BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c35560_g1_i1 len=452 path=[1:0-451]

Length=452
                                                                      Score     E

emb|CDP20741.1|  unnamed protein product                                123   3e-32   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    123   1e-30   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                120   1e-29   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        120   1e-29   
ref|XP_009774375.1|  PREDICTED: fruit bromelain-like                    117   2e-29   
dbj|BAD29959.1|  cysteine protease                                      120   2e-29   Daucus carota [carrots]
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                119   4e-29   
emb|CDP18641.1|  unnamed protein product                                119   5e-29   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        119   6e-29   
ref|XP_006360707.1|  PREDICTED: vignain-like                            117   3e-28   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    116   5e-28   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             115   7e-28   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    115   9e-28   
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        115   1e-27   
ref|XP_009616844.1|  PREDICTED: zingipain-1-like                        114   2e-27   
ref|XP_006367780.1|  PREDICTED: ananain-like                            114   2e-27   
ref|XP_004234254.1|  PREDICTED: zingipain-2-like                        114   3e-27   
emb|CBI21973.3|  unnamed protein product                                114   3e-27   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    114   3e-27   
emb|CBI21972.3|  unnamed protein product                                113   4e-27   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    113   4e-27   Vitis vinifera
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    113   5e-27   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    113   5e-27   Vitis vinifera
emb|CAN70559.1|  hypothetical protein VITISV_032465                     113   8e-27   Vitis vinifera
ref|XP_006360708.1|  PREDICTED: vignain-like                            112   1e-26   
emb|CDP18639.1|  unnamed protein product                                112   1e-26   
emb|CDP18638.1|  unnamed protein product                                112   2e-26   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    112   2e-26   
ref|XP_006362426.1|  PREDICTED: vignain-like                            112   2e-26   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like              111   3e-26   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like              111   3e-26   
emb|CBI21975.3|  unnamed protein product                                110   6e-26   
ref|NP_001233949.1|  phytophthora-inhibited protease 1                  110   6e-26   
ref|NP_001066557.2|  Os12g0273800                                       108   7e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like              110   8e-26   
emb|CDP18644.1|  unnamed protein product                                110   9e-26   
gb|AFW76903.1|  hypothetical protein ZEAMMB73_202256                    106   1e-25   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            109   1e-25   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like              109   1e-25   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            109   1e-25   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    109   1e-25   Vitis vinifera
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        109   1e-25   
ref|XP_002523448.1|  cysteine protease, putative                        109   2e-25   Ricinus communis
ref|XP_004301219.1|  PREDICTED: fruit bromelain-like                    105   2e-25   
ref|XP_009797968.1|  PREDICTED: vignain-like                            109   2e-25   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    109   2e-25   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    109   2e-25   
gb|KDP23191.1|  hypothetical protein JCGZ_00324                         108   2e-25   
ref|XP_002525124.1|  cysteine protease, putative                        108   2e-25   Ricinus communis
gb|EAY97106.1|  hypothetical protein OsI_19029                          108   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_008811650.1|  PREDICTED: vignain-like                            108   2e-25   
emb|CBI21976.3|  unnamed protein product                                108   3e-25   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         108   3e-25   
gb|ABA97421.1|  Vignain precursor, putative                             108   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like              108   3e-25   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    108   4e-25   Vitis vinifera
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like              107   5e-25   
emb|CDP05747.1|  unnamed protein product                                107   6e-25   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     107   7e-25   
ref|XP_009609440.1|  PREDICTED: ananain-like                            104   8e-25   
emb|CAN64655.1|  hypothetical protein VITISV_005140                     107   8e-25   Vitis vinifera
gb|AHA62773.1|  papain-like cysteine protease                           107   9e-25   
gb|AHA62774.1|  papain-like cysteine protease                           107   9e-25   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         107   9e-25   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840          107   1e-24   Sorghum bicolor [broomcorn]
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             107   1e-24   
ref|XP_006362435.1|  PREDICTED: fruit bromelain-like                    107   1e-24   
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830          107   1e-24   Sorghum bicolor [broomcorn]
ref|XP_006432594.1|  hypothetical protein CICLE_v10001719mg             107   1e-24   
ref|XP_006432617.1|  hypothetical protein CICLE_v10001723mg             107   1e-24   
ref|XP_006432601.1|  hypothetical protein CICLE_v10001718mg             107   1e-24   
ref|XP_006490014.1|  PREDICTED: xylem cysteine proteinase 1-like        107   1e-24   
ref|XP_002522559.1|  cysteine protease, putative                        107   1e-24   Ricinus communis
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        106   1e-24   
ref|XP_002523447.1|  cysteine protease, putative                        106   2e-24   Ricinus communis
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    106   2e-24   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    106   2e-24   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    106   2e-24   Vitis vinifera
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    106   2e-24   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             106   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006471123.1|  PREDICTED: xylem cysteine proteinase 1-like        103   3e-24   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...    105   3e-24   Vitis vinifera
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                        105   3e-24   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                    105   3e-24   
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410          105   3e-24   Sorghum bicolor [broomcorn]
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        105   4e-24   
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    105   4e-24   
ref|XP_006362436.1|  PREDICTED: vignain-like                            105   5e-24   
ref|XP_002522560.1|  cysteine protease, putative                        102   5e-24   Ricinus communis
dbj|BAF56427.1|  cysteine proteinase                                    105   6e-24   Lotus japonicus
ref|XP_004232961.1|  PREDICTED: zingipain-2-like                        105   6e-24   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                105   6e-24   
emb|CDP18645.1|  unnamed protein product                                105   6e-24   
ref|XP_002525123.1|  cysteine protease, putative                        105   7e-24   Ricinus communis
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             104   7e-24   
ref|XP_009606934.1|  PREDICTED: zingipain-2                             104   7e-24   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        104   8e-24   
ref|XP_006421532.1|  hypothetical protein CICLE_v10005342mg             104   9e-24   
emb|CAE03344.2|  OSJNBb0005B05.11                                       104   9e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006421530.1|  hypothetical protein CICLE_v10005334mg             104   9e-24   
ref|XP_006421528.1|  hypothetical protein CICLE_v10006884mg             104   1e-23   
ref|NP_001052232.2|  Os04g0203500                                       104   1e-23   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66275.1|  OSIGBa0147O06.5                                        104   1e-23   Oryza sativa [red rice]
ref|NP_001275606.1|  fruit bromelain-like precursor                     104   1e-23   
gb|AFV30165.1|  cysteine proteinase                                     104   1e-23   
gb|AAR92154.1|  putative cysteine protease 1                            103   1e-23   Iris x hollandica [Dutch iris]
ref|XP_006362434.1|  PREDICTED: fruit bromelain-like                    104   1e-23   
gb|EMT04560.1|  Vignain                                                 102   1e-23   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             103   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             103   2e-23   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g             103   2e-23   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    103   2e-23   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...    103   2e-23   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                103   2e-23   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             103   2e-23   
ref|XP_010059083.1|  PREDICTED: zingipain-2-like                        103   2e-23   
ref|XP_003539770.1|  PREDICTED: vignain-like                            103   2e-23   
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                   103   2e-23   
ref|XP_006467666.1|  PREDICTED: vignain-like                            103   2e-23   
gb|KCW74260.1|  hypothetical protein EUGRSUZ_E02907                     103   2e-23   
ref|XP_004975182.1|  PREDICTED: vignain-like                            103   3e-23   
ref|XP_004975183.1|  PREDICTED: vignain-like                            103   3e-23   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    103   3e-23   
ref|XP_006652104.1|  PREDICTED: vignain-like                            102   3e-23   
ref|XP_009775922.1|  PREDICTED: zingipain-2                             102   3e-23   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...    102   3e-23   Oryza sativa Indica Group [Indian rice]
gb|AHA62772.1|  papain-like cysteine protease                           102   4e-23   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...    102   4e-23   
ref|XP_011009181.1|  PREDICTED: senescence-specific cysteine prot...    102   4e-23   
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...    102   4e-23   
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...    102   4e-23   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        102   4e-23   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g             102   4e-23   
gb|AHA62776.1|  papain-like cysteine protease                           102   4e-23   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             102   4e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006362429.1|  PREDICTED: fruit bromelain-like                    102   4e-23   
gb|AHA62778.1|  RCR3-like cysteine protease                             102   4e-23   
ref|XP_003612210.1|  Cysteine proteinase                                102   5e-23   
ref|XP_009793843.1|  PREDICTED: zingipain-2-like                        102   5e-23   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        102   5e-23   
gb|AAA50755.1|  cysteine proteinase                                     102   5e-23   Alnus glutinosa
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    102   6e-23   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             102   6e-23   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                     102   6e-23   
ref|XP_004506025.1|  PREDICTED: vignain-like                            102   6e-23   
ref|XP_006492717.1|  PREDICTED: xylem cysteine proteinase 1-like        102   7e-23   
ref|XP_010094328.1|  Fruit bromelain                                    102   7e-23   
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg             102   7e-23   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             102   8e-23   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    101   9e-23   
ref|XP_006362428.1|  PREDICTED: vignain-like                            101   1e-22   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                        101   1e-22   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    101   1e-22   
gb|AFP73348.1|  cysteine protease                                       101   1e-22   
gb|AAK27968.1|AF242372_1  cysteine protease                             101   1e-22   Ipomoea batatas [batate]
gb|EEC84514.1|  hypothetical protein OsI_31214                          101   1e-22   Oryza sativa Indica Group [Indian rice]
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                101   1e-22   
ref|XP_002531151.1|  cysteine protease, putative                        101   1e-22   Ricinus communis
ref|XP_002519955.1|  cysteine protease, putative                        101   1e-22   Ricinus communis
dbj|BAF46311.1|  cysteine proteinase precursor                          101   1e-22   Ipomoea nil [qian niu]
ref|XP_008340724.1|  PREDICTED: vignain-like                            101   1e-22   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        101   1e-22   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             100   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009361500.1|  PREDICTED: vignain-like                            100   2e-22   
gb|AGT16936.1|  vignain-like protein                                    100   2e-22   
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    100   2e-22   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         100   2e-22   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        100   2e-22   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        100   2e-22   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        100   3e-22   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...    100   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010091715.1|  hypothetical protein L484_001478                   100   3e-22   
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...    100   3e-22   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             100   3e-22   
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        100   3e-22   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        100   3e-22   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                        100   3e-22   
ref|XP_006470296.1|  PREDICTED: xylem cysteine proteinase 1-like        100   3e-22   
ref|XP_002522571.1|  cysteine protease, putative                        100   3e-22   Ricinus communis
gb|AAL14199.1|  cysteine proteinase precursor                           100   3e-22   Ipomoea batatas [batate]
ref|XP_010045989.1|  PREDICTED: vignain-like                          99.4    4e-22   
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850        99.8    4e-22   Sorghum bicolor [broomcorn]
ref|XP_003539970.1|  PREDICTED: vignain-like                            100   4e-22   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    100   4e-22   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                        100   4e-22   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...  99.8    4e-22   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                             100   4e-22   
gb|EMT20796.1|  Vignain                                                 100   4e-22   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g           99.8    4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg           99.8    4e-22   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3           99.8    4e-22   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg           99.8    5e-22   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg           99.8    5e-22   
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg           99.8    5e-22   
ref|XP_004293931.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  99.8    5e-22   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                      99.4    6e-22   
ref|XP_004290089.1|  PREDICTED: vignain-like                          99.4    6e-22   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    102   6e-22   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                      99.4    6e-22   
ref|XP_003540013.1|  PREDICTED: vignain-like                          99.4    6e-22   
ref|XP_007048796.1|  Senescence-associated gene 12                    99.4    7e-22   
gb|ACU23533.1|  unknown                                               97.4    7e-22   Glycine max [soybeans]
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                      99.0    8e-22   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                  99.8    8e-22   
ref|XP_007048792.1|  Senescence-associated gene 12                    99.0    8e-22   
dbj|BAF56429.1|  cysteine proteinase                                  99.0    9e-22   Lotus japonicus
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...  99.0    1e-21   
ref|XP_006469011.1|  PREDICTED: vignain-like                          99.0    1e-21   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g           98.6    1e-21   
ref|XP_004489011.1|  PREDICTED: vignain-like                          98.6    1e-21   
ref|XP_010042857.1|  PREDICTED: actinidain-like                       95.1    1e-21   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...  98.6    1e-21   
ref|XP_006592467.1|  PREDICTED: vignain-like                          98.6    1e-21   
ref|XP_003539989.1|  PREDICTED: vignain-like                          98.6    1e-21   
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                      98.2    1e-21   
ref|XP_004505498.1|  PREDICTED: vignain-like                          98.2    1e-21   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                      98.2    1e-21   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2           98.2    1e-21   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                      98.2    2e-21   
ref|XP_009798360.1|  PREDICTED: zingipain-2-like                      98.2    2e-21   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1           98.2    2e-21   
ref|XP_006582263.1|  PREDICTED: vignain-like                          98.2    2e-21   
ref|XP_006582264.1|  PREDICTED: vignain-like                          98.2    2e-21   
gb|AFP73357.1|  cysteine protease                                     98.2    2e-21   
gb|AFP73358.1|  cysteine protease                                     98.2    2e-21   
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                      98.2    2e-21   
gb|AAP32195.1|  cysteine protease 5                                   98.2    2e-21   Trifolium repens [creeping white clover]
gb|AFP73326.1|  cysteine protease                                     98.2    2e-21   
ref|XP_009359967.1|  PREDICTED: vignain-like                          98.2    2e-21   
gb|AAP32198.1|  cysteine protease 12                                  98.2    2e-21   Trifolium repens [creeping white clover]
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                      97.8    2e-21   
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...  97.8    2e-21   
gb|KDO37366.1|  hypothetical protein CISIN_1g048025mg                 97.1    2e-21   
ref|XP_006445663.1|  hypothetical protein CICLE_v10015799mg           97.8    2e-21   
gb|KHN08873.1|  Vignain                                               97.8    2e-21   
gb|KDO63024.1|  hypothetical protein CISIN_1g018958mg                 97.4    2e-21   
ref|XP_007214465.1|  hypothetical protein PRUPE_ppa023848mg           97.8    3e-21   
ref|XP_008353751.1|  PREDICTED: actinidain-like                       96.3    3e-21   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g           97.4    3e-21   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                      97.4    3e-21   
gb|KDO63025.1|  hypothetical protein CISIN_1g018958mg                 97.4    3e-21   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                      97.4    3e-21   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                      97.4    3e-21   
ref|XP_003526232.1|  PREDICTED: vignain-like                          97.4    3e-21   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                      97.4    3e-21   
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g           97.4    3e-21   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...  97.4    3e-21   
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...  97.4    3e-21   
ref|XP_009617814.1|  PREDICTED: zingipain-2-like                      97.4    3e-21   
ref|XP_003538185.1|  PREDICTED: vignain-like                          97.4    3e-21   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                      97.1    4e-21   
ref|XP_006592465.1|  PREDICTED: vignain-like                          97.1    4e-21   
dbj|BAF56430.1|  cysteine proteinase                                  97.1    4e-21   Lotus japonicus
gb|EMT14655.1|  hypothetical protein F775_52509                       97.1    4e-21   
gb|AFP73334.1|  cysteine protease                                     97.1    4e-21   
gb|AFP73347.1|  cysteine protease                                     97.1    4e-21   
ref|XP_003557016.1|  PREDICTED: vignain-like                          97.1    4e-21   
ref|XP_010059348.1|  PREDICTED: zingipain-2-like                      97.1    4e-21   
ref|XP_010056876.1|  PREDICTED: zingipain-2-like                      97.1    4e-21   
gb|AFP73318.1|  cysteine protease                                     97.1    4e-21   
gb|AFP73317.1|  cysteine protease                                     97.1    4e-21   
ref|XP_003527350.1|  PREDICTED: vignain-like                          97.1    4e-21   
ref|XP_010040204.1|  PREDICTED: fruit bromelain-like                  96.7    4e-21   
ref|XP_007132882.1|  hypothetical protein PHAVU_011G1328001g          94.0    4e-21   
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...  97.1    5e-21   
gb|AFP73355.1|  cysteine protease                                     97.1    5e-21   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...  97.1    5e-21   
ref|XP_006469012.1|  PREDICTED: vignain-like                          96.7    5e-21   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1               96.7    5e-21   
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...  96.7    5e-21   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like            97.1    5e-21   
gb|KCW45396.1|  hypothetical protein EUGRSUZ_L00916                   96.7    5e-21   
ref|XP_002522572.1|  cysteine protease, putative                      96.7    5e-21   Ricinus communis
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g           96.7    5e-21   
ref|XP_010091714.1|  Fruit bromelain                                  99.0    6e-21   
ref|XP_009594088.1|  PREDICTED: zingipain-2-like                      96.7    6e-21   
ref|XP_002531152.1|  cysteine protease, putative                      96.7    6e-21   Ricinus communis
gb|AAM19208.1|AF493233_1  cysteine protease                           96.7    6e-21   Solanum pennellii
ref|XP_006469128.1|  PREDICTED: vignain-like                          96.7    6e-21   
ref|XP_003596314.1|  Cysteine proteinase                              96.7    6e-21   
gb|AFP73316.1|  cysteine protease                                     96.3    7e-21   
ref|XP_006306520.1|  hypothetical protein CARUB_v10012525mg           96.3    7e-21   
gb|AFP73368.1|  cysteine protease                                     96.3    7e-21   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                      96.3    7e-21   
gb|AFP73352.1|  cysteine protease                                     96.3    7e-21   
gb|AFP73370.1|  cysteine protease                                     96.3    7e-21   
ref|XP_009604790.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  94.4    7e-21   
ref|XP_002446131.1|  hypothetical protein SORBIDRAFT_06g002140        96.3    7e-21   
gb|AFP73363.1|  cysteine protease                                     96.3    7e-21   
gb|AFP73356.1|  cysteine protease                                     96.3    8e-21   
ref|XP_004306851.1|  PREDICTED: vignain-like                          96.3    8e-21   
gb|EMT29822.1|  Vignain                                               95.9    9e-21   
gb|KHN28095.1|  Thiol protease                                        95.9    1e-20   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like            95.9    1e-20   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like            95.9    1e-20   
gb|AFP73349.1|  cysteine protease                                     95.9    1e-20   
emb|CAD40112.2|  OSJNBa0035O13.5                                      95.9    1e-20   
gb|AFP73365.1|  cysteine protease                                     95.9    1e-20   
gb|EAY93078.1|  hypothetical protein OsI_14879                        95.9    1e-20   
gb|AAM19207.1|AF493232_1  cysteine protease                           95.9    1e-20   
gb|AFP73331.1|  cysteine protease                                     95.9    1e-20   
ref|XP_007050065.1|  Senescence-associated gene 12                    95.9    1e-20   
gb|AFP73330.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73329.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73327.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73351.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73364.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73333.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73319.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73315.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73312.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73321.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73362.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73311.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73338.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73323.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73359.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73324.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73360.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73320.1|  cysteine protease                                     95.9    1e-20   
ref|XP_004232967.2|  PREDICTED: zingipain-2                           95.9    1e-20   
gb|AFP73367.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73314.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73340.1|  cysteine protease                                     95.9    1e-20   
gb|AFP73369.1|  cysteine protease                                     95.9    1e-20   
ref|XP_006445658.1|  hypothetical protein CICLE_v10015798mg           95.9    1e-20   
ref|XP_010059344.1|  PREDICTED: zingipain-2-like                      95.5    1e-20   
ref|XP_008391525.1|  PREDICTED: fruit bromelain-like                  92.8    1e-20   
gb|AFP73361.1|  cysteine protease                                     95.5    1e-20   
gb|AFP73335.1|  cysteine protease                                     95.5    1e-20   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg              95.5    1e-20   
ref|XP_011005486.1|  PREDICTED: senescence-specific cysteine prot...  95.1    1e-20   
gb|AFP73342.1|  cysteine protease                                     95.5    1e-20   
ref|XP_003527349.1|  PREDICTED: vignain-like                          95.5    1e-20   
gb|AFP73332.1|  cysteine protease                                     95.5    1e-20   
gb|AFP73322.1|  cysteine protease                                     95.5    1e-20   
gb|AFP73313.1|  cysteine protease                                     95.5    1e-20   
gb|AFP73328.1|  cysteine protease                                     95.5    1e-20   
ref|XP_010521644.1|  PREDICTED: ervatamin-B-like                      95.5    1e-20   
emb|CAL64936.1|  putative cysteine protease 8                         95.5    2e-20   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg           95.1    2e-20   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...  95.1    2e-20   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g           95.1    2e-20   
gb|KCW74661.1|  hypothetical protein EUGRSUZ_E03389                   95.1    2e-20   
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                      95.1    2e-20   
ref|XP_006592475.1|  PREDICTED: vignain-like                          95.1    2e-20   
gb|ADP02216.1|  Peptidase_C1 domain-containing protein                93.2    2e-20   
gb|KHN27797.1|  Thiol protease SEN102                                 95.1    2e-20   
ref|XP_006388354.1|  hypothetical protein POPTR_0213s002201g          90.1    2e-20   
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  95.1    2e-20   
gb|AAP32196.1|  cysteine protease 8                                   95.1    2e-20   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg           95.1    2e-20   
ref|XP_006291447.1|  hypothetical protein CARUB_v10017584mg           94.7    2e-20   
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  94.7    2e-20   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                      94.7    2e-20   
ref|XP_004305438.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  94.7    3e-20   
ref|XP_008354173.1|  PREDICTED: actinidain-like                       93.6    3e-20   
ref|XP_006468205.1|  PREDICTED: actinidain-like                       94.7    3e-20   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like            94.7    3e-20   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...  94.4    3e-20   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g           94.4    3e-20   
gb|KCW74094.1|  hypothetical protein EUGRSUZ_E02741                   93.6    3e-20   
ref|XP_004308225.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  94.7    3e-20   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg           94.4    3e-20   
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170        94.4    3e-20   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                      94.4    4e-20   
ref|XP_006306115.1|  hypothetical protein CARUB_v10011567mg           94.4    4e-20   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                      94.4    4e-20   
gb|AFK36701.1|  unknown                                               94.4    4e-20   
ref|XP_010059331.1|  PREDICTED: zingipain-2-like                      94.4    4e-20   
ref|XP_010061449.1|  PREDICTED: zingipain-1-like                      94.0    4e-20   
dbj|BAD29955.1|  cysteine protease                                    94.4    4e-20   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg           94.0    4e-20   
gb|ADP02217.1|  Peptidase_C1 domain-containing protein                94.0    4e-20   
ref|XP_003556992.1|  PREDICTED: vignain-like                          94.0    5e-20   
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                      94.0    5e-20   
ref|XP_010557424.1|  PREDICTED: ervatamin-B-like                      94.0    5e-20   
gb|EMT08019.1|  Vignain                                               93.6    5e-20   
ref|XP_007048674.1|  Senescence-associated gene 12                    94.0    6e-20   
ref|XP_010091035.1|  KDEL-tailed cysteine endopeptidase CEP1          94.0    6e-20   
ref|XP_003527388.1|  PREDICTED: vignain-like                          94.0    6e-20   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                      94.0    6e-20   
ref|XP_007132868.1|  hypothetical protein PHAVU_011G1314000g          93.2    6e-20   
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g           93.6    6e-20   
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg           93.6    6e-20   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                       93.6    6e-20   
ref|XP_008225326.1|  PREDICTED: actinidain-like                       93.6    6e-20   
ref|XP_010509794.1|  PREDICTED: ervatamin-B-like                      93.6    6e-20   
gb|KHN12137.1|  Thiol protease                                        93.6    7e-20   
ref|XP_006291440.1|  hypothetical protein CARUB_v10017575mg           93.6    7e-20   
gb|KCW76121.1|  hypothetical protein EUGRSUZ_D00498                   92.8    7e-20   
ref|XP_004505461.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  93.6    7e-20   
ref|XP_009366072.1|  PREDICTED: zingipain-2-like                      93.6    7e-20   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like            93.6    7e-20   
ref|XP_007148057.1|  hypothetical protein PHAVU_006G1768000g          90.1    7e-20   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                 93.2    7e-20   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...  93.6    8e-20   
ref|XP_003607571.1|  Cysteine proteinase EP-B                         93.6    8e-20   
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g           93.2    8e-20   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g           93.2    8e-20   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like            93.2    8e-20   
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like            93.2    8e-20   
ref|XP_010469398.1|  PREDICTED: ervatamin-B-like                      93.2    9e-20   
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                      93.2    1e-19   
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                      93.2    1e-19   
dbj|BAF56428.1|  cysteine proteinase                                  93.2    1e-19   
emb|CAH66233.1|  H0825G02.10                                          93.2    1e-19   
ref|XP_003526217.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  93.2    1e-19   
ref|XP_010426443.1|  PREDICTED: ervatamin-B                           93.2    1e-19   
ref|XP_003527330.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  93.2    1e-19   
ref|XP_002513120.1|  cysteine protease, putative                      93.2    1e-19   
ref|XP_003527331.1|  PREDICTED: vignain-like                          92.8    1e-19   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g           92.8    1e-19   
ref|XP_009352792.1|  PREDICTED: zingipain-1-like                      92.8    1e-19   
ref|XP_010040202.1|  PREDICTED: zingipain-2-like                      92.8    1e-19   
ref|XP_010413778.1|  PREDICTED: ervatamin-B-like                      92.8    1e-19   
gb|EMT15489.1|  Thiol protease SEN102                                 92.8    1e-19   
gb|AFP73325.1|  cysteine protease                                     92.8    1e-19   
gb|KCW74081.1|  hypothetical protein EUGRSUZ_E02719                   89.7    1e-19   
gb|KHN33932.1|  KDEL-tailed cysteine endopeptidase CEP1               92.8    1e-19   
ref|XP_008340275.1|  PREDICTED: fruit bromelain-like                  95.1    1e-19   
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                      92.8    1e-19   
ref|XP_008246197.1|  PREDICTED: vignain-like                          92.4    1e-19   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                      92.8    1e-19   
ref|XP_010040203.1|  PREDICTED: ervatamin-B-like                      92.8    1e-19   
ref|XP_007025413.1|  Maternal effect embryo arrest 18                 95.5    1e-19   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g           92.4    1e-19   
ref|XP_010499431.1|  PREDICTED: zingipain-2-like                      92.8    2e-19   
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                92.4    2e-19   
dbj|BAC06931.1|  putative cysteine proteinase                         92.8    2e-19   
ref|XP_010059021.1|  PREDICTED: xylem cysteine proteinase 1-like      91.7    2e-19   
ref|XP_009349242.1|  PREDICTED: vignain-like                          94.0    2e-19   
ref|XP_008228922.1|  PREDICTED: vignain-like                          92.4    2e-19   
ref|XP_009352952.1|  PREDICTED: fruit bromelain-like                  92.4    2e-19   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                      92.4    2e-19   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g           92.4    2e-19   
gb|KCW76125.1|  hypothetical protein EUGRSUZ_D00501                   93.2    2e-19   
ref|XP_010523123.1|  PREDICTED: ervatamin-B-like                      92.4    2e-19   
gb|KHN32069.1|  Vignain                                               92.4    2e-19   
gb|KHN08187.1|  Thiol protease SEN102                                 92.0    2e-19   
gb|KHN13721.1|  Vignain                                               92.0    2e-19   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                   92.4    2e-19   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                      92.4    2e-19   
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g           92.0    2e-19   
ref|XP_002881320.1|  hypothetical protein ARALYDRAFT_321132           92.0    2e-19   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                      92.0    2e-19   
gb|KDP40484.1|  hypothetical protein JCGZ_24483                       92.0    2e-19   
gb|KCW84692.1|  hypothetical protein EUGRSUZ_B01511                   88.6    2e-19   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                      92.0    2e-19   
ref|NP_565780.1|  cysteine proteinase-like protein                    92.0    2e-19   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  92.0    2e-19   
dbj|BAF00646.1|  putative cysteine proteinase                         92.0    3e-19   
ref|XP_008364019.1|  PREDICTED: zingipain-2-like                      92.0    3e-19   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                      92.0    3e-19   
ref|XP_002466439.1|  hypothetical protein SORBIDRAFT_01g007820        92.0    3e-19   
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                      92.0    3e-19   
ref|XP_006291442.1|  hypothetical protein CARUB_v10017578mg           91.7    3e-19   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                      91.7    3e-19   
ref|XP_009352948.1|  PREDICTED: ervatamin-B-like                      92.0    3e-19   
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                      91.7    3e-19   
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160        91.7    3e-19   
ref|XP_009352793.1|  PREDICTED: zingipain-2-like                      91.7    3e-19   
gb|KHN27806.1|  Vignain                                               91.3    3e-19   
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150        91.7    3e-19   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g           91.3    4e-19   
ref|XP_010499428.1|  PREDICTED: ervatamin-B-like                      91.3    4e-19   
ref|XP_009352795.1|  PREDICTED: ervatamin-B-like                      91.3    4e-19   
gb|EMT08022.1|  Vignain                                               91.3    4e-19   
gb|ADP02219.1|  Peptidase_C1 domain-containing protein                92.0    4e-19   
ref|XP_008228971.1|  PREDICTED: zingipain-2-like                      91.3    5e-19   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g           91.3    5e-19   
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                      91.3    5e-19   
ref|XP_003599735.1|  Cysteine proteinase                              91.3    5e-19   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                      91.3    5e-19   
gb|EEC81394.1|  hypothetical protein OsI_24614                        91.3    5e-19   
ref|XP_007021896.1|  Cysteine proteinases superfamily protein, pu...  90.9    5e-19   
ref|XP_011047550.1|  PREDICTED: senescence-specific cysteine prot...  89.4    5e-19   
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                      90.9    5e-19   
ref|XP_010057075.1|  PREDICTED: ervatamin-B-like                      90.9    5e-19   
gb|KCW45401.1|  hypothetical protein EUGRSUZ_L00921                   90.9    5e-19   
gb|ABF70145.1|  cysteine protease, putative                           91.3    5e-19   
gb|ADY68475.1|  stem bromelain                                        90.9    5e-19   
gb|EEE66441.1|  hypothetical protein OsJ_22818                        90.9    6e-19   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                      90.9    6e-19   
ref|XP_010040207.1|  PREDICTED: ervatamin-B-like                      90.9    6e-19   
gb|KDP21086.1|  hypothetical protein JCGZ_21557                       88.6    6e-19   
gb|AFW80235.1|  hypothetical protein ZEAMMB73_542371                  90.5    6e-19   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                      90.9    6e-19   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1          90.9    6e-19   
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                      90.9    6e-19   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                      90.9    6e-19   
ref|XP_007132871.1|  hypothetical protein PHAVU_011G131700g           90.5    7e-19   
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                      90.9    7e-19   
gb|KHN33935.1|  KDEL-tailed cysteine endopeptidase CEP1               90.5    7e-19   
dbj|BAA21848.1|  bromelain                                            90.9    7e-19   
emb|CAA08860.1|  cysteine proteinase precursor, AN8                   90.9    7e-19   
ref|XP_010059000.1|  PREDICTED: ervatamin-C-like                      90.5    7e-19   
ref|XP_006280797.1|  hypothetical protein CARUB_v10026767mg           90.5    7e-19   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934  93.2    8e-19   
ref|XP_009352794.1|  PREDICTED: fruit bromelain                       87.4    8e-19   



>emb|CDP20741.1| unnamed protein product, partial [Coffea canephora]
Length=165

 Score =   123 bits (309),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 3/98 (3%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA  F ++L L AVL+L   ASQAT+  L+E P M E+HE+WM  HGR YK+DAEKA R+
Sbjct  1    MALRFSWKLSLTAVLMLAMMASQATSRSLNEAP-MTEKHEQWMAQHGRVYKDDAEKADRY  59

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            K F++NV FI SFNKAGN+ YKL +N+F+DLTNEEF+A
Sbjct  60   KTFKENVNFIASFNKAGNRPYKLDINQFADLTNEEFRA  97



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA + +++LI A +L+L  +  QATA    + SM+ERHE+WM  HGR+YK+D EKAKRFK
Sbjct  1    MALSTNWRLIFAVLLVLEMWTYQATARSLPDASMIERHEEWMAQHGRAYKDDVEKAKRFK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF++NV++I+SFN+AG + YKL VNKF+DLTNEEF+A+
Sbjct  61   IFKENVEYIQSFNEAGTRPYKLAVNKFADLTNEEFQAS  98



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +1

Query  64   LSSMASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAK  240
            ++S+  N+ F  ILA VL+L  +ASQATA      SM+ERHE+WMV +GR+YKNDAEKAK
Sbjct  1    MASITPNWRF--ILAVVLVLQMWASQATARTLPNASMVERHEQWMVQYGRTYKNDAEKAK  58

Query  241  RFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            R+ IF+ NV++I+S N+A  ++YKL +NKF+DLTNEEF+A+
Sbjct  59   RYNIFKDNVEYIQSVNEAETRTYKLAINKFADLTNEEFQAS  99



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +1

Query  85   FDFQLILAAVLLLGAFASQATALD--EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE  258
            F++ L  AA+L+L +FASQAT+ D  E  SM+++HE+WM H GR YK+D EKAKRFKIF+
Sbjct  6    FNWNLAFAALLVLVSFASQATSRDLYEAASMVQKHEQWMSHFGRVYKDDVEKAKRFKIFQ  65

Query  259  QNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
             NV++IE  NKAG + YKLG+N+F+DL+NEEF+ T
Sbjct  66   HNVEYIEFVNKAGTRPYKLGINEFADLSNEEFRDT  100



>ref|XP_009774375.1| PREDICTED: fruit bromelain-like, partial [Nicotiana sylvestris]
Length=201

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +1

Query  76   ASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKI  252
            ++  +++L   A+L+LG +ASQ T+ D  E SM+++HE WM   GR Y++DAEKAKR KI
Sbjct  56   STRXNWKLAFVALLVLGMWASQTTSRDLNEASMVQKHEYWMARFGRVYRDDAEKAKRLKI  115

Query  253  FEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            F+ NV +IES NKAG + YKLG+N+F+DLTNEEF+AT
Sbjct  116  FKDNVDYIESVNKAGIRPYKLGINEFADLTNEEFRAT  152


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKR  243
            MA   +++L   A+L+LG +ASQ T+ D  E SM+++HE WM   GR Y++DAEK+ R
Sbjct  1    MALISNWKLAFVALLVLGMWASQTTSRDLNEASMVQKHEYWMARFGRVYRDDAEKSTR  58



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 2/103 (2%)
 Frame = +1

Query  61   ILSSMASNFDFQ-LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEK  234
             L +  +N  F+  ++AA++LLGA+A QAT+    E SM ERHE+WM+ +GR YK++AEK
Sbjct  15   CLCTSTTNMAFKHFMIAALILLGAWACQATSRTLPEASMFERHEQWMIQYGRVYKDEAEK  74

Query  235  AKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            + RF+IF  NVKFIE FNK G QSYKL VN+F+D TNEEF+A+
Sbjct  75   SVRFQIFMDNVKFIEEFNKDGRQSYKLAVNEFADQTNEEFQAS  117



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +1

Query  64   LSSMASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAK  240
            ++S+  N+ F  ILAAVL+L  + SQATA    + S++ERHE+WMV +GR+YKNDAEKAK
Sbjct  5    IASITPNWRF--ILAAVLVLQMWVSQATARTLPDASIVERHEQWMVQYGRTYKNDAEKAK  62

Query  241  RFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            RF IF+ NV++I+S N+   ++YKL +NKF+DLTNEEF+A+
Sbjct  63   RFNIFKDNVEYIQSVNETETRAYKLAINKFADLTNEEFQAS  103



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MAS    +LI  A L+L   ASQA   +  E SM+E+HE+WM  +GR YKN+AEK  R+K
Sbjct  1    MASIATSKLIFTAFLMLTVLASQAVCRNLNEASMIEKHEQWMAQNGRVYKNEAEKGNRYK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            IF++NV+FIESFNKAG +SYKLG+N+F+DLTN EF+A
Sbjct  61   IFKENVEFIESFNKAGTKSYKLGINQFADLTNVEFRA  97



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA   +++L   A+L+LG +ASQ T+ D  E SM+++HE WM   GR Y++DAEKAKR K
Sbjct  1    MALICNWKLAFVALLVLGMWASQTTSRDLNEASMVQKHEYWMARFGRVYRDDAEKAKRLK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ NV +IES NKAG + YKLG+N+F+DLTNEEF+AT
Sbjct  61   IFKNNVDYIESVNKAGIRPYKLGINEFADLTNEEFRAT  98



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA  F+++L   A+L+LG  ASQAT+    E SM+++HE+WM H GR YK+D EKAKRF 
Sbjct  1    MAITFNWKLAFVALLVLGMQASQATSRGLYETSMVQKHEQWMTHFGRVYKDDVEKAKRFN  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ N K+I S NKAG + YKL +N+F+DLTNEEF+AT
Sbjct  61   IFKDNTKYINSVNKAGIKPYKLDINEFADLTNEEFRAT  98



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA   +++L+ AA+L+L  + SQATA    + +M+E+HE+WM   GR YK+DAEK+KRF+
Sbjct  1    MALTPNWKLVFAALLVLEMWGSQATARTLPDAAMIEKHEQWMAQFGRVYKDDAEKSKRFR  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF++NV++IESFN+AG + Y L +NKF+DLTNEEF+A+
Sbjct  61   IFKENVEYIESFNEAGARPYTLAINKFADLTNEEFQAS  98



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA  F+++L  AA+L+LG  AS+A++    E SM+++H +WM   GR+YK+DAEKAKR K
Sbjct  1    MALTFNWKLAFAALLVLGMHASRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF++N ++I+S NKAG + YKLG+N F+DLTNEEF+AT
Sbjct  61   IFKENAEYIDSVNKAGIRPYKLGINDFADLTNEEFRAT  98



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   115 bits (288),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQL-ILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA  FD++L  +AA+L+ G    QAT+    E SM+++HE+WM   GR YKND EKAKRF
Sbjct  1    MAMTFDWKLAFVAALLVFGMQDFQATSRGLYETSMVQKHEQWMTRFGRVYKNDVEKAKRF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF+ N+ +I+SFNKAG +SYKL +N+F+DLTN+EF+AT
Sbjct  61   KIFKDNIDYIDSFNKAGTKSYKLDINEFADLTNDEFRAT  99



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA   D + IL A ++LG +ASQA A +  E SM ERHE+WM  HGR YK D EK +RF 
Sbjct  1    MALFVDRKFILVAAMVLGLYASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFM  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ NV+FIESFN+   + YKLG+N F+DLTN+EFKAT
Sbjct  61   IFKNNVEFIESFNENNTRPYKLGINGFADLTNDEFKAT  98



>ref|XP_009616844.1| PREDICTED: zingipain-1-like [Nicotiana tomentosiformis]
Length=341

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA  F    ++A +L++G F  QAT+ D +  SMLERHEKWM +HGR YK+D EKAKRF 
Sbjct  1    MALKFCRLSLVAILLVVGIFGFQATSRDLQVYSMLERHEKWMSNHGRVYKDDVEKAKRFN  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATM  366
            IF++NV FI+SFN     SY+LG+NKF+DLTNEEF++ +
Sbjct  61   IFKENVDFIDSFNNDATHSYQLGLNKFADLTNEEFQSMV  99



>ref|XP_006367780.1| PREDICTED: ananain-like [Solanum tuberosum]
Length=348

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +1

Query  115  LLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN  288
            ++ G +ASQ T   L +  SMLE+HE WM  HGR+Y+ND EKAKR  IF++NVKFIESFN
Sbjct  16   VIFGMYASQVTCRNLQDPSSMLEKHESWMARHGRAYENDIEKAKRLNIFKKNVKFIESFN  75

Query  289  KAGNQSYKLGVNKFSDLTNEEF  354
              G++SYKLG+NKFSDLT+EEF
Sbjct  76   NNGSRSYKLGINKFSDLTSEEF  97



>ref|XP_004234254.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=346

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +1

Query  115  LLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKA  294
            +++G +ASQ T   +  SM+E+HE WM  HGR+YKND EKAKR  IF +NVKFIESFN  
Sbjct  16   MIVGMYASQVTCSQDSTSMVEKHESWMARHGRTYKNDIEKAKRLNIFTKNVKFIESFNNN  75

Query  295  GNQSYKLGVNKFSDLTNEEF  354
             ++SYKLG+NKF+DLT+EEF
Sbjct  76   DSKSYKLGINKFTDLTSEEF  95



>emb|CBI21973.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   +Q I  A+L +L A+ASQATA +  E SM ERHE WMV +GR YK+  EK+KR+
Sbjct  1    MASVNQYQYICLALLFVLAAWASQATARNLHEASMYERHEDWMVQYGREYKDADEKSKRY  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF+ NV  IESFNKA ++SYKL +N+F+DLTNEEF+A+
Sbjct  61   KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRAS  99



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA  F+++L   A+L+L   ASQAT+    E SM+++H++WM   GR YK+D EKAKRFK
Sbjct  1    MAMTFNWKLAFIALLVLVMQASQATSRGLYETSMVQKHDQWMTRFGRVYKDDVEKAKRFK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ N ++I+SFNKAG + YKL +N+F+DLTNEEF+AT
Sbjct  61   IFKDNTEYIDSFNKAGTKPYKLDINEFADLTNEEFRAT  98



>emb|CBI21972.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   +Q I  A+L +L A+ASQATA    E SM ERHE WMV +GR YK+  EK+KR+
Sbjct  1    MASVNQYQYICLALLFVLAAWASQATARSLHEASMYERHEDWMVQYGREYKDADEKSKRY  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF+ NV  IESFNKA ++SYKL +N+F+DLTNEEF+A+
Sbjct  61   KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRAS  99



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   +Q I  A+L +L A+ASQATA +  E SM ERHE WMV +GR YK+  EK+KR+
Sbjct  1    MASVNQYQYICLALLFVLAAWASQATARNLHEASMYERHEDWMVQYGREYKDADEKSKRY  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF+ NV  IESFNKA ++SYKL +N+F+DLTNEEF+A+
Sbjct  61   KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRAS  99



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA   ++ L LAA+++L  + SQATA    + SM+E+HE+W+   GR YK+DAEKAKRF 
Sbjct  1    MALRPNWILFLAALVVLEIWGSQATARTLPDASMVEKHEQWIAQFGRVYKDDAEKAKRFN  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF++NV++I+SFN+AG + YKL +NKF+DLTNEEF+A+
Sbjct  61   IFKENVEYIQSFNEAGARPYKLAINKFADLTNEEFQAS  98



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   +Q I  A+L +L A+ASQATA    E SM ERHE WMV +GR YK+  EK+KR+
Sbjct  1    MASVNQYQYICLALLFVLAAWASQATARSLHEASMYERHEDWMVQYGREYKDADEKSKRY  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF+ NV  IESFNKA ++SYKL +N+F+DLTNEEF+A+
Sbjct  61   KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRAS  99



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   +Q I  A+L +L A+ASQATA    E SM ERHE WMV +GR YK+  EK+KR+
Sbjct  1    MASVNQYQYICLALLFVLAAWASQATARXLHEASMYERHEDWMVQYGREYKDADEKSKRY  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF+ NV  IESFNKA ++SYKL +N+F+DLTNEEF+A+
Sbjct  61   KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRAS  99



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA  F+++L   A+L+LG  ASQAT+    E S++++HE+WM   GR YK+D EKAKRFK
Sbjct  1    MAMTFNWKLAFVALLVLGMQASQATSRGLYETSIVKKHEQWMARFGRVYKDDVEKAKRFK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ N ++I+S N AG + YKL VN+FSDLTNEEF+AT
Sbjct  61   IFKDNTEYIDSVNMAGIKPYKLDVNEFSDLTNEEFRAT  98



>emb|CDP18639.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA  F+  L+ AA LLL   ASQATA    E S+ E+HE+WMV HGR YK++AEKAKRFK
Sbjct  1    MAWTFNSMLVTAAFLLLAMLASQATARSLYEASLTEKHEQWMVEHGRVYKDEAEKAKRFK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEF  354
            IF++ V++IE+FNKAGN+SY LG+N+F+DLTNEEF
Sbjct  61   IFKETVEYIEAFNKAGNKSYVLGINRFADLTNEEF  95



>emb|CDP18638.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA  F+  L+ AA LLL   ASQATA    E S+ E+HE+WMV HGR YK++AEKAKRFK
Sbjct  1    MAWTFNSMLVTAAFLLLAMLASQATARSLYEASLTEKHEQWMVEHGRVYKDEAEKAKRFK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEF  354
            IF++ V++IE+FNKAGN+SY LG+N+F+DLTNEEF
Sbjct  61   IFKETVEYIEAFNKAGNKSYVLGINRFADLTNEEF  95



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN  288
            VL+L A AS ATA    E +M ERHE+WMV HGR YK  AEK +RF+IF+ NV+FIESFN
Sbjct  15   VLVLCACASHATARTLTEMTMAERHEQWMVRHGRVYKESAEKERRFQIFKANVEFIESFN  74

Query  289  KAGNQSYKLGVNKFSDLTNEEFKA  360
             AGN  YKLGVN+F+DLTNEEFKA
Sbjct  75   -AGNSKYKLGVNQFADLTNEEFKA  97



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA   + +    A+L+LG +A++AT+ D  E SM+++HEKWM H GR Y++D EKAKRF 
Sbjct  1    MALTINCKSAFLALLVLGMWANEATSRDLNEASMVQKHEKWMAHFGRVYRDDTEKAKRFN  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ N  +IES NKAG + YKL +N F+DLTNEEF+AT
Sbjct  61   IFKDNFDYIESINKAGMRPYKLRINGFADLTNEEFRAT  98



>ref|XP_004975180.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  ATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGV  321
            A  L ++ +M+ RHE+WM  HGR YK+DAEKA+RF++F+ NVKFIE+FN AGN+ + LGV
Sbjct  24   ARELSDDSAMVARHEQWMAQHGRLYKDDAEKARRFEVFKTNVKFIETFNAAGNRKFWLGV  83

Query  322  NKFSDLTNEEFKATMLNEG  378
            N+F+DLTN+EF+AT  N+G
Sbjct  84   NQFADLTNDEFRATKTNKG  102



>ref|XP_004974538.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKI  252
            MAS   F L +     L + A  A AL ++ +M+ RHE+WM  + R YK+ AEKA+RF++
Sbjct  1    MASPKAFLLAILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEV  60

Query  253  FEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            F+ NVKFIESFN AGN+ + LGVN+F+DLTN+EF+AT  N+G
Sbjct  61   FKANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKG  102



>emb|CBI21975.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVLL-LGAFASQATALDE-EPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   +Q I  A+L  L A+ASQATA +  E SM ERHE WM  +GR YK+  EK+KR+
Sbjct  1    MASVNQYQYICLALLFFLAAWASQATARNLLEASMYERHEDWMAQYGRVYKDADEKSKRY  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF+ NV  IESFNKA ++SYKL +N+F+DLTNEEF+A+
Sbjct  61   KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRAS  99



>ref|NP_001233949.1| phytophthora-inhibited protease 1 [Solanum lycopersicum]
 gb|ABG23376.1| phytophthora-inhibited protease 1 [Solanum lycopersicum]
Length=345

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 72/104 (69%), Gaps = 6/104 (6%)
 Frame = +1

Query  73   MASNFDFQ-----LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKA  237
            MASNF  +     L+L ++L L  F   +  L +E SMLERHE WMVHHGR YK+D EK 
Sbjct  1    MASNFFLKNITVVLLLFSILSLYPFIVTSRNL-KELSMLERHENWMVHHGRVYKDDIEKE  59

Query  238  KRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATML  369
             RFK F++NV+FIESFNK G Q YKL VNK++DLT EEF  + +
Sbjct  60   HRFKTFKENVEFIESFNKNGTQRYKLAVNKYADLTTEEFTTSFM  103



>ref|NP_001066557.2| Os12g0273800 [Oryza sativa Japonica Group]
 dbj|BAF29576.2| Os12g0273800 [Oryza sativa Japonica Group]
Length=210

 Score =   108 bits (269),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 5/96 (5%)
 Frame = +1

Query  100  ILAAVLLL-----GAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            IL  ++ L     GA  + A  L  + +M  RHE+WM  HGR YK+ AEKA+R ++F+ N
Sbjct  12   ILCCIVCLYSSSGGAIVAAARELGGDAAMAARHERWMAQHGRVYKDAAEKARRLEVFKAN  71

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLN  372
            V FIESFN  G   Y LGVN+F+DLT+EEFKATM N
Sbjct  72   VAFIESFNAGGKNRYWLGVNQFADLTSEEFKATMTN  107



>ref|XP_004974540.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%), Gaps = 2/98 (2%)
 Frame = +1

Query  85   FDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            F   ++  A L  GA A  A AL ++ +M+ RHE+WM  + R YK+ AEKA+RF++F  N
Sbjct  7    FLLAILGCAFLFSGALA--ARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFNAN  64

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            VKFIESFN AGN+ + LGVN+F+DLTN+EF+AT  N+G
Sbjct  65   VKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKG  102



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 72/92 (78%), Gaps = 3/92 (3%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV  267
            ++++    LLG  A Q  A  L++E +M+ER+E+WM  HGR YK+ AEK +RFKIF+ NV
Sbjct  2    KVVIGFFFLLGLLAIQGAARNLNDE-AMVERYEQWMSLHGRVYKDSAEKERRFKIFKDNV  60

Query  268  KFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +FIESFN+AGN+ YKLG+N+F+DLTNEEF A+
Sbjct  61   EFIESFNRAGNRPYKLGINQFADLTNEEFVAS  92



>gb|AFW76903.1| hypothetical protein ZEAMMB73_202256 [Zea mays]
Length=151

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 77/121 (64%), Gaps = 3/121 (2%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            Q  + AVL    F   A A   L+E+ +M+ RHE+WM  + R YK+ AEKA+RF++F+ N
Sbjct  5    QASILAVLSFAFFCGAALAARDLNEDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKAN  64

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEGkapprprpskpasllNESLAEV  444
            VKFIESFN  GN+ + LG+N+F+DLTN+EF+ T  N+G  P   + S      N S+  +
Sbjct  65   VKFIESFNTGGNRKFWLGINQFADLTNDEFRTTKTNKGFKPSLDKVSTGFRYENVSVDAI  124

Query  445  P  447
            P
Sbjct  125  P  125



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQAT--ALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKR  243
            MA       I  ++L+LG +A+ A   AL E+  SM ERHE+WM  +GR+YK+D+EK KR
Sbjct  1    MALTLQKTSIFVSLLVLGMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKR  60

Query  244  FKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            F+IF+ NV++IES NKAGN+ YKLG+N+F+D TNEEF+A+
Sbjct  61   FQIFKSNVEYIESVNKAGNKPYKLGINEFADQTNEEFRAS  100



>ref|XP_004973089.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKI  252
            MAS   F L +     L + A  A  L ++ +M+ RHE+WM  + R YK+ AEKA+RF++
Sbjct  1    MASPKAFLLAILGCAFLFSGALAARTLSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEV  60

Query  253  FEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            F+ NVKFIESFN AGN+ + LGVN+F+DLTN+EF+AT  N+G
Sbjct  61   FKANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKG  102



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQAT--ALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKR  243
            MA       I  ++L+LG +A+ A   AL E+  SM ERHE+WM  +GR+YK+D+EK KR
Sbjct  1    MALTLQKTSIFVSLLVLGMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKR  60

Query  244  FKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            F+IF+ NV++IES NKAGN+ YKLG+N+F+D TNEEF+A+
Sbjct  61   FQIFKSNVEYIESVNKAGNKPYKLGINEFADQTNEEFRAS  100



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVLL-LGAFASQATALDE-EPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   +Q I  A+L  L A+ASQATA +  E SM ERHE WM  +GR YK+  EK+KR+
Sbjct  1    MASVNQYQYICLALLFFLAAWASQATARNLLEASMYERHEDWMAQYGRVYKDADEKSKRY  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF+ NV  IESFNKA ++SYKL +N+F+DLTNEEF+A+
Sbjct  61   KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRAS  99



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MAS    +L+L  V +LG +ASQA + +  E +M ERH++WM  HGR Y++DAEK +RF 
Sbjct  1    MASPLVGKLVLVMVAVLGLWASQARSRELHEATMRERHDQWMARHGRVYQDDAEKERRFS  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ NV  +ESFNK GN+ Y L +N F+DLT EEFKA+
Sbjct  61   IFKNNVDLVESFNKNGNKPYTLAINAFADLTIEEFKAS  98



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA+  + +L+  A+L++G + SQA +    + +M ERHE WMV +GR YK+++EK +RF+
Sbjct  1    MATISERKLMFVALLVVGLWVSQAWSRSLHDAAMNERHEMWMVKYGRVYKDNSEKERRFE  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF  NV+FIESFNK GN+ YKL +N+F+DLTNEEFKA+
Sbjct  61   IFRNNVEFIESFNKPGNRPYKLDINEFADLTNEEFKAS  98



>ref|XP_004301219.1| PREDICTED: fruit bromelain-like [Fragaria vesca subsp. vesca]
Length=152

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 69/92 (75%), Gaps = 4/92 (4%)
 Frame = +1

Query  97   LILAAVLLLGAFASQA---TALDEEPS-MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            ++L  +L+ G +ASQA   T  D + + M++RH++WM  HGR+YK+ AEK KRFKIF+ N
Sbjct  10   ILLQVLLIFGIWASQAYCRTFPDADVNVMVKRHDQWMASHGRAYKDHAEKKKRFKIFKDN  69

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            VKFIESFN  GNQ Y L +N+F+DLTNEEF A
Sbjct  70   VKFIESFNIGGNQPYSLRINEFADLTNEEFLA  101



>ref|XP_009797968.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=340

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA  F+++L  AA+L+LG  AS+A++    E SM+++HE+WM    R YK+DAEK KR K
Sbjct  1    MALTFNWKLAFAALLVLGMQASRASSRGFYEGSMVQKHEQWMDRFRRVYKDDAEKEKRLK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF++N ++I+S NKAG + YKLG+N+F+DLTNEEF+AT
Sbjct  61   IFKENAEYIDSVNKAGIRPYKLGINEFADLTNEEFRAT  98



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +1

Query  109  AVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            +VLLL A AS ATA    E +M ERHE+WM   GR+Y++ AEK +R++IF+ NV+ IESF
Sbjct  14   SVLLLCACASHATARTLSEMTMAERHEQWMAQQGRAYRDSAEKERRYQIFKANVELIESF  73

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKATM  366
            N AGN  YKLGVN+F+DLTNEEFKA M
Sbjct  74   N-AGNSKYKLGVNQFADLTNEEFKAMM  99



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MAS    Q   A  L+LG +A Q T  + +EPSM  RHE+WM   G+ Y + AEK +RF+
Sbjct  1    MASICKRQCFFAIFLILGTWACQVTPRELQEPSMSARHEQWMATFGKVYADAAEKERRFE  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFK  357
            IF+ NV++IESFN AGN+ YKL VNKF+DLTNEE K
Sbjct  61   IFKDNVEYIESFNTAGNKPYKLSVNKFADLTNEELK  96



>gb|KDP23191.1| hypothetical protein JCGZ_00324 [Jatropha curcas]
Length=287

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +1

Query  112  VLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN  288
            VL+LG FASQA A   ++ +M ERHE WM  +GR YK++AEK KRF IF+ NV+FIESFN
Sbjct  63   VLVLGLFASQALARPLQDETMKERHEMWMAKYGRVYKDNAEKEKRFNIFKNNVEFIESFN  122

Query  289  KAGNQSYKLGVNKFSDLTNEEFKAT  363
            K GN+ YKL +N F+DL+NEEFKA+
Sbjct  123  KYGNKLYKLDINGFADLSNEEFKAS  147



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            L++A   +L  +A QA+  +  E +M+ERHEKWM  HG+ YK+D EK +RF+IF+ NV+F
Sbjct  10   LLIALFFVLAMWADQASTRELHESTMVERHEKWMAKHGKVYKDDEEKLRRFQIFKNNVEF  69

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N AGN SY LG+N+F+DLTNEEF+A+
Sbjct  70   IESSNAAGNNSYMLGINRFADLTNEEFRAS  99



>gb|EAY97106.1| hypothetical protein OsI_19029 [Oryza sativa Indica Group]
Length=350

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 5/96 (5%)
 Frame = +1

Query  100  ILAAVLLL-----GAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            IL  ++ L     GA  + A  L  + +M  RHE+WM  HGR YK+ AEKA+R ++F+ N
Sbjct  12   ILCCIVCLYSSSGGAIVAAARELGGDAAMAARHERWMAQHGRVYKDAAEKARRLEVFKAN  71

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLN  372
            V FIESFN  G   Y LGVN+F+DLT+EEFKATM N
Sbjct  72   VAFIESFNAGGKNRYWLGVNQFADLTSEEFKATMTN  107



>ref|XP_008811650.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=302

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +1

Query  109  AVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            +VLLL A AS ATA    E +M ERHE+WM   GR+Y++ AEK +R++IF+ NV+ IESF
Sbjct  14   SVLLLCACASHATARTLSEMTMAERHEQWMAQQGRAYRDSAEKERRYQIFKSNVELIESF  73

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKATM  366
            N AGN  YKLGVN+F+DLTNEEF+A M
Sbjct  74   N-AGNSKYKLGVNQFADLTNEEFRAMM  99



>emb|CBI21976.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   +Q I  A+L +L A+ASQATA +  E SM ERHE WM  +GR YK+  EK+KR+
Sbjct  1    MASVNQYQYICLALLFVLAAWASQATARNLHEASMYERHEDWMAQYGRVYKDADEKSKRY  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEF  354
            KIF+ NV  IESFNKA ++SYKL +N+F+DLTNEEF
Sbjct  61   KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEF  96



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + LA + +L A ASQA A   ++ SM ERHE WM  +GR YK+  EK  R+KIF++NV+ 
Sbjct  10   IFLALIFILAALASQAIARSLQDASMYERHEDWMAQNGRVYKDANEKEIRYKIFKENVER  69

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IESFNKAG +SYKLG+N+F+DLTNEEFK +
Sbjct  70   IESFNKAGGKSYKLGINQFADLTNEEFKTS  99



>gb|ABA97421.1| Vignain precursor, putative [Oryza sativa Japonica Group]
 gb|EEE62878.1| hypothetical protein OsJ_17681 [Oryza sativa Japonica Group]
Length=350

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 5/96 (5%)
 Frame = +1

Query  100  ILAAVLLL-----GAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            IL  ++ L     GA  + A  L  + +M  RHE+WM  HGR YK+ AEKA+R ++F+ N
Sbjct  12   ILCCIVCLYSSSGGAIVAAARELGGDAAMAARHERWMAQHGRVYKDAAEKARRLEVFKAN  71

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLN  372
            V FIESFN  G   Y LGVN+F+DLT+EEFKATM N
Sbjct  72   VAFIESFNAGGKNRYWLGVNQFADLTSEEFKATMTN  107



>ref|XP_004974539.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKI  252
            MAS   F L +     L + A  A AL ++ +M+ RHE+WM  + R YK+ AEKA+R ++
Sbjct  1    MASPKAFLLAILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEV  60

Query  253  FEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            F  NVKFIESFN AGN+ + LGVN+F+DLTN+EF+AT  N+G
Sbjct  61   FNANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKG  102



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   +Q I  A+L +L A+ASQATA +  E SM ERHE WM  +GR YK+  EK+KR+
Sbjct  1    MASVNQYQYICLALLFVLAAWASQATARNLHEASMYERHEDWMAQYGRVYKDADEKSKRY  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEF  354
            KIF+ NV  IESFNKA ++SYKL +N+F+DLTNEEF
Sbjct  61   KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEF  96



>ref|XP_004974541.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +1

Query  85   FDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            F   ++  A L  GA A  A AL ++ +M+ RHE+WM  + R YK+ AEKA+R ++F  N
Sbjct  7    FLLAILGCAFLFSGALA--ARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEVFNAN  64

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            VKFIESFN AGN+ + LGVN+F+DLTN+EF+AT  N+G
Sbjct  65   VKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKG  102



>emb|CDP05747.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATAL----DEEPSMLERHEKWMVHHGRSYKNDAEKAK  240
            M        IL +  +L   ASQAT+     ++E +M+E HEKWM  +GR YK+DAEKAK
Sbjct  1    MGVPLKLMPILVSFFVLVIGASQATSRLLHENDEAAMVEEHEKWMATYGRVYKDDAEKAK  60

Query  241  RFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            RF+IF++N ++IESFNKAG ++Y L +N+F+D+TNEEF+A
Sbjct  61   RFQIFKKNFEYIESFNKAGTKTYSLSINRFADMTNEEFRA  100



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +1

Query  115  LLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNK  291
            ++LG +ASQA A +  E SM ERHE+WM  HGR YK D EK +RF IF+ NV+FIESFN+
Sbjct  1    MVLGLYASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIESFNE  60

Query  292  AGNQSYKLGVNKFSDLTNEEFKAT  363
               + YKLG+N F+DLTN+EFKAT
Sbjct  61   NNTRPYKLGINGFADLTNDEFKAT  84



>ref|XP_009609440.1| PREDICTED: ananain-like [Nicotiana tomentosiformis]
Length=172

 Score =   104 bits (259),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALDEEPSML---ERHEKWMVHHGRSYKNDAEKAKR  243
            MA   +   +L    ++G + S ATA + +P+ L   ERHE WM  HGR YK++AEK KR
Sbjct  1    MAMKINLISVLILFFVVGMYKSHATARNLQPAELSVSERHELWMARHGRVYKDEAEKGKR  60

Query  244  FKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
              IF++N++FIES N+AGN SYKLG+N+F+D+T+EEF A
Sbjct  61   LMIFKENMQFIESVNRAGNLSYKLGINEFADITSEEFFA  99



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   ++ I  A+L +L A+AS A A +  E SM ERHE WM  +GR YK+  EK+KR+
Sbjct  1    MASVNQYRYICLALLFVLAAWASHAKARNLHEASMYERHEDWMAQYGRVYKDAGEKSKRY  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF+ NV  IESFNKA N+SYKL +N+F+DLTNEEF+A+
Sbjct  61   KIFKDNVARIESFNKAMNKSYKLSINEFADLTNEEFRAS  99



>gb|AHA62773.1| papain-like cysteine protease [Solanum demissum]
 gb|AHA62775.1| papain-like cysteine protease [Solanum verrucosum]
Length=344

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALDEEP--SMLERHEKWMVHHGRSYKNDAEKAKR  243
            MA   D   IL  +  ++  F SQ TA   +P  S+ ERHE+WM  HGR YK++ EK +R
Sbjct  1    MAMKIDLMSILITLFFVISMFNSQTTAARSQPKLSVSERHEQWMSRHGRVYKDEVEKGER  60

Query  244  FKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            F IF++N+KFIES NKAGN SYKLG+N+F+D+T+EEF A
Sbjct  61   FMIFKENMKFIESINKAGNLSYKLGINEFADITSEEFLA  99



>gb|AHA62774.1| papain-like cysteine protease [Solanum demissum]
Length=344

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALDEEP--SMLERHEKWMVHHGRSYKNDAEKAKR  243
            MA   D   IL  +  ++  F SQ TA   +P  S+ ERHE+WM  HGR YK++ EK +R
Sbjct  1    MAMKIDLMSILITLFFVISMFNSQTTAARSQPKLSVSERHEQWMSRHGRVYKDEVEKGER  60

Query  244  FKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            F IF++N+KFIES NKAGN SYKLG+N+F+D+T+EEF A
Sbjct  61   FMIFKENMKFIESINKAGNLSYKLGINEFADITSEEFLA  99



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLI-LAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA N  +  I LA + +LGA ASQA A   ++ S+ ERHEKWM  +G+ YK+  EK  R 
Sbjct  1    MALNTQYPRISLALIFILGALASQAIARSLQDASINERHEKWMAQYGKVYKDANEKVIRR  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF++NV+ IESFNKAG + YKLG+N+F+DLTNEEFK +
Sbjct  61   KIFKRNVERIESFNKAGGKPYKLGINQFADLTNEEFKTS  99



>ref|XP_002436841.1| hypothetical protein SORBIDRAFT_10g009840 [Sorghum bicolor]
 gb|EER88208.1| hypothetical protein SORBIDRAFT_10g009840 [Sorghum bicolor]
Length=328

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 70/95 (74%), Gaps = 3/95 (3%)
 Frame = +1

Query  103  LAAVLLLGAFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + A+L L  F   A A   L+++ +M+ RHE+WMV + R YK+  EKA+RF++F+ NVKF
Sbjct  8    ILAILGLAFFCGAALAARDLNDDSAMVARHEQWMVQYSRVYKDTTEKARRFEVFKANVKF  67

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            IESFN  GN+ + LGVN+F+DLTN+EF+AT  N+G
Sbjct  68   IESFNAGGNRKFWLGVNQFADLTNDEFRATKTNKG  102



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +1

Query  103  LAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            +A +L+LG  AS+A++    E SM+++H +WM   GR+YK+DAEKAKR KIF++N ++I+
Sbjct  1    MAPLLVLGMHASRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYID  60

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            S NKAG + YKLG+N F+DLTNEEF+AT
Sbjct  61   SVNKAGIRPYKLGINDFADLTNEEFRAT  88



>ref|XP_006362435.1| PREDICTED: fruit bromelain-like [Solanum tuberosum]
Length=344

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = +1

Query  73   MASNFDFQLILAAVL--LLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKR  243
            MA NF  + I+  VL  +L       T+ D +E SMLERHEKWM HHGR YK+D EK  R
Sbjct  1    MAFNFCLKNIIVLVLFFILSLCPFIVTSRDLKELSMLERHEKWMAHHGRVYKDDIEKEHR  60

Query  244  FKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLN  372
            FK F++NV+FIESFN+ G   YKL +NK++DLT EEF A+ + 
Sbjct  61   FKTFKENVEFIESFNQNGTLRYKLAINKYADLTTEEFTASFMG  103



>ref|XP_002436840.1| hypothetical protein SORBIDRAFT_10g009830 [Sorghum bicolor]
 gb|EER88207.1| hypothetical protein SORBIDRAFT_10g009830 [Sorghum bicolor]
Length=328

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 70/95 (74%), Gaps = 3/95 (3%)
 Frame = +1

Query  103  LAAVLLLGAFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + A+L L  F   A A   L+++ +M+ RHE+WMV + R YK+  EKA+RF++F+ NVKF
Sbjct  8    ILAILGLAFFCGAALAARDLNDDSAMVARHEQWMVQYSRVYKDTTEKARRFEVFKANVKF  67

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            IESFN  GN+ + LGVN+F+DLTN+EF+AT  N+G
Sbjct  68   IESFNAGGNRKFWLGVNQFADLTNDEFRATKTNKG  102



>ref|XP_006432594.1| hypothetical protein CICLE_v10001719mg [Citrus clementina]
 gb|ESR45834.1| hypothetical protein CICLE_v10001719mg [Citrus clementina]
Length=344

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 73/95 (77%), Gaps = 4/95 (4%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD----EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE  258
            F +I  ++++L  ++S+  ++      EPS++E+HEKWM  HGR+YK+D EK KRFKIF+
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFK  64

Query  259  QNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +N+++IE  N+  N++YKLG N+FSDLTNEEF+A+
Sbjct  65   ENLEYIEKANEEANRTYKLGTNEFSDLTNEEFRAS  99



>ref|XP_006432617.1| hypothetical protein CICLE_v10001723mg [Citrus clementina]
 ref|XP_006494213.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 ref|XP_006495364.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 gb|ESR45857.1| hypothetical protein CICLE_v10001723mg [Citrus clementina]
Length=344

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 73/95 (77%), Gaps = 4/95 (4%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD----EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE  258
            F +I  ++++L  ++S+  ++      EPS++E+HEKWM  HGR+YK+D EK KRFKIF+
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFK  64

Query  259  QNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +N+++IE  N+  N++YKLG N+FSDLTNEEF+A+
Sbjct  65   ENLEYIEKANEEANRTYKLGTNEFSDLTNEEFRAS  99



>ref|XP_006432601.1| hypothetical protein CICLE_v10001718mg [Citrus clementina]
 gb|ESR45841.1| hypothetical protein CICLE_v10001718mg [Citrus clementina]
Length=344

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 73/95 (77%), Gaps = 4/95 (4%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD----EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE  258
            F +I  ++++L  ++S+  ++      EPS++E+HEKWM  HGR+YK+D EK KRFKIF+
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFK  64

Query  259  QNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +N+++IE  N+  N++YKLG N+FSDLTNEEF+A+
Sbjct  65   ENLEYIEKANEEANRTYKLGTNEFSDLTNEEFRAS  99



>ref|XP_006490014.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 ref|XP_006495221.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=344

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 73/95 (77%), Gaps = 4/95 (4%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD----EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE  258
            F +I  ++++L  ++S+  ++      EPS++E+HEKWM  HGR+YK+D EK KRFKIF+
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFK  64

Query  259  QNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +N+++IE  N+  N++YKLG N+FSDLTNEEF+A+
Sbjct  65   ENLEYIEKANEEANRTYKLGTNEFSDLTNEEFRAS  99



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            +L+L A+LL+  +ASQ+ +    E SM  RH+ WM  +GR YK + EK KRFKIF++NV+
Sbjct  8    KLVLMAMLLVTLWASQSWSRSLHEASMELRHKTWMTQYGRVYKGNVEKEKRFKIFKENVE  67

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            FIESFN  GN+ YKLG+N F+DLTNEEF+A+
Sbjct  68   FIESFNNNGNKPYKLGINAFTDLTNEEFRAS  98



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MAS    +L+L  V +LG +ASQ  + +  + +M +RHE+WM  HG  Y++DAEK +RF 
Sbjct  1    MASTLVGKLVLVMVAILGLWASQVRSRELHKATMRQRHEQWMARHGWVYQDDAEKERRFS  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ NV FIESFNK GN+ Y L +N F+DLT EEFKA+
Sbjct  61   IFKNNVDFIESFNKDGNKPYTLAINAFADLTIEEFKAS  98



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA+  + +L+  A+L++G +ASQA +    + +M ERHE WM  +GR YK+++EK +RF+
Sbjct  1    MATVSENKLMFVALLVVGLWASQAWSRSLHDAAMNERHEMWMAKYGRVYKDNSEKERRFE  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF  NV+FIESFNK GN+ YKL +N+F+DLTNEEFK +
Sbjct  61   IFRNNVEFIESFNKLGNRPYKLDINEFADLTNEEFKVS  98



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA N  ++L++AA+L+L  ++SQ TA    + + ++ HE+WM   GR YK++AEK+KRF+
Sbjct  1    MAMNPSWRLVIAALLVLEMWSSQGTARTLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFR  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF++NV++I SFN+A  + Y+L +NKF+DLTNEEF A+
Sbjct  61   IFKENVEYIRSFNEAAARPYRLAINKFADLTNEEFVAS  98



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA N  ++L++AA+L+L  ++SQ TA    + + ++ HE+WM   GR YK++AEK+KRF+
Sbjct  1    MAMNPSWRLVIAALLVLEMWSSQGTARTLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFR  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF++NV++I SFN+A  + Y+L +NKF+DLTNEEF A+
Sbjct  61   IFKENVEYIRSFNEAAARPYRLAINKFADLTNEEFVAS  98



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            ++I   +L++G +ASQA +    E SM ERHE WM  +GR+YK+ AEK +RFKIF++NV+
Sbjct  6    KIICITLLIMGVWASQALSRTLHEVSMSERHEDWMGLYGRTYKDIAEKERRFKIFKENVE  65

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +IES N AGN+ YKL +N+F+D TNEEFKA+
Sbjct  66   YIESVNSAGNRRYKLSINEFADQTNEEFKAS  96



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = +1

Query  112  VLLLGAFASQATA-LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN  288
            VLLL  FAS ATA +  E +M ERHE+WM  HGR Y + AEK +RF+IF+ NV+ IESFN
Sbjct  15   VLLLCTFASHATARMLSEMTMHERHEQWMSQHGRVYGDSAEKERRFQIFKANVELIESFN  74

Query  289  KAGNQSYKLGVNKFSDLTNEEFKATM  366
             AGN  YKLGVN+F+DLT EEFKA M
Sbjct  75   -AGNSKYKLGVNQFADLTIEEFKAMM  99



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            +LI A VLLLG + S   +    E SM+ERHE WM  +GR+YK   EK +R  IF+ NV+
Sbjct  31   KLIFAVVLLLGLWTSHVWSRSLYEASMMERHETWMAQYGRAYKGHVEKERRLNIFKNNVE  90

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            FIESFNK G + YKL VN+F+DLTNEEF+A+
Sbjct  91   FIESFNKVGKKPYKLSVNEFADLTNEEFQAS  121



>ref|XP_006471123.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=179

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            +   ++L+   ASQ  +     EPS++E+HE+WM  HGR+YK++ EKA R  IF+QN+++
Sbjct  13   MFVIIILVITCASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEY  72

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            IE  NK GN++YKLG N+FSDLTNEEF+A
Sbjct  73   IEKANKEGNRTYKLGTNEFSDLTNEEFRA  101



>ref|XP_002280263.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=339

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS   +Q +  A+L +L A+ASQAT+    E SM ERHE WM  +GR YK+  EK KRF
Sbjct  1    MASTNQYQYVSMALLFILAAWASQATSRSLHEASMYERHEDWMARYGRMYKDANEKEKRF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            KIF+ NV  IESFNKA +++YKL +N+F+DLTNEEF++
Sbjct  61   KIFKDNVARIESFNKAMDKTYKLSINEFADLTNEEFRS  98



>ref|XP_008669676.1| PREDICTED: ervatamin-B-like [Zea mays]
 tpg|DAA38581.1| TPA: hypothetical protein ZEAMMB73_156486 [Zea mays]
Length=347

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATAL-------DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE  258
            +L A+L  G     A  L       D+E +M+ RHE+WMV HGR YK++ +KA RF +F+
Sbjct  7    LLLAILGCGVCLCSAAVLAARELGGDDELAMVARHEQWMVQHGRVYKDETDKAHRFLVFK  66

Query  259  QNVKFIESFN---KAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
             NVKFIESFN    AGN+ + LGVN+F+DLTN+EF+AT  N+G
Sbjct  67   ANVKFIESFNAAAAAGNRKFWLGVNQFADLTNDEFRATKTNKG  109



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 77/122 (63%), Gaps = 3/122 (2%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQ  261
             Q  + AVL    F   A A   L+E+ +M+ RHE+WM  + R YK+ AEKA+RF++F+ 
Sbjct  4    LQASILAVLSFAFFCGAALAARDLNEDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKA  63

Query  262  NVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEGkapprprpskpasllNESLAE  441
            NVKFIESFN  GN+ + LG+N+F+DLTN+EF+ T  N+G  P   + S      N S+  
Sbjct  64   NVKFIESFNTGGNRKFWLGINQFADLTNDEFRTTKTNKGFKPSLDKVSTGFRYENVSVDA  123

Query  442  VP  447
            +P
Sbjct  124  IP  125



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            IL   L  GA A  A  L+++ +M+ RHE+WM  + R YK+  EKA+RF++F+ NVKFIE
Sbjct  11   ILGLALFCGA-ALAARDLNDDSAMVARHEQWMAQYNRVYKDATEKAQRFEVFKANVKFIE  69

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            SFN  GN+ + LGVN+F+DLTN+EF+AT  N+G
Sbjct  70   SFNAGGNRKFWLGVNQFADLTNDEFRATKTNKG  102



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MAS    +L+L  V +LG +ASQA + +    +M ERHE+ M  HGR Y++DAEK +RF 
Sbjct  1    MASTLVGKLVLVMVAILGLWASQARSRELHGATMWERHEQRMARHGRVYQDDAEKERRFS  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ NV FIESFNK GN+ Y L +N F DLT EEFKA+
Sbjct  61   IFKNNVDFIESFNKDGNKPYTLAINAFVDLTIEEFKAS  98



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            M S    Q I+A +L+LG +A +  + + +EPSM  RHE+WM   G+ Y + AEK +RF+
Sbjct  1    MVSICKRQCIIAFILILGTWAYEVASRELQEPSMSARHEQWMATFGKVYADAAEKERRFE  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFK  357
            IF+ NV++IESFN AGN+ YKL VNKF+DLT EE K
Sbjct  61   IFKDNVEYIESFNTAGNKPYKLSVNKFADLTTEELK  96



>ref|XP_006362436.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  166  SMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTN  345
            SMLERHEKWM HHGR YK+D EKA+R KIF++NV FIESFN     SY+LGVNKF+DLTN
Sbjct  34   SMLERHEKWMSHHGRVYKDDVEKAERLKIFKENVDFIESFNNDAVHSYQLGVNKFADLTN  93

Query  346  EEFKATM  366
            EEF++ +
Sbjct  94   EEFQSMV  100



>ref|XP_002522560.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39860.1| cysteine protease, putative [Ricinus communis]
Length=160

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +1

Query  118  LLGAFASQA-TALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKA  294
            ++G +ASQA + L  + ++ ERHE WM  +GR YK+ AEK +RFKIF++NV+FIESFNKA
Sbjct  27   VVGLWASQAWSRLLYDATINERHEMWMAKYGRVYKDRAEKEERFKIFKENVEFIESFNKA  86

Query  295  GNQSYKLGVNKFSDLTNEEFKAT  363
            GN++YKL +N+F+DLTNEEF+ +
Sbjct  87   GNKAYKLSINEFADLTNEEFRTS  109



>dbj|BAF56427.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV  267
            +Q+  A VL LG +A Q ++   ++ SM ERHE+WM  +G+ YK+  EK KRF IF++NV
Sbjct  8    YQISFALVLCLGLWAFQVSSRTLQDASMHERHEQWMARYGKVYKDLQEKEKRFNIFQENV  67

Query  268  KFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            K+IE+ N AGN+ YKLGVN+F+DLTN+EF AT
Sbjct  68   KYIEASNNAGNKPYKLGVNQFTDLTNKEFIAT  99



>ref|XP_004232961.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=341

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  166  SMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTN  345
            SMLERHEKWM HHGR YK+D EKA+R KIF++NV+FIE+FN     SY+LGVNKF+DLTN
Sbjct  34   SMLERHEKWMSHHGRVYKDDVEKAERLKIFKENVEFIEAFNNDAAHSYQLGVNKFADLTN  93

Query  346  EEFKATM  366
            EEF++ +
Sbjct  94   EEFQSMV  100



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +1

Query  115  LLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNK  291
            ++L  +ASQATA    + SM+ERHE+WMV +GR+YKNDAEKA RF IF+ NV++I+S N+
Sbjct  1    MVLQIWASQATARTLPDTSMVERHEQWMVQYGRTYKNDAEKANRFNIFKDNVEYIQSVNE  60

Query  292  AGNQSYKLGVNKFSDLTNEEFKAT  363
            A  ++YKL +NKF+DL +EEF+A+
Sbjct  61   AETRTYKLAINKFADLKHEEFQAS  84



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  166  SMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTN  345
            +M+ERHE+WM  HGR Y +DAEK +RF+IF++NV+FIE+FN+AG + YKLGVN+F+DLTN
Sbjct  28   AMVERHEQWMSLHGRVYTDDAEKERRFQIFKKNVEFIEAFNQAGKRPYKLGVNQFADLTN  87

Query  346  EEFKAT  363
            EEFKA+
Sbjct  88   EEFKAS  93



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            L +A   +L   A QA + +  E  M  RHEKWM  HG+ YK+D EK +RF+IF+ NV F
Sbjct  10   LPIALFFVLAMCADQAASRELHELEMTGRHEKWMAKHGKVYKDDKEKLRRFQIFKSNVVF  69

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            IESFN AGN+SY LG+NKF+DLTNEEF+A
Sbjct  70   IESFNTAGNKSYMLGINKFADLTNEEFRA  98



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            M S    Q   A +L+LG +A +  + + +EPSM  RHE+WM  +G+ Y + AEK +RF+
Sbjct  1    MVSICKRQCFFAFILILGTWAYEVASRELQEPSMSARHEQWMETYGKVYADAAEKERRFE  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFK  357
            IF+ NV++IESFN AGN+ YKL VNKF+DLTNEE K
Sbjct  61   IFKDNVEYIESFNTAGNKPYKLSVNKFADLTNEELK  96



>ref|XP_009606934.1| PREDICTED: zingipain-2 [Nicotiana tomentosiformis]
Length=339

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 73/105 (70%), Gaps = 5/105 (5%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALDEEPSML---ERHEKWMVHHGRSYKNDAEKAKR  243
            MA   +   +L    ++G + S ATA + +P+ L   ERHE WM  HGR YK++AEK KR
Sbjct  1    MAMKINLISVLILFFVVGMYKSHATARNLQPAELSVSERHELWMARHGRVYKDEAEKGKR  60

Query  244  FKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEF--KATMLN  372
              IF++N++FIES N+AGN SYKLG+N+F+D+T+EEF  + T LN
Sbjct  61   LMIFKENMQFIESVNRAGNLSYKLGINEFADITSEEFFARYTGLN  105



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +1

Query  115  LLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN  288
            ++LG + S A A  + +EP ML RHE+WM  +GR YK+ AEK +RF+IF  N ++IES N
Sbjct  1    MVLGVWVSGAMARGIADEP-MLRRHEQWMAQYGRVYKDAAEKERRFQIFRGNYEYIESIN  59

Query  289  KAGNQSYKLGVNKFSDLTNEEFKATMLN  372
            +AG++ YKLG+N+F+D+TNEEFKA+ L 
Sbjct  60   RAGDRKYKLGLNQFADMTNEEFKASRLG  87



>ref|XP_006421532.1| hypothetical protein CICLE_v10005342mg [Citrus clementina]
 gb|ESR34772.1| hypothetical protein CICLE_v10005342mg [Citrus clementina]
Length=343

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD----EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE  258
            F +I  ++++L  ++S+  ++      EPS++E+HEKWM  HGR+YK+D EK  RFKIF+
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEMRFKIFK  64

Query  259  QNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +N+++IE  N+  N++YKLG N+FSDLTNEEF+A+
Sbjct  65   ENLEYIEKANEEANRTYKLGTNEFSDLTNEEFRAS  99



>emb|CAE03344.2| OSJNBb0005B05.11 [Oryza sativa Japonica Group]
 gb|EAZ29753.1| hypothetical protein OsJ_13812 [Oryza sativa Japonica Group]
Length=323

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            IL  + L  A  + A  L ++ +M  RHE+WM  +GR YK+DAEKA+RF++F+ NV FIE
Sbjct  11   ILGCLCLCSAVLA-ARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANVAFIE  69

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            SFN AGN  + LGVN+F+DLTN+EF++T  N+G
Sbjct  70   SFN-AGNHKFWLGVNQFADLTNDEFRSTKTNKG  101



>ref|XP_006421530.1| hypothetical protein CICLE_v10005334mg [Citrus clementina]
 gb|ESR34770.1| hypothetical protein CICLE_v10005334mg [Citrus clementina]
Length=344

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD----EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE  258
            F +I  ++++L  ++S+  ++      EPS++E+HEKWM  HGR+YK+D EK  RFKIF+
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEMRFKIFK  64

Query  259  QNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +N+++IE  N+  N++YKLG N+FSDLTNEEF+A+
Sbjct  65   ENLEYIEKANEEANRTYKLGTNEFSDLTNEEFRAS  99



>ref|XP_006421528.1| hypothetical protein CICLE_v10006884mg [Citrus clementina]
 gb|ESR34768.1| hypothetical protein CICLE_v10006884mg [Citrus clementina]
Length=323

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD----EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE  258
            F +I  ++++L  ++S+  ++      EPS++E+HEKWM  HGR+YK+D EK  RFKIF+
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEMRFKIFK  64

Query  259  QNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +N+++IE  N+  N++YKLG N+FSDLTNEEF+A+
Sbjct  65   ENLEYIEKANEEANRTYKLGTNEFSDLTNEEFRAS  99



>ref|NP_001052232.2| Os04g0203500 [Oryza sativa Japonica Group]
 dbj|BAF14146.2| Os04g0203500 [Oryza sativa Japonica Group]
Length=336

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            IL  + L  A  + A  L ++ +M  RHE+WM  +GR YK+DAEKA+RF++F+ NV FIE
Sbjct  11   ILGCLCLCSAVLA-ARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANVAFIE  69

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            SFN AGN  + LGVN+F+DLTN+EF++T  N+G
Sbjct  70   SFN-AGNHKFWLGVNQFADLTNDEFRSTKTNKG  101



>emb|CAH66275.1| OSIGBa0147O06.5 [Oryza sativa Indica Group]
Length=339

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            IL  + L  A  + A  L ++ +M  RHE+WM  +GR YK+DAEKA+RF++F+ NV FIE
Sbjct  11   ILGCLCLCSAVLA-ARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANVAFIE  69

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            SFN AGN  + LGVN+F+DLTN+EF++T  N+G
Sbjct  70   SFN-AGNHKFWLGVNQFADLTNDEFRSTKTNKG  101



>ref|NP_001275606.1| fruit bromelain-like precursor [Solanum tuberosum]
 gb|AHA62777.1| papain-like cysteine protease [Solanum tuberosum]
Length=344

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA   D   IL  +  ++  F SQ TA  +   S+ ERHE+WM  HGR YK++ EK +RF
Sbjct  1    MAMKIDLMSILITLFFVISMFNSQTTARSQPKLSVSERHEQWMSRHGRVYKDEVEKGERF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IF++N+KFIES NKAGN SYKLGVN+F+D+T+EEF A
Sbjct  61   MIFKENMKFIESINKAGNLSYKLGVNEFADITSEEFLA  98



>gb|AFV30165.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 68/92 (74%), Gaps = 1/92 (1%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV  267
            +Q+  A VL LG +A Q ++   ++ SM ERHE+WM  +GR YK+  EK KRF IF++NV
Sbjct  8    YQVSFALVLCLGLWAFQVSSRTLQDASMQERHEQWMARYGRVYKDLQEKEKRFSIFKENV  67

Query  268  KFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
             +IE+ N AG++ YKLGVN+F+DLTNEEF AT
Sbjct  68   NYIEASNNAGDKPYKLGVNQFADLTNEEFIAT  99



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 64/86 (74%), Gaps = 4/86 (5%)
 Frame = +1

Query  109  AVLLLGAFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            A+L++  +ASQ  A   L E  SMLERHE+WM  HGR YKN AEKA RF+IF  NV+ IE
Sbjct  14   ALLIVAIWASQGEAGRSLGENKSMLERHEQWMAQHGRVYKNAAEKAHRFEIFRANVERIE  73

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFK  357
            SFN A N  +KLGVN+F+DLTNEEFK
Sbjct  74   SFN-AENHKFKLGVNQFADLTNEEFK  98



>ref|XP_006362434.1| PREDICTED: fruit bromelain-like [Solanum tuberosum]
Length=348

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = +1

Query  73   MASNFDFQ----LILAAVLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEK  234
            MA NF  +    L+L  +L L  F   +  L E  + SMLERHEKWM  H R+YK++ EK
Sbjct  1    MAFNFCLKNIIILVLFFILSLSPFIVTSRDLKELSKLSMLERHEKWMARHERAYKDEIEK  60

Query  235  AKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLN  372
              RFK F++NVKFIESFNK G Q YKL VNK++DLT EEF A+ + 
Sbjct  61   EHRFKTFKKNVKFIESFNKNGTQRYKLAVNKYADLTTEEFTASYMG  106



>gb|EMT04560.1| Vignain [Aegilops tauschii]
Length=258

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 70/102 (69%), Gaps = 9/102 (9%)
 Frame = +1

Query  97   LILAAVLLLG-----AFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKI  252
            +++   L+LG      F S   A   L ++ SM+ RHE WMV +GR YK+DAEKA+RF +
Sbjct  1    MVIPKGLILGILGCVCFCSSVLAARELSDDLSMVARHESWMVQYGRVYKDDAEKAQRFGV  60

Query  253  FEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            F+ NV FI+SFN A N  + LGVN+F+DLTNEEFKAT  N+G
Sbjct  61   FKANVGFIKSFN-AKNLKFYLGVNQFADLTNEEFKATKANKG  101



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +1

Query  91   FQLILAAVL-LLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQ  261
            FQ +  A+L +LGA+ S++TA  L + P M ERHE+WM  +GR YK+D E+A R+ IF++
Sbjct  7    FQFVCLALLFILGAWPSKSTARTLLDAP-MYERHEQWMTQYGRVYKDDNERATRYSIFKE  65

Query  262  NVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            NV  I++FN    +SYKLGVN+F+DLTNEEFKA+
Sbjct  66   NVARIDAFNSQTGKSYKLGVNQFADLTNEEFKAS  99



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +1

Query  91   FQLILAAVL-LLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQ  261
            FQ +  A+L +LGA+ S++TA  L + P M ERHE+WM  +GR YK+D E+A R+ IF++
Sbjct  7    FQFVCLALLFILGAWPSKSTARTLLDAP-MYERHEQWMTQYGRVYKDDNERATRYSIFKE  65

Query  262  NVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            NV  I++FN    +SYKLGVN+F+DLTNEEFKA+
Sbjct  66   NVARIDAFNSQTGKSYKLGVNQFADLTNEEFKAS  99



>ref|XP_006380495.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
 gb|ERP58292.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
Length=321

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = +1

Query  91   FQLILAAVLLL-GAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQ  261
            FQ +  A+L + GA+ S++TA  L + P M ERHE+WM  +GR YK+D E+A R+ IF++
Sbjct  7    FQFVCLALLFISGAWPSKSTARTLLDAP-MYERHEQWMTQYGRVYKDDTERATRYSIFKE  65

Query  262  NVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            NV  I++FN    +SYKLGVN+F+DLTNEEFKA+
Sbjct  66   NVARIDAFNSQTGKSYKLGVNQFADLTNEEFKAS  99



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLL-GAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKR  243
            M S   FQ +  A+L + GA+ S++TA  L + P M ERHE+WM  +GR YK+D E+A R
Sbjct  1    MRSTKQFQFVCLALLFISGAWPSKSTARTLLDAP-MYERHEQWMTQYGRVYKDDNERATR  59

Query  244  FKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            + IF++NV  I++FN    +SYKLGVN+F+DLTNEEFKA+
Sbjct  60   YSIFKENVARIDAFNSQTGKSYKLGVNQFADLTNEEFKAS  99



>ref|XP_003578721.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=349

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 66/93 (71%), Gaps = 5/93 (5%)
 Frame = +1

Query  115  LLLGAFASQATALDE----EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIES  282
            ++LG     +T L      + +M+ERHE+WM  HGR YK+ AEKA+RF+ F  NV FIES
Sbjct  11   VVLGCICLCSTVLSARELGDAAMVERHEQWMAQHGRVYKDGAEKARRFEAFRNNVVFIES  70

Query  283  FNKAGN-QSYKLGVNKFSDLTNEEFKATMLNEG  378
            FN AGN + + LGVN+F+DLTN+EF+AT  N+G
Sbjct  71   FNAAGNRRKFWLGVNQFTDLTNDEFRATKTNKG  103



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +1

Query  130  FASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQS  306
            +ASQ+TA      SM+E+HE+WMV  GR+YK+DAEKA R+KIF+QNV++I+S ++A N +
Sbjct  2    YASQSTARTLPNKSMIEKHEQWMVQCGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAQNWT  61

Query  307  YKLGVNKFSDLTNEEFKAT  363
            YKL +NKF+DLTNEEF+A+
Sbjct  62   YKLAINKFADLTNEEFQAS  80



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 68/90 (76%), Gaps = 3/90 (3%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
             LA + +LGA+ S++TA  L + P M ERHE+WM  +GR YK+D E+A R+ IF++NV  
Sbjct  11   CLALLFILGAWPSKSTARTLLDAP-MYERHEQWMTQYGRVYKDDTERATRYSIFKENVAR  69

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            I++FN    +SYKLGVN+F+DLTNEEFKA+
Sbjct  70   IDAFNSQTGKSYKLGVNQFADLTNEEFKAS  99



>ref|XP_010059083.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 ref|XP_010059084.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW74261.1| hypothetical protein EUGRSUZ_E02908 [Eucalyptus grandis]
Length=341

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA      LI++ VL+LGA+A  AT++    +P++ E+HE+WM ++ R+Y +  EKAKR 
Sbjct  1    MAFTLKSDLIISLVLILGAWAWHATSVRPLHDPTIAEQHEQWMANYSRTYNDLQEKAKRQ  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEF  354
             IF +N++FIE FNK+GN++++LG+N+FSDLTNEEF
Sbjct  61   AIFAKNLQFIEDFNKSGNRTFQLGLNQFSDLTNEEF  96



>ref|XP_003539770.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +1

Query  103  LAAVLLLGAFA-SQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            LA +LL G +A S  T   E+ SM ERHE+WM  HG+ YK+  EK  R+KIF+QNVK IE
Sbjct  12   LALLLLFGFWAFSANTRTLEDASMHERHEQWMAQHGKVYKDHHEKELRYKIFQQNVKGIE  71

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             FN AGN+S+KLGVN+F+DLT EEFKA
Sbjct  72   GFNNAGNKSHKLGVNQFADLTEEEFKA  98



>gb|KDO55227.1| hypothetical protein CISIN_1g019112mg [Citrus sinensis]
Length=346

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            ++L+   ASQ  +     EPS++E+HE+WM  HGR+YK++ EKA R  IF+QN+++IE  
Sbjct  17   IILVITCASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLTIFKQNLEYIEKA  76

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKAT  363
            NK GN++YKLG N+FSDLTNEEF+A+
Sbjct  77   NKEGNRTYKLGTNEFSDLTNEEFRAS  102



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            +L+LAA+L+LG +A Q+ +    + +M ERHE WM  +GR Y+++AEK  RFKIF++NV+
Sbjct  9    KLVLAAILVLGVWAPQSWSRTLNDATMNERHEMWMAQYGRVYRDNAEKEMRFKIFKENVE  68

Query  271  FIESF-NKAGNQSYKLGVNKFSDLTNEEFKA  360
            +I SF NKA N+ YKLG+N+F+D TNEEF+A
Sbjct  69   YIASFNNKARNKPYKLGINEFADQTNEEFRA  99



>gb|KCW74260.1| hypothetical protein EUGRSUZ_E02907 [Eucalyptus grandis]
Length=381

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +1

Query  70   SMASNFDFQLILAAVLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKR  243
            +MA      LI++ VL+LGA+A  AT++    +P++ E+HE+WM ++ R+Y +  EKAKR
Sbjct  40   AMAFTLKSDLIISLVLILGAWAWHATSVRPLHDPTIAEQHEQWMANYSRTYNDLQEKAKR  99

Query  244  FKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEF  354
              IF +N++FIE FNK+GN++++LG+N+FSDLTNEEF
Sbjct  100  QAIFAKNLQFIEDFNKSGNRTFQLGLNQFSDLTNEEF  136



>ref|XP_004975182.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +1

Query  103  LAAVLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI  276
            L A+L      S   A  E  + +M+ERHEKWMV +GR YK+ AEKA+RF++F+ NV FI
Sbjct  8    LLAILGCACLCSSILAARELSDAAMVERHEKWMVEYGRVYKDTAEKAQRFEVFKDNVAFI  67

Query  277  ESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            ESFN AGN  + L VN+F+DLTN+EF+AT  N+G
Sbjct  68   ESFN-AGNTKFWLAVNQFADLTNDEFRATKANKG  100



>ref|XP_004975183.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +1

Query  103  LAAVLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI  276
            L A+L      S   A  E  + +M+ERHEKWMV +GR YK+ AEKA+RF++F+ NV FI
Sbjct  8    LLAILGCACLCSSILAARELSDAAMVERHEKWMVEYGRVYKDTAEKAQRFEVFKDNVAFI  67

Query  277  ESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            ESFN AGN  + L VN+F+DLTN+EF+AT  N+G
Sbjct  68   ESFN-AGNTKFWLAVNQFADLTNDEFRATKANKG  100



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
              + +  +L L A+ + +  + E  +MLERHE+WM  +GR YKN+ EK  R+KIF+ NV+
Sbjct  8    ISVFIVLILTLWAYQTTSRLVPERLAMLERHEEWMERYGRVYKNEEEKMMRYKIFKDNVE  67

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            FIE+FN AG + YKLG+N F+D TNEEFKA
Sbjct  68   FIEAFNAAGTRPYKLGINAFADQTNEEFKA  97



>ref|XP_006652104.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=342

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            +L  + L  A  +     D++ +M  RHE+WM  +GR YK+ AEKA+RF++F+ NV FIE
Sbjct  11   VLGCLYLCSAVLAARELGDDDAAMAARHERWMAQYGRVYKDAAEKARRFEVFKANVAFIE  70

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            SFN  G + + LGVN+F+DLTN EF+AT  N+G
Sbjct  71   SFNGGGGRKFWLGVNQFADLTNYEFRATNTNKG  103



>ref|XP_009775922.1| PREDICTED: zingipain-2 [Nicotiana sylvestris]
Length=338

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 4/104 (4%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALDEEP--SMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA   +   ++    ++G + S ATA + +P  S+ ERHE WM  HGR YK++AEK KR 
Sbjct  1    MAMKINLISVVILFFVVGMYKSHATARNLQPELSVSERHELWMARHGRVYKDEAEKGKRL  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEF--KATMLN  372
             IF++N++FIES N+AGN SYKLG+N+F+D+T++EF  + T LN
Sbjct  61   VIFKENMQFIESINRAGNLSYKLGINEFADITSDEFFARYTGLN  104



>sp|A2XQE8.1|SAG39_ORYSI RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EAY93058.1| hypothetical protein OsI_14861 [Oryza sativa Indica Group]
Length=339

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            IL  + L  A  + A  L ++ +M  RHE+WM  +GR Y++DAEKA+RF++F+ NV FIE
Sbjct  11   ILGCLCLCSAVLA-ARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFKANVAFIE  69

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            SFN AGN ++ LGVN+F+DLTN+EF+ T  N+G
Sbjct  70   SFN-AGNHNFWLGVNQFADLTNDEFRWTKTNKG  101



>gb|AHA62772.1| papain-like cysteine protease [Solanum stoloniferum]
Length=343

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA   D   IL  +  ++  F SQ TA  +   S+ ERHE+WM  HGR YK++ EK +RF
Sbjct  1    MAMKIDLMSILITLFFVISMFNSQTTARSQPKLSVSERHEQWMSRHGRVYKDEVEKRERF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IF++N+KFIES NKAGN SYKLG+N+F+D+T+EEF A
Sbjct  61   MIFKENMKFIESINKAGNLSYKLGINEFADITSEEFLA  98



>ref|XP_006470294.1| PREDICTED: xylem cysteine proteinase 1-like isoform X2 [Citrus 
sinensis]
 gb|KDO38136.1| hypothetical protein CISIN_1g019063mg [Citrus sinensis]
Length=346

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            ++L+   ASQ  +     EPS++E+HE+WM  HGR+YK++ EKA R  IF+QN+++IE  
Sbjct  17   IILVITCASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIEKA  76

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKA  360
            NK GN++YKLG N+FSDLTNEEF+A
Sbjct  77   NKEGNRTYKLGTNEFSDLTNEEFRA  101



>ref|XP_011009181.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=276

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = +1

Query  91   FQLILAAVLLL-GAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQ  261
            FQ +  A+L + GA+ S++TA  L + P M ERHE+WM  +GR YK+D E+A R+ IF++
Sbjct  27   FQFVCLALLFISGAWPSKSTARTLLDAP-MYERHEQWMTQYGRVYKDDNERATRYSIFKE  85

Query  262  NVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            NV  +++FN    +SYKLGVN+F+DLTNEEFKA+
Sbjct  86   NVARVDAFNSQTGKSYKLGVNQFADLTNEEFKAS  119



>ref|XP_006470292.1| PREDICTED: xylem cysteine proteinase 1-like isoform X2 [Citrus 
sinensis]
Length=346

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            ++L+   ASQ  +     EPS++E+HE+WM  HGR+YK++ EKA R  IF+QN+++IE  
Sbjct  17   IILVITCASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIEKA  76

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKA  360
            NK GN++YKLG N+FSDLTNEEF+A
Sbjct  77   NKEGNRTYKLGTNEFSDLTNEEFRA  101



>ref|XP_006470293.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470295.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=346

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            ++L+   ASQ  +     EPS++E+HE+WM  HGR+YK++ EKA R  IF+QN+++IE  
Sbjct  17   IILVITCASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIEKA  76

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKA  360
            NK GN++YKLG N+FSDLTNEEF+A
Sbjct  77   NKEGNRTYKLGTNEFSDLTNEEFRA  101



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MAS-NFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MAS  F++++   A+L+L  F SQAT+ D  E S+ ++H++WM   GR YK+D EKAKRF
Sbjct  1    MASLTFNWKVAFGALLVLEMFVSQATSRDLYEASIFQKHKQWMSLFGRVYKDDIEKAKRF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            KIF+ N ++IE  NK G + Y LG+N+F+DL+NEEFKA+
Sbjct  61   KIFKDNFEYIEFVNKVGTRPYILGINEFADLSNEEFKAS  99



>ref|XP_007132814.1| hypothetical protein PHAVU_011G126700g [Phaseolus vulgaris]
 gb|ESW04808.1| hypothetical protein PHAVU_011G126700g [Phaseolus vulgaris]
Length=333

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MAS    Q ILA  LLL    SQ  +    E S+ ERHE WM  +G+ YK+ AEK KRF 
Sbjct  1    MASTTQKQYILALFLLLAVGISQVMSRKLHETSLRERHENWMQEYGKVYKDAAEKEKRFL  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ NV+FIESFN  GN+ YKLGVN F+DLT +EFKA+
Sbjct  61   IFKDNVEFIESFNAVGNKPYKLGVNHFADLTVQEFKAS  98



>gb|AHA62776.1| papain-like cysteine protease [Solanum tuberosum]
Length=344

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA   D   IL  +  ++  F SQ TA  +   S+ ERHE+WM  HGR YK++ EK +RF
Sbjct  1    MAMKIDLMSILITLFFVISMFNSQTTARSQPKLSVSERHEQWMSRHGRVYKDEVEKGERF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IF++N+KFI+S NKAGN SYKLG+N+F+D+T+EEF A
Sbjct  61   MIFKENMKFIDSINKAGNLSYKLGINEFADITSEEFLA  98



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + LA + +LGA+ S++ A   ++ SM ERHE+WM  +GR YK+DAEK  R+ IF++NV  
Sbjct  10   ICLALLFVLGAWPSKSAARTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVAR  69

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            I++FN    +SYKLGVN+F+DL+NEEFKA+
Sbjct  70   IDAFNSQTGKSYKLGVNQFADLSNEEFKAS  99



>ref|XP_006362429.1| PREDICTED: fruit bromelain-like [Solanum tuberosum]
Length=344

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA   D   IL  +  ++  F SQ TA  +   S+ ERHE+WM  HGR YK++ EK +RF
Sbjct  1    MAMKIDSMSILITLFFVISMFNSQTTARSQPKLSVSERHEQWMSRHGRVYKDEVEKGERF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IF++N+KFIES NKAGN SYKLG+N+F+D+T+EEF A
Sbjct  61   MIFKENMKFIESINKAGNLSYKLGINEFADITSEEFLA  98



>gb|AHA62778.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=348

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 61/84 (73%), Gaps = 4/84 (5%)
 Frame = +1

Query  133  ASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKA---GN  300
            AS A  LD E+ SM ERHE+WM  HGR YK+D EK KRF+IF++NVK IE FN+    G 
Sbjct  26   ASSARPLDHEQVSMRERHEQWMARHGREYKDDIEKEKRFQIFKENVKRIEEFNRGSGNGK  85

Query  301  QSYKLGVNKFSDLTNEEFKATMLN  372
            +SY LGVN F+DLTNEEFKA   N
Sbjct  86   KSYTLGVNAFTDLTNEEFKAIYAN  109



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +1

Query  76   ASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKI  252
            A+N  + + LA V  LG +A Q T+   ++ SM ERHE+WM H+G+ YK+  E+ KRFKI
Sbjct  3    ANNQLYHISLALVFCLGLWAIQVTSRTLQDGSMHERHERWMNHYGKVYKDHQEREKRFKI  62

Query  253  FEQNVKFIESFNKA-GNQSYKLGVNKFSDLTNEEFKAT  363
            F +N+K+IE+FN    N+SYKLG+N+F+DLTNEEF A+
Sbjct  63   FTENMKYIEAFNNGDNNESYKLGINQFADLTNEEFVAS  100



>ref|XP_009793843.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=371

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +1

Query  70   SMASNFDFQLILAAVLLLGAFASQATALDEEP--SMLERHEKWMVHHGRSYKNDAEKAKR  243
            +MA   +   ++    ++G + S ATA + +P  S+ ERHE WM  HGR YK++AEK KR
Sbjct  32   TMAMKINLISVVILFFVVGMYKSHATARNLQPELSVSERHELWMARHGRVYKDEAEKGKR  91

Query  244  FKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
              IF++N++FIES N+AGN SYKLG+N+++D+T++EF A
Sbjct  92   LMIFKENMQFIESINRAGNLSYKLGINEYADITSDEFFA  130



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = +1

Query  85   FDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            F   LI+  V + GA A     + + P M  RHE+WM  +GR YK+ AEK +RF+IF+ N
Sbjct  6    FVLALIVLGVWVFGAMAR---GIADVP-MSTRHEQWMAQYGRVYKDAAEKERRFQIFKDN  61

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLN  372
              +IES N+AGN+ YKLG+N+F+D+TNEEFKA+ L 
Sbjct  62   CNYIESVNRAGNRKYKLGLNQFADMTNEEFKASHLG  97



>gb|AAA50755.1| cysteine proteinase [Alnus glutinosa]
Length=340

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 2/91 (2%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD--EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
              L  ++ LGA ASQ  A    ++ SM ERHE+WM  +GR YK+  EK KR+KIFE+NV 
Sbjct  8    FCLVVMVTLGALASQLAAARSLQDASMRERHEEWMASYGRVYKDINEKQKRYKIFEENVA  67

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
             IES NK  N+ YKL VN+F+DLTNEEFKA+
Sbjct  68   LIESSNKDANKPYKLSVNQFADLTNEEFKAS  98



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            +LI A VLLLG + S   +    E SM+ERHE WM  +GR+YK+  EK +R   F+ NV+
Sbjct  31   KLIFAVVLLLGLWTSHVWSRSLYEASMMERHETWMAQYGRAYKDRVEKERRLNTFKNNVE  90

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            FIESFNK G + YKL VN+F+DL NEEF+A+
Sbjct  91   FIESFNKDGKKPYKLSVNEFADLMNEEFRAS  121



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 69/92 (75%), Gaps = 2/92 (2%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD--EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV  267
            Q +  A++LLGA++ QA +    ++ +M ER+E+W   +GR Y+++AEK KRF IF+QNV
Sbjct  8    QCLCLALILLGAWSPQAMSSRTLQDAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQNV  67

Query  268  KFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
              IE+FNKA  + YKL VN+F+DLTNEEFKA+
Sbjct  68   ANIEAFNKASEKPYKLAVNEFADLTNEEFKAS  99



>gb|KCW76116.1| hypothetical protein EUGRSUZ_D00493 [Eucalyptus grandis]
Length=354

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 72/107 (67%), Gaps = 3/107 (3%)
 Frame = +1

Query  49   HTTNILSSMASNFDFQLIL---AAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYK  219
            H  N ++ MA     +LIL   + VL+  A  ++  ++  E ++L RHE+WM  HGR+YK
Sbjct  2    HCHNTVNLMAFKKQSRLILLLVSFVLVFWALPAECRSIHRESTLLSRHEQWMAQHGRTYK  61

Query  220  NDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            +  EK +RF IF+ NV++IESFN A  + YKL +N+F+DLTNEEF+A
Sbjct  62   DAEEKDRRFAIFQSNVEYIESFNSAPGRDYKLKINQFADLTNEEFRA  108



>ref|XP_004506025.1| PREDICTED: vignain-like [Cicer arietinum]
Length=342

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +1

Query  103  LAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            LA  L+ G  A +  A   E+ S+LER+E+WM  +G+ YK   EKA R++IF++NV+FIE
Sbjct  12   LALFLVFGLLALETNARSLEDASLLERYEQWMTQNGKVYKGSQEKALRYQIFKENVQFIE  71

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFK  357
            +FNK GN+ YKLG+N+F+DLTNEEFK
Sbjct  72   AFNKGGNKPYKLGINQFADLTNEEFK  97



>ref|XP_006492717.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 gb|KDO63019.1| hypothetical protein CISIN_1g018968mg [Citrus sinensis]
Length=348

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            ++LL + ASQ  +     E S++E HEKWM  HGRSYK++ EK  RFKIF++N+++IE  
Sbjct  22   IILLVSCASQVVSSRSTHEQSVVEMHEKWMAQHGRSYKDELEKEMRFKIFKENLEYIEKA  81

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKA  360
            NK GN++YKLG N+FSDLTN+EF+A
Sbjct  82   NKEGNRTYKLGTNRFSDLTNDEFRA  106



>ref|XP_010094328.1| Fruit bromelain [Morus notabilis]
 gb|EXB55748.1| Fruit bromelain [Morus notabilis]
Length=339

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            F +I+ ++L +    + + +L +  ++ ERHE+W++ HGRSY+NDAEK KRFKIF+ NV 
Sbjct  4    FLIIVLSILGIWTSQTMSRSLHKAVTLTERHEQWILRHGRSYENDAEKKKRFKIFKDNVN  63

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEF  354
            FIE FNK  N++YK+ +NKF+D+T EEF
Sbjct  64   FIERFNKGENRTYKMSINKFADMTREEF  91



>ref|XP_006446541.1| hypothetical protein CICLE_v10015814mg [Citrus clementina]
 gb|ESR59781.1| hypothetical protein CICLE_v10015814mg [Citrus clementina]
Length=346

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  160  EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDL  339
            EPS++ +HE+WM  HGR+YK++ EKA R KIF+QN+++IE  NK GN++YKLG N+FSDL
Sbjct  35   EPSIVAKHEQWMAQHGRTYKDELEKAMRLKIFKQNLEYIEKANKEGNRTYKLGTNEFSDL  94

Query  340  TNEEFKAT  363
            TNEEF+A+
Sbjct  95   TNEEFRAS  102



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 67/91 (74%), Gaps = 3/91 (3%)
 Frame = +1

Query  100  ILAAVLLLGAFASQA---TALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            IL  +L+LG +ASQA   T LD   SML+RHE+WM  +   YK+D E+ KRF+IF+ NV+
Sbjct  11   ILLTLLVLGVWASQANCRTLLDAHTSMLDRHEQWMARYVPIYKDDEEREKRFQIFKDNVE  70

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            FIESFN A NQ YKL +N F+D ++EEF+A+
Sbjct  71   FIESFNYASNQPYKLNINGFADQSHEEFQAS  101



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV  267
            Q  +  +++LG + S ATA  + + P M  RHE+WM  +GR YK+  EK +RF+IF+ N 
Sbjct  6    QCFVLKLIVLGVWVSGATARGIADVP-MSTRHEQWMAQYGRVYKDAVEKERRFQIFKDNS  64

Query  268  KFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLN  372
             +IES N+AGN+ YKLG+N+F+D+TNEEFKA+ L 
Sbjct  65   NYIESVNRAGNRKYKLGLNQFADMTNEEFKASHLG  99



>ref|XP_006362428.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGA-FASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA   +++    A+L++G  +A++AT+ D  E SM++++EKWM   GR Y++D EKAKRF
Sbjct  1    MALTINWKSAFLALLVIGILWANEATSRDLNEASMVQKNEKWMARFGRVYRDDTEKAKRF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
             IF+ N  +I+S NKAG + YKL +N F+DLTNEEF+AT
Sbjct  61   NIFKDNFDYIQSINKAGMRPYKLSINGFADLTNEEFRAT  99



>ref|XP_010052196.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
Length=345

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI  276
            L+++ VL+  A  ++  ++  E ++L RHE+WM  HGR+YK+  EK +RF IF+ NV++I
Sbjct  12   LLVSFVLVFWALPAECRSIHRESTLLSRHEQWMAQHGRTYKDAEEKDRRFAIFQSNVEYI  71

Query  277  ESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            ESFN A  + YKL +N+F+DLTNEEF+A
Sbjct  72   ESFNSAPGRDYKLKINQFADLTNEEFRA  99



>ref|XP_010686289.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Beta 
vulgaris subsp. vulgaris]
Length=344

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = +1

Query  70   SMASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            ++ SN  F ++L  + L G+ AS +  LD+EPSM+  HEKWM  HGR Y ND EK +RFK
Sbjct  2    ALLSNLCF-ILLFVLALWGSLAS-SRLLDDEPSMIIEHEKWMNIHGRVYTNDVEKTRRFK  59

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF +NVK IE  NK  N+ + LGVN F+DLTNEEF+A+
Sbjct  60   IFNENVKRIELLNKM-NRGFTLGVNAFADLTNEEFRAS  96



>gb|AFP73348.1| cysteine protease [Solanum lycopersicoides]
Length=343

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA   D   IL  +  ++  F SQ TA  +   S+ ERHE WM  HGR YK++ EK +RF
Sbjct  1    MAMKIDLMSILITLFFVISMFNSQTTARSQPKLSVSERHELWMSRHGRVYKDEVEKGERF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEF  354
             IF++N+KFIES NKAGN SYKLG+N+F+D+T+EEF
Sbjct  61   MIFKENMKFIESVNKAGNLSYKLGINEFADITSEEF  96



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  169  MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNE  348
            M+ RHE+WM  +GR YK +AEK KRF IF++NV++IESFNKAG + YKLG+N F+DLTN+
Sbjct  33   MVVRHEQWMAQYGRVYKTEAEKTKRFNIFKENVEYIESFNKAGTKPYKLGINAFADLTNQ  92

Query  349  EFKAT  363
            EFKA+
Sbjct  93   EFKAS  97



>gb|EEC84514.1| hypothetical protein OsI_31214 [Oryza sativa Indica Group]
Length=348

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 66/93 (71%), Gaps = 2/93 (2%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            IL  + L  A  + A  L ++ +M  RHE+WM  +GR YK+DAEKA+RF++F+ N  FIE
Sbjct  11   ILGCLCLCSAVLA-ARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANAAFIE  69

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            SFN AGN  + LGVN+F+DLTN+EF+ T  N+G
Sbjct  70   SFN-AGNHKFWLGVNQFADLTNDEFRLTKTNKG  101



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = +1

Query  130  FASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQS  306
            +ASQ+TA      SM+E+HE+WM+ +GR+YK+DAEKA R+KIF+QNV++I+S ++A N++
Sbjct  2    WASQSTARTLPHKSMIEKHEQWMLQYGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAENRT  61

Query  307  YKLGVNKFSDLTNEEFKAT  363
            YKL +NKF+DLT++EFKA+
Sbjct  62   YKLAINKFADLTSDEFKAS  80



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + LA + LLGA  SQA A   ++ SM E+HE+WM   GR Y +  EK  R+KIF++NV+ 
Sbjct  10   ISLALIFLLGALVSQAMARTLQDASMHEKHEEWMSRFGRVYNDGNEKEIRYKIFKENVQR  69

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IESFNKA  +SYKLG+N+F+DLTNEEFK +
Sbjct  70   IESFNKASGKSYKLGINQFADLTNEEFKTS  99



>ref|XP_002519955.1| cysteine protease, putative [Ricinus communis]
 gb|EEF42559.1| cysteine protease, putative [Ricinus communis]
Length=321

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA + + +L +A +++   +ASQA A  L  E +++E+HE+WM  HGR+Y++  EK +RF
Sbjct  1    MALSLEKKLAIALLVVFSTWASQAMARQLINEDALVEKHEQWMARHGRTYQDSEEKERRF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +IF+ N+++I++FNKA NQ+Y+LG+N F+DL++EE+ AT
Sbjct  61   QIFKSNLEYIDNFNKASNQTYQLGLNNFADLSHEEYVAT  99



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALDEEPSMLE-RHEKWMVHHGRSYKNDAEKAKRFK  249
            MASN   +L++A  L+    A  AT+     S++  RHE+WM  +GR YKN+ EK KR+ 
Sbjct  1    MASN-SLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  59

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF++NV++IESFNKAG + YKLG+N F+DLTN+EF A+
Sbjct  60   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIAS  97



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            +  A + +LGA +S AT+   ++PSM  ++E+WM H+GR Y N  EK KRF IF+ NV F
Sbjct  8    MCFALIFMLGALSSHATSRTLQDPSMYGKYEQWMAHYGRVYTNINEKEKRFNIFKANVDF  67

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N   N+ YKL VN+F+DLTNEEFKA+
Sbjct  68   IESSNNDANKPYKLKVNQFADLTNEEFKAS  97



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            F ++L A+L + A  + A  L +EP ML ++E+WM+ +GR YKN+AEK   FKIF++N +
Sbjct  3    FLILLFAILGIWASKTTARTLVDEPLML-KYEQWMIQYGRVYKNNAEKDSHFKIFKKNAE  61

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IE+FN A NQ YKLG+N F+DLTNEEF+A
Sbjct  62   RIEAFNDAANQPYKLGINAFADLTNEEFRA  91



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +1

Query  76   ASNFDFQLILAAVLLLGAFASQ--ATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            A   + ++ L  +L+L A+A++     LDE+  ML+RHE+WM  HGR Y +  EK KR+ 
Sbjct  3    AKKCNTRIFLPFLLILAAWATKIACRPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYL  62

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            IF++N++ IE+FN   ++ YKLGVNKF+DLTNEEF+A
Sbjct  63   IFKENIERIEAFNNGSDRGYKLGVNKFADLTNEEFRA  99



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            +ILA + +LGA +SQAT+   ++ SM  R+E+WM H+GR Y +  EK KRF IF++NV F
Sbjct  12   IILALIFMLGALSSQATSRTLQDASMYGRYEQWMAHYGRVYSDINEKEKRFNIFKENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N   N+ +KL VN+F+DLTNEEFKA+
Sbjct  72   IESSNNDANKLHKLSVNQFADLTNEEFKAS  101



>gb|AGT16936.1| vignain-like protein [Saccharum hybrid cultivar R570]
Length=341

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            F +++ A L   A A++    D++ +M+ERHE+WM  + R YK+  EKA+RF++F+ NVK
Sbjct  9    FGILVGAFLCSAALAARDLN-DDDSAMVERHEQWMAQYSRVYKDATEKAQRFEVFKVNVK  67

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            FIESFN A N+ + LGVN+F+DLT +EF+AT  N+G
Sbjct  68   FIESFNAARNRKFWLGVNQFADLTIDEFRATKTNKG  103



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            Q+ LA + +L A+ S++ A   ++ SM ERHE+WM  +GR YK+DAEK  R+ IF++NV 
Sbjct  34   QICLALLFVLVAWPSKSVARTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVA  93

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
             I++FN    +SYKLGVN+F+DL+NEEFKA+
Sbjct  94   RIDAFNSQTGKSYKLGVNQFADLSNEEFKAS  124



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  160  EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDL  339
            E S+ ERHE WM  H R YK+  EK  RF+IF +NVKFIESFNKAGN+SYKLG+N F+DL
Sbjct  15   EASLEERHEIWMAQHERVYKDATEKEMRFQIFRENVKFIESFNKAGNKSYKLGINAFTDL  74

Query  340  TNEEFKAT  363
            TN+EF+A+
Sbjct  75   TNKEFRAS  82



>ref|XP_009354265.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + L  +L+LGA++SQAT+   ++ +M  RHE+W+  +GR Y N  EK  RFKI ++NV F
Sbjct  12   MYLGLILMLGAWSSQATSRSLQDAAMYGRHEQWLARYGRVYNNVNEKETRFKILKENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +ES NK  N+ YKL VN+F+DLTNEEFKA+
Sbjct  72   VESSNKDANKPYKLSVNQFADLTNEEFKAS  101



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + L  +L+LGA++SQAT+   ++ SM  R+E+W+  +GR Y +  EK  RFKIF++NV F
Sbjct  12   MCLGLILMLGAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES NK  N  YKL VN+F+DLTNEEFKA+
Sbjct  72   IESSNKDANTPYKLRVNQFADLTNEEFKAS  101



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI  276
             LA +++LGA++S+AT+   ++ SM  RHE+WMV +GR Y ++ EK KRFKIF++NV +I
Sbjct  14   CLALIIMLGAWSSKATSRSLQDASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFKENVAYI  73

Query  277  ESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            ES N   ++ YKL VN+F+DLTNEEF A+
Sbjct  74   ESSNADASKPYKLRVNQFTDLTNEEFIAS  102



>sp|Q7XWK5.2|SAG39_ORYSJ RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa Japonica Group]
 gb|EAZ29764.1| hypothetical protein OsJ_13822 [Oryza sativa Japonica Group]
Length=339

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 67/93 (72%), Gaps = 2/93 (2%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            IL  + L  A  + A  L ++ +M  RHE+WM  +GR Y++DAEKA+RF++F+ NV FIE
Sbjct  11   ILGCLCLCSAVLA-ARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFKANVAFIE  69

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            SFN AGN ++ LGVN+F+DLTN+EF+    N+G
Sbjct  70   SFN-AGNHNFWLGVNQFADLTNDEFRWMKTNKG  101



>ref|XP_010091715.1| hypothetical protein L484_001478 [Morus notabilis]
 gb|EXB44999.1| hypothetical protein L484_001478 [Morus notabilis]
Length=353

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATAL--DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            + LA  L+LG +ASQA      EE S+ E HE+WM  HGR+YK++AEK +R KI+++N++
Sbjct  10   IFLALNLVLGLWASQAECRKPPEEASLRESHEQWMARHGRTYKDNAEKEQRLKIYKENLE  69

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +++ FN  GNQ++KL +N+F+DLTNEEF  T
Sbjct  70   YVKKFNSEGNQTFKLSLNRFADLTNEEFDYT  100



>ref|XP_006470291.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Citrus 
sinensis]
Length=346

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            ++L+   ASQ  +     EPS++E+HE+WM  HGR+YK++ EKA R  IF+QN+++I   
Sbjct  17   IILVITCASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKA  76

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKA  360
            NK GN++YKLG N+FSDLTNEEF+A
Sbjct  77   NKEGNRTYKLGTNEFSDLTNEEFRA  101



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 67/92 (73%), Gaps = 2/92 (2%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD--EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV  267
            Q +  A++LLGA+  QA +    ++ +M ER+E+W   +GR Y+++AEK KRF IF+QNV
Sbjct  8    QCLCLALILLGAWIPQALSSRALQDAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQNV  67

Query  268  KFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
              IE+FNKA  + YKL VN+F+DLTNEEFK +
Sbjct  68   AHIEAFNKASKKPYKLAVNEFADLTNEEFKVS  99



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI  276
             LA +++LGA++S+AT+   ++ SM  RHE+WMV +GR Y ++ EK KRFKIF++NV +I
Sbjct  14   CLALIIMLGAWSSKATSRSLQDASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFKENVAYI  73

Query  277  ESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            ES N   ++ YKL VN+F+DLTNEEF A+
Sbjct  74   ESSNADSSKPYKLRVNQFTDLTNEEFIAS  102



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            +    +L+LGA++SQAT+   ++ SM  R+E+W+  +GR Y +  EK  RFKIF++NV F
Sbjct  12   MCFGLILMLGAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES NK  N+ YKL VN+F+DLTNEEFKA+
Sbjct  72   IESSNKDANKPYKLSVNQFADLTNEEFKAS  101



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = +1

Query  115  LLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN  288
            ++LG + S ATA  + +EP M  RHE+WMV +GR Y + AEK +RF+IF  N ++IES N
Sbjct  1    MVLGVWVSGATAHGIADEP-MSRRHEQWMVQYGRVYMDAAEKERRFQIFRDNYEYIESVN  59

Query  289  KAGNQSYKLGVNKFSDLTNEEFKATMLN  372
            +AG++ YKLG+N+F+D+TN EFKA+ L 
Sbjct  60   RAGDRKYKLGLNQFADMTNGEFKASHLG  87



>ref|XP_006470296.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=347

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            ++L+   ASQ  +     EPS++E+HE+WM  HGR+YK++ EKA R  IF+QN+++I   
Sbjct  17   IILVITCASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKA  76

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKA  360
            NK GN++YKLG N+FSDLTNEEF+A
Sbjct  77   NKEGNRTYKLGTNEFSDLTNEEFRA  101



>ref|XP_002522571.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39871.1| cysteine protease, putative [Ricinus communis]
Length=343

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 71/93 (76%), Gaps = 4/93 (4%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            +L++  +++LG + SQA     L+ E ++ E+HE+WM  HGR+Y ++AEK +RF+IF+ N
Sbjct  9    KLVITLLMILGTWVSQAMPRPLLNAE-AIAEKHEQWMARHGRTYHDNAEKERRFQIFKNN  67

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            + +IE+FNKA N++YKLG+NKFSDL+ EEF  T
Sbjct  68   LDYIENFNKAFNKTYKLGLNKFSDLSEEEFVTT  100



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  169  MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNE  348
            M+ RHE+WM  +GR Y+N+ EK KRF IF++NV++IESFNKAG + YKLG+N F+DLTN+
Sbjct  35   MVVRHEQWMAQYGRVYENEVEKTKRFNIFKENVEYIESFNKAGTKPYKLGINAFADLTNQ  94

Query  349  EFKAT  363
            EFKA+
Sbjct  95   EFKAS  99



>ref|XP_010045989.1| PREDICTED: vignain-like [Eucalyptus grandis]
 gb|KCW84693.1| hypothetical protein EUGRSUZ_B01513 [Eucalyptus grandis]
Length=255

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +1

Query  112  VLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN  288
            V +LG +ASQA + +  + +M ERHE+WM  HGR Y++ AEK + F IF+ NV++IESFN
Sbjct  2    VTILGLWASQAWSRELHDATMRERHEQWMARHGRVYEDAAEKERCFLIFKTNVEYIESFN  61

Query  289  KAGNQSYKLGVNKFSDLTNEEFKAT  363
            + GN+ YKL +N F+DLT+EEFKA+
Sbjct  62   QDGNKPYKLAINAFADLTSEEFKAS  86



>ref|XP_002436842.1| hypothetical protein SORBIDRAFT_10g009850 [Sorghum bicolor]
 gb|EER88209.1| hypothetical protein SORBIDRAFT_10g009850 [Sorghum bicolor]
Length=296

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  169  MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNE  348
            M+ RHE+WMV + R YK+  EKA+RF++F+ NVKFIESFN  GN+ + LGVN+F+DLTN+
Sbjct  1    MVARHEQWMVQYSRVYKDATEKAQRFEVFKSNVKFIESFNAGGNRKFWLGVNQFADLTND  60

Query  349  EFKATMLNEG  378
            EF+AT  N+G
Sbjct  61   EFRATKTNKG  70



>ref|XP_003539970.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            +A N  + + LA +  LG +A Q T+   ++ SM ERHE+WM  + + YK+  E+ KRFK
Sbjct  2    VAKNQFYHISLALLFCLGFWAFQVTSRTLQDASMYERHEEWMARYAKVYKDPEEREKRFK  61

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            IF++NV +IE+FN A N+ YKLG+N+F+DLTNEEF A
Sbjct  62   IFKENVNYIEAFNNAANKPYKLGINQFADLTNEEFIA  98



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = +1

Query  91   FQLILAAVL-LLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQ  261
            FQ +  A+L ++GA+ S++ A  L + P M ERHE+WM  +GR YK+D E+A R+ IF++
Sbjct  27   FQFVCLALLFIVGAWPSKSIARTLLDAP-MYERHEQWMTQYGRVYKDDNERATRYSIFKE  85

Query  262  NVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            NV  +++FN    +SYKLGVN+F+DLTNEEFKA+
Sbjct  86   NVARVDAFNSQTGKSYKLGVNQFADLTNEEFKAS  119



>ref|XP_008659445.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW86316.1| hypothetical protein ZEAMMB73_635707 [Zea mays]
Length=340

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            IL      GA A  A  L ++ +M+ RHE+WM  + R YK+ +EKA+RF++F+ NVKFIE
Sbjct  11   ILGFAFFCGA-ALAARDLSDDSAMVARHEQWMAQYSRVYKDASEKARRFEVFKANVKFIE  69

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            SFN  GN  + LGVN+F+DLTN+EF++   N+G
Sbjct  70   SFNAGGNNKFWLGVNQFADLTNDEFRSIKTNKG  102



>ref|XP_003578808.1| PREDICTED: senescence-specific cysteine protease SAG39 [Brachypodium 
distachyon]
Length=339

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            IL  + L G+  + A  L+++ SM+ RHE WM+ +GR YK+ AEKA++F++F+ N +FI 
Sbjct  11   ILGCLCLCGSVLA-ARELNDDLSMVARHENWMLQYGRVYKDAAEKAQKFEVFKANAEFIN  69

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            SFN AGN  + LG+N+F+D+TNEEFKAT  N+G
Sbjct  70   SFN-AGNHKFWLGINQFADITNEEFKATKTNKG  101



>ref|XP_010279091.1| PREDICTED: ervatamin-B [Nelumbo nucifera]
Length=345

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MAS    + +   + +L  +A QAT+   +E S+ +++E+W+ +HGR Y N AEK KRFK
Sbjct  1    MASACQCRSLCVTLFILSVWAPQATSRRLQETSIAKKYEEWVNNHGRVYNNVAEKEKRFK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF  N+ FIESFN   NQSYKL +NKF+DLTNEEF +T
Sbjct  61   IFRDNLNFIESFNSIRNQSYKLNLNKFADLTNEEFTST  98



>gb|EMT20796.1| Vignain [Aegilops tauschii]
Length=394

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 83/141 (59%), Gaps = 6/141 (4%)
 Frame = +1

Query  43   SFHTTNILS-----SMASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHG  207
            S H T +++     +MA +    L +   L   +    A  L+++ SM+ RHE+WMV + 
Sbjct  41   STHCTLVVAQSIKHTMAISKALILSILGCLCFCSSVLAARELNDDLSMVARHERWMVQYN  100

Query  208  RSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEGkap  387
            R YK+  EKA RF++F+ NV FIESFN A N+ + LG+N+F+DLTNEEFKAT  N+G  P
Sbjct  101  RVYKDTTEKAHRFEVFKANVGFIESFN-AENRKFYLGINQFTDLTNEEFKATKANKGYRP  159

Query  388  prprpskpasllNESLAEVPE  450
               R        N SL  +PE
Sbjct  160  SLERVPTGFRYENVSLDALPE  180



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +1

Query  76   ASNFDFQLILAAVLLLGAFASQ--ATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            A   + ++ +  +L+L A+A++     LDE+  ML+RHE+WM  HGR Y +  EK KR+ 
Sbjct  3    AKKCNTRIFVPFLLILAAWATKIACRPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYL  62

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            IF++N++ IE+FN   ++ YKLGVNKF+DLTNEEF+A
Sbjct  63   IFKENIERIEAFNNGSDRGYKLGVNKFADLTNEEFRA  99



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + LA + +LGA++SQAT+ + ++ SM  ++E+WM  +GR Y +  EK  RFKIF++NV F
Sbjct  12   ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMARYGRVYTDIQEKEMRFKIFKENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N   N+ YKL VN+F+DLTNEEFKA+
Sbjct  72   IESSNSDANKPYKLSVNQFADLTNEEFKAS  101



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  160  EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDL  339
            E SM+++H +WM   GR+YK+DAEKAKR KIF++N ++I+S NKAG + YKLG+N F+DL
Sbjct  13   EASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYIDSVNKAGIRPYKLGINDFADL  72

Query  340  TNEEFKAT  363
            TNEEF+AT
Sbjct  73   TNEEFRAT  80



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + LA + +LGA++SQAT+ + ++ SM  ++E+WM  +GR Y +  EK  RFKIF++NV F
Sbjct  12   ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMARYGRVYTDIQEKEMRFKIFKENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N   N+ YKL VN+F+DLTNEEFKA+
Sbjct  72   IESSNSDANKPYKLSVNQFADLTNEEFKAS  101



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 68/92 (74%), Gaps = 1/92 (1%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV  267
            F   LA +++LGA++S+AT+   ++ SM  RHE+WM  +GR Y ++ EK KRFKIF++NV
Sbjct  11   FCTCLALIIMLGAWSSEATSRSLQDASMYGRHEQWMTRYGRVYTDNEEKEKRFKIFKENV  70

Query  268  KFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
             +IES N   ++ YKL VN+F+DLTNEEF A+
Sbjct  71   AYIESSNADTSKPYKLRVNQFTDLTNEEFIAS  102



>ref|XP_007214697.1| hypothetical protein PRUPE_ppa026948mg [Prunus persica]
 gb|EMJ15896.1| hypothetical protein PRUPE_ppa026948mg [Prunus persica]
Length=340

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + L  +L+LG ++S+AT+ + ++ SM ER+E+WMVH+GR Y +  EK KRF+IF++NV +
Sbjct  11   VCLVLILMLGTWSSEATSHNLQDASMYERYEQWMVHYGREYDDVNEKQKRFEIFKKNVAY  70

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N   N+SYKL VN+F+D TNEE KA+
Sbjct  71   IESSNSDVNKSYKLSVNQFADQTNEEVKAS  100



>ref|XP_004293931.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Fragaria 
vesca subsp. vesca]
Length=345

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 3/88 (3%)
 Frame = +1

Query  97   LILAAVLLLGAFASQAT--ALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            +ILA  +  G  ASQAT  AL  E S+ ++HE+WM  HGR Y + +EK +R  IF +NV+
Sbjct  8    VILAIFISFGTLASQATTHAL-YEASIAQKHEQWMAKHGRVYPDSSEKERRLAIFTKNVE  66

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEF  354
            F+E FNK GN++YKL +NKFSD+TNEEF
Sbjct  67   FVEKFNKEGNKTYKLSINKFSDMTNEEF  94



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA  F+++L  A +L+LG   S  T+    E S+ E+HE+WM  +GR YK+D +KAKR +
Sbjct  1    MAFIFNWRLNFATLLVLGLCISLVTSRTLYEASITEKHEQWMSQYGRVYKDDTKKAKRLE  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             F+QN+++IES NK   ++YKLG+N+F+D+TNEEFKA
Sbjct  61   TFKQNLEYIESTNKDVTRTYKLGINQFADMTNEEFKA  97



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + LA +L+LGA++S+AT+   ++  M  R+E+WM+ +GR Y +  EK KRFKIF++NV F
Sbjct  10   ICLALILILGAWSSEATSRSLQDALMYGRYEQWMIRYGRIYSDTDEKEKRFKIFKENVAF  69

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N   N+ YKL VN F+DLTNEEF A+
Sbjct  70   IESSNDEANKPYKLSVNGFADLTNEEFTAS  99



>ref|XP_010317330.1| PREDICTED: uncharacterized protein LOC101251741 [Solanum lycopersicum]
Length=802

 Score =   102 bits (253),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 48/98 (49%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA   +++    A+ +L  +  + T+ +  E SM+++HEKWM   GR Y++DAEKAKRF 
Sbjct  463  MALTINWKSAFLALAVLTMWTIEVTSRELNEASMVQKHEKWMARFGRVYRDDAEKAKRFN  522

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ NV +IES NK+G + YKL +N F+DLTNEEF+AT
Sbjct  523  IFKDNVDYIESINKSGMRPYKLSINGFADLTNEEFRAT  560



>ref|XP_008659446.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=340

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = +1

Query  103  LAAVLLLGAFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            ++A++    F   A A   L ++  M+ RHE+WM  + R YK+ +EKA+RF++F+ NV+F
Sbjct  8    ISAIIGFAFFCGAAMAARDLSDDSVMVARHEQWMAQYSRVYKDASEKARRFEVFKANVQF  67

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            IESFN  GN  + LGVN+F+DLTN+EF++T  N+G
Sbjct  68   IESFNAGGNNKFWLGVNQFADLTNDEFRSTKTNKG  102



>ref|XP_003540013.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003540014.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN27798.1| Vignain [Glycine soja]
 gb|KHN27800.1| Vignain [Glycine soja]
Length=337

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MAS    Q ILA VLLL    SQ  + +  E SM ERHE+WM  +G+ YK+ AEK KR  
Sbjct  1    MASIGKKQHILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLL  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ NV+FIESFN AGN+ YKL +N  +D TNEEF A+
Sbjct  61   IFKDNVEFIESFNAAGNRPYKLSINHLADQTNEEFVAS  98



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + LA + ++GA   +AT+   ++ SM ERHE+WM  +GR Y ++ E+ +RF IF++NV  
Sbjct  12   ICLAFIFIVGALVCEATSRTLQDASMYERHEQWMARYGRVYHDNNEREQRFNIFKENVAH  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            I+SFN+A ++ YKLGVN+F+DLTNEEF A+
Sbjct  72   IDSFNRAKDKPYKLGVNQFADLTNEEFTAS  101



>gb|ACU23533.1| unknown [Glycine max]
Length=208

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            F L L  V    AF   A  L++ P M ERHE+WM  HG+ Y +  EK ++++ F++NV+
Sbjct  11   FTLALCLVFAFCAFEGNARTLEDAP-MRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQ  69

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IE+FN AGN+ YKLG+N F+DLTNEEFKA
Sbjct  70   RIEAFNHAGNKPYKLGINHFADLTNEEFKA  99



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + L+ +L++GA++S AT+   ++ SM  R+E+W+  +GR Y N  EK  RFKIF +NV F
Sbjct  12   MCLSLILMMGAWSSGATSRTLQDASMYGRYEQWLTRYGRVYNNVNEKETRFKIFNENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES NK  N+ YKL VN+F+DLTNEEFKA+
Sbjct  72   IESSNKYANKPYKLSVNQFADLTNEEFKAS  101



>gb|AFW86317.1| hypothetical protein ZEAMMB73_339067 [Zea mays]
Length=433

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 73/107 (68%), Gaps = 6/107 (6%)
 Frame = +1

Query  67   SSMASNFDFQLILAAVLLLGAFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKA  237
            S+MA+    +  ++A++    F   A A   L ++  M+ RHE+WM  + R YK+ +EKA
Sbjct  92   STMAT---LKASISAIIGFAFFCGAAMAARDLSDDSVMVARHEQWMAQYSRVYKDASEKA  148

Query  238  KRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLNEG  378
            +RF++F+ NV+FIESFN  GN  + LGVN+F+DLTN+EF++T  N+G
Sbjct  149  RRFEVFKANVQFIESFNAGGNNKFWLGVNQFADLTNDEFRSTKTNKG  195



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + LA + ++GA   +AT+   ++ SM ERHE+WM  +GR Y+++ E+ +RF IF++NV  
Sbjct  12   ICLAFIFIVGALVCEATSRTLQDASMYERHEQWMARYGRVYQDNNEREQRFNIFKENVAR  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            I+SFN+A ++ YKLGVN+F+DLTN+EF A+
Sbjct  72   IDSFNRAKDKPYKLGVNQFADLTNDEFTAS  101



>dbj|BAF56429.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD---EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            Q ILA  LLL    S+  + +    E S++ERHE+WM  + + YK+ AEK KRF IF+ N
Sbjct  9    QYILALFLLLAVGISRVISRELHETETSLIERHEQWMAKYDKVYKDAAEKEKRFLIFKDN  68

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            V+FIESFN AGN+ YKLGVN  +DLT EEFKA+
Sbjct  69   VEFIESFNAAGNKPYKLGVNHLADLTIEEFKAS  101



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV  267
            Q  +  +++LG + S ATA  + + P +  RHE+WM  +GR YK+  EK +RF+IF+ N 
Sbjct  6    QCFVLKLIVLGVWVSAATARGIADVP-ISTRHEQWMARYGRVYKDAVEKERRFQIFKDNH  64

Query  268  KFIESFNKAGNQSYKLGVNKFSDLTNEEFKATMLN  372
             +IES N+AGN+ YKLG+N+F+D+TNEEFKA+ L 
Sbjct  65   NYIESVNRAGNRKYKLGLNQFADMTNEEFKASHLG  99



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD--EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV  267
            Q +  A++LLGA+  QA +    ++ +M ER+E+W   +GR Y+++ EK KRF IF+QNV
Sbjct  8    QCLCLALILLGAWIPQAMSSRTLQDAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKQNV  67

Query  268  KFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
              IE+FNKA  + YKL VN+F+DLTNEEFK +
Sbjct  68   AHIEAFNKASKKPYKLAVNEFADLTNEEFKVS  99



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV  267
            F   LA V++    A +A A   ++ SM ERHE+WMV HG+ Y + +EK ++++IF++NV
Sbjct  7    FHSTLALVIVFAFCALEANARTLQDASMRERHEQWMVTHGKLYLDSSEKEQKYQIFKENV  66

Query  268  KFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            + IE+FN AGN+ YKLG+N+F+DLTNEEFKA
Sbjct  67   QRIEAFNNAGNKPYKLGINQFADLTNEEFKA  97



>ref|XP_004489011.1| PREDICTED: vignain-like [Cicer arietinum]
Length=343

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +1

Query  112  VLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN  288
            VL LG +A QAT+ + ++ SM ERHE+WM  +G+ YKN  E+ KRF IF++NV +IE  N
Sbjct  15   VLCLGLWAFQATSRNLQDDSMHERHEQWMGQYGKVYKNAKEREKRFGIFKENVNYIEVSN  74

Query  289  KAGNQSYKLGVNKFSDLTNEEFKAT  363
              GN+SYKLG+N+F+DLTN EF A+
Sbjct  75   SVGNKSYKLGINEFADLTNHEFVAS  99



>ref|XP_010042857.1| PREDICTED: actinidain-like [Eucalyptus grandis]
Length=133

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD--EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA +   + I+A  L+L A+A  AT++    E ++ E+HE+WM  +GR+YK+  EK KR 
Sbjct  1    MAFSVKSEFIVALALILNAWAWHATSVRTLHESNIAEQHEQWMAQYGRTYKDQGEKEKRR  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEF  354
             IF+++++FIE FN +GN+++KLG+N+FSDLT++EF
Sbjct  61   AIFKKHLQFIEDFNASGNRTFKLGINQFSDLTDDEF  96



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  124  GAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAG  297
            G + SQA A  L  E SMLERHE+WM  HG  Y++  EK KRF IF+ NV+ IE+FN AG
Sbjct  21   GIWVSQAAARTLPAEASMLERHEQWMASHGVLYEDAVEKEKRFTIFKDNVERIEAFNMAG  80

Query  298  NQSYKLGVNKFSDLTNEEFKAT  363
            N+ YKL VN+F+D TNEEFKA+
Sbjct  81   NKPYKLSVNRFADQTNEEFKAS  102



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            +A N  + + LA +L +   A Q T    ++ SM ERHE+WM  +G+ YK+  E+ KRF+
Sbjct  2    VAKNHFYHISLAMLLCMAFLAFQVTCRTLQDASMYERHEQWMTRYGKVYKDPQEREKRFR  61

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            IF++NV +IE+FN A N+ YKL +N+F+DLTNEEF A
Sbjct  62   IFKENVNYIEAFNNAANKRYKLAINQFADLTNEEFIA  98



>ref|XP_003539989.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            +A N  + + LA +  LG +A Q T+   ++ SM ERHE+WM  + + YK+  E+ KRFK
Sbjct  2    VAKNQFYHISLALLFCLGFWAFQVTSRTLQDASMYERHEEWMARYAKVYKDPEEREKRFK  61

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            IF++NV +IE+FN A ++ YKLG+N+F+DLTNEEF A
Sbjct  62   IFKENVNYIEAFNNAADKPYKLGINQFADLTNEEFIA  98



>ref|XP_008342781.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + L  +L+L A++SQAT+   ++ SM  R+E+W+  +GR Y +  EK  RFKIF++NV F
Sbjct  1    MCLGLILMLXAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAF  60

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES NK  N+ YKL VN+F DLTNEEFKA+
Sbjct  61   IESSNKDANKPYKLSVNQFXDLTNEEFKAS  90



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = +1

Query  73   MASNFDFQLI-LAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA+N     I LA  L LG +A Q T+   ++ SM E HE+WM H+G+ YK+  EK KR 
Sbjct  1    MAANNQLYYISLALFLCLGLWAIQGTSRTLQDDSMYESHEQWMRHYGKVYKDSQEKEKRS  60

Query  247  KIFEQNVKFIESFNKAGN-QSYKLGVNKFSDLTNEEF  354
            KIF QN+ +I++FN AGN ++YKLG+N+++DLTNEEF
Sbjct  61   KIFTQNINYIQAFNNAGNDKAYKLGINQYADLTNEEF  97



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + L  +L+L A++SQAT+   ++ SM  R+E+W+  +GR Y +  EK  RFKIF++NV F
Sbjct  1    MCLGLILMLXAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAF  60

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES NK  N+ YKL VN+F DLTNEEFKA+
Sbjct  61   IESSNKDANKPYKLSVNQFXDLTNEEFKAS  90



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 67/89 (75%), Gaps = 3/89 (3%)
 Frame = +1

Query  109  AVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIES  282
            A+++LG + S ATA  + +EP M  +HE+WM  +GR Y + AEK +RF+IF  N ++I+S
Sbjct  9    ALMVLGVWVSGATARGIADEP-MRTKHEQWMAQNGRVYTDAAEKERRFQIFRDNYEYIKS  67

Query  283  FNKAGNQSYKLGVNKFSDLTNEEFKATML  369
             N+AG++ YKLG+N+F+DLTN EFKA+ L
Sbjct  68   VNRAGDRKYKLGLNQFADLTNGEFKASRL  96



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + L+ +L+LGA++S AT+   ++ SM  R+E+W+  +GR Y +  EK  RFKIF++NV F
Sbjct  12   MCLSLILMLGAWSSGATSRTLQDASMYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES NK  N+ Y+L VN+F+DLTNEEFKA+
Sbjct  72   IESSNKDANKPYRLSVNQFADLTNEEFKAS  101



>ref|XP_009798360.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=341

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 66/89 (74%), Gaps = 3/89 (3%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            Q IL  V++ G + SQ T+ + +E SMLE+HE WM +HGR+YKN+ EK KR  IF++NVK
Sbjct  10   QFILLFVII-GMYESQVTSRNIQELSMLEKHELWMANHGRTYKNEEEKEKRLNIFKENVK  68

Query  271  FIESFNKAG-NQSYKLGVNKFSDLTNEEF  354
            FIESFN  G  + YK+G+N F+DLT EEF
Sbjct  69   FIESFNNNGIKKPYKIGINAFADLTAEEF  97



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 67/89 (75%), Gaps = 3/89 (3%)
 Frame = +1

Query  109  AVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIES  282
            A+++LG + S ATA  + +EP M  +HE+WM  +GR Y + AEK +RF+IF  N ++I+S
Sbjct  35   ALMVLGVWVSGATARGIADEP-MRTKHEQWMAQNGRVYTDAAEKERRFQIFRDNYEYIKS  93

Query  283  FNKAGNQSYKLGVNKFSDLTNEEFKATML  369
             N+AG++ YKLG+N+F+DLTN EFKA+ L
Sbjct  94   VNRAGDRKYKLGLNQFADLTNGEFKASRL  122



>ref|XP_006582263.1| PREDICTED: vignain-like [Glycine max]
Length=338

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            M S    Q ILA VLLL    SQ  + +  E SM ERHE+WM  +G+ YK+ AEK KR  
Sbjct  1    MGSMGKKQHILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLL  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ NV+FIESFN AGN+ YKL +N  +D TNEEF A+
Sbjct  61   IFKDNVEFIESFNAAGNKPYKLSINHLADQTNEEFVAS  98



>ref|XP_006582264.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN33267.1| Vignain [Glycine soja]
Length=338

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            M S    Q ILA VLLL    SQ  + +  E SM ERHE+WM  +G+ YK+ AEK KR  
Sbjct  1    MGSMGKKQHILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLL  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IF+ NV+FIESFN AGN+ YKL +N  +D TNEEF A+
Sbjct  61   IFKDNVEFIESFNAAGNKPYKLSINHLADQTNEEFVAS  98



>gb|AFP73357.1| cysteine protease [Solanum habrochaites]
Length=344

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA   D   IL  +  ++  F SQ  A  +   S+ ERHE WM  HGR YK++ EK +RF
Sbjct  1    MAMKVDLMSILITLFFVISMFNSQTRARSQPKLSVSERHELWMSRHGRVYKDEVEKGERF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IF++N+KFIES NKAGN SYKLG+N+F+D+T+EEF A
Sbjct  61   MIFKENMKFIESVNKAGNLSYKLGMNEFADITSEEFLA  98



>gb|AFP73358.1| cysteine protease, partial [Solanum habrochaites]
Length=345

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA   D   IL  +  ++  F SQ  A  +   S+ ERHE WM  HGR YK++ EK +RF
Sbjct  1    MAMKVDLMSILITLFFVISMFNSQTRARSQPKLSVSERHELWMSRHGRVYKDEVEKGERF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IF++N+KFIES NKAGN SYKLG+N+F+D+T+EEF A
Sbjct  61   MIFKENMKFIESVNKAGNLSYKLGMNEFADITSEEFLA  98



>ref|XP_008244477.1| PREDICTED: zingipain-2-like [Prunus mume]
Length=340

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 71/99 (72%), Gaps = 5/99 (5%)
 Frame = +1

Query  82   NFDFQL----ILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF  246
            NF  QL     L  +L+LG ++S+AT+ + ++ SM ER+E+WMV +GR Y +  EK KRF
Sbjct  2    NFSKQLWRCVCLVLILMLGTWSSEATSRNLQDASMYERYEQWMVRYGREYDDVNEKQKRF  61

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            +IF++NV +IES N   N+SYKL VN+F+D TNEE KA+
Sbjct  62   EIFKKNVAYIESSNSDVNKSYKLSVNQFADQTNEEVKAS  100



>gb|AAP32195.1| cysteine protease 5 [Trifolium repens]
Length=343

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  76   ASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKI  252
            A+N  + + LA    LG  A Q T+   ++ S+ ERHE+WM H+G+ YKN  E+ KR +I
Sbjct  3    ANNQLYHVSLALFFCLGLLAIQVTSRTLQDDSIFERHEQWMTHYGKVYKNPQEREKRLRI  62

Query  253  FEQNVKFIESFNKAG-NQSYKLGVNKFSDLTNEEFKAT  363
            F +N+K+IE+ N AG N+ YKLG+N+F+DLTNEEF A+
Sbjct  63   FTENLKYIEASNNAGNNKPYKLGINQFADLTNEEFIAS  100



>gb|AFP73326.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +1

Query  73   MASNFDFQLILAAVL-LLGAFASQATALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKRF  246
            MA   D   IL  +  ++  F SQ  A  +   S+ ERHE WM  HGR YK++ EK +RF
Sbjct  1    MAMKVDLMSILITLFFVISMFNSQTRARSQPKLSVSERHELWMSRHGRVYKDEVEKGERF  60

Query  247  KIFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IF++N+KFIES NKAGN SYKLG+N+F+D+T++EF A
Sbjct  61   MIFKENIKFIESVNKAGNLSYKLGMNEFADITSQEFLA  98



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            +ILA + +LGA +SQAT+   ++ SM  R+E+WM  +GR Y +  EK KRF IF++NV F
Sbjct  12   IILALIFMLGALSSQATSRTLQDASMYGRYEQWMARYGRVYSDINEKEKRFNIFKENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N   N+ +KL VN+F+DLTNEEFKA+
Sbjct  72   IESSNNDANKLHKLSVNQFADLTNEEFKAS  101



>gb|AAP32198.1| cysteine protease 12 [Trifolium repens]
Length=343

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  76   ASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKI  252
            A+N  + + LA    LG  A Q T+   ++ S+ ERHE+WM H+G+ YKN  E+ KR +I
Sbjct  3    ANNQLYHVSLALFFCLGLLAIQVTSRTLQDDSIFERHEQWMTHYGKVYKNPQEREKRLRI  62

Query  253  FEQNVKFIESFNKAGN-QSYKLGVNKFSDLTNEEFKAT  363
            F +N+K+IE+ N AGN + YKLG+N+F+DLTNEEF A+
Sbjct  63   FTENLKYIEASNNAGNKKPYKLGINQFADLTNEEFIAS  100



>ref|XP_009798361.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=339

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            MA  F+++L  A +L+LG   S  T+    E S+ E+HE+WM  +GR Y +D EK +R +
Sbjct  1    MAFMFNWRLNFAILLVLGLCVSLVTSRALYEASITEKHEQWMTQYGRVYTDDTEKTERLE  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
             F+QN+++IES NK   ++YKLG+N+F+D+TNEEFKA+
Sbjct  61   TFKQNLEYIESINKDVTRTYKLGINQFADMTNEEFKAS  98



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            Q   A +L+LG +A +  + + +E SM  RHE+WM  +G+ Y + AE  +RFKIF+ NV+
Sbjct  8    QCFFAFILILGMWAFEVASRELQESSMSARHEQWMATYGKVYVDAAEIERRFKIFKDNVE  67

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            +IESFN AGN+ YKL VNKF+D TNEEFK 
Sbjct  68   YIESFNTAGNKPYKLSVNKFADQTNEEFKG  97



>gb|KDO37366.1| hypothetical protein CISIN_1g048025mg, partial [Citrus sinensis]
Length=246

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  160  EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVNKFSDL  339
            EPS++ +HE+WM  HGR+YK++ EKA R  IF+QN+++I   NK GN++YKLG N+FSDL
Sbjct  3    EPSIVAKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKANKEGNRTYKLGTNEFSDL  62

Query  340  TNEEFKAT  363
            TNEEF+A+
Sbjct  63   TNEEFRAS  70



>ref|XP_006445663.1| hypothetical protein CICLE_v10015799mg [Citrus clementina]
 gb|ESR58903.1| hypothetical protein CICLE_v10015799mg [Citrus clementina]
Length=348

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            ++LL + ASQ  +     E S++E H+KWM  HGRSYK++ EK  R KIF++N+++IE  
Sbjct  22   IILLVSCASQVVSSRSTHEQSVVEIHKKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKA  81

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKA  360
            NK GN++YKLG N+FSDLTN+EF+A
Sbjct  82   NKEGNRTYKLGTNRFSDLTNDEFRA  106



>gb|KHN08873.1| Vignain [Glycine soja]
Length=335

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +1

Query  94   QLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            Q ILA VLLL    SQ  + +  E SM ERHE+WM  +G+ YK+ AEK KR  IF+ NV+
Sbjct  5    QHILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVE  64

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            FIESFN AGN+ YKL +N  +D TNEEF A+
Sbjct  65   FIESFNAAGNKPYKLSINHLADQTNEEFVAS  95



>gb|KDO63024.1| hypothetical protein CISIN_1g018958mg [Citrus sinensis]
Length=281

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            + LL + ASQ  +     E S++E HEKWM  HGRSYK++ EK  R KIF++N+++IE  
Sbjct  22   ITLLVSCASQVVSSRSTHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKA  81

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKA  360
            NK GN++YKLG N+FSDLTN+EF+A
Sbjct  82   NKEGNRTYKLGTNQFSDLTNDEFRA  106



>ref|XP_007214465.1| hypothetical protein PRUPE_ppa023848mg [Prunus persica]
 gb|EMJ15664.1| hypothetical protein PRUPE_ppa023848mg [Prunus persica]
Length=340

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + L  +L+LG ++S+AT+ + ++ SM ER+E+WMV +GR Y +  EK KRF+IF++NV +
Sbjct  11   VCLVLILMLGTWSSEATSRNLQDASMYERYEQWMVRYGREYNDVNEKQKRFEIFKKNVAY  70

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N   N+SYKL VN+F+D TNEE KA+
Sbjct  71   IESSNSDVNKSYKLSVNQFADQTNEEVKAS  100



>ref|XP_008353751.1| PREDICTED: actinidain-like [Malus domestica]
Length=227

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +1

Query  100  ILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI  276
             L  +L+LGA++SQAT+   ++ SM  R+E+W+  +GR + +  EK  RFKIF++NV FI
Sbjct  13   CLGLILVLGAWSSQATSRSLQDASMYGRYEQWLARYGRVHNDINEKETRFKIFKENVAFI  72

Query  277  ESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            E  NK  N+ YKL VN+F+DLTNEEFKAT
Sbjct  73   EFSNKDANKPYKLSVNQFADLTNEEFKAT  101



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN  264
            + + LA +  +G +  Q T   L ++ SM ERHE+WM  +G  YK+  E+ KRF+IF++N
Sbjct  8    YHISLALLFCMGFWGFQVTCRTLQDDVSMYERHEEWMTRYGSVYKDPEEREKRFRIFKKN  67

Query  265  VKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            V +IE+FN A N+ Y+LG N+F+DLTNEEF A
Sbjct  68   VNYIETFNNAANKPYQLGTNQFADLTNEEFIA  99



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + LA + +LGA++SQAT+ + ++ SM  ++E+WM  +GR +    EK  RFKIF++NV F
Sbjct  12   ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMTRYGRVFTGVQEKEMRFKIFKENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N   N+ YKL VN+F+DLTNEEFKA+
Sbjct  72   IESSNSDANKPYKLSVNQFADLTNEEFKAS  101



>gb|KDO63025.1| hypothetical protein CISIN_1g018958mg [Citrus sinensis]
Length=348

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +1

Query  112  VLLLGAFASQATALDE--EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESF  285
            + LL + ASQ  +     E S++E HEKWM  HGRSYK++ EK  R KIF++N+++IE  
Sbjct  22   ITLLVSCASQVVSSRSTHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKA  81

Query  286  NKAGNQSYKLGVNKFSDLTNEEFKA  360
            NK GN++YKLG N+FSDLTN+EF+A
Sbjct  82   NKEGNRTYKLGTNQFSDLTNDEFRA  106



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + L  +L+LGA++S+AT+   ++ SM  R+++W+  +GR Y +  EK  RFKIF++NV F
Sbjct  1    MCLGLILMLGAWSSEATSRSLQDASMYGRYKQWLARYGRIYNDTNEKETRFKIFKENVAF  60

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IE  NK  N+ YKL VN+F+DLTNEEFKAT
Sbjct  61   IEFSNKDANKPYKLSVNQFADLTNEEFKAT  90



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + LA + +LGA +SQAT+   ++ SM  ++E+WM  +GR+Y +  EK KRF IF++NV F
Sbjct  12   ICLAFIFILGALSSQATSRTLQDASMYAKYEQWMASYGRAYADINEKEKRFNIFKENVAF  71

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IES N   N+ YKL VN+F+DLTNEEFKA+
Sbjct  72   IESSNNDANKLYKLSVNQFADLTNEEFKAS  101



>ref|XP_003526232.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +1

Query  103  LAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE  279
            LA +L +   A Q T    ++ SM ERHE+WM  +G+ YK+  E+ KRF++F++NV +IE
Sbjct  12   LAMLLCMTFLAFQVTCRTLQDASMYERHEQWMTRYGKVYKDPQEREKRFRVFKENVNYIE  71

Query  280  SFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            +FN A N+SYKLG+N+F+DLTN+EF A
Sbjct  72   AFNNAANKSYKLGINQFADLTNKEFIA  98



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            + L  +L+LGA++S+AT+   ++ SM  R+++W+  +GR Y +  EK  RFKIF++NV F
Sbjct  1    MCLGLILMLGAWSSEATSRSLQDASMYGRYKQWLARYGRIYNDTNEKETRFKIFKENVAF  60

Query  274  IESFNKAGNQSYKLGVNKFSDLTNEEFKAT  363
            IE  NK  N+ YKL VN+F+DLTNEEFKAT
Sbjct  61   IEFSNKDANKPYKLSVNQFADLTNEEFKAT  90



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  73   MASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFK  249
            M S    Q   A +L+LG +A +  + + +E  M  RHE+WM  +G+ Y + AEK +RFK
Sbjct  1    MVSICKRQCFFAFILILGMWAFEVASRELQESYMSARHEQWMATYGKVYVDAAEKERRFK  60

Query  250  IFEQNVKFIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
            IF+ NV++IESFN AGN+ YKL VNKF+D TNE+FK 
Sbjct  61   IFKNNVEYIESFNTAGNKPYKLSVNKFADQTNEKFKG  97



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +1

Query  133  ASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSY  309
            A QAT+ D  E S+++RHE+WM   GR YK+DAEKAKRFKIF+ N ++I+S N AG + Y
Sbjct  3    AYQATSRDLYEASIVKRHEQWMARFGRVYKDDAEKAKRFKIFKDNTEYIDSVNMAGIKPY  62

Query  310  KLGVNKFSDLTNEEFKAT  363
            KL VN+F+DLTN+EF+ T
Sbjct  63   KLDVNEFADLTNDEFRVT  80



>ref|XP_011005485.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=339

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 7/90 (8%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            F LILA  ++          LDE+  ML+RHE+WM  HGR Y++  EK KR+ IF++N++
Sbjct  14   FLLILATKIV-------CRPLDEQEYMLKRHEEWMAQHGRVYEDMKEKEKRYLIFKENIE  66

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IE+FN   ++ YKLGVNKF+DLTNEEF+A
Sbjct  67   RIEAFNSGSDRGYKLGVNKFADLTNEEFRA  96



>ref|XP_009617814.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=340

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = +1

Query  97   LILAAVLLLGAFASQATALDEEP-SMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF  273
            L +   +++G   SQ T+ + +  SMLE+HE WM  HGR+YKN+AEK KR  IF++NVKF
Sbjct  10   LFILLFVIIGMSTSQVTSRNIQALSMLEKHESWMSSHGRTYKNEAEKEKRLNIFKENVKF  69

Query  274  IESFNKAGN-QSYKLGVNKFSDLTNEEF  354
            IESFN  G  + YKLG+N F+DLT EEF
Sbjct  70   IESFNNNGTKKPYKLGINAFADLTAEEF  97



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +1

Query  91   FQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK  270
            F L L  V    AF   A  L++ P M ERHE+WM  HG+ Y +  EK ++++ F++NV+
Sbjct  11   FTLALCLVFAFCAFEGNARTLEDAP-MRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQ  69

Query  271  FIESFNKAGNQSYKLGVNKFSDLTNEEFKA  360
             IE+FN AGN+ YKLG+N F+DLTNEEFKA
Sbjct  70   RIEAFNHAGNKPYKLGINHFADLTNEEFKA  99



Lambda      K        H        a         alpha
   0.315    0.128    0.358    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521547509808