++ M        +     K  Y DV GGELWI++L  +L+HGL PKS
Sbjct  16    HSLAGQAQARGGVIMSMESLRHPEMR-FYPGKMPYVDVSGGELWINILHESLKHGLTPKS  74

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQAF HGPQI+NVH+L+VVTG GE V CS+++NS+LFH VL
Sbjct  75    WTDYLHLTVGGTLSNAGVSGQAFRHGPQINNVHQLEVVTGTGEVVRCSDDENSDLFHGVL  134

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIAL  AP  V+WIRVLYSDF  FT+DQE+LIS         FDY+EG
Sbjct  135   GGLGQFGIITRARIALGPAPTMVKWIRVLYSDFSIFTEDQEFLIS-----SQNSFDYIEG  189

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+N+W+SSF SP++PV+ S ++S+G VL+CLE+ K         V+Q I+ +
Sbjct  190   FVIINRTGLVNDWQSSF-SPKDPVRSSQLQSEGKVLFCLEVAKYLYPENNYDVNQNIETI  248

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F +++PYV FLDRVH +E+KLR KGLW++PHPWLNL VPKS+I +F  G
Sbjct  249   LSELNYIPSTLFQSEVPYVQFLDRVHISEMKLRKKGLWEIPHPWLNLLVPKSKIHDFAAG  308

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  I+ + ++GPILIYP+NK++W   TS V+PEE++FYLVA L SA+        L+++
Sbjct  309   VFGNIIRDTSNGPILIYPVNKSQWRNGTSMVSPEEDIFYLVAFLSSAIPYSTGKDGLEHI  368

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              S+N+ IL FC  + + +KQYLP YSTQ EWK HFG++WE F  RK  +DP  +L+ GQ 
Sbjct  369   LSENKRILNFCASTQLGVKQYLPQYSTQDEWKAHFGKQWEVFSRRKSTYDPLAMLAPGQR  428

Query  222   IF  217
             IF
Sbjct  429   IF  430



>ref|XP_010508710.1| PREDICTED: cytokinin dehydrogenase 1-like [Camelina sativa]
Length=580

 Score =   498 bits (1283),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 237/425 (56%), Positives = 318/425 (75%), Gaps = 14/425 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKP---LVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQA+   GVV++M     ++  P   +   +  Y DV GGELWI++L+ TL++GL+
Sbjct  125   HSLQGQALAHQGVVIKME----SLRNPDLWIYKGEQPYVDVSGGELWINILRETLKYGLS  180

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAGISGQAF +GPQI+NV++L++VTGKGE VTCSE++NSELF+
Sbjct  181   PKSWTDYLHLTVGGTLSNAGISGQAFKYGPQINNVYQLEIVTGKGEVVTCSEKRNSELFY  240

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             +VLGGLGQFG+ITRARI+LE A   V+WIRVLYSDF  F++DQEYLIS       + FDY
Sbjct  241   SVLGGLGQFGIITRARISLEPALHMVKWIRVLYSDFSVFSRDQEYLIS-----KEKTFDY  295

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             VEGFVI++   L+NNWRSSF  P +  + S  KSDG  LYCLE+ K ++   A+++ +E 
Sbjct  296   VEGFVIINRTDLLNNWRSSF-RPNDSTEASKFKSDGKTLYCLEVVKYFNTEEANSMHKET  354

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             D LL +L +IPS++F++++PY++FLDRVH AE KLR+KGLW+VPHPWLNL +PKS I +F
Sbjct  355   DKLLSELNYIPSTLFSSEVPYIEFLDRVHIAERKLRAKGLWEVPHPWLNLLIPKSSISKF  414

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
                VF  I+ +  +GPILIYP+N++KW++ TS + P E++FYLVA L SAV   +    L
Sbjct  415   ATEVFHNIITSNNNGPILIYPVNQSKWNKHTSMIIPNEDIFYLVAFLPSAVPKSSGKNDL  474

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             + L  QN+ ++ FC  + + +KQYLPHY TQQEWK HFG++WE F  RK  +DP  IL+ 
Sbjct  475   EYLLKQNQRVMNFCTTANLHVKQYLPHYETQQEWKSHFGKRWETFSQRKHTYDPLTILAP  534

Query  231   GQLIF  217
             GQ IF
Sbjct  535   GQRIF  539



>ref|XP_008244287.1| PREDICTED: cytokinin dehydrogenase 1 [Prunus mume]
Length=545

 Score =   497 bits (1279),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 235/422 (56%), Positives = 315/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA T  G+V+ M    A   +  + E+  Y DV GGELWI++L  TL+HGL+PKS
Sbjct  124   HSLQGQAQTHGGLVINMESLKAQQMQVHIGEQ-PYVDVSGGELWINILHETLKHGLSPKS  182

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLS AGISGQAF HGPQI+NV++L+VVTG+GE +TCSE  + +LF+ VL
Sbjct  183   WTDYLHLTVGGTLSYAGISGQAFRHGPQINNVYQLEVVTGQGEVITCSENNSPDLFYGVL  242

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+IT+ARI+LE AP+ V+WIRVLYSDF +F+KDQE+LIS         FDY+EG
Sbjct  243   GGLGQFGIITQARISLEPAPKMVKWIRVLYSDFSSFSKDQEFLIS-----SENSFDYIEG  297

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +P++P++ S   SDG  LYCLE+ K ++ +  D +DQ  + L
Sbjct  298   FVIINRTGLLNNWRSSF-NPKDPMQASKFNSDGRTLYCLEMAKYFNPNETDVMDQRTESL  356

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L  L +IPS++F +++ YV+FLDRVH +E+KLR+KGLW+VPHPW+NL +PKS+I +F   
Sbjct  357   LLLLHYIPSTLFLSEVSYVEFLDRVHLSEIKLRTKGLWEVPHPWMNLLIPKSKIHDFADE  416

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             +F  IL +  +GPIL+YP+NK KW   TS VTP+E+VFYLVA L SAV +   +  L  +
Sbjct  417   IFGNILTDNINGPILMYPVNKTKWHNNTSLVTPDEDVFYLVAFLSSAVPSSTGTDGLDQI  476

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QNR IL++C  + + +KQYLP+Y TQQEWK HFG +W+ F  RK  +DP  IL+ GQ 
Sbjct  477   LTQNRRILEYCDRAQLGIKQYLPYYRTQQEWKAHFGPRWQSFIQRKSSYDPLAILAPGQR  536

Query  222   IF  217
             IF
Sbjct  537   IF  538



>dbj|BAH47540.1| cytokinin oxidase [Zinnia violacea]
Length=534

 Score =   496 bits (1278),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 239/433 (55%), Positives = 314/433 (73%), Gaps = 11/433 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSE----KFMYADVWGGELWIDVLKSTLEHGL  1312
             HS+ GQA    GVV+ M   A         +       + DV GGELWI++L+ +L+HG 
Sbjct  108   HSLEGQAQAHQGVVINMESLAKYQEMDFYVDGNYKNTPFVDVSGGELWINILRESLKHGF  167

Query  1311  APKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELF  1132
             APKSWTDYL+L+VGGTLSNAGISGQAF HGPQI+NVH+L VVTG GE VTC++E NS+LF
Sbjct  168   APKSWTDYLHLTVGGTLSNAGISGQAFRHGPQINNVHQLQVVTGTGEVVTCTKEMNSDLF  227

Query  1131  HAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFD  952
             H VLGGLGQFG+ITRA I LE AP+ V+WI+VLY DF  FTKDQE LIS         FD
Sbjct  228   HGVLGGLGQFGIITRAHITLEPAPEMVKWIKVLYMDFATFTKDQELLIS-----SNTSFD  282

Query  951   YVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             YVEGFV+++  GL+NNWRSSF S ++PV+     ++G  +YCLEI K Y Q    T+DQ+
Sbjct  283   YVEGFVLINRTGLLNNWRSSFKS-KDPVQAKRFVTEGKTIYCLEIAKYYKQEDVHTIDQK  341

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             I+ LL  L +   ++F +++ YV+FLDRVH +ELKL+ KGLWDVPHPWLNL VPKS+I +
Sbjct  342   IESLLSTLNYNDFTLFISEVSYVEFLDRVHVSELKLQEKGLWDVPHPWLNLLVPKSKIHQ  401

Query  594   FDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQT  415
             F   VF  IL + ++GPILIYP++K++W+ +TS VTP+E VFYLVA L SA+ +   + +
Sbjct  402   FANEVFGKILTDSSNGPILIYPVDKSRWNTKTSMVTPKENVFYLVAFLSSAMPSSTGTDS  461

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILS  235
             L+N+ SQN+ IL+ C+ + +E KQYLPHY+TQ+EW++HFG +WE F  RK ++DP  IL+
Sbjct  462   LENILSQNKRILEVCENANLETKQYLPHYNTQEEWEKHFGSQWEAFVRRKFRYDPLAILT  521

Query  234   TGQLIFTPSFNAM  196
              GQ IF  + N +
Sbjct  522   PGQRIFQKAINFL  534



>ref|XP_010418548.1| PREDICTED: cytokinin dehydrogenase 6 [Camelina sativa]
Length=548

 Score =   496 bits (1278),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 244/432 (56%), Positives = 314/432 (73%), Gaps = 26/432 (6%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG---------AAAAVPKPLVSEKFMYADVWGGELWIDVLKST  1327
             HS+ GQA T  G+V++M               VP P       Y DV GGELWI++L  T
Sbjct  109   HSLQGQAQTRNGIVIRMESLHPQKLQVHTVEDVPAP-------YVDVSGGELWINILHET  161

Query  1326  LEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQ  1147
             L++GLAPKSWTDYL+L+VGGTLSNAGISGQAF HGPQISNVH+L+VVTGKGE + CSE Q
Sbjct  162   LKYGLAPKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEVVTGKGEILNCSERQ  221

Query  1146  NSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPP  967
             NS+LFH VLGGLGQFG+ITRARIALE AP  V+W+RVLY DF AF KDQE LIS      
Sbjct  222   NSDLFHGVLGGLGQFGIITRARIALEAAPTMVKWVRVLYQDFSAFIKDQERLIS-----A  276

Query  966   AQKFDYVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQ-STA  793
               K DYVEGFVI++  GL+NNWR S F+P +P++ S  KSDG  LYCLE+ K Y +    
Sbjct  277   DNKLDYVEGFVIINRTGLLNNWRLS-FTPEDPLQASQFKSDGRTLYCLEVAKYYFKLDNK  335

Query  792   DTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  613
             D + Q +   L +L +I S++FT+++ Y  FLDRVH +E+KLRSKG W+VPHPWLNL VP
Sbjct  336   DVISQGVKETLSELSYISSTLFTSEVTYEAFLDRVHVSEVKLRSKGQWEVPHPWLNLLVP  395

Query  612   KSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVEN  433
             +S + EF +GVF  IL + ++GP+++YP+NK KWD RTSAVTPEE++FYLVA+L SAV  
Sbjct  396   RSTVKEFAKGVFGNILTDTSNGPVIVYPVNKAKWDNRTSAVTPEEDIFYLVAILTSAVPG  455

Query  432   GNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFD  253
              ++   ++ +  +N+ IL+F + +GI +KQYLPHY+T++EW+ HFG KW+ F  RK ++D
Sbjct  456   KDDG--VEQILKRNQRILEFSEAAGIGLKQYLPHYTTREEWRSHFGAKWDNFVRRKSRYD  513

Query  252   PKHILSTGQLIF  217
             P  IL+ G  IF
Sbjct  514   PLAILAPGHRIF  525



>ref|XP_002308300.2| Cytokinin dehydrogenase 3 precursor family protein [Populus trichocarpa]
 gb|EEE91823.2| Cytokinin dehydrogenase 3 precursor family protein [Populus trichocarpa]
Length=529

 Score =   496 bits (1277),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 244/430 (57%), Positives = 307/430 (71%), Gaps = 16/430 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-------GAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLE  1321
             HS+ GQAM + GVV+ M+       G    V K        YADV G +LWIDVL ST+E
Sbjct  104   HSVGGQAMASNGVVVDMTSLRNHKNGTGITVSK--CPSLGFYADVGGEQLWIDVLHSTME  161

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             HG AP SWTDYLYLSVGGTLSNAGISG  F +GPQISNV+E+DVVTGKGE VTCS   NS
Sbjct  162   HGFAPVSWTDYLYLSVGGTLSNAGISGTTFRYGPQISNVYEMDVVTGKGELVTCSSHTNS  221

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELF+AVLGGLGQFG+ITRARIALE AP+RV+W+R+LYSDF AFT+DQE LIS++G+    
Sbjct  222   ELFYAVLGGLGQFGIITRARIALEPAPKRVKWVRILYSDFSAFTRDQERLISINGRKQKN  281

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
               DY+EG +++ +G  NNWRSSFF   +  K  S+ +   ++YCLE+ K YD  T   VD
Sbjct  282   ALDYLEGSLLMAQGPPNNWRSSFFPSSDIPKIMSLVTQHAIIYCLEVAKYYDDGTRHIVD  341

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             +++  LLK L F+   +F  D+ +VDFL+RV   E KL S+GLWDVPHPWLNLF+PKSRI
Sbjct  342   KDLQQLLKGLSFVAGFMFEKDVSFVDFLNRVRSGEQKLHSQGLWDVPHPWLNLFLPKSRI  401

Query  600   DEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGN  427
              EF++GVF  ++   N T+G +L YPMN+ KWD++ SAV PEE++FY V  L S+  N  
Sbjct  402   LEFNKGVFHDLVLKRNITTGVVLFYPMNRKKWDDKMSAVIPEEDIFYTVGFLHSSGFNDW  461

Query  426   ESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPK  247
             ++        QN+DILKFC ++GIE+KQYLP Y++ +EW  HFG KW  F+ RK QFDPK
Sbjct  462   QA-----YDHQNKDILKFCDKAGIEIKQYLPLYNSNKEWINHFGSKWRNFRERKAQFDPK  516

Query  246   HILSTGQLIF  217
              +LS GQ IF
Sbjct  517   MMLSPGQRIF  526



>ref|XP_004508239.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=543

 Score =   496 bits (1278),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/441 (56%), Positives = 313/441 (71%), Gaps = 18/441 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS--------GAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS +GQAM   GVV+ M+        GA +    PL+     Y DV G +LWIDVL  T 
Sbjct  108   HSTSGQAMARDGVVVDMASYRKQRNGGAISVSEDPLIG---YYVDVGGEQLWIDVLYETF  164

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             EH LAP SWTDYLYL+VGGTLSNAGISGQ F +GPQI+NVHE+DV+TGKG+ VTCS ++N
Sbjct  165   EHRLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQITNVHEMDVITGKGDLVTCSSKKN  224

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             SELFHA+LGGLGQFGVITRARI+LE AP  V+W+RVLYSDF  FTKDQE LIS+ G    
Sbjct  225   SELFHALLGGLGQFGVITRARISLEPAPTWVKWVRVLYSDFSDFTKDQERLISIDGSTKN  284

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
              + D++EG +++ +G INNWRSSFF   +  + SS+ +   +LYCLE+ K YD  +   V
Sbjct  285   IELDFLEGMLLMQQGSINNWRSSFFPLSHHSRISSLITKHNILYCLELAKYYDHQSEKMV  344

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             D+EI VLL+ L +IP   +  ++ YV+FL+RV   ELKL+S+GLW VPHPWLNLFVPKS+
Sbjct  345   DKEIQVLLQGLAYIPGLHYEKNVSYVEFLNRVRSGELKLQSQGLWHVPHPWLNLFVPKSQ  404

Query  603   IDEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             I +F+ GVF  I+   N TSG +LIYPMNK+KWD+R S +TP+E+VFY V  L S+  N 
Sbjct  405   ILDFNSGVFNDIILKRNITSGIVLIYPMNKSKWDDRMSTITPDEDVFYAVGFLHSSAFNN  464

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
                   K   +QN++ILKFC + GI++KQYLP++ST++ WK HFG KW  F   KL FDP
Sbjct  465   -----WKAYDAQNKEILKFCNDVGIKVKQYLPNHSTEEHWKNHFGTKWRTFLETKLLFDP  519

Query  249   KHILSTGQLIFTPSFNAMTAS  187
             + ILS GQ IF  + N +  S
Sbjct  520   RMILSPGQKIFNDNTNKICYS  540



>ref|XP_009630800.1| PREDICTED: cytokinin dehydrogenase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=543

 Score =   496 bits (1278),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 240/422 (57%), Positives = 317/422 (75%), Gaps = 12/422 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M        K    E   Y DV  GELWI++LK +L+ GLAPKS
Sbjct  124   HSLEGQAQAYQGVVISMESLQTPAMKFKTGE-LPYVDVSAGELWINILKESLKLGLAPKS  182

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV +L+VVTGKGE +TCSEEQN++LFH VL
Sbjct  183   WTDYLHLTVGGTLSNAGISGQAFRHGPQINNVQQLEVVTGKGEVITCSEEQNADLFHGVL  242

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP++V+WIRVLYSDF  F+ DQE+LIS         FDY+EG
Sbjct  243   GGLGQFGIITRARIALEIAPKQVKWIRVLYSDFSIFSNDQEHLISTQ-----DTFDYIEG  297

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI+++ GL+NNWRS+ F+P++PV  S+  S+G VL+CLEI K ++    D++DQ IDV+
Sbjct  298   FVIINQTGLLNNWRSA-FNPKDPVLASNFSSEGRVLFCLEIAKYFNPEVTDSIDQNIDVI  356

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL +I S++F +++ Y +FLDRVH +E+KL+     +V HPWLNL +PKSRI EF + 
Sbjct  357   LSKLNYIRSTLFLSEVSYAEFLDRVHVSEMKLQE----NVSHPWLNLLIPKSRILEFAQQ  412

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GP+LIYP+NK+KW + TS VTP+E+VFYL+A L SA+ +   +  L+++
Sbjct  413   VFGKILTDTSNGPLLIYPVNKSKWRKGTSMVTPDEDVFYLIAFLSSAMSSSTGNDGLRHI  472

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL FC+E+ I MKQYLP+Y T++EWK+HFG +WE F  RK  +DP  IL+ GQ 
Sbjct  473   LAQNKRILNFCEETNIGMKQYLPNYKTKEEWKDHFGHQWEAFARRKSTYDPLAILAPGQR  532

Query  222   IF  217
             IF
Sbjct  533   IF  534



>ref|XP_006353538.1| PREDICTED: cytokinin dehydrogenase 3 [Solanum tuberosum]
Length=527

 Score =   496 bits (1276),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 243/430 (57%), Positives = 308/430 (72%), Gaps = 16/430 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG------AAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEH  1318
             HSI GQAM   GV+++MS           V     S    YADV G +LWIDVL+STLE+
Sbjct  106   HSIRGQAMAKNGVIVEMSSLNNNNNENCGVRVSWDSGLGFYADVGGEQLWIDVLRSTLEY  165

Query  1317  GLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSE  1138
             GLAP SWTDYLYL+VGGTLSNAGISGQ F +GPQISNVHE+DV+TGKGE VTCS++ NSE
Sbjct  166   GLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVHEMDVITGKGELVTCSKDMNSE  225

Query  1137  LFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQK  958
             LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY DF  FTKDQE+LIS+H       
Sbjct  226   LFFGVLGGLGQFGIITRARIVLDKAPTRVKWVRMLYDDFSKFTKDQEHLISIH----HNG  281

Query  957   FDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQ  778
              DYVEG +++++  +NNWRSSFFSP N  K +S+ S   ++YCLEI K YD   A+T+D+
Sbjct  282   LDYVEGSLMMEQSSLNNWRSSFFSPSNQTKIASLLSKNKIMYCLEIVKYYDDQNANTIDE  341

Query  777   EIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRID  598
             E+  L+K LK++   +F  D+ +V+FL+RV   EL+L+SKG WDVPHPWLNLFVPKS I 
Sbjct  342   ELKKLVKGLKYLGGFMFKKDVSFVEFLNRVRSGELELQSKGKWDVPHPWLNLFVPKSSIM  401

Query  597   EFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNE  424
              F   VF  I+   NKT+GPIL+YP ++ +WD+R S + PEEE FY V LL S+    + 
Sbjct  402   HFHAAVFVDIILRQNKTTGPILVYPTSRKRWDDRMSTMIPEEETFYCVGLLHSS----SG  457

Query  423   SQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKH  244
              +  K L +QN +IL +C + G+ +KQYLPHY T+++W +HFG+KW  FQ RK  FDPK 
Sbjct  458   YKECKILDNQNEEILNYCDKVGLNIKQYLPHYKTKEDWIKHFGKKWNIFQQRKDLFDPKM  517

Query  243   ILSTGQLIFT  214
             ILS GQ IF 
Sbjct  518   ILSPGQRIFN  527



>gb|ACM79256.1| cytokinin oxidase/dehydrogenase [Gossypium hirsutum]
 gb|ACT21088.1| cytokinin oxidase/dehydrogenase [Gossypium hirsutum]
Length=526

 Score =   495 bits (1275),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 239/427 (56%), Positives = 312/427 (73%), Gaps = 10/427 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPL---VSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HS  GQAM   GVV+ M   A          VS   +YADV G +LWIDVL +TLE+GLA
Sbjct  103   HSARGQAMAENGVVVDMRSMANNRRNGTGIRVSIDRLYADVGGEQLWIDVLNATLEYGLA  162

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             P SWTDYLYL+VGGTLSNAGISGQ F +GPQISNV E+DV+TGK + +TCS   NSELF+
Sbjct  163   PVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVLEMDVITGKADFLTCSPRMNSELFY  222

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             AVLGGLGQFG+ITRARI L+ AP+ V+W+R+LY DF +FTKDQE LIS +G+      DY
Sbjct  223   AVLGGLGQFGIITRARIPLQPAPKGVKWVRLLYDDFSSFTKDQELLISKNGRKDKSALDY  282

Query  948   VEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             +EG +++D+G  +NWRSSFF  ++  K  S+ +  G++YCLEI K+YD  T  TVD+E+ 
Sbjct  283   LEGSLLMDQGSPDNWRSSFFPHKDHPKIISLITKHGIIYCLEIVKHYDDRTKHTVDKEMK  342

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              +L+ L ++P  +F  D+ Y +FL+RV   ELKL+S+GLWDVPHPWLNLF+PKS+I +F+
Sbjct  343   QVLQGLNYMPGFMFGKDVGYEEFLNRVRSGELKLKSQGLWDVPHPWLNLFIPKSQISDFN  402

Query  588   RGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQT  415
              GVF+ I+   N T+GP+L+YPMN+ K D+R SAV P+EE+FY V  L S+        T
Sbjct  403   NGVFRDIVLERNITTGPVLVYPMNRQKRDDRMSAVIPDEEIFYTVGFLHSS-----GFDT  457

Query  414   LKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILS  235
              +  + QN+DI++FC ++GI +KQYLPHYST++EW  HFG KW+ FQHRK QFDP+ +LS
Sbjct  458   WEAFEDQNKDIMRFCNKTGILVKQYLPHYSTKEEWVHHFGSKWKVFQHRKYQFDPRMLLS  517

Query  234   TGQLIFT  214
              GQ IF 
Sbjct  518   PGQRIFN  524



>ref|XP_009142753.1| PREDICTED: cytokinin dehydrogenase 1-like [Brassica rapa]
Length=533

 Score =   495 bits (1275),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 238/425 (56%), Positives = 319/425 (75%), Gaps = 19/425 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKP---LVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQA+   GVV+ M     ++P P   +      Y DV GGELWI++LK TL+HGL+
Sbjct  112   HSLQGQALAHQGVVINME----SLPSPDIKIYKGTQPYVDVSGGELWINILKETLKHGLS  167

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAGI GQAF HGPQI+NV++L++VTGKGE+VTCS++ N ELFH
Sbjct  168   PKSWTDYLHLTVGGTLSNAGIGGQAFKHGPQINNVYQLEIVTGKGEAVTCSKKLNPELFH  227

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
             +VLGGLGQFG+ITRARI+L  AP  V+WIRVLYSDF  F++DQE+LIS       + FD+
Sbjct  228   SVLGGLGQFGIITRARISLGPAPHMVKWIRVLYSDFSTFSRDQEHLIS-----KKKGFDF  282

Query  948   VEGFVIVDEG-LINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             VEG V ++   L+NNWRSS F+P +  + S  KSDG  LYCLE+ K +++  A++++QE 
Sbjct  283   VEGSVTINRTELLNNWRSS-FTPNDSTEASQFKSDGKTLYCLEVVKYFNKEEANSMNQET  341

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LL +L +IPS++F++ +PY++FLDRVH  E+KLR+KGLW+VPHPWLNL VPKS I EF
Sbjct  342   EKLLSELSYIPSTLFSSVVPYIEFLDRVHLGEIKLRAKGLWEVPHPWLNLLVPKSSIFEF  401

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
                VF  IL +  +GPILIYP+N++KW++RTS +TP E++FYLVA L SA++N      L
Sbjct  402   ATEVFNNILTSNNNGPILIYPVNQSKWNKRTSLITPSEDIFYLVAFLPSALQND-----L  456

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             ++L  QN+ +L FC+E+ + +KQYLPHY TQ+EW+ HFG KWE F   K ++DP  IL+ 
Sbjct  457   EHLLRQNQRVLNFCEEAKMNVKQYLPHYETQREWRSHFGNKWETFAKIKHEYDPLAILAP  516

Query  231   GQLIF  217
             G  IF
Sbjct  517   GHRIF  521



>ref|XP_009393975.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=534

 Score =   495 bits (1275),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 236/431 (55%), Positives = 315/431 (73%), Gaps = 16/431 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLV-----SEKFMYADVWGGELWIDVLKSTLEHG  1315
             HS+ GQA+   GVV+ M GA     +  +       +  Y D  G +LWIDVL+ T++HG
Sbjct  108   HSVRGQALARDGVVVDM-GALRGDGQGRIRVCGEGCRPSYVDAGGEQLWIDVLRETMKHG  166

Query  1314  LAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSEL  1135
             LAP+SWTDYLYL+VGGTLSNAGISGQ F +GPQISNV+ELDV+TGKGE+VTCSE+  ++L
Sbjct  167   LAPRSWTDYLYLTVGGTLSNAGISGQTFLYGPQISNVYELDVITGKGETVTCSEQHEADL  226

Query  1134  FHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKF  955
             F AVLGGL QFG+ITRARIA+E AP  VRW+R++Y DF AFT DQE LISL  +   + F
Sbjct  227   FFAVLGGLAQFGIITRARIAIEPAPTMVRWVRLIYKDFAAFTSDQERLISLEKK---KGF  283

Query  954   DYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQE  775
             +YVEG VI+ + L +NWRSSF+   +  + S + +  G +YCLE  K YD +TA ++DQE
Sbjct  284   NYVEGSVIMADSLTDNWRSSFYVEEDITRISRLAAQYGAVYCLEGAKYYDHATASSIDQE  343

Query  774   IDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDE  595
             +  ++  L+++P   F  D+ Y+ FL+RV + E KL+S+GLW+VPHPWLN+ +P+SRI E
Sbjct  344   LRSVVDDLRYLPGFEFRNDVSYMHFLNRVREGETKLQSRGLWNVPHPWLNMLIPRSRILE  403

Query  594   FDRGVFKGILG-NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQ  418
             FDRGVFK IL  N + GPILI  MN+NKWD+RTSAV P+EEVFY + LLRS ++      
Sbjct  404   FDRGVFKSILKHNNSVGPILICAMNRNKWDQRTSAVVPDEEVFYAIGLLRSGMDG-----  458

Query  417   TLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHIL  238
               KNL+ QN +IL+FC ++GI  +QYLPHY++  +W++HFG KW+ F  RK+++DP+ +L
Sbjct  459   -WKNLEEQNEEILRFCDDAGISYRQYLPHYTSLADWRKHFGAKWDVFVERKMRYDPRALL  517

Query  237   STGQLIFTPSF  205
             S GQ IFT SF
Sbjct  518   SPGQRIFTSSF  528



>ref|XP_007028626.1| Cytokinin oxidase/dehydrogenase 1 isoform 1 [Theobroma cacao]
 ref|XP_007028627.1| Cytokinin oxidase/dehydrogenase 1 isoform 1 [Theobroma cacao]
 gb|EOY09128.1| Cytokinin oxidase/dehydrogenase 1 isoform 1 [Theobroma cacao]
 gb|EOY09129.1| Cytokinin oxidase/dehydrogenase 1 isoform 1 [Theobroma cacao]
Length=544

 Score =   496 bits (1276),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 239/425 (56%), Positives = 323/425 (76%), Gaps = 15/425 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKP---LVSEKFMYADVWGGELWIDVLKSTLEHGLA  1309
             HS+ GQA    GVV+ M     ++ +P   + + +  Y DV GGELWI++L+ TL++GL+
Sbjct  124   HSLQGQAQAYQGVVINME----SLERPSMHVQTGEVPYVDVSGGELWINILQETLKYGLS  179

Query  1308  PKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFH  1129
             PKSWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKGE +TCS++QN++LF+
Sbjct  180   PKSWTDYLHLTVGGTLSNAGISGQAFRHGPQINNVYQLEVVTGKGEVLTCSDKQNADLFY  239

Query  1128  AVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDY  949
              VLGGLGQFG+ITRARI+L  A   V+WIRVLYS+F AF+ DQE+LIS         FDY
Sbjct  240   GVLGGLGQFGIITRARISLAPARTMVKWIRVLYSEFSAFSNDQEHLIS-----SENTFDY  294

Query  948   VEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEI  772
             VEGFVI++  GL++NWRSSF +P+NP++ S  +SDG +LYCLE+ K ++    D + + I
Sbjct  295   VEGFVIINRTGLLHNWRSSF-NPKNPIQASQFRSDGKILYCLEMVKYFNPEETDIL-KSI  352

Query  771   DVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEF  592
             + LL +L +IPS++F +++ YV+FLDRVH +E+KLRSKGLW+VPHPWLNL +PKSRI +F
Sbjct  353   ENLLSELNYIPSTLFLSEVSYVEFLDRVHLSEIKLRSKGLWEVPHPWLNLLIPKSRIFDF  412

Query  591   DRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTL  412
              + VF  I+ + ++GPILIYP+NK KW+ RTS VTPEE++ YLVA L SA+ +   +  L
Sbjct  413   TQEVFGNIVKDNSNGPILIYPVNKAKWNNRTSMVTPEEDIIYLVAFLSSALPSSTGTDGL  472

Query  411   KNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILST  232
             +++ +QN+ IL FC E+ +  KQYLPHYSTQ EW+ HFG +WE F  RK  +DP  IL+ 
Sbjct  473   EHIMTQNQRILDFCAEAQLGAKQYLPHYSTQDEWQAHFGPQWETFVQRKSAYDPLAILAP  532

Query  231   GQLIF  217
             GQ IF
Sbjct  533   GQKIF  537



>ref|XP_010231472.1| PREDICTED: cytokinin dehydrogenase 9 [Brachypodium distachyon]
Length=521

 Score =   494 bits (1273),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 233/422 (55%), Positives = 321/422 (76%), Gaps = 12/422 (3%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ+  A G+V++M  +  +V   +      Y D  GGELWI+VL  TL++ LAPKS
Sbjct  100   HSLYGQSQAAGGIVIRME-SLRSVRMQVHPGASPYVDASGGELWINVLDETLKYRLAPKS  158

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAG+SGQ F HGPQISNV+E+++VTG+G+ VTCS EQNS+LFHA L
Sbjct  159   WTDYLHLTVGGTLSNAGVSGQTFRHGPQISNVNEMEIVTGRGDVVTCSPEQNSDLFHAAL  218

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE APQ VRWIRVLY DF +FT+DQE L+S       + FDY+EG
Sbjct  219   GGLGQFGIITRARIALEPAPQMVRWIRVLYLDFTSFTEDQEMLLSAE-----KTFDYIEG  273

Query  939   FVIVD-EGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++ EG++NNWRSS F+P++PV+ S  + D  VL+CLE+TKN++   ADT++QE++ L
Sbjct  274   FVIINREGILNNWRSS-FNPQDPVRASQFEPDEEVLFCLEMTKNFNPEEADTMEQEVNAL  332

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L++ P S+F TD+ Y++FLDRVH +E+KLR+KG+W+VPHPWLNL +P+S I +F R 
Sbjct  333   LSQLRYTPPSLFHTDVTYMEFLDRVHYSEMKLRAKGMWEVPHPWLNLIIPRSTIHKFARE  392

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPIL+YP+++++WD RTS V P+EE+FYLV  L SA+      Q++++ 
Sbjct  393   VFGKILKDNNNGPILLYPVSRSRWDNRTSVVIPDEEIFYLVGFLSSAL----GPQSVEHT  448

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              + N  I++F  ++ I +KQYLP+Y+T+ EWK H+G +W+ FQ RK  +DP  IL+ GQ 
Sbjct  449   LNLNMQIIEFSNKASIGVKQYLPNYTTEPEWKAHYGARWDTFQQRKTTYDPLAILAPGQR  508

Query  222   IF  217
             IF
Sbjct  509   IF  510



>gb|EMS67590.1| Cytokinin dehydrogenase 4 [Triticum urartu]
Length=418

 Score =   491 bits (1263),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 232/397 (58%), Positives = 306/397 (77%), Gaps = 8/397 (2%)
 Frame = -1

Query  1377  YADVWGGELWIDVLKSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHE  1198
             Y D  GG LWI+VL  TL+HGLAPKSWTDYL+L+VGGTLSNAG+SGQAF  GPQ+SNV++
Sbjct  29    YVDAPGGALWINVLHETLKHGLAPKSWTDYLHLTVGGTLSNAGVSGQAFRQGPQVSNVNQ  88

Query  1197  LDVVTGKGESVTCSEEQNSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQ  1018
             L++VTG+G+ VTCS E+NS+LF+  LGGLGQFG+ITRARIALE AP+ VRWIRVLYSDF 
Sbjct  89    LEIVTGRGDVVTCSPEENSDLFYGALGGLGQFGIITRARIALEPAPKMVRWIRVLYSDFA  148

Query  1017  AFTKDQEYLISLHGQPPAQKFDYVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGG  841
             +FT+DQE LIS       + FDY+EGFVI++  G++NNWR+SF  P++PV+ S  +SDG 
Sbjct  149   SFTEDQEALISAE-----ETFDYIEGFVIINRTGILNNWRTSF-KPQDPVQASHFQSDGK  202

Query  840   VLYCLEITKNYDQSTADTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRS  661
             VLYCLE+TKN+D   AD ++QE+ VLL +L++I S++F TD+ Y++FLDRVH +ELKLR+
Sbjct  203   VLYCLEMTKNFDPDEADIMEQEVGVLLSRLRYIQSTLFHTDVTYLEFLDRVHSSELKLRA  262

Query  660   KGLWDVPHPWLNLFVPKSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPE  481
             +GLW+VPHPWLNL +P+S I  F R VF  IL +  +GPIL+YP+N++KWD RTS V PE
Sbjct  263   QGLWEVPHPWLNLLIPRSTIHRFAREVFGKILKDSNNGPILLYPVNRSKWDNRTSVVIPE  322

Query  480   EEVFYLVALLRSAVENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEH  301
             EE FYLV  L SA  + +   ++++  S N  I+ FC ++G+ MKQYL  Y+TQQ+WK H
Sbjct  323   EETFYLVGFLSSA-PSASGHGSVEHAVSLNDKIVDFCDKAGVGMKQYLAPYTTQQQWKAH  381

Query  300   FGEKWERFQHRKLQFDPKHILSTGQLIFTPSFNAMTA  190
             FG +WE F+ RK  +DP  IL+ GQ IF  +   M++
Sbjct  382   FGARWETFERRKHMYDPLAILAPGQRIFPKASLPMSS  418



>emb|CAN77185.1| hypothetical protein VITISV_039458 [Vitis vinifera]
Length=522

 Score =   494 bits (1273),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 248/431 (58%), Positives = 318/431 (74%), Gaps = 25/431 (6%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-------SGAAAAVPK-PLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS+ GQAM + GVV++M        G+   V K P+      YADV G + WIDVL++TL
Sbjct  104   HSLRGQAMASHGVVVEMRSLNNCSCGSGIRVTKNPIWGS---YADVGGEQQWIDVLQATL  160

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             +HGLAP SWTDYLYL++GGTLSNAGISGQ F HGPQISNV+E+DV+TGKGE VTCS++ N
Sbjct  161   KHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTN  220

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             SELF AVLGGLGQFG+ITRARIALE AP+RV+WI++LY DF  F++DQE+LIS++G    
Sbjct  221   SELFFAVLGGLGQFGIITRARIALEPAPERVKWIQMLYDDFSTFSRDQEHLISING----  276

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
                DY+EG + +     NNWRSS FSP    + SS+ S  G++YCLE+ K YD+ T+ TV
Sbjct  277   --LDYLEGSLXMQNSXPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTV  333

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             D+E+  LLK L F+P  VFT D+  VDFL+RVH  EL LR+KGLWDVPHPWLNLFVP SR
Sbjct  334   DEELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVPGSR  393

Query  603   IDEFDRGVFKGILG--NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             I +F+ GVF+ IL   N+T+G  L+YP+ +NKWD+RTSAV P+E++FY V  L S+  + 
Sbjct  394   ISDFNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGXLHSSGADD  453

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
              E      L++QN++ILKFC ++GI++K+YL  Y+T+ +W  HFG KW  F+ RK QFDP
Sbjct  454   WEP-----LENQNKEILKFCDKAGIKIKRYLSRYTTKXDWMNHFGPKWXTFEDRKAQFDP  508

Query  249   KHILSTGQLIF  217
             K ILS GQ IF
Sbjct  509   KMILSPGQQIF  519



>ref|XP_002264445.1| PREDICTED: cytokinin dehydrogenase 3 [Vitis vinifera]
Length=522

 Score =   494 bits (1273),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 245/430 (57%), Positives = 319/430 (74%), Gaps = 23/430 (5%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMS-------GAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLE  1321
             HS+ GQAM   GVV++M        G+   V K  +S    YAD  G +LWIDVL++TL+
Sbjct  104   HSLRGQAMAPHGVVVEMRSLNNCSRGSGIRVTKNPISGS--YADAGGEQLWIDVLQATLK  161

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             HGLAP SWTDYLYL++GGTLSNAGISGQ F HGPQISNV+E+DV+TGKGE VTCS++ NS
Sbjct  162   HGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTNS  221

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELF AVLGGLGQFG+I RARIAL+ AP+RV+WI++LY DF  F++DQE+LIS++G     
Sbjct  222   ELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISING-----  276

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
               DY+EG +++     NNWRSS FSP    + SS+ S  G++YCLE+ K YD+ T+ TVD
Sbjct  277   -LDYLEGSLLMQNSSPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVD  334

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             +E+  LLK L F+P  VFT D+  VDFL+RVH  EL L++KGLWDVPHPWLNLFVP SRI
Sbjct  335   EELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLQAKGLWDVPHPWLNLFVPGSRI  394

Query  600   DEFDRGVFKGILG--NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGN  427
              +F+ GVF+ IL   N+T+G  L+YP+ +NKWD+RTSAV P+E++FY V LL S+  +  
Sbjct  395   SDFNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDW  454

Query  426   ESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPK  247
             E      L++QN++IL+FC ++GI++K+YL  Y+T+++W  HFG KW  F+ RK QFDPK
Sbjct  455   EP-----LENQNKEILQFCDKAGIKIKRYLSRYTTKEDWMNHFGPKWRTFEDRKAQFDPK  509

Query  246   HILSTGQLIF  217
              ILS GQ IF
Sbjct  510   LILSPGQQIF  519



>ref|XP_011009888.1| PREDICTED: cytokinin dehydrogenase 3 [Populus euphratica]
Length=529

 Score =   495 bits (1274),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 244/430 (57%), Positives = 305/430 (71%), Gaps = 16/430 (4%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-------SGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLE  1321
             HS+ GQAM + GVV+ M       +G    V K        YADV G +LWIDVL ST+E
Sbjct  104   HSVGGQAMASNGVVVDMMSLRNHKNGTGITVSK--CPSLGFYADVGGEQLWIDVLHSTME  161

Query  1320  HGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNS  1141
             HG AP SWTDYLYLSVGGTLSNAGISG  F +GPQISNV+E+DVVTGKGE VTCS   NS
Sbjct  162   HGFAPVSWTDYLYLSVGGTLSNAGISGTTFQYGPQISNVYEMDVVTGKGELVTCSSHTNS  221

Query  1140  ELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQ  961
             ELF+AVLGGLGQFG+ITRARIALE AP+RV+W+R+LYSDF AFT+DQE LIS++G     
Sbjct  222   ELFYAVLGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSAFTRDQELLISINGWKQKN  281

Query  960   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVD  781
               DY+EG +++ +G  NNWRSSFF   +  K  S+ +   ++YCLE+ K YD  T  TVD
Sbjct  282   ALDYLEGSLLMAQGPPNNWRSSFFPSSDIPKIMSLVTQHAIIYCLEVAKYYDDGTRHTVD  341

Query  780   QEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRI  601
             +++  L K L F+    F  D+ +VDFL+RV   E KL S+GLWDVPHPWLNLF+PKSRI
Sbjct  342   KDLQQLFKGLSFVAGFKFEKDVSFVDFLNRVRSGEQKLHSQGLWDVPHPWLNLFLPKSRI  401

Query  600   DEFDRGVFKGIL--GNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGN  427
              +F++GVF  ++   N T+G +L YPMN+ KWD++ SAV PEE++FY V  L S+  N  
Sbjct  402   LDFNKGVFHDLVLKRNITTGVVLFYPMNRKKWDDKMSAVIPEEDIFYTVGFLHSSGFNDW  461

Query  426   ESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPK  247
             ++        QN+DILKFC  +GIE+KQYLPHY++ +EW  HFG KW  F+ RK QFDPK
Sbjct  462   QA-----YDHQNKDILKFCDRNGIEIKQYLPHYNSNKEWINHFGSKWRNFRERKAQFDPK  516

Query  246   HILSTGQLIF  217
              +LS GQ IF
Sbjct  517   MMLSPGQRIF  526



>ref|XP_002534458.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF27923.1| gulonolactone oxidase, putative [Ricinus communis]
Length=540

 Score =   494 bits (1273),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 230/422 (55%), Positives = 318/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+ M        +  + E  ++ DV GGELWI+VL  TL++GLAPKS
Sbjct  123   HSLQGQAQAHQGIVISMESLQGPEMRIHMGEP-LHVDVSGGELWINVLHETLKYGLAPKS  181

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L++VTGKGE +TCSE+ N++LF+  L
Sbjct  182   WTDYLHLTVGGTLSNAGISGQAFQHGPQINNVYQLEIVTGKGEVLTCSEQLNADLFYGAL  241

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+RVRWIRVLY++F  F+ DQE+LI+         FDY+EG
Sbjct  242   GGLGQFGIITRARISLERAPKRVRWIRVLYAEFSKFSNDQEHLIA-----SENSFDYIEG  296

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +P++P++ S   SDG  LYCLEI K ++    D ++Q+ + L
Sbjct  297   FVIINRTGLLNNWRSSF-NPKDPLQASQFISDGRTLYCLEIAKYFNPEDFDIMNQKTEDL  355

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L  L +IPS++F +++ YV+FLDRVH +E+KLR++GLW+VPHPW+NL +PKS I  F + 
Sbjct  356   LSGLSYIPSTLFLSEVSYVEFLDRVHVSEMKLRAEGLWEVPHPWMNLLIPKSNISAFAKE  415

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+N++KW+ +TS +TPEE++FYLV  L SAV +     +L ++
Sbjct  416   VFGNILTDSSNGPILIYPVNQSKWNNKTSLITPEEDIFYLVGFLSSAVPSSTGKDSLPHI  475

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              ++N+ IL FC ++ + +KQYLPHYS+Q+EW+ HFG +WE F  RK  +DP  IL+ GQ 
Sbjct  476   LARNKRILDFCSKANLGVKQYLPHYSSQEEWQAHFGPQWEVFVQRKSTYDPLAILAPGQR  535

Query  222   IF  217
             IF
Sbjct  536   IF  537



>emb|CAN80714.1| hypothetical protein VITISV_042932 [Vitis vinifera]
Length=522

 Score =   494 bits (1272),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 247/431 (57%), Positives = 319/431 (74%), Gaps = 25/431 (6%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQM-------SGAAAAVPK-PLVSEKFMYADVWGGELWIDVLKSTL  1324
             HS+ GQAM   GVV++M        G+   V K P+      YADV G + WIDVL++TL
Sbjct  104   HSLRGQAMAXHGVVVEMRSLNNCSXGSGIRVTKNPIWGS---YADVGGEQQWIDVLQATL  160

Query  1323  EHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQN  1144
             +HGLAP SWTDYLYL++GGTLSNAGISGQ F HGPQISNV+E+DV+TGKGE VTCS++ N
Sbjct  161   KHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTN  220

Query  1143  SELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPA  964
             SELF AVLGGLGQFG+I RARIAL+ AP+RV+WI++LY DF  F++DQE+LIS++G    
Sbjct  221   SELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISING----  276

Query  963   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTV  784
                DY+EG +++     NNWRSS FSP    + SS+ S  G++YCLE+ K YD+ T+ TV
Sbjct  277   --LDYLEGSLLMQNSSPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTV  333

Query  783   DQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSR  604
             D+E+  LLK L F+P  VFT D+  VDFL+RVH  EL LR+KGLWDVPHPWLNLFVP SR
Sbjct  334   DEELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVPGSR  393

Query  603   IDEFDRGVFKGILG--NKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENG  430
             I +F+ GVF+ IL   N+T+G  L+YP+ +NKWD+RTSAV P+E++FY V LL S+  + 
Sbjct  394   ISDFNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADD  453

Query  429   NESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDP  250
              E      L++QN++ILKFC ++GI++K+YL  Y+T+++W  HFG KW  F+ RK QFDP
Sbjct  454   WEP-----LENQNKEILKFCDKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFDP  508

Query  249   KHILSTGQLIF  217
             K ILS GQ IF
Sbjct  509   KMILSPGQQIF  519



>ref|XP_010523651.1| PREDICTED: cytokinin dehydrogenase 1 [Tarenaya hassleriana]
Length=551

 Score =   495 bits (1274),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 239/423 (57%), Positives = 316/423 (75%), Gaps = 10/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSE-KFMYADVWGGELWIDVLKSTLEHGLAPK  1303
             HS+ GQA    GVV+ M    +  P+  + + K  Y DV GGELWI+VL+ TL++GL+PK
Sbjct  124   HSLQGQAQAHQGVVINMESLRS--PQIRIHKGKQPYVDVSGGELWINVLRETLKYGLSPK  181

Query  1302  SWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAV  1123
             SWTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKGE +TCSE+QNSELFH V
Sbjct  182   SWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEVVTGKGEVLTCSEKQNSELFHGV  241

Query  1122  LGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVE  943
             LGGLGQFG+ITRARI+LE AP  V+WIRVLYS+F AF++DQE+LIS         FDY+E
Sbjct  242   LGGLGQFGIITRARISLEPAPNMVKWIRVLYSEFSAFSRDQEHLISREN-----GFDYIE  296

Query  942   GFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDV  766
             GFVI++  GL+NNWRSSF +P+   + S   +DG  LYCLE+ K ++Q     V+QE D 
Sbjct  297   GFVIINRTGLLNNWRSSF-NPKYSNQASQFNTDGKTLYCLEVAKYFNQEDGAFVNQESDR  355

Query  765   LLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDR  586
             LL +L +I S++F++++ Y++FLDRVH +E+KLR++GLW+VPHPWLNL +PKS+I EF  
Sbjct  356   LLSELNYIQSTLFSSEVSYIEFLDRVHISEIKLRAQGLWEVPHPWLNLLIPKSKIFEFAT  415

Query  585   GVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKN  406
              VF  IL + ++GP+LIYP+N++KW+  TS VTP E++FYLVA L SAV +   +  L+ 
Sbjct  416   EVFNRILTSNSNGPVLIYPVNQSKWNSNTSLVTPNEDIFYLVAFLSSAVPSSTGTDGLEY  475

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             L  QN+ +L FC  + + +KQYL  Y TQ+EWK HFG +WE F  RK  +DP  IL+ GQ
Sbjct  476   LLKQNQRVLDFCAAANLNVKQYLARYETQEEWKTHFGNRWETFAQRKYAYDPLAILAPGQ  535

Query  225   LIF  217
              IF
Sbjct  536   RIF  538



>ref|XP_009133497.1| PREDICTED: cytokinin dehydrogenase 1-like [Brassica rapa]
Length=545

 Score =   495 bits (1274),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 238/423 (56%), Positives = 317/423 (75%), Gaps = 9/423 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ++   GVV+ M    +   K +   K  YADV GGE WI++L+ TL++GL+PKS
Sbjct  118   HSLQGQSLAHQGVVINMESLRSPDIK-IHKGKQPYADVSGGESWINILRETLKYGLSPKS  176

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF +GPQI+NV++L+++TGKGE +TCSE+QNSELF++VL
Sbjct  177   WTDYLHLTVGGTLSNAGISGQAFKYGPQINNVYQLEIITGKGEVMTCSEKQNSELFYSVL  236

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIAL  AP  V+WIRVLYSDF AF++DQE+LI+         FDYVEG
Sbjct  237   GGLGQFGIITRARIALGPAPHMVKWIRVLYSDFSAFSRDQEHLIT-----KKNGFDYVEG  291

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FV V+   L++NWRSS FSP + +  S  KS+G  LYCLE+ K +    A++ + E++ L
Sbjct  292   FVTVNRTDLLDNWRSS-FSPNDSIGASQFKSEGKTLYCLEVVKYFILEEANSTNLEVEKL  350

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L +IPS++F++++PY++FLDRVH AE+KLR+KGLW+VPHPWLNL +PKS I EF   
Sbjct  351   LSELSYIPSTLFSSEVPYIEFLDRVHIAEIKLRAKGLWEVPHPWLNLLIPKSSIFEFATE  410

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGN-ESQTLKN  406
             VF  IL +  +GPILIYP+N++KW++ TS +TP E++FYLVA L SAV N N  +  L+ 
Sbjct  411   VFNNILTSNNNGPILIYPVNQSKWNKHTSLITPAEDIFYLVAFLPSAVPNPNSRTSNLEY  470

Query  405   LQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQ  226
             L  QN+ +L FC  + I +KQYLPHY TQ+EW+ HFG +WE F  RK  +DP  IL+ G 
Sbjct  471   LLRQNQRVLNFCSAANINVKQYLPHYETQREWRSHFGNRWETFAKRKHTYDPLAILAPGH  530

Query  225   LIF  217
              IF
Sbjct  531   RIF  533



>ref|XP_010468848.1| PREDICTED: cytokinin dehydrogenase 6-like [Camelina sativa]
Length=537

 Score =   494 bits (1273),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 250/447 (56%), Positives = 323/447 (72%), Gaps = 34/447 (8%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSG---------AAAAVPKPLVSEKFMYADVWGGELWIDVLKST  1327
             HS+ GQA T  G+V++M           +   VP P       Y DV GGELWI++L  T
Sbjct  109   HSLQGQAQTRNGIVIRMESLHPQKLQVHSVDDVPAP-------YVDVSGGELWINILHET  161

Query  1326  LEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQ  1147
             L++GLAPKSWTDYL+L+VGGTLSN GISGQAF HGPQISNVH+L+VVTGKGE + CSE Q
Sbjct  162   LKYGLAPKSWTDYLHLTVGGTLSNVGISGQAFRHGPQISNVHQLEVVTGKGEILNCSERQ  221

Query  1146  NSELFHAVLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPP  967
             NS+LFH VLGGLGQFG+ITRARIALE AP  V+W+RVLY DF AF +DQE LIS      
Sbjct  222   NSDLFHGVLGGLGQFGIITRARIALEAAPTMVKWVRVLYQDFSAFIQDQERLIS-----A  276

Query  966   AQKFDYVEGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQ-STA  793
               K DYVEGFVI++  GL+NNWR S F+P +P++ S  KSDG  LYCLE+ K Y +    
Sbjct  277   DNKLDYVEGFVIINRTGLLNNWRLS-FTPEDPLQASQFKSDGRTLYCLEVAKYYFKLDDK  335

Query  792   DTVDQEIDVLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  613
             D + Q +   L +L +I S++FT+++ Y  FLDRVH +E+KLRSKG W+VPHPWLNL VP
Sbjct  336   DVISQGVKETLSELSYISSTLFTSEVTYEAFLDRVHVSEVKLRSKGQWEVPHPWLNLLVP  395

Query  612   KSRIDEFDRGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAV--  439
             +S + +F +GVF  IL + ++GP+++YP+NK KW+ RTSAVTPEEE+FYLVA+L SAV  
Sbjct  396   RSTVKKFAKGVFGNILTDTSNGPVIVYPVNKAKWNNRTSAVTPEEEIFYLVAILTSAVPG  455

Query  438   -ENGNESQTLKNLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKL  262
              E+G E Q LK    +N+ IL+F + +GI +KQYLPHY+T++EW+ HFG KW+ F  RK 
Sbjct  456   KEDGVE-QILK----RNQRILEFSEAAGIGLKQYLPHYTTREEWRSHFGAKWDDFVRRKS  510

Query  261   QFDPKHILSTGQLIF--TPSFNAMTAS  187
             ++DP  IL+ G  IF   P F++ ++S
Sbjct  511   RYDPLAILAPGHRIFPKAPVFSSYSSS  537



>ref|NP_001045353.1| Os01g0940000 [Oryza sativa Japonica Group]
 sp|Q5JLP4.1|CKX4_ORYSJ RecName: Full=Cytokinin dehydrogenase 4; AltName: Full=Cytokinin 
oxidase 4; Short=OsCKX4; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD87612.1| putative cytokinin dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF07267.1| Os01g0940000 [Oryza sativa Japonica Group]
Length=529

 Score =   494 bits (1272),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 235/424 (55%), Positives = 321/424 (76%), Gaps = 10/424 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFM--YADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQ+  A G+V++M   AAA  + +        + D  GGELWI+VL  TL+HGLAP
Sbjct  104   HSLLGQSQAAGGIVVKMESLAAAAARAVRVHGGASPHVDAPGGELWINVLHETLKHGLAP  163

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             +SWTDYL+L+VGGTLSNAG+SGQAF HGPQ+SNV++L++VTG+GE VTCS E NS+LF+A
Sbjct  164   RSWTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGEVVTCSHEVNSDLFYA  223

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
              LGGLGQFG+ITRARIALE AP+ VRWIRVLYSDF+ FT+DQE LI+       + FDY+
Sbjct  224   ALGGLGQFGIITRARIALEPAPKMVRWIRVLYSDFETFTEDQEKLIA-----SEKTFDYI  278

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EGFVI++  G++NNWR+S F P++PV+ S  +SDG VLYCLE+T N++   AD ++QE+ 
Sbjct  279   EGFVIINRTGILNNWRTS-FKPQDPVQASQFQSDGRVLYCLELTMNFNHDEADIMEQEVG  337

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LL +L++I S++F TD+ Y++FLDRVH +ELKLR++GLW+VPHPWLNL +P+S + +F 
Sbjct  338   ALLSRLRYISSTLFYTDVTYLEFLDRVHTSELKLRAQGLWEVPHPWLNLLIPRSTVHKFA  397

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             + VF  IL +  +GPIL+YP+N+ KWD RTS V P+EE+FYLV  L SA  +     +++
Sbjct  398   KEVFGKILKDSNNGPILLYPVNRTKWDNRTSVVIPDEEIFYLVGFLSSAPSSSGHG-SVE  456

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
             +  + N  I+ FC+++G+ MKQYL  Y+TQ++WK HFG +WE F+ RK  +DP  IL+ G
Sbjct  457   HAMNLNNKIVDFCEKNGVGMKQYLAPYTTQKQWKAHFGARWETFERRKHTYDPLAILAPG  516

Query  228   QLIF  217
             Q IF
Sbjct  517   QRIF  520



>ref|XP_007203158.1| hypothetical protein PRUPE_ppa024442mg [Prunus persica]
 gb|EMJ04357.1| hypothetical protein PRUPE_ppa024442mg [Prunus persica]
Length=545

 Score =   494 bits (1273),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 234/422 (55%), Positives = 316/422 (75%), Gaps = 8/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA T  G+V+ M    A   +  + E+  Y DV GGELWI++L  TL++GL+PKS
Sbjct  124   HSLQGQAQTHGGLVINMESLKAQQMQVHIGEQ-PYVDVSGGELWINILHETLKYGLSPKS  182

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLS AGISGQAF HGPQI+NV++L+VVTG+GE +TCSE ++ +LF+ VL
Sbjct  183   WTDYLHLTVGGTLSYAGISGQAFRHGPQINNVYQLEVVTGQGEVITCSENKSPDLFYGVL  242

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+IT+ARI+LE AP+ V+WIRVLYSDF +FTKDQE+LIS         FDY+EG
Sbjct  243   GGLGQFGIITQARISLEPAPKMVKWIRVLYSDFSSFTKDQEFLIS-----SENSFDYIEG  297

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI++  GL+NNWRSSF +P++P++ S   SDG  LYCLE+ K ++ +  D +DQ  + L
Sbjct  298   FVIINRTGLLNNWRSSF-NPKDPMQASKFNSDGRTLYCLEMAKYFNPNETDVMDQRTESL  356

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L  L +IPS++F +++ YV+FLDRVH +E+KLR+KGLW+VPHPW+NL +PKS+I +F   
Sbjct  357   LLLLHYIPSTLFLSEVSYVEFLDRVHLSEIKLRTKGLWEVPHPWMNLLIPKSKIHDFADE  416

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             +F  IL +  +GPIL+YP+NK KW+  TS VTP+E+VFYLVA L SAV +   +  L  +
Sbjct  417   IFGNILTDNINGPILMYPVNKTKWNNNTSLVTPDEDVFYLVAFLSSAVPSSTGTDGLDQI  476

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN  IL++C  + + +KQYLP+Y TQQEWK HFG +W+ F  RK  +DP  IL+ GQ 
Sbjct  477   LTQNTRILEYCDRAQLGIKQYLPYYRTQQEWKAHFGPRWQAFIQRKSSYDPLAILAPGQR  536

Query  222   IF  217
             IF
Sbjct  537   IF  538



>gb|EAY77168.1| hypothetical protein OsI_05138 [Oryza sativa Indica Group]
Length=525

 Score =   494 bits (1271),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 235/424 (55%), Positives = 321/424 (76%), Gaps = 10/424 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFM--YADVWGGELWIDVLKSTLEHGLAP  1306
             HS+ GQ+  A G+V++M   AAA  + +        + D  GGELWI+VL  TL+HGLAP
Sbjct  100   HSLLGQSQAAGGIVVKMESLAAAAARAVRVHGGASPHVDAPGGELWINVLHETLKHGLAP  159

Query  1305  KSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHA  1126
             +SWTDYL+L+VGGTLSNAG+SGQAF HGPQ+SNV++L++VTG+GE VTCS E NS+LF+A
Sbjct  160   RSWTDYLHLTVGGTLSNAGVSGQAFRHGPQVSNVNQLEIVTGRGEVVTCSHEVNSDLFYA  219

Query  1125  VLGGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYV  946
              LGGLGQFG+ITRARIALE AP+ VRWIRVLYSDF+ FT+DQE LI+       + FDY+
Sbjct  220   ALGGLGQFGIITRARIALEPAPKMVRWIRVLYSDFETFTEDQEKLIA-----SEKTFDYI  274

Query  945   EGFVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEID  769
             EGFVI++  G++NNWR+S F P++PV+ S  +SDG VLYCLE+T N++   AD ++QE+ 
Sbjct  275   EGFVIINRTGILNNWRTS-FKPQDPVQASQFQSDGRVLYCLELTMNFNHDEADIMEQEVG  333

Query  768   VLLKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFD  589
              LL +L++I S++F TD+ Y++FLDRVH +ELKLR++GLW+VPHPWLNL +P+S + +F 
Sbjct  334   ALLSRLRYISSTLFYTDVTYLEFLDRVHTSELKLRAQGLWEVPHPWLNLLIPRSTVHKFA  393

Query  588   RGVFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLK  409
             + VF  IL +  +GPIL+YP+N+ KWD RTS V P+EE+FYLV  L SA  +     +++
Sbjct  394   KEVFGKILKDSNNGPILLYPVNRTKWDNRTSVVIPDEEIFYLVGFLSSAPSSSGHG-SVE  452

Query  408   NLQSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTG  229
             +  + N  I+ FC+++G+ MKQYL  Y+TQ++WK HFG +WE F+ RK  +DP  IL+ G
Sbjct  453   HAMNLNNKIVDFCEKNGVGMKQYLAPYTTQKQWKAHFGARWETFERRKHTYDPLAILAPG  512

Query  228   QLIF  217
             Q IF
Sbjct  513   QRIF  516



>ref|XP_011048092.1| PREDICTED: cytokinin dehydrogenase 1 [Populus euphratica]
Length=539

 Score =   494 bits (1273),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 234/422 (55%), Positives = 313/422 (74%), Gaps = 9/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    G+V+ M        +    E   Y D  G ELWI++L  TL++GLAPKS
Sbjct  123   HSLQGQAQAHQGIVINMESLQGPEMQVHTGE-LPYVDASGSELWINILHETLKYGLAPKS  181

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+N+++L+VVTGKGE VTCSE+QN++LF+ VL
Sbjct  182   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNIYQLEVVTGKGEVVTCSEKQNADLFYGVL  241

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARI+LE AP+ V+WIR LY +F  F+KDQE+LIS         FDY+EG
Sbjct  242   GGLGQFGIITRARISLEPAPKTVKWIRALYDEFSKFSKDQEHLIS------KNSFDYIEG  295

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
              VI++  GL+NNWRSSF  P++P++ S   S+G  LYCLEI K ++ + +D ++QE + L
Sbjct  296   LVIINRTGLLNNWRSSF-KPKDPLQASQFISEGKTLYCLEIAKYFNPNESDAMNQETESL  354

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L  L +IPS++F +++ YV+FLDRVH++E+KL++KGLW++PHPWLNL +PK++I EF + 
Sbjct  355   LSDLSYIPSTLFLSEVSYVEFLDRVHQSEIKLQAKGLWEIPHPWLNLLIPKNKIFEFAQE  414

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + ++GPILIYP+NK+KWD RTS +TPEE+ FYLVA L SA+ +      L ++
Sbjct  415   VFGNILTDSSNGPILIYPVNKSKWDNRTSLITPEEDTFYLVAFLSSAMPSSTGRDGLFHI  474

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              +QN+ IL FC  + +  KQYLPHYSTQ+EW+ HFG KWE F  RK  +DP  IL+ G  
Sbjct  475   LAQNQRILGFCSSTSLGAKQYLPHYSTQEEWQAHFGPKWEVFVLRKSTYDPMAILAPGHR  534

Query  222   IF  217
             IF
Sbjct  535   IF  536



>ref|NP_001244907.1| cytokinin oxidase/dehydrogenase-like 5 precursor [Solanum lycopersicum]
 dbj|BAM09007.1| cytokinin oxidase/dehydrogenase-like [Solanum lycopersicum]
Length=543

 Score =   494 bits (1273),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 236/422 (56%), Positives = 313/422 (74%), Gaps = 7/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQA    GVV+ M    A   +   + +  + DV  GELWI++L  +L+  L PKS
Sbjct  119   HSLEGQAQAYQGVVISMESLRAPAMRFHHAGELPFVDVSAGELWINILHESLKLELTPKS  178

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L+VGGTLSNAGISGQAF HGPQI+NV++L+VVTGKGE +TCS+EQN++LF+ VL
Sbjct  179   WTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEVVTGKGEVITCSKEQNADLFYGVL  238

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIAL+ AP++V+WIRVLYSDF  F+ DQE LIS         FDYVEG
Sbjct  239   GGLGQFGIITRARIALQPAPKKVKWIRVLYSDFSTFSNDQEQLIS-----SKDSFDYVEG  293

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FVI+++ GL+NNWRS+F +P++P+  +   S+G VLYCLE+ K ++       DQ IDVL
Sbjct  294   FVIINKTGLLNNWRSTF-NPKDPLLATKFSSEGKVLYCLEVAKYFNPEETPNTDQNIDVL  352

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L KL +I S++F +++ YV+FLDRVH +E+KL+ KGLWDVPHPWLNL +PKSRI +F + 
Sbjct  353   LSKLSYIKSTLFQSEVSYVEFLDRVHVSEMKLQEKGLWDVPHPWLNLLIPKSRIHDFAQE  412

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL + + GPILIYP+NK+KW + TS VTPEE+V YL+A L SA+ +      L+++
Sbjct  413   VFGKILTDTSHGPILIYPVNKSKWIKGTSMVTPEEDVMYLIAFLSSAMPSSTGKDGLEHI  472

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              ++N+ IL FC ++ I MKQYLPHY+TQ++WK HFG +WE F  RK  +DP  IL+ G  
Sbjct  473   LNKNKKILNFCNKAHIGMKQYLPHYTTQEDWKVHFGPRWETFARRKSTYDPLSILAPGHR  532

Query  222   IF  217
             IF
Sbjct  533   IF  534



>ref|XP_004962256.1| PREDICTED: cytokinin dehydrogenase 9-like [Setaria italica]
Length=522

 Score =   493 bits (1270),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 238/422 (56%), Positives = 316/422 (75%), Gaps = 9/422 (2%)
 Frame = -1

Query  1479  HSINGQAMTAAGVVLQMSGAAAAVPKPLVSEKFMYADVWGGELWIDVLKSTLEHGLAPKS  1300
             HS+ GQ   A G+V++M     A  + + S    Y D  GGELWI+VL  T ++GLAPKS
Sbjct  100   HSLRGQCQAAGGIVIKMESLPTARMQ-VHSGASPYVDASGGELWINVLHETFKYGLAPKS  158

Query  1299  WTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGESVTCSEEQNSELFHAVL  1120
             WTDYL+L++GGTLSNAG+SGQ F HGPQISNV EL++VTG+G+ +TCS +QNS+LFHA L
Sbjct  159   WTDYLHLTIGGTLSNAGVSGQTFRHGPQISNVIELEIVTGRGDIITCSPDQNSDLFHAAL  218

Query  1119  GGLGQFGVITRARIALEHAPQRVRWIRVLYSDFQAFTKDQEYLISLHGQPPAQKFDYVEG  940
             GGLGQFG+ITRARIALE AP+ VRWIRVLYSDF +FT+DQE LIS       + FDY+EG
Sbjct  219   GGLGQFGIITRARIALERAPKMVRWIRVLYSDFISFTEDQEMLISAE-----RTFDYIEG  273

Query  939   FVIVDE-GLINNWRSSFFSPRNPVKFSSVKSDGGVLYCLEITKNYDQSTADTVDQEIDVL  763
             FV ++  G++NNWRSS F+P++PV  S  +SDG VL+CLE+TKNY+    D ++QE++ L
Sbjct  274   FVTINRTGILNNWRSS-FNPQDPVWASQFESDGRVLFCLEMTKNYNPEEVDNMEQEVNNL  332

Query  762   LKKLKFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIDEFDRG  583
             L +L++IP S+F TD+ Y++FLDRVH +E+KLR+KG+W+VPHPWLNL +PKS I  F R 
Sbjct  333   LYQLRYIPQSLFHTDVTYIEFLDRVHSSEVKLRAKGMWEVPHPWLNLMIPKSSIHTFARE  392

Query  582   VFKGILGNKTSGPILIYPMNKNKWDERTSAVTPEEEVFYLVALLRSAVENGNESQTLKNL  403
             VF  IL +  +GPIL+YP+NK +WD RTS V P+EEVFYLV  L SA  + +   ++++ 
Sbjct  393   VFGKILKDSNNGPILLYPVNKFRWDNRTSVVIPDEEVFYLVGFLSSA-PSSSGPHSIEHT  451

Query  402   QSQNRDILKFCKESGIEMKQYLPHYSTQQEWKEHFGEKWERFQHRKLQFDPKHILSTGQL  223
              + N  I++F  ++GI +KQYLP+Y+T+QEWK HF  +WE F  RK  +DP  IL+ GQ 
Sbjct  452   LNLNNQIIEFSDKAGIGVKQYLPNYNTEQEWKAHFEARWETFLRRKNAYDPLAILAPGQG  511

Query  222   IF  217
             IF
Sbjct  512   IF  513



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4137144853660