BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c35521_g1_i1 len=1790 path=[1818:0-1789]

Length=1790
                                                                      Score     E

ref|XP_009766130.1|  PREDICTED: anthranilate N-benzoyltransferase...    568   0.0      
ref|XP_009603648.1|  PREDICTED: anthranilate N-benzoyltransferase...    566   0.0      
ref|XP_006368253.1|  transferase family protein                         559   0.0      
ref|XP_006355150.1|  PREDICTED: anthranilate N-benzoyltransferase...    554   0.0      
ref|XP_011018370.1|  PREDICTED: anthranilate N-benzoyltransferase...    551   0.0      
emb|CDP19817.1|  unnamed protein product                                548   0.0      
ref|XP_011070203.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    543   0.0      
ref|XP_006471640.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    538   0.0      
gb|KDP28072.1|  hypothetical protein JCGZ_19480                         536   0.0      
ref|XP_010113024.1|  Omega-hydroxypalmitate O-feruloyl transferase      536   0.0      
emb|CAN76941.1|  hypothetical protein VITISV_042905                     532   0.0      Vitis vinifera
ref|XP_002274239.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    532   0.0      Vitis vinifera
ref|XP_006471642.1|  PREDICTED: anthranilate N-benzoyltransferase...    528   9e-180   
ref|XP_007040904.1|  HXXXD-type acyl-transferase family protein         526   4e-179   
ref|XP_009374636.1|  PREDICTED: anthranilate N-benzoyltransferase...    525   3e-178   
ref|XP_004301771.1|  PREDICTED: anthranilate N-benzoyltransferase...    525   4e-178   
ref|XP_006432873.1|  hypothetical protein CICLE_v10003717mg             523   8e-178   
ref|XP_008380661.1|  PREDICTED: anthranilate N-benzoyltransferase...    522   4e-177   
gb|ACU18592.1|  unknown                                                 513   8e-174   Glycine max [soybeans]
ref|XP_007210153.1|  hypothetical protein PRUPE_ppa023735mg             513   1e-173   
ref|XP_003612550.1|  Omega-hydroxypalmitate O-feruloyl transferase      512   2e-173   
ref|XP_003519086.1|  PREDICTED: anthranilate N-benzoyltransferase...    511   7e-173   
ref|XP_008238079.1|  PREDICTED: anthranilate N-benzoyltransferase...    509   3e-172   
ref|XP_004512355.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    507   3e-171   
ref|XP_010244192.1|  PREDICTED: anthranilate N-benzoyltransferase...    508   9e-171   
ref|XP_007145597.1|  hypothetical protein PHAVU_007G252100g             504   3e-170   
ref|XP_008451859.1|  PREDICTED: anthranilate N-benzoyltransferase...    503   2e-169   
ref|XP_006303518.1|  hypothetical protein CARUB_v10010922mg             501   2e-169   
ref|XP_002891141.1|  transferase family protein                         498   4e-168   
ref|XP_004148999.1|  PREDICTED: anthranilate N-benzoyltransferase...    498   4e-168   
ref|NP_174434.1|  HXXXD-type acyl-transferase-like protein              497   1e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478899.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    492   1e-165   
ref|XP_010056138.1|  PREDICTED: anthranilate N-benzoyltransferase...    489   1e-164   
ref|XP_004166659.1|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    489   2e-164   
ref|XP_009114984.1|  PREDICTED: anthranilate N-benzoyltransferase...    488   5e-164   
ref|XP_010499698.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    488   6e-164   
emb|CDY12305.1|  BnaA09g25050D                                          479   1e-160   
gb|KFK44930.1|  hypothetical protein AALP_AA1G321300                    479   1e-160   
emb|CDY62304.1|  BnaA09g54240D                                          478   3e-160   
ref|XP_006415323.1|  hypothetical protein EUTSA_v10009746mg             474   9e-159   
ref|XP_006432870.1|  hypothetical protein CICLE_v10003778mg             470   1e-157   
emb|CBI29221.3|  unnamed protein product                                471   2e-157   
ref|XP_010519084.1|  PREDICTED: anthranilate N-benzoyltransferase...    466   1e-155   
ref|XP_002519902.1|  transferase, putative                              464   2e-155   Ricinus communis
gb|EPS71697.1|  hypothetical protein M569_03062                         406   5e-132   
ref|XP_010918051.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    368   4e-117   
ref|XP_010943006.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    363   4e-115   
ref|XP_008800447.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    356   1e-112   
gb|KDO46398.1|  hypothetical protein CISIN_1g039950mg                   305   3e-96    
gb|KHN23945.1|  Anthranilate N-benzoyltransferase protein 1             300   4e-94    
ref|XP_010463047.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    288   9e-88    
ref|XP_008778760.1|  PREDICTED: rosmarinate synthase-like               278   9e-83    
ref|XP_002270252.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    274   4e-81    Vitis vinifera
gb|KDO38871.1|  hypothetical protein CISIN_1g035783mg                   264   1e-80    
ref|XP_002270251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    272   3e-80    Vitis vinifera
gb|AHA90802.1|  cinnamyl alcohol acyltransferase 1                      270   2e-79    
ref|XP_010938319.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    267   2e-78    
ref|XP_002270079.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    267   2e-78    Vitis vinifera
ref|XP_002270076.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    266   6e-78    Vitis vinifera
emb|CAN61304.1|  hypothetical protein VITISV_040201                     265   1e-77    Vitis vinifera
ref|XP_008783080.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    264   3e-77    
ref|XP_008795534.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    263   4e-77    
ref|XP_002271221.2|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...    262   2e-76    Vitis vinifera
ref|XP_002270325.2|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    262   2e-76    Vitis vinifera
ref|XP_009408072.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    260   7e-76    
emb|CDO99661.1|  unnamed protein product                                259   7e-76    
ref|XP_007023566.1|  HXXXD-type acyl-transferase family protein, ...    259   3e-75    
ref|XP_009385887.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    257   7e-75    
ref|XP_010928753.1|  PREDICTED: rosmarinate synthase                    257   9e-75    
ref|XP_009603729.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    256   4e-74    
gb|KDP25022.1|  hypothetical protein JCGZ_22557                         255   5e-74    
ref|XP_006343272.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    254   1e-73    
ref|XP_007023568.1|  HXXXD-type acyl-transferase family protein, ...    254   2e-73    
gb|KDO67093.1|  hypothetical protein CISIN_1g011528mg                   254   2e-73    
ref|XP_009619139.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    253   5e-73    
ref|XP_010654977.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    253   7e-73    
ref|XP_006425196.1|  hypothetical protein CICLE_v10028328mg             252   1e-72    
ref|XP_002269682.3|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    252   1e-72    Vitis vinifera
ref|XP_009104555.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    251   2e-72    
ref|XP_009783339.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    251   2e-72    
ref|XP_011087026.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    251   3e-72    
emb|CAN75148.1|  hypothetical protein VITISV_027192                     251   3e-72    Vitis vinifera
ref|XP_008344964.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    251   3e-72    
ref|XP_009786591.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    251   4e-72    
ref|XP_008380698.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    250   5e-72    
ref|XP_002270539.2|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    250   6e-72    Vitis vinifera
ref|XP_006347188.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    249   7e-72    
ref|XP_008808376.1|  PREDICTED: agmatine coumaroyltransferase-2-like    249   1e-71    
ref|XP_006488699.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    249   2e-71    
emb|CBI18361.3|  unnamed protein product                                247   2e-71    
ref|XP_010429767.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    248   2e-71    
ref|XP_009344995.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    248   2e-71    
ref|XP_002519354.1|  Anthranilate N-benzoyltransferase protein, p...    248   5e-71    Ricinus communis
ref|XP_004971568.1|  PREDICTED: anthranilate N-benzoyltransferase...    247   6e-71    
ref|XP_009126112.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    246   8e-71    
ref|XP_010087075.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    246   2e-70    
gb|KFK22998.1|  hypothetical protein AALP_AAs66525U000100               246   2e-70    
ref|XP_011031277.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    247   2e-70    
gb|KEH33678.1|  HXXXD-type acyl-transferase family protein              246   2e-70    
ref|XP_010251800.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    246   2e-70    
ref|XP_002270208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    246   2e-70    Vitis vinifera
ref|XP_009589974.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    246   3e-70    
ref|XP_010058993.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    246   4e-70    
gb|KFK42277.1|  hypothetical protein AALP_AA2G235000                    244   5e-70    
ref|XP_010417515.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   5e-70    
ref|XP_004305787.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   7e-70    
ref|XP_004305788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   1e-69    
ref|XP_011094024.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    243   2e-69    
ref|XP_010058984.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    244   2e-69    
ref|XP_010942972.1|  PREDICTED: agmatine coumaroyltransferase-2-like    243   3e-69    
ref|XP_002310897.2|  hypothetical protein POPTR_0007s15050g             243   4e-69    Populus trichocarpa [western balsam poplar]
ref|XP_004242867.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    243   4e-69    
ref|XP_004232772.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   4e-69    
ref|XP_003617368.1|  Acetyltransferase, putative                        243   4e-69    
ref|XP_010539596.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    242   5e-69    
ref|XP_004305786.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   5e-69    
ref|XP_006471641.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   5e-69    
ref|XP_003617366.1|  Anthranilate N-benzoyltransferase protein          242   6e-69    
ref|XP_009348540.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   6e-69    
ref|XP_004491310.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   7e-69    
ref|XP_006301720.1|  hypothetical protein CARUB_v10022178mg             240   3e-68    
ref|XP_010539595.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    240   3e-68    
ref|XP_004303785.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    240   3e-68    
gb|KFK42268.1|  hypothetical protein AALP_AA2G233500                    238   3e-68    
emb|CDX88496.1|  BnaC06g39400D                                          239   3e-68    
ref|XP_009799016.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   4e-68    
ref|XP_002889224.1|  hypothetical protein ARALYDRAFT_316796             242   7e-68    
ref|XP_010472736.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    239   9e-68    
gb|KEH33677.1|  HXXXD-type acyl-transferase family protein              239   1e-67    
ref|XP_002532044.1|  Anthranilate N-benzoyltransferase protein, p...    238   1e-67    Ricinus communis
ref|XP_009106615.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    238   2e-67    
ref|XP_008245068.1|  PREDICTED: anthranilate N-benzoyltransferase...    237   3e-67    
ref|XP_009391475.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    237   3e-67    
gb|AHA90803.1|  cinnamyl alcohol acyltransferase 2                      236   7e-67    
ref|XP_007146240.1|  hypothetical protein PHAVU_006G024000g             237   7e-67    
gb|EYU33936.1|  hypothetical protein MIMGU_mgv1a005884mg                236   1e-66    
ref|XP_010552395.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    235   2e-66    
gb|KCW54004.1|  hypothetical protein EUGRSUZ_J03198                     235   5e-66    
ref|XP_010034102.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    235   5e-66    
gb|EMT15648.1|  Anthranilate N-benzoyltransferase protein 1             234   5e-66    
ref|NP_174567.1|  HXXXD-type acyl-transferase-like protein              234   5e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010040471.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   5e-66    
ref|NP_178020.1|  HXXXD-type acyl-transferase                           234   6e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006586058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   6e-66    
ref|XP_010034103.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    235   1e-65    
ref|XP_010058994.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    234   1e-65    
gb|KHN38347.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    233   2e-65    
ref|XP_010040470.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   2e-65    
ref|XP_007146239.1|  hypothetical protein PHAVU_006G023900g             233   2e-65    
ref|XP_010472737.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   5e-65    
ref|XP_007217230.1|  hypothetical protein PRUPE_ppa005452mg             231   6e-65    
ref|XP_006389934.1|  hypothetical protein EUTSA_v10018518mg             231   9e-65    
gb|KDO60230.1|  hypothetical protein CISIN_1g012180mg                   231   1e-64    
gb|AAC17079.1|  Contains similarity to C2-HC type zinc finger pro...    233   1e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003545151.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    230   1e-64    
ref|XP_006488633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    230   1e-64    
gb|KHN11990.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    230   2e-64    
ref|XP_010030883.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   2e-64    
ref|XP_003519535.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    230   2e-64    
gb|KCW56804.1|  hypothetical protein EUGRSUZ_I02472                     228   1e-63    
gb|KHM99656.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    228   1e-63    
ref|XP_003530722.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    227   3e-63    
ref|XP_010040766.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    228   3e-63    
gb|EYU25783.1|  hypothetical protein MIMGU_mgv1a006078mg                224   2e-62    
ref|XP_008228085.1|  PREDICTED: anthranilate N-benzoyltransferase...    223   7e-62    
ref|NP_197145.2|  HXXXD-type acyl-transferase-like protein              222   2e-61    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB09608.1|  unnamed protein product                                222   2e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006424489.1|  hypothetical protein CICLE_v10028364mg             221   5e-61    
ref|XP_004966759.1|  PREDICTED: anthranilate N-benzoyltransferase...    220   1e-60    
ref|XP_006343402.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    219   2e-60    
gb|KDP35222.1|  hypothetical protein JCGZ_09381                         218   4e-60    
ref|XP_004967783.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    218   7e-60    
gb|EAY73387.1|  hypothetical protein OsI_01269                          218   8e-60    Oryza sativa Indica Group [Indian rice]
gb|ABG75942.1|  coniferyl alcohol acyltransferase                       216   2e-59    Petunia x hybrida [garden petunia]
ref|XP_010535222.1|  PREDICTED: agmatine coumaroyltransferase-1-like    216   3e-59    
ref|XP_003553148.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    216   4e-59    
ref|XP_002891015.1|  transferase family protein                         213   1e-58    
ref|XP_003617373.1|  Taxadien-5-alpha-ol O-acetyltransferase            214   1e-58    
gb|KHN13176.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    213   3e-58    
ref|XP_010248256.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    210   3e-58    
gb|AFW55789.1|  agmatine coumaroyltransferase                           213   5e-58    
dbj|BAA92405.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfera...    212   6e-58    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146980.1|  LOC100280589                                       212   7e-58    Zea mays [maize]
ref|NP_001130649.1|  transferase isoform 1                              209   9e-57    Zea mays [maize]
emb|CDY38115.1|  BnaC02g06580D                                          205   2e-56    
gb|AFW75530.1|  hypothetical protein ZEAMMB73_669200                    209   2e-56    
gb|EAY99655.1|  hypothetical protein OsI_21633                          206   1e-55    Oryza sativa Indica Group [Indian rice]
gb|EEE54281.1|  hypothetical protein OsJ_01188                          205   2e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006343401.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    203   3e-55    
ref|XP_003561102.1|  PREDICTED: rosmarinate synthase-like               205   3e-55    
ref|XP_009609794.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    201   6e-55    
ref|XP_006655791.1|  PREDICTED: agmatine coumaroyltransferase-2-like    204   7e-55    
gb|EAY73389.1|  hypothetical protein OsI_01271                          202   2e-54    Oryza sativa Indica Group [Indian rice]
gb|KCW44660.1|  hypothetical protein EUGRSUZ_L01809                     202   2e-54    
ref|XP_002447065.1|  hypothetical protein SORBIDRAFT_06g027990          202   2e-54    Sorghum bicolor [broomcorn]
ref|XP_010041079.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    202   3e-54    
ref|NP_001042650.2|  Os01g0261600                                       202   4e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004964835.1|  PREDICTED: anthranilate N-benzoyltransferase...    204   4e-54    
ref|XP_004978226.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    201   8e-54    
dbj|BAJ86050.1|  predicted protein                                      201   1e-53    
gb|ACF85647.1|  unknown                                                 201   1e-53    Zea mays [maize]
ref|XP_002436488.1|  hypothetical protein SORBIDRAFT_10g003560          200   2e-53    Sorghum bicolor [broomcorn]
gb|EEE54278.1|  hypothetical protein OsJ_01184                          199   3e-53    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146851.1|  agmatine coumaroyltransferase                      199   3e-53    Zea mays [maize]
gb|ACG29622.1|  transferase                                             199   3e-53    Zea mays [maize]
ref|NP_001183762.1|  hypothetical protein                               199   3e-53    
emb|CDM83195.1|  unnamed protein product                                198   9e-53    
gb|KCW74067.1|  hypothetical protein EUGRSUZ_E02701                     197   1e-52    
ref|NP_001174603.1|  Os06g0150550                                       197   2e-52    
ref|NP_001150771.1|  transferase                                        196   3e-52    Zea mays [maize]
gb|EAY99714.1|  hypothetical protein OsI_21696                          197   3e-52    Oryza sativa Indica Group [Indian rice]
gb|KDP25023.1|  hypothetical protein JCGZ_22558                         195   4e-52    
emb|CDX79279.1|  BnaC06g20240D                                          193   4e-52    
ref|XP_002437844.1|  hypothetical protein SORBIDRAFT_10g003600          201   4e-52    Sorghum bicolor [broomcorn]
dbj|BAJ96756.1|  predicted protein                                      196   6e-52    
gb|EMT19167.1|  Anthranilate N-benzoyltransferase protein 3             195   9e-52    
gb|EMT19980.1|  hypothetical protein F775_15344                         195   1e-51    
gb|ABA95047.1|  Transferase family protein, expressed                   194   2e-51    Oryza sativa Japonica Group [Japonica rice]
dbj|BAK03783.1|  predicted protein                                      193   6e-51    
ref|XP_008668908.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    192   1e-50    
ref|XP_004962590.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    191   2e-50    
tpg|DAA36101.1|  TPA: hypothetical protein ZEAMMB73_105025              192   5e-50    
ref|NP_001056826.2|  Os06g0151100                                       191   6e-50    Oryza sativa Japonica Group [Japonica rice]
gb|EEC80023.1|  hypothetical protein OsI_21698                          191   6e-50    Oryza sativa Indica Group [Indian rice]
gb|KHG25192.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    185   3e-49    
dbj|BAJ95580.1|  predicted protein                                      188   5e-49    
ref|XP_004964836.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   1e-48    
emb|CDP14267.1|  unnamed protein product                                185   2e-48    
ref|XP_004976754.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    184   8e-48    
ref|XP_004964837.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    184   9e-48    
ref|NP_001053822.1|  Os04g0609500                                       181   1e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447068.1|  hypothetical protein SORBIDRAFT_06g028020          180   2e-46    Sorghum bicolor [broomcorn]
gb|EAZ35847.1|  hypothetical protein OsJ_20144                          179   4e-46    Oryza sativa Japonica Group [Japonica rice]
gb|EMT02774.1|  Anthranilate N-benzoyltransferase protein 1             177   2e-45    
ref|XP_003581633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   3e-45    
ref|XP_003575891.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    176   7e-45    
ref|XP_006851033.1|  hypothetical protein AMTR_s00025p00227780          172   1e-44    
ref|XP_003581632.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   1e-44    
dbj|BAJ87867.1|  predicted protein                                      172   3e-44    
ref|XP_008778761.1|  PREDICTED: anthranilate N-benzoyltransferase...    167   1e-43    
gb|KCW74058.1|  hypothetical protein EUGRSUZ_E02684                     160   2e-40    
gb|KFK22997.1|  hypothetical protein AALP_AAs66525U000100               157   4e-40    
ref|NP_001053821.1|  Os04g0609300                                       161   9e-40    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059280.2|  Os07g0244600                                       159   3e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562118.1|  PREDICTED: anthranilate N-benzoyltransferase...    158   1e-38    
gb|EMS59417.1|  Anthranilate N-benzoyltransferase protein 3             155   2e-38    
ref|XP_003575487.2|  PREDICTED: anthranilate N-benzoyltransferase...    152   3e-37    
gb|EEE66874.1|  hypothetical protein OsJ_23688                          150   2e-36    Oryza sativa Japonica Group [Japonica rice]
gb|ACU24086.1|  unknown                                                 147   3e-36    Glycine max [soybeans]
emb|CDY38112.1|  BnaC02g06610D                                          149   4e-36    
emb|CBI33422.3|  unnamed protein product                                138   8e-34    
gb|KHM99654.1|  Anthranilate N-benzoyltransferase protein 1             140   8e-34    
emb|CBI33404.3|  unnamed protein product                                135   1e-32    
emb|CBI33409.3|  unnamed protein product                                133   6e-32    
emb|CBI33412.3|  unnamed protein product                                136   8e-32    
ref|XP_006851034.1|  hypothetical protein AMTR_s00025p00228010          131   2e-31    
gb|EMT01890.1|  hypothetical protein F775_20351                         132   6e-31    
gb|EAY85454.1|  hypothetical protein OsI_06834                          134   1e-30    Oryza sativa Indica Group [Indian rice]
ref|XP_002960555.1|  BAHD family acyltransferase, clade I               133   2e-30    
ref|XP_002969198.1|  BAHD acyltransferase, clade I                      133   2e-30    
emb|CDY57949.1|  BnaA07g38470D                                          131   5e-30    
gb|EAZ31931.1|  hypothetical protein OsJ_16103                          131   1e-29    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002457607.1|  hypothetical protein SORBIDRAFT_03g010150          131   1e-29    Sorghum bicolor [broomcorn]
gb|KDP38692.1|  hypothetical protein JCGZ_04045                         130   2e-29    
gb|EMS53414.1|  Anthranilate N-benzoyltransferase protein 1             126   5e-29    
gb|EEE61652.1|  hypothetical protein OsJ_16104                          128   1e-28    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002436479.1|  hypothetical protein SORBIDRAFT_10g003415          125   3e-28    Sorghum bicolor [broomcorn]
emb|CBI33414.3|  unnamed protein product                                126   3e-28    
ref|XP_008245067.1|  PREDICTED: anthranilate N-benzoyltransferase...    124   8e-28    
gb|EAZ19063.1|  hypothetical protein OsJ_34591                          125   8e-28    Oryza sativa Japonica Group [Japonica rice]
dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                  125   9e-28    Ipomoea batatas [batate]
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    125   2e-27    
ref|XP_002969437.1|  BAHD family acyltransferase, clade I               124   2e-27    
ref|XP_010654997.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    122   3e-27    
dbj|BAC82918.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfera...    120   2e-26    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    121   3e-26    
emb|CBI18364.3|  unnamed protein product                                119   4e-26    
ref|XP_001754825.1|  predicted protein                                  120   5e-26    
ref|XP_008228082.1|  PREDICTED: uncharacterized protein LOC103327529    115   7e-26    
emb|CBI18360.3|  unnamed protein product                                118   1e-25    
ref|XP_006471700.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    119   1e-25    
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g             119   2e-25    
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    119   2e-25    
ref|XP_011071306.1|  PREDICTED: vinorine synthase-like                  118   4e-25    
gb|AEK80405.1|  HQT                                                     117   4e-25    
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase              117   7e-25    
gb|KDP38697.1|  hypothetical protein JCGZ_04050                         116   1e-24    
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    116   2e-24    
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    115   3e-24    
ref|XP_006401163.1|  hypothetical protein EUTSA_v10013552mg             115   4e-24    
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    115   4e-24    
ref|XP_006471699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    114   5e-24    
ref|NP_001275483.1|  HQT                                                114   5e-24    
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    115   6e-24    
emb|CAN83973.1|  hypothetical protein VITISV_018429                     114   7e-24    
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    114   8e-24    
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    114   8e-24    
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    114   8e-24    
ref|XP_006280408.1|  hypothetical protein CARUB_v10026341mg             114   1e-23    
ref|XP_010031397.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    113   1e-23    
sp|O24645.1|HCBT1_DIACA  RecName: Full=Anthranilate N-benzoyltran...    113   2e-23    
ref|XP_008223800.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    113   2e-23    
ref|XP_010229972.1|  PREDICTED: uncharacterized protein LOC100842402    112   3e-23    
ref|XP_011085805.1|  PREDICTED: vinorine synthase-like                  112   3e-23    
ref|XP_004964655.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    112   4e-23    
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    111   5e-23    
ref|XP_008223799.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    112   5e-23    
ref|XP_010929588.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    111   5e-23    
ref|XP_002969985.1|  BAHD family acyltransferase, clade V               111   7e-23    
ref|XP_007211620.1|  hypothetical protein PRUPE_ppa005563mg             111   8e-23    
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein               110   9e-23    
ref|XP_011071304.1|  PREDICTED: vinorine synthase-like                  110   1e-22    
ref|XP_010031392.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    110   2e-22    
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    109   3e-22    
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase           109   3e-22    
ref|XP_002981455.1|  BAHD family acyltransferase, clade V               109   3e-22    
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase                 109   3e-22    
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase               109   3e-22    
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g             109   3e-22    
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    109   3e-22    
ref|XP_009770247.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    108   4e-22    
ref|XP_002990807.1|  BAHD family acyltransferase, clade I               109   4e-22    
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             109   4e-22    
ref|XP_008791113.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    108   5e-22    
ref|XP_009600109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    108   5e-22    
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    108   5e-22    
sp|O23917.1|HCBT2_DIACA  RecName: Full=Anthranilate N-benzoyltran...    108   6e-22    
ref|XP_010023890.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    108   8e-22    
ref|XP_002514980.1|  Anthranilate N-benzoyltransferase protein, p...    108   8e-22    
ref|XP_008790158.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    107   9e-22    
ref|NP_001275190.1|  feruloyl transferase                               107   1e-21    
ref|XP_001785388.1|  predicted protein                                  108   1e-21    
ref|XP_010023889.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   1e-21    
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    107   1e-21    
ref|XP_011085818.1|  PREDICTED: vinorine synthase-like                  107   1e-21    
sp|O23918.1|HCBT3_DIACA  RecName: Full=Anthranilate N-benzoyltran...    107   1e-21    
ref|XP_010023888.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   1e-21    
ref|XP_006347627.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   1e-21    
ref|XP_004235315.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   1e-21    
ref|XP_002965064.1|  BAHD family acyltransferase, clade I               107   2e-21    
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    107   2e-21    
emb|CBI33421.3|  unnamed protein product                                105   2e-21    
ref|XP_010023896.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    106   2e-21    
ref|XP_010023895.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    105   3e-21    
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    106   3e-21    
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    106   3e-21    
emb|CDX67482.1|  BnaA07g15220D                                          106   4e-21    
emb|CDX88644.1|  BnaA03g10050D                                          106   4e-21    
ref|XP_008804093.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    105   4e-21    
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    105   4e-21    
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1              106   5e-21    
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    105   5e-21    
ref|XP_002974492.1|  BAHD family acyltransferase, clade I               106   5e-21    
ref|XP_010555967.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    102   6e-21    
ref|XP_011071181.1|  PREDICTED: vinorine synthase-like isoform X1       105   6e-21    
emb|CAB06428.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase     105   6e-21    
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                      105   7e-21    
ref|XP_010483334.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    105   7e-21    
ref|XP_002962154.1|  BAHD family acyltransferase, clade I               105   7e-21    
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4         105   7e-21    
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    105   7e-21    
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    105   7e-21    
ref|XP_001767890.1|  predicted protein                                  104   8e-21    
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    105   1e-20    
emb|CDY05866.1|  BnaC08g20430D                                          104   1e-20    
ref|XP_004243072.2|  PREDICTED: uncharacterized protein LOC101253393    101   1e-20    
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g             104   1e-20    
ref|XP_009140062.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    105   1e-20    
gb|AJA31666.1|  rosmarinic acid synthase                                104   1e-20    
gb|EMT10846.1|  2-alpha-hydroxytaxane 2-O-benzoyltransferase            102   1e-20    
ref|XP_003634222.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    104   1e-20    
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    104   1e-20    
ref|XP_004503772.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    104   1e-20    
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g             104   1e-20    
ref|XP_009125170.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    104   1e-20    
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    104   2e-20    
ref|XP_011083978.1|  PREDICTED: vinorine synthase-like                  104   2e-20    
emb|CDP02827.1|  unnamed protein product                                104   2e-20    
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    104   2e-20    
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    103   2e-20    
ref|XP_010554116.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    103   2e-20    
ref|XP_002511135.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    103   2e-20    
ref|XP_004145588.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    103   2e-20    
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   2e-20    
ref|XP_002967327.1|  hypothetical protein SELMODRAFT_408274             102   2e-20    
gb|KDP22581.1|  hypothetical protein JCGZ_26412                         103   3e-20    
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   3e-20    
gb|EPS61293.1|  hypothetical protein M569_13504                         103   3e-20    
ref|XP_010441266.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    103   3e-20    
emb|CDY68497.1|  BnaCnng59260D                                          103   3e-20    
ref|XP_002870657.1|  transferase family protein                         103   4e-20    
gb|ADA60182.1|  rosmarinic acid synthase                                103   4e-20    
gb|AFF57840.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    103   4e-20    
ref|XP_010450574.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    103   4e-20    
ref|XP_008239515.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    103   4e-20    
emb|CDY48963.1|  BnaA04g10770D                                          103   4e-20    
ref|XP_004301782.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    103   4e-20    
ref|XP_009358743.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    103   4e-20    
ref|XP_010436043.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    103   5e-20    
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   5e-20    
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   5e-20    
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   5e-20    
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   6e-20    
ref|XP_010023900.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    102   6e-20    
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   6e-20    
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    102   6e-20    
dbj|BAF49306.1|  putative acyltransferase                               102   6e-20    
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase                 102   6e-20    
ref|XP_002873775.1|  predicted protein                                  101   6e-20    
ref|NP_568587.2|  omega-hydroxypalmitate O-feruloyl transferase         102   6e-20    
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   7e-20    
ref|XP_006464645.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   7e-20    
ref|XP_003525421.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    102   7e-20    
ref|NP_851111.1|  omega-hydroxypalmitate O-feruloyl transferase         102   7e-20    
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   8e-20    
ref|XP_006405403.1|  hypothetical protein EUTSA_v10027756mg             102   8e-20    
ref|XP_004157127.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    102   8e-20    
ref|XP_006471643.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   9e-20    
ref|XP_006283644.1|  hypothetical protein CARUB_v10004701mg             102   9e-20    
ref|XP_010023898.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    102   9e-20    
ref|XP_009132100.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   9e-20    
emb|CAN82918.1|  hypothetical protein VITISV_023290                     101   1e-19    
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    101   1e-19    
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    101   1e-19    
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    101   1e-19    
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g             101   1e-19    
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase                101   2e-19    
gb|AFF19202.1|  BAHD acyltransferase                                    101   2e-19    
ref|XP_011086241.1|  PREDICTED: vinorine synthase-like                  101   2e-19    
ref|XP_002969199.1|  BAHD acyltransferase, clade I                      101   2e-19    
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    100   2e-19    
gb|AFS68800.1|  hydroxycinnamoyl transferase                            100   2e-19    
gb|KCW80998.1|  hypothetical protein EUGRSUZ_C02374                     100   2e-19    
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           100   2e-19    
emb|CBI33415.3|  unnamed protein product                              98.6    2e-19    
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    100   2e-19    
ref|XP_006415694.1|  hypothetical protein EUTSA_v10007649mg             100   3e-19    
ref|XP_008778437.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    100   3e-19    
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase           100   3e-19    
ref|XP_008372277.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    100   3e-19    
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    100   3e-19    
ref|XP_007137866.1|  hypothetical protein PHAVU_009G162300g             100   3e-19    
ref|XP_010452842.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    100   4e-19    
ref|XP_009375174.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    100   4e-19    
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           100   4e-19    
gb|KFK33037.1|  hypothetical protein AALP_AA6G322400                    100   5e-19    
ref|XP_010023883.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  99.8    5e-19    
emb|CDY11732.1|  BnaC06g13400D                                        99.8    5e-19    
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                 99.8    5e-19    
ref|XP_009383405.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  99.8    6e-19    
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  99.8    6e-19    
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  99.8    6e-19    
ref|XP_002325143.2|  transferase family protein                       99.8    7e-19    
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972    101   8e-19    
ref|XP_010673351.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  99.4    8e-19    
emb|CBI21083.3|  unnamed protein product                              99.4    9e-19    
emb|CBI33403.3|  unnamed protein product                              97.1    9e-19    
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...  99.0    9e-19    
emb|CBI33419.3|  unnamed protein product                              97.1    1e-18    
gb|KFK27325.1|  hypothetical protein AALP_AA8G368300                  99.0    1e-18    
ref|XP_006453312.1|  hypothetical protein CICLE_v10008265mg           99.0    1e-18    
ref|XP_011023948.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  99.0    1e-18    
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...  98.6    1e-18    
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...  98.6    1e-18    
ref|XP_010270496.1|  PREDICTED: uncharacterized acetyltransferase...  99.0    1e-18    
ref|XP_010086996.1|  Omega-hydroxypalmitate O-feruloyl transferase    98.6    1e-18    
gb|KDO63871.1|  hypothetical protein CISIN_1g014029mg                 98.6    1e-18    
ref|XP_002969436.1|  BAHD acyltransferase, clade I                    98.6    1e-18    
emb|CDY62885.1|  BnaC03g74670D                                        98.2    1e-18    
gb|KDP38750.1|  hypothetical protein JCGZ_04103                       98.6    1e-18    
ref|XP_002960556.1|  BAHD family acyltransferase, clade I             98.6    1e-18    
gb|ABR17170.1|  unknown                                               98.2    2e-18    
ref|XP_004493180.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  98.6    2e-18    
gb|EYU46140.1|  hypothetical protein MIMGU_mgv1a024211mg              97.4    2e-18    
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  98.2    2e-18    
gb|ADG46003.1|  hydroxycinnamoyl transferase                          98.2    2e-18    
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                        98.2    2e-18    
gb|KCW50679.1|  hypothetical protein EUGRSUZ_J00365                   97.8    2e-18    
gb|KFK28037.1|  hypothetical protein AALP_AA8G463700                  97.8    2e-18    
ref|XP_010031398.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  98.2    2e-18    
emb|CDY41518.1|  BnaA06g22710D                                        97.8    2e-18    
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.8    2e-18    
gb|KDO61846.1|  hypothetical protein CISIN_1g036315mg                 98.2    2e-18    
ref|XP_003610074.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  98.2    2e-18    
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...  98.2    2e-18    
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  97.8    2e-18    
ref|XP_010250620.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.8    2e-18    
ref|XP_009150410.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.4    3e-18    
ref|XP_006447016.1|  hypothetical protein CICLE_v10015302mg           97.4    3e-18    
ref|XP_008231492.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  97.8    3e-18    
emb|CDY11845.1|  BnaC03g12710D                                        99.4    3e-18    
ref|XP_008226171.1|  PREDICTED: BAHD acyltransferase At5g47980-like   97.8    3e-18    
ref|XP_006470104.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.4    3e-18    
gb|KFK44501.1|  hypothetical protein AALP_AA1G265200                  97.4    3e-18    
ref|XP_009130368.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  97.8    3e-18    
ref|XP_011070326.1|  PREDICTED: vinorine synthase-like                97.4    3e-18    
ref|XP_008368264.1|  PREDICTED: vinorine synthase-like                97.1    3e-18    
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.8    4e-18    
emb|CAJ40778.1|  hydroxycinnamoyl transferase                         97.1    4e-18    
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  97.1    4e-18    



>ref|XP_009766130.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Nicotiana 
sylvestris]
Length=454

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/464 (63%), Positives = 363/464 (78%), Gaps = 23/464 (5%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             D+ V  I +SVVK +G  P+P ILTLSNLDLLSGRFPVTY Y +      + SS  I+D 
Sbjct  10    DYTVSIIRKSVVKAIGPIPEPRILTLSNLDLLSGRFPVTYFYVYHKAKH-NDSSASIVDE  68

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             L+ SL+ CLS FYPFAGRI+PNP+T+EPEILCDN G L + AQA+I L +L+FYNLNK +
Sbjct  69    LQNSLAICLSHFYPFAGRIIPNPETNEPEILCDNTGALFLVAQASISLNQLDFYNLNKCL  128

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E GKLVP  ++     F VQ+Q+T Y CGG+ +TFTFDHALGDASSF KFL  WSE+A  
Sbjct  129   E-GKLVPIHKE-----FPVQVQLTNYECGGIFITFTFDHALGDASSFTKFLLMWSEIARK  182

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
             KP S SPDHRR+L R R+PP YN S DE+F+SCSL DIL++  P TLL     KRLYYID
Sbjct  183   KPLSFSPDHRRYLFRARYPPIYNRSFDESFISCSLHDILHISTPNTLL-----KRLYYID  237

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNK-CKMGWLVDGRT  792
             AS+I +LQKLAS +    GT  +RTKIEAFSAYIWK+MV A+DK H+K CKMGWLVDGRT
Sbjct  238   ASNIDRLQKLASLD----GT--KRTKIEAFSAYIWKIMVKAIDKGHSKKCKMGWLVDGRT  291

Query  791   RI--PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWI  618
             RI    ++ +YIGN LS+  GE S+DE++  +I+ +A++VH AIS  T+AEHFLDLIDWI
Sbjct  292   RICTEKVLENYIGNALSIAVGEASVDEIEQASIANVANNVHDAISKVTSAEHFLDLIDWI  351

Query  617   ECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYV  438
             EC++PGLML+K+VLG+ GP  AIVVSSGRRFPV E++FGFG PV+GTV STI+++GVGY+
Sbjct  352   ECNKPGLMLAKIVLGQGGP--AIVVSSGRRFPVAEVDFGFGGPVVGTVYSTIQKLGVGYI  409

Query  437   NQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             NQRP A+GDGSWT+SAILWP+M+ ALES SE +FQP+T++ L L
Sbjct  410   NQRPGAKGDGSWTISAILWPEMIEALESDSEHVFQPMTSNHLKL  453



>ref|XP_009603648.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Nicotiana 
tomentosiformis]
Length=455

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/465 (63%), Positives = 363/465 (78%), Gaps = 24/465 (5%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             D+ V  I +SVVK  G  P+P ILTLSNLDLLSGRFPVTY Y +      + SS  + D 
Sbjct  10    DYAVSIIRKSVVKATGPIPEPRILTLSNLDLLSGRFPVTYFYVYHKAKH-NDSSASVADE  68

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK SL+ CLS FYPFAGRI+PNP+T+EPEILCDN G L + AQA+I L +L+FYNLNK +
Sbjct  69    LKNSLANCLSHFYPFAGRIIPNPETNEPEILCDNTGALFLVAQASISLNQLDFYNLNKCL  128

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E GKLVP       ++F VQ+Q+T Y CGG+ +TFTFDHALGDASSF KFL  WSE+A  
Sbjct  129   E-GKLVPIH-----EEFPVQVQLTNYECGGIFITFTFDHALGDASSFTKFLLMWSEIARK  182

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
             KP S SPDHRR+LLR R+PP YN S D++F+SCSL DIL++  P TLL     KRLYYID
Sbjct  183   KPLSFSPDHRRYLLRARYPPIYNRSFDKSFISCSLHDILHISTPSTLL-----KRLYYID  237

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNK-CKMGWLVDGRT  792
             AS+I +LQKLAS +    GT  +RTKIEAFSAYIWK+MV A+DK H+K CKMGWLVDGRT
Sbjct  238   ASNIDRLQKLASLD----GT--KRTKIEAFSAYIWKIMVKAIDKGHSKKCKMGWLVDGRT  291

Query  791   RI---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDW  621
             RI     +M +YIGN LS+  GE S++E++  +I+ +A++VH AIS  T+AEHFLDLIDW
Sbjct  292   RICNTEKVMENYIGNALSIAVGEASVNEIEQASIANVANNVHNAISKVTSAEHFLDLIDW  351

Query  620   IECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGY  441
             IEC++PGL+L+K+VLG+ GP  AIVVSSGRRFPV E++FGFGSPV+GTV STI+++GVGY
Sbjct  352   IECNKPGLVLAKIVLGQGGP--AIVVSSGRRFPVAEVDFGFGSPVVGTVYSTIQKLGVGY  409

Query  440   VNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             +NQRP A+GDGSWT+SAILWP+M+ ALES SE +FQP+T++ L L
Sbjct  410   INQRPGAKGDGSWTISAILWPEMIEALESDSEHVFQPMTSNHLKL  454



>ref|XP_006368253.1| transferase family protein [Populus trichocarpa]
 gb|ERP64822.1| transferase family protein [Populus trichocarpa]
Length=448

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/472 (61%), Positives = 359/472 (76%), Gaps = 27/472 (6%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHS  1533
             M  V     F V F  +SVVK     PKP  LTLSNLDLLSGRFPVTY YF+ +P +   
Sbjct  1     MEEVPEHGKFAVIFTEKSVVKAANPLPKPQRLTLSNLDLLSGRFPVTYFYFYHNPEKVCF  60

Query  1532  SSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELE  1353
             SS  I+++LK+SL++ LS +YPFAG+IV NP T+EPEI+CD+ G LVVE  ANI LK+L+
Sbjct  61    SS--IMESLKSSLAETLSYYYPFAGQIVQNPNTNEPEIICDDNGALVVEGHANISLKKLD  118

Query  1352  FYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLT  1173
             FYNL+++++ GKLV         +F +Q+Q+TRYTCGG+ +TFTFDHALGDAS+F KFL 
Sbjct  119   FYNLDQFLQ-GKLVSL-----NTEFPLQVQVTRYTCGGISITFTFDHALGDASAFGKFLV  172

Query  1172  TWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIM  993
             +WSE+A  KP SC PDHRR LL    P  Y+ SLD+TFV C++++I+NM   PT  + I+
Sbjct  173   SWSEIAQRKPISCMPDHRRNLLARCPPT-YHPSLDQTFVKCTIEEIINM---PT--TQIL  226

Query  992   LKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMG  813
             LKRLY+ID SSI++LQ+LA        +  +RTKIEAFSAY+WK+MV A+D+ H KCKMG
Sbjct  227   LKRLYHIDVSSINRLQQLAC------ASGNKRTKIEAFSAYVWKIMVTAIDERHQKCKMG  280

Query  812   WLVDGRTRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEH  642
             WLVDGR R+ G   +MS+YIGNVLS+   E ++ ELK G+IS IAS+VH +IS  TN  H
Sbjct  281   WLVDGRGRVHGAQNLMSNYIGNVLSVAVAEATIAELKQGSISDIASNVHDSISKVTNEAH  340

Query  641   FLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTI  462
             FLDLIDWIECHRPGLMLS +VLGR GP  A+V+SSGRRFPV EL+FGFG PVLGTVC+T+
Sbjct  341   FLDLIDWIECHRPGLMLSSIVLGRGGP--ALVLSSGRRFPVAELDFGFGGPVLGTVCTTV  398

Query  461   ERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             E+IGVGY+NQRPSAR DGSWTVSAILWP++ AALES S  IFQP++A  L L
Sbjct  399   EKIGVGYMNQRPSARNDGSWTVSAILWPELAAALESDS--IFQPMSASLLRL  448



>ref|XP_006355150.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Solanum 
tuberosum]
Length=454

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/474 (62%), Positives = 353/474 (74%), Gaps = 25/474 (5%)
 Frame = -1

Query  1712  MAAVDSCSD-FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFH  1536
             MA VD+  D + V FI +SVVK     P+PY+LTLSNLDLLSGRFPVTY Y +      +
Sbjct  1     MALVDARDDDYTVSFIRKSVVKATVTIPEPYVLTLSNLDLLSGRFPVTYFYIYHKAKH-N  59

Query  1535  SSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKEL  1356
             SSS  I D L+ SL+ CLS FYPFAGRI+ N +T EPEI+CDN G L +EAQ++  LKEL
Sbjct  60    SSSASIADELRKSLANCLSHFYPFAGRIISNTETHEPEIVCDNTGALFLEAQSSNSLKEL  119

Query  1355  EFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFL  1176
             + YNLNK +E GKLVP        +F VQ+Q+T Y CGG+ +TFTFDHALGDASSF+KFL
Sbjct  120   DLYNLNKCLE-GKLVPT-----NQEFPVQVQLTNYKCGGIIITFTFDHALGDASSFSKFL  173

Query  1175  TTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI  996
               WS++A  K  S SPDHRR+LLR R PP YN S DE+F+SCSL+DI N+  P TL+   
Sbjct  174   LMWSQIARKKSLSFSPDHRRYLLRARNPPIYNHSFDESFISCSLNDIHNISTPRTLV---  230

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKM  816
               KRLYYIDASSI  LQK+ S +    GT  +RTKIEAFSAYIWK+MV A+DK H KCKM
Sbjct  231   --KRLYYIDASSIDMLQKIVSID----GT--KRTKIEAFSAYIWKIMVKAIDKGHKKCKM  282

Query  815   GWLVDGRTRI----PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNA  648
             GWLVDGRTRI      +  +YIGN LS+  GE S+ E+    +S +A  VH AIS  T+A
Sbjct  283   GWLVDGRTRICTYNEKVTENYIGNALSIAVGEASVSEIDQALLSDVAKKVHNAISKVTSA  342

Query  647   EHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCS  468
             EHFLDLIDWIE ++PGLMLSK+VLG+ GP  AIVVSSGRRFPV E++FGFGSPVLGTV S
Sbjct  343   EHFLDLIDWIEWNKPGLMLSKIVLGQGGP--AIVVSSGRRFPVAEVDFGFGSPVLGTVYS  400

Query  467   TIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             TI+++GVGY+NQR  A+GDGSWTVSAILWPDM+ ALES S  +FQP+T++ L L
Sbjct  401   TIKKLGVGYINQRQGAKGDGSWTVSAILWPDMIEALESDSNHVFQPMTSNHLKL  454



>ref|XP_011018370.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Populus 
euphratica]
Length=448

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/463 (61%), Positives = 357/463 (77%), Gaps = 27/463 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNL  1506
             F V+F  +SVVK     PKP  LTLSNLDLLSGRFPVTY YF+ +P +   SS  I+++L
Sbjct  10    FAVNFTEKSVVKAANPLPKPQRLTLSNLDLLSGRFPVTYFYFYHNPEKVCFSS--IMESL  67

Query  1505  KASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVE  1326
             K+SL++ LS +YPFAG+IV NP T+EPEI+CD+ G LVVE  ANI LK+L+FYNL+++++
Sbjct  68    KSSLAETLSYYYPFAGQIVQNPSTNEPEIICDDNGALVVEGHANISLKKLDFYNLDQFLQ  127

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK  1146
              GKLV          F +Q+Q+TRY+CGG+ +TFTFDHALGDAS+F KFL +WSE+A  K
Sbjct  128   -GKLVSL-----NTGFPLQVQVTRYSCGGISITFTFDHALGDASAFGKFLVSWSEIAQRK  181

Query  1145  PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDA  966
             P SC+PDHRR LL    P  Y+ SLD+TFV C++++I+N+   PT  + I+LKRLY+ID 
Sbjct  182   PISCTPDHRRNLLARCPPT-YHPSLDQTFVKCTIEEIINI---PT--TRILLKRLYHIDV  235

Query  965   SSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI  786
             SSI++LQ+LA        +  +RTKIEAFSAY+WK+MV A+D+ H KCKMGWLVDGR R+
Sbjct  236   SSINRLQQLAC------ASGNKRTKIEAFSAYVWKIMVTAIDERHQKCKMGWLVDGRGRV  289

Query  785   PG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIE  615
              G   +MS+YIGNVLS+   E ++ ELK G+IS +AS+VH +IS  TN  HFLDLIDWIE
Sbjct  290   HGAEDLMSNYIGNVLSVAVAEATIAELKQGSISDVASNVHDSISKVTNEAHFLDLIDWIE  349

Query  614   CHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVN  435
             CHRPGLMLS +VLGR GP  A+V+SSGRRFPV EL+FGFG PVLGTVC+T+E+IGVGY+N
Sbjct  350   CHRPGLMLSSIVLGRGGP--ALVLSSGRRFPVAELDFGFGGPVLGTVCTTVEKIGVGYMN  407

Query  434   QRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             QRPSAR DGSWTVSAILWP++ AALES S  IF P++A  L L
Sbjct  408   QRPSARNDGSWTVSAILWPELAAALESDS--IFLPMSASLLRL  448



>emb|CDP19817.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/463 (62%), Positives = 350/463 (76%), Gaps = 25/463 (5%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNL  1506
             F V FI ++VVK +G  P  +ILTLSNLDLLSGRFPVTY YF+  P Q H  +P     L
Sbjct  3     FEVKFIRKTVVKAIGPLPDSHILTLSNLDLLSGRFPVTYFYFYNKP-QDHIPTP--FHAL  59

Query  1505  KASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVE  1326
             K SL++CLS FYPFAG+IV N +T+EPEI+CDN G L+VEA+ANI LKEL+FYNL+K ++
Sbjct  60    KDSLAKCLSLFYPFAGKIVQNSQTNEPEIICDNSGALLVEAKANIPLKELDFYNLDKSLQ  119

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK  1146
              GKLV   +     DF +QIQ+T YTCG L +TFTFDHALGDAS+F +FL TWSE+AT+K
Sbjct  120   -GKLVTIHQ-----DFPLQIQVTNYTCGNLSMTFTFDHALGDASAFGRFLLTWSEIATSK  173

Query  1145  PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDA  966
               S SPDH R L++ R PP Y+ SLDETF+SC+L DI N+   PT   + +LKRLYY+D 
Sbjct  174   SLSGSPDHSRDLIQARSPPTYDPSLDETFISCTLQDIANI---PT--GNKVLKRLYYVDV  228

Query  965   SSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI  786
              SI  LQ LAS +      S  RTKIEAFSAY+WK+MV A++K+H KCKMGWLVDGRTR+
Sbjct  229   KSIDSLQTLASLD------SEERTKIEAFSAYVWKIMVRAINKNHEKCKMGWLVDGRTRL  282

Query  785   P---GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIE  615
                   MS+YIGNV+S+ FG+  +  LK  ++++ A+ VH +IS  TN  HFLDLIDWIE
Sbjct  283   GKDRNSMSNYIGNVISVAFGDGDVHGLKQASLAETATLVHDSISKVTNQAHFLDLIDWIE  342

Query  614   CHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVN  435
             CHRPGLMLSK+VLG  GP  AIVVSSGRRFPV E++ GFG+P+LGTVCSTIE+IGVGY+N
Sbjct  343   CHRPGLMLSKIVLGLGGP--AIVVSSGRRFPVSEIDIGFGNPILGTVCSTIEKIGVGYIN  400

Query  434   QRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             QRPSA+GDGSW VS ILWP+M+AALES    +FQP+ A  L L
Sbjct  401   QRPSAKGDGSWIVSVILWPEMIAALESDPNQVFQPMNAKFLQL  443



>ref|XP_011070203.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=449

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/463 (61%), Positives = 347/463 (75%), Gaps = 27/463 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNL  1506
             F V+ + ++VVK  G  P+ ++++LSNLDLLSGRFPVTY+YF+R   + HSSS  I  +L
Sbjct  11    FEVEVVRKTVVKAAGPVPESHVISLSNLDLLSGRFPVTYIYFYR---RTHSSS-LIRGSL  66

Query  1505  KASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVE  1326
             K SL+QCLS FYPFAGRI  NPK+ EPEI+CDN G LVVEAQA+I L E +FYNLNK ++
Sbjct  67    KESLAQCLSHFYPFAGRISENPKSGEPEIICDNSGALVVEAQASISLDEFDFYNLNKSLQ  126

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK  1146
              GKL+    Q     F VQ+QIT Y  GG+ +TFTFDHALGDA++F+KFL TWSE+A  K
Sbjct  127   -GKLISVNHQ-----FPVQVQITNYIRGGISMTFTFDHALGDATAFSKFLVTWSEIAMKK  180

Query  1145  PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDA  966
             P SCSPDH R L     P  Y+ SLDE FVSC++++I N+   P +  SI+LKRLYYID 
Sbjct  181   PISCSPDHSRSLRARFPPT-YDPSLDEEFVSCTMEEICNI---PAI--SILLKRLYYIDE  234

Query  965   SSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI  786
             SSI++LQ+LAS          +RTKIEAFSAYIWKVM NA+DK+H  CK+GWLVDGR+R+
Sbjct  235   SSINRLQRLAS------ANGNKRTKIEAFSAYIWKVMANAIDKNHEFCKIGWLVDGRSRL  288

Query  785   PGI---MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIE  615
                   MS+YIGNVLSL FGE ++ +LK G+I+ IA  +H AIST TN  HF +LIDW+E
Sbjct  289   SKCQNSMSNYIGNVLSLAFGESNVADLKKGSIAGIADIIHKAISTVTNEAHFRNLIDWVE  348

Query  614   CHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVN  435
             CHRPGLM+SK VLG  GP  A+V+SSGRRFPV EL+FGFG+PVLGTV STIE +GVGY+N
Sbjct  349   CHRPGLMISKNVLGLGGP--ALVISSGRRFPVAELDFGFGNPVLGTVSSTIEGLGVGYIN  406

Query  434   QRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             QR SA  DGSWTVSAILWP+MV ALES    IFQP+  + + L
Sbjct  407   QRQSAGADGSWTVSAILWPEMVEALESDPNHIFQPMNLNHIQL  449



>ref|XP_006471640.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
Length=451

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/463 (61%), Positives = 351/463 (76%), Gaps = 28/463 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNL  1506
             F V    +S+VK +G  P+P+ L LSNLDLLSGRFPVTY YF+R P  F  + P II  L
Sbjct  12    FEVKPTGKSIVKAIGPLPEPHTLQLSNLDLLSGRFPVTYFYFYRRP--FGKNYPLIIQTL  69

Query  1505  KASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVE  1326
             + SL++ L+ +YPFAGRI+ NP+T+EPEI+CD  G LV+EA+ANI L  L+FYNLN+ ++
Sbjct  70    RISLAKTLNFYYPFAGRIIQNPQTNEPEIICDKNGALVLEAEANIPLVNLDFYNLNESLQ  129

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK  1146
              GKLV         DF +QIQ+T YTCGG+ +TF+FDHALGDASSF KFL +WSE+A  K
Sbjct  130   -GKLVSI-----QPDFPLQIQVTSYTCGGISITFSFDHALGDASSFGKFLVSWSEIAQQK  183

Query  1145  PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDA  966
             P +CSPD  R  LR RFPP Y+ SLD+TFV C++++I N+  P T   +I+LKRLY+IDA
Sbjct  184   PITCSPD-LRRNLRARFPPSYHPSLDQTFVKCTIEEISNI--PST---NILLKRLYHIDA  237

Query  965   SSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI  786
             SSI +LQ+LAS +       ++RTK+EAFSAYIWK+MV ++D+ H KCKMGWLVDGR RI
Sbjct  238   SSISRLQQLASVK------GKKRTKVEAFSAYIWKIMVTSIDEKHGKCKMGWLVDGRCRI  291

Query  785   ---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIE  615
                   MS YIGNVLSL  GE S+ ELK G+IS+IA+ VH +I+  TN  HFLDLIDWIE
Sbjct  292   LKHENPMSSYIGNVLSLAVGEASVTELKQGSISEIANRVHDSITKVTNEAHFLDLIDWIE  351

Query  614   CHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVN  435
             CHRPGLML+++VLGRDGP   +VVSSGRRFPV EL+FGFG+PVLG V S IER GVGY+N
Sbjct  352   CHRPGLMLARVVLGRDGP--TVVVSSGRRFPVAELDFGFGNPVLGAVSSIIERSGVGYIN  409

Query  434   QRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             QRPSA  DGSWTVSAILWP++  ALES S  IFQP++A D HL
Sbjct  410   QRPSATCDGSWTVSAILWPELATALESDS--IFQPMSAAD-HL  449



>gb|KDP28072.1| hypothetical protein JCGZ_19480 [Jatropha curcas]
Length=449

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/463 (60%), Positives = 342/463 (74%), Gaps = 27/463 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNL  1506
             F V    +S+VK     P P  L L+NLDLLSGRFPVTYLY +++P     +S  I+++L
Sbjct  11    FEVYLTEKSIVKAANHLPTPQRLALTNLDLLSGRFPVTYLYLYQNPQTVSFTS--IVESL  68

Query  1505  KASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVE  1326
             K SL++ LS +YPFAGRIV NP T EP I+CDN G LVVE  ANI LK+L+ Y+LN  +E
Sbjct  69    KKSLAETLSHYYPFAGRIVQNPLTSEPVIICDNNGALVVEGHANISLKKLDLYDLNHSLE  128

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK  1146
              GKLV         DF +Q+Q+T YTCGG+ +TFTFDHALGDAS+F KFL +WSE+A NK
Sbjct  129   -GKLVSI-----NPDFPLQVQVTNYTCGGISITFTFDHALGDASAFGKFLLSWSEIALNK  182

Query  1145  PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDA  966
             P SC PDHRR +     P  Y+ SLD TFV C+LDDI+NM   PT  ++I+LKRLY+ID 
Sbjct  183   PLSCMPDHRRNIYPRYPPS-YHPSLDRTFVKCTLDDIINM---PT--TNILLKRLYHIDV  236

Query  965   SSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI  786
             SSI+KLQ +A    +      +RTKIEAFSAY+WK+MV  +D+ H +CKMGWLVDGR RI
Sbjct  237   SSINKLQHIACSNGN------KRTKIEAFSAYVWKIMVATIDQKHERCKMGWLVDGRGRI  290

Query  785   ---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIE  615
                   MS+YIGNVLSL   E S+ +L+ G+IS IA++VH AIS  TN EHFLDLIDWIE
Sbjct  291   CREQNSMSNYIGNVLSLAVAEASIAQLRQGSISDIATNVHDAISQVTNNEHFLDLIDWIE  350

Query  614   CHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVN  435
             CHRPGLMLS +VLGR GP  A+V+SSGRRFPV E+ FGFGSPVLGTVCSTI++IGVGY+N
Sbjct  351   CHRPGLMLSNIVLGRGGP--ALVLSSGRRFPVAEINFGFGSPVLGTVCSTIQKIGVGYMN  408

Query  434   QRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             QR SA+GDGSWT+SAILWP++ A LE  S+ IF+P++   L L
Sbjct  409   QRSSAQGDGSWTISAILWPELAATLE--SDPIFEPMSDSHLQL  449



>ref|XP_010113024.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXC35195.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=452

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/470 (60%), Positives = 346/470 (74%), Gaps = 27/470 (6%)
 Frame = -1

Query  1700  DSCSDFRVDFITESVVKTVGLT-PKPYILTLSNLDLLSGRFPVTYLYFF-RSPNQFHSSS  1527
             +S S F V+     +VK    + P P +L LSNLDLLSGRFPVTY YF+  S    H+S 
Sbjct  4     ESTSLFEVNLTKNHIVKAFNPSLPNPNVLKLSNLDLLSGRFPVTYFYFYCNSLANEHTSQ  63

Query  1526  PKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFY  1347
             P +I+ LK SL+  L  +YPFAGRIV N  T+EP+I+CDN G L+VEA ANI +K L+FY
Sbjct  64    P-VIEGLKKSLAITLEHYYPFAGRIVQNTDTNEPQIICDNSGALIVEANANIPMKMLDFY  122

Query  1346  NLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTW  1167
             NLNK +E G+LV          F +QIQ+T YTCGG+ LTFTFDHALGDA++F KFL +W
Sbjct  123   NLNKSLE-GRLVSI-----TPGFPLQIQVTYYTCGGISLTFTFDHALGDATAFGKFLVSW  176

Query  1166  SELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLK  987
             SE+A NKP S  P+H+R LL  R PP Y+ SLD+TFV C++++I+N+  P      I+LK
Sbjct  177   SEIARNKPVSFKPNHQRNLLIARTPPIYDPSLDQTFVKCTIEEIMNIPTP-----KILLK  231

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWL  807
             RLY+IDASS+ +LQ LAS         +RRTKIEAFSAY+WK+MV A++K+    KMGWL
Sbjct  232   RLYFIDASSVDRLQSLASV------NGKRRTKIEAFSAYVWKIMVKAIEKNQATSKMGWL  285

Query  806   VDGRTRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFL  636
             VDGRTR+      MS+YIGNVLSL FGE  +D+LK  +IS IA+ VH AIS  TN  HFL
Sbjct  286   VDGRTRMCKDQISMSNYIGNVLSLAFGEAKVDDLKQSSISDIANKVHDAISKVTNEAHFL  345

Query  635   DLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIER  456
             DLIDWIECHRPGLMLSK+VLG+ GP  A+V+SSGRRFPV EL+FGFG PVLGTVCSTIER
Sbjct  346   DLIDWIECHRPGLMLSKIVLGQGGP--ALVLSSGRRFPVAELDFGFGGPVLGTVCSTIER  403

Query  455   IGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             IGV Y+NQRPSA G+GSWTVSAILWP+  +ALES S  IFQP+TA  L L
Sbjct  404   IGVAYMNQRPSASGNGSWTVSAILWPEFASALESDS--IFQPMTASHLQL  451



>emb|CAN76941.1| hypothetical protein VITISV_042905 [Vitis vinifera]
Length=450

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/468 (60%), Positives = 345/468 (74%), Gaps = 27/468 (6%)
 Frame = -1

Query  1700  DSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK  1521
             D    F V+F +++V+K +G  P+P+I+TLSNLDLLSGRFPVTY YF+  P     SS  
Sbjct  7     DVHGKFEVNFTSKTVIKAIGPLPEPHIITLSNLDLLSGRFPVTYFYFYHRPVLDDFSS--  64

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             II+ LK SL++ L+ +YPF+GRI  NP T+EPEI+CDN G LVVEA ANI LK+L+F+NL
Sbjct  65    IIEALKCSLAKILNHYYPFSGRIAENPNTNEPEIICDNSGALVVEAHANIPLKDLDFHNL  124

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             N  ++ GKLV         +F  Q+Q+T YTCGG+ +TFTFDHALGDAS+F KFL +WSE
Sbjct  125   NLSLQ-GKLVSI-----NPEFPFQVQVTNYTCGGISITFTFDHALGDASAFGKFLFSWSE  178

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             +A  +P SC PDHRR L     P  Y+  LD TFV C++++I+N+   PT+  + +LKRL
Sbjct  179   IALRRPLSCIPDHRRNLHARCPPT-YDPLLDRTFVKCTMEEIVNI---PTM--NTLLKRL  232

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVD  801
             Y++DASSI+ LQKLA           +RTKIEAFSAY+WKVMV A+D+ H KC MGWLVD
Sbjct  233   YHVDASSINHLQKLACL------NGHKRTKIEAFSAYLWKVMVKAIDEKHEKCNMGWLVD  286

Query  800   GRTRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDL  630
             GR  + G    +S+YIGNVLS+  GE S+ E+K G+I  +A  VH  IS  TN  HFLDL
Sbjct  287   GRMSMCGGXNSLSNYIGNVLSVAVGEASVVEVKQGSILDVAKIVHKVISKVTNKAHFLDL  346

Query  629   IDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIG  450
             IDWIECHRPGLMLS+ VLGR GP   +VVSSGRRFPV EL+FGFG+PVLGTVCSTIER+G
Sbjct  347   IDWIECHRPGLMLSRTVLGRGGP--TLVVSSGRRFPVSELDFGFGTPVLGTVCSTIERLG  404

Query  449   VGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             VGY+NQR SARGDGSWTVSAILWP++ AALES S  I QP+TA  L L
Sbjct  405   VGYINQRQSARGDGSWTVSAILWPELAAALESDS--ILQPMTATHLQL  450



>ref|XP_002274239.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
Length=450

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/468 (60%), Positives = 345/468 (74%), Gaps = 27/468 (6%)
 Frame = -1

Query  1700  DSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK  1521
             D    F V+F +++V+K +G  P+P+I+TLSNLDLLSGRFPVTY YF+  P     SS  
Sbjct  7     DVHGKFEVNFTSKTVIKAIGPLPEPHIITLSNLDLLSGRFPVTYFYFYHRPVLDDFSS--  64

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             II+ LK SL++ L+ +YPF+GRI  NP T+EPEI+CDN G LVVEA ANI LK+L+F+NL
Sbjct  65    IIEALKCSLAKILNHYYPFSGRIAENPNTNEPEIICDNSGALVVEAHANIPLKDLDFHNL  124

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             N  ++ GKLV         +F  Q+Q+T YTCGG+ +TFTFDHALGDAS+F KFL +WSE
Sbjct  125   NLSLQ-GKLVSI-----NPEFPFQVQVTNYTCGGISITFTFDHALGDASAFGKFLFSWSE  178

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             +A  +P SC PDHRR L     P  Y+  LD TFV C++++I+N+   PT+  + +LKRL
Sbjct  179   IALRRPLSCIPDHRRNLHARCPPT-YDPLLDRTFVKCTMEEIVNI---PTM--NTLLKRL  232

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVD  801
             Y++DASSI+ LQKLA           +RTKIEAFSAY+WKVMV A+D+ H KC MGWLVD
Sbjct  233   YHVDASSINHLQKLACL------NGHKRTKIEAFSAYLWKVMVKAIDEKHEKCNMGWLVD  286

Query  800   GRTRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDL  630
             GR  + G    +S+YIGNVLS+  GE S+ E+K G+I  +A  VH  IS  TN  HFLDL
Sbjct  287   GRMSMCGGQNSLSNYIGNVLSVAVGEASVVEVKQGSILDVAKIVHKVISKVTNKAHFLDL  346

Query  629   IDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIG  450
             IDWIECHRPGLMLS+ VLGR GP   +VVSSGRRFPV EL+FGFG+PVLGTVCSTIER+G
Sbjct  347   IDWIECHRPGLMLSRTVLGRGGP--TLVVSSGRRFPVSELDFGFGTPVLGTVCSTIERLG  404

Query  449   VGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             VGY+NQR SARGDGSWTVSAILWP++ AALES S  I QP+TA  L L
Sbjct  405   VGYINQRQSARGDGSWTVSAILWPELAAALESDS--ILQPMTATHLQL  450



>ref|XP_006471642.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Citrus 
sinensis]
Length=451

 Score =   528 bits (1361),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 278/456 (61%), Positives = 348/456 (76%), Gaps = 28/456 (6%)
 Frame = -1

Query  1664  ESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQC  1485
             +S+VK +G  P+P+ L LSNLDLLSGRFPVTY YF+R P  F  + P II  L+ SL++ 
Sbjct  19    KSIVKAMGPLPEPHTLQLSNLDLLSGRFPVTYFYFYRRP--FGKNYPLIIQTLRISLAKT  76

Query  1484  LSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPA  1305
             L+ +YPFAGRI+ NP+T+EPEI+CD  G LV+EA+ANI L  L+FYNLN+ ++ GKLV  
Sbjct  77    LNFYYPFAGRIIQNPQTNEPEIICDKNGALVLEAEANIPLVNLDFYNLNESLQ-GKLVSI  135

Query  1304  FRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPD  1125
                    DF +QIQ+T YTCGG+ +TF+FDHALGDASSF KFL +WSE+A  KP +CSPD
Sbjct  136   -----QPDFPLQIQVTSYTCGGISITFSFDHALGDASSFGKFLVSWSEIAQQKPITCSPD  190

Query  1124  HrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQ  945
               R  LR RFPP Y+ SLD+TFV C++++I N+  PPT   +I+LKR Y+IDASSI +LQ
Sbjct  191   -LRRNLRARFPPSYHPSLDQTFVKCTIEEISNI--PPT---NILLKRFYHIDASSISRLQ  244

Query  944   KLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI---PGIM  774
             +LAS         ++RTK+EAFSAYIWK+MV ++DK H KCKM WL+DG +RI      M
Sbjct  245   QLASV------NGKKRTKVEAFSAYIWKIMVTSIDKKHGKCKMDWLLDGCSRIRKYENPM  298

Query  773   SDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLM  594
             S YIGNVLSL  GE S+ ELK G+IS+IAS VH +I+  TN  HFLDLIDWIECHRPGLM
Sbjct  299   SSYIGNVLSLAVGEASVTELKQGSISEIASRVHDSITKVTNEAHFLDLIDWIECHRPGLM  358

Query  593   LSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARG  414
              +++VLGRDGP  A+++SSGRRFPV EL+FGFGSPVLG V S IER GVGY+NQRPSA+ 
Sbjct  359   PARVVLGRDGP--AVLMSSGRRFPVVELDFGFGSPVLGAVSSIIERSGVGYINQRPSAKC  416

Query  413   DGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             DGSWTVSAILWP++  ALE  S+ IFQP+++ D HL
Sbjct  417   DGSWTVSAILWPELATALE--SDFIFQPMSSAD-HL  449



>ref|XP_007040904.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY25405.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=450

 Score =   526 bits (1356),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 273/463 (59%), Positives = 345/463 (75%), Gaps = 26/463 (6%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPY--ILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKII  1515
                V+F  +S+VK   L P+ +  ++TLSNLDLLSGRFPVTYLYF+  P+  + SS   +
Sbjct  12    QMEVNFTKKSIVKAFNLLPERHHKLITLSNLDLLSGRFPVTYLYFYHRPSINNLSS--TV  69

Query  1514  DNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
             ++LK+SL++ LS +YPFAGRI  +P T EP I+CDN G L+VEAQANI L++L+ YN+N 
Sbjct  70    ESLKSSLAETLSYYYPFAGRITEDPDTSEPIIICDNTGALLVEAQANIPLRKLDLYNIND  129

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              ++ GKLV         +F +Q+Q+T YTCGG+ +TFTFDHALGDAS+F  FL++WS++A
Sbjct  130   SLQ-GKLVST-----DPNFPLQVQVTHYTCGGVSMTFTFDHALGDASAFGNFLSSWSQVA  183

Query  1154  TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYY  975
                P SC PDH R L     P  Y   LD+TFV C+L++I N+  P T   +I+LKRLYY
Sbjct  184   RKMPLSCIPDHGRNLRPRLPPT-YRPCLDQTFVKCTLEEIRNI--PKT---NILLKRLYY  237

Query  974   IDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGR  795
             +DASSI+KLQ LA  + +      +RTKIEAFSAYIWKVMV  +DKSH KCKMGWLVDGR
Sbjct  238   VDASSINKLQSLACADGN------KRTKIEAFSAYIWKVMVTTIDKSHAKCKMGWLVDGR  291

Query  794   TRIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIE  615
              R+ G MS+YIGNVLS+   E S+ E+K G+IS+IA++VH AIS   N EHFLDLIDWIE
Sbjct  292   GRLNGSMSNYIGNVLSVAIEEASIVEIKQGSISEIANNVHEAISKVANEEHFLDLIDWIE  351

Query  614   CHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVN  435
             CH+PGLML K+VLGR GP  A+V+SSGRRFPV EL+FGFGSPVLGTV S IE+ GVGY+N
Sbjct  352   CHKPGLMLPKVVLGRGGP--ALVLSSGRRFPVAELDFGFGSPVLGTVSSIIEKSGVGYMN  409

Query  434   QRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             QRPSAR DGSW VSAI+WP++ AALES S  +FQP+ A  L +
Sbjct  410   QRPSARSDGSWIVSAIIWPELAAALESDS--VFQPLCASHLQI  450



>ref|XP_009374636.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Pyrus 
x bretschneideri]
Length=458

 Score =   525 bits (1351),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 278/476 (58%), Positives = 344/476 (72%), Gaps = 36/476 (8%)
 Frame = -1

Query  1691  SDFRVDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFH------S  1533
             +DF V+F  + +VK     P +P+ILTLSNLDLLSGRFPVTY YF+  PN+ H      S
Sbjct  5     ADFEVNFTGKFIVKATNPMPDQPHILTLSNLDLLSGRFPVTYFYFY--PNKPHDHDHDAS  62

Query  1532  SSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELE  1353
             +   II++LK SL+  L  +YPF GRIV NP T+EP+I+CDN G LVVEA ANI LK L 
Sbjct  63    NFTSIIESLKTSLANTLDCYYPFCGRIVTNPHTNEPKIMCDNSGALVVEAHANIPLKRLN  122

Query  1352  FYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLT  1173
             FYN+++ +++ KLV         DF +Q+Q T YTCGG+ +TFTFDHALGDA+SF  FL 
Sbjct  123   FYNIDRSLQKDKLVSI-----NPDFPLQVQATFYTCGGVSITFTFDHALGDATSFGNFLL  177

Query  1172  TWSELATNKPPSCSPDHrrfllrprfpp-RYNTSLDETFVSCSLDDILNMRPPPTLLSSI  996
             +WSE+A  KP SC PDHRR L      P  Y++SLD TFV C++++I+N+    TL+   
Sbjct  178   SWSEIARKKPISCMPDHRRNLHLRARSPPTYHSSLDHTFVKCTMEEIMNIPTAKTLI---  234

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD-KSHNKCK  819
               KRLY+ID SSI +LQ LAS+        ++RTKIEA SAYIWK MV A+D KSH  CK
Sbjct  235   --KRLYFIDGSSIKQLQNLASKN------GKQRTKIEAVSAYIWKTMVTAIDTKSHGMCK  286

Query  818   MGWLVDGRTRI-----PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTAT  654
             MGWLVDGR+R+        +S+YIGNVLSL  GE S+ +L   +IS++A  V  AIS  T
Sbjct  287   MGWLVDGRSRLHKNEDENSLSNYIGNVLSLACGEASVSDLNQNSISEVADMVGEAISKVT  346

Query  653   NAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTV  474
             N EHFLDLIDWIECHRPG+MLS++VLG+ GP   +V+SSGRRFPVGEL+FGFGSPVLGTV
Sbjct  347   NEEHFLDLIDWIECHRPGIMLSRVVLGQGGP--TVVLSSGRRFPVGELDFGFGSPVLGTV  404

Query  473   CSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             CSTIERIGV Y+NQR SA+GDGSWTVS+ILWP++ AALES S  IFQP+T   L L
Sbjct  405   CSTIERIGVAYMNQRSSAKGDGSWTVSSILWPELAAALESDS--IFQPMTTSHLQL  458



>ref|XP_004301771.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Fragaria 
vesca subsp. vesca]
Length=462

 Score =   525 bits (1351),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 277/476 (58%), Positives = 349/476 (73%), Gaps = 35/476 (7%)
 Frame = -1

Query  1691  SDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIID  1512
             ++F V+F  + +VK      KP+ILTLSNLDLLSGRFPVTY YF+  P++ H++   I +
Sbjct  6     AEFEVNFTRKFIVKASNPLVKPHILTLSNLDLLSGRFPVTYFYFY--PSKPHANF-NITE  62

Query  1511  NLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             +LK+SL++ L+ +YPFAG+IV NP T+EPEI+CDN G LV+EAQANI L  L FY+LN+ 
Sbjct  63    SLKSSLAKTLNSYYPFAGKIVLNPSTNEPEIMCDNSGALVLEAQANIPLNTLNFYDLNQS  122

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELAT  1152
             +   KLV  +      D  +QIQ+T YTCGG+ +TFTFDHALGDASSF KFL +WSE+A 
Sbjct  123   LRGNKLVSIY-----PDIPLQIQVTYYTCGGVSITFTFDHALGDASSFGKFLLSWSEMAR  177

Query  1151  NKPPSCSPDHrrfllrprfpp-RYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYY  975
             NK  SC PDH+R L      P RY++SLD++FV C++++I+N+    TL+     KRLY+
Sbjct  178   NKSMSCVPDHQRSLRISARNPPRYHSSLDQSFVKCTMEEIMNIPTAKTLV-----KRLYF  232

Query  974   IDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA-----VDKSHNK-CKMG  813
             I+ SSI++LQ  A          ++RTKIEA SAY+WK MV A      +KSHN  CKMG
Sbjct  233   IENSSINQLQSQACR------NGKKRTKIEAVSAYVWKTMVQANIGTSTNKSHNAVCKMG  286

Query  812   WLVDGRTRI------PGI-MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTAT  654
             WLVDGR+R+      P   MS+YIGNVLSL FGE S+++LK G+IS +A+ V  AIS  T
Sbjct  287   WLVDGRSRLHKRDYDPNTNMSNYIGNVLSLAFGEASVNDLKKGSISDVANMVREAISKVT  346

Query  653   NAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTV  474
             N EHFLDLIDWIECHRPGLMLSK+VLG+ G   A+V+SSGR FPV EL+FGFGSPVLGTV
Sbjct  347   NEEHFLDLIDWIECHRPGLMLSKIVLGQGGGVPALVLSSGRMFPVAELDFGFGSPVLGTV  406

Query  473   CSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             CSTIE+IGV Y+NQRPSA GDGSWT+S ILWP++ AALES S  IFQP+TA  L L
Sbjct  407   CSTIEKIGVAYMNQRPSATGDGSWTMSCILWPELAAALESDS--IFQPMTADRLQL  460



>ref|XP_006432873.1| hypothetical protein CICLE_v10003717mg [Citrus clementina]
 gb|ESR46113.1| hypothetical protein CICLE_v10003717mg [Citrus clementina]
Length=451

 Score =   523 bits (1348),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 276/456 (61%), Positives = 347/456 (76%), Gaps = 28/456 (6%)
 Frame = -1

Query  1664  ESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQC  1485
             +S+VK +G  P+P+ L LSNLDLLSGRFPVTY YF+  P  F  + P II  L+ SL++ 
Sbjct  19    KSIVKAMGPLPEPHTLQLSNLDLLSGRFPVTYFYFYCRP--FGKNYPLIIQTLRISLAKT  76

Query  1484  LSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPA  1305
             L+ +YPFAGRI+ NP+T+EPEI+CD  G LV+EA+ANI L  L+FYNLN+ ++ GKLV  
Sbjct  77    LNFYYPFAGRIIQNPQTNEPEIICDKNGALVLEAEANIPLVNLDFYNLNESLQ-GKLVSI  135

Query  1304  FRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPD  1125
                    DF +QIQ+T YTCGG+ +TF+FDHALGDAS+F KFL +WSE+A  KP +CSPD
Sbjct  136   -----QPDFPLQIQVTSYTCGGISITFSFDHALGDASTFGKFLVSWSEIAQQKPITCSPD  190

Query  1124  HrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQ  945
               R  LR RFPP Y+ SLD+TFV C++++I N+  PPT   +I+LKR Y+IDASSI +LQ
Sbjct  191   -LRRNLRARFPPSYHPSLDQTFVKCTIEEISNI--PPT---NILLKRFYHIDASSISRLQ  244

Query  944   KLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI---PGIM  774
             +LAS         ++RTK+EAFSAYIWK+MV ++DK H KCKM WL+DG +RI      M
Sbjct  245   QLASV------NGKKRTKVEAFSAYIWKIMVTSIDKKHGKCKMDWLLDGCSRIRKYENPM  298

Query  773   SDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLM  594
             S YIGNVLSL  GE S+ ELK G+IS+IAS VH +I+  TN  HFLDLIDWIECHRPGLM
Sbjct  299   SSYIGNVLSLAVGEASVTELKQGSISEIASRVHDSITKVTNEAHFLDLIDWIECHRPGLM  358

Query  593   LSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARG  414
              +++VLGRDGP  A+++SSGRRFPV EL+FGFGSPVLG V S IER GVGY+NQRPSA+ 
Sbjct  359   PARVVLGRDGP--AVLMSSGRRFPVVELDFGFGSPVLGAVSSIIERSGVGYINQRPSAKC  416

Query  413   DGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             DGSWTVSAILWP++  ALE  S+ IFQP+++ D HL
Sbjct  417   DGSWTVSAILWPELATALE--SDFIFQPMSSAD-HL  449



>ref|XP_008380661.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Malus 
domestica]
Length=458

 Score =   522 bits (1344),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 277/476 (58%), Positives = 342/476 (72%), Gaps = 36/476 (8%)
 Frame = -1

Query  1691  SDFRVDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFH------S  1533
             +DF V+F  + +VK     P +P+ILTLSNLDLLSGRFPVTY YF+  PN+ H      S
Sbjct  5     TDFEVNFTGKFIVKATNPMPDQPHILTLSNLDLLSGRFPVTYFYFY--PNKPHDHDHDAS  62

Query  1532  SSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELE  1353
             +   II++LK SL+  L  +YPF GRIV NP T+EP+I+CDN G LVVEA ANI LK L 
Sbjct  63    NFTSIIESLKTSLANTLDCYYPFCGRIVTNPHTNEPKIMCDNSGALVVEAHANIPLKRLN  122

Query  1352  FYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLT  1173
             FYN++  +++ KLV         DF +Q+Q T YTCGG+ +TFTFDHALGDA+SF  FL 
Sbjct  123   FYNIDLSLQKDKLVSI-----NPDFPLQVQATFYTCGGVSITFTFDHALGDATSFGNFLL  177

Query  1172  TWSELATNKPPSCSPDHrrfllrprfpp-RYNTSLDETFVSCSLDDILNMRPPPTLLSSI  996
             +WSE+A  KP SC PDHRR L      P  Y++SLD TFV C++++I+N+    TL+   
Sbjct  178   SWSEIARKKPISCMPDHRRNLHLRARSPPTYHSSLDHTFVKCTMEEIMNIPTAKTLI---  234

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD-KSHNKCK  819
               KRLY+ID SSI +LQ LAS         ++RTKIEA SAYIWK MV A+D KSH  CK
Sbjct  235   --KRLYFIDGSSIKQLQNLASRN------GKQRTKIEAVSAYIWKTMVTAIDTKSHGMCK  286

Query  818   MGWLVDGRTRI-----PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTAT  654
             MGWLVDGR+R+        +S+YIGNVLS+ FGE S+ +L   +IS++A  V  AIS  T
Sbjct  287   MGWLVDGRSRLHKKEDENSLSNYIGNVLSVAFGEASVSDLNQNSISEVADMVGEAISKVT  346

Query  653   NAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTV  474
             N EHFLDLIDWIECHRPG+MLS++VLG+ GP   +V+SSG RFPVGEL+FGFGSPVLGTV
Sbjct  347   NEEHFLDLIDWIECHRPGIMLSRVVLGQGGP--TLVLSSGSRFPVGELDFGFGSPVLGTV  404

Query  473   CSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             CSTIERIGV Y+NQR SA+GDGSWTVS+ILWP++ AALES S  IFQP+T   L L
Sbjct  405   CSTIERIGVAYMNQRSSAKGDGSWTVSSILWPELAAALESDS--IFQPMTTSHLQL  458



>gb|ACU18592.1| unknown [Glycine max]
Length=454

 Score =   513 bits (1322),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 264/464 (57%), Positives = 339/464 (73%), Gaps = 29/464 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK-IIDN  1509
             F V F  +SVVK +  + +P+ +TLSNLDLLSGRFPVTYLYF+R   +  S + K  +D 
Sbjct  16    FEVTFSRKSVVKALNPSLEPFSITLSNLDLLSGRFPVTYLYFYR---KLESDNFKAFVDA  72

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +L+Q L R+YPFAG+IV NPKT EPEI+CDN G LV+EA  NI LK L+FYNLN+ +
Sbjct  73    LKNTLAQVLDRYYPFAGQIVQNPKTSEPEIICDNNGALVIEAHTNIPLKSLDFYNLNETL  132

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             +  K+V         DF +QIQ T YTCGG+ + FTFDHALGDA+SF KF+ +W E+A  
Sbjct  133   QE-KVVSV-----EPDFPLQIQATEYTCGGISIAFTFDHALGDATSFGKFIASWCEIAQK  186

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
             KP S  PDH R L     P  Y  SLD+TF+ C++ +I NM      ++ ++LKRLY+I+
Sbjct  187   KPLSSIPDHTRHLRARSSPK-YQPSLDQTFMKCTMKEIQNMP-----MNHVLLKRLYHIE  240

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTR  789
             ASSI  LQKLAS   +G+    +RTKIEAFSAY+WK+M+  +D+ H  CKMGWLVDGR R
Sbjct  241   ASSIDMLQKLASL--NGV----KRTKIEAFSAYVWKIMIGTIDERHKTCKMGWLVDGRER  294

Query  788   I---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWI  618
             +     +MS+YIGNVLSL FGE S+ ELK  +IS+IA  VH AIS   N +HFLDLIDWI
Sbjct  295   MGRGKNLMSNYIGNVLSLAFGEASIQELKEASISEIAKTVHEAISKVNNEDHFLDLIDWI  354

Query  617   ECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYV  438
             ECHRPGLML+K VLG++GP   +VVSSG+RFPV E++FGFGSP+LGTV ++I+++GV Y+
Sbjct  355   ECHRPGLMLAKAVLGQEGP--TLVVSSGQRFPVKEVDFGFGSPLLGTVYTSIQKVGVSYM  412

Query  437   NQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             NQR SA+GDGSWTVSAILWP++ AAL+   + IF P++A  L L
Sbjct  413   NQRLSAKGDGSWTVSAILWPELEAALQ--DDPIFHPMSASHLQL  454



>ref|XP_007210153.1| hypothetical protein PRUPE_ppa023735mg [Prunus persica]
 gb|EMJ11352.1| hypothetical protein PRUPE_ppa023735mg [Prunus persica]
Length=458

 Score =   513 bits (1321),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 286/476 (60%), Positives = 349/476 (73%), Gaps = 32/476 (7%)
 Frame = -1

Query  1697  SCSDFRVDFITESVVK-TVGLTPKPYILTLSNLDLLSGRFPVTYLYFF-RSPNQFHSSS-  1527
             S + F V+F T+ +VK T  +   P+IL+LSNLDLLSGRFPV+Y YF+   P+  H+++ 
Sbjct  3     SEAHFEVNFTTKFIVKPTNPMVDHPHILSLSNLDLLSGRFPVSYFYFYPNKPHDLHAATD  62

Query  1526  -PKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEF  1350
                II++L  SL+  L+ +YPFAGRIVPN  T+EPEI+CDN GVLVVEA ANI LKEL F
Sbjct  63    FSSIIESLNTSLASTLNSYYPFAGRIVPNQHTNEPEIMCDNSGVLVVEAHANIPLKELNF  122

Query  1349  YNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTT  1170
             Y+L++ ++  KL          DF  QIQ+T YTCGG+ +TFTFDHALGDA+SF  FL +
Sbjct  123   YDLDQSLKSNKLASI-----SPDFPFQIQVTLYTCGGVSITFTFDHALGDATSFGNFLLS  177

Query  1169  WSELATNKPPSCSPDHrrfllrprf-ppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIM  993
             WSE+A  KP SC PDHRR L      PP Y++SLD++FV C++++I+N+    TL+    
Sbjct  178   WSEIARKKPVSCVPDHRRNLHLRARCPPSYHSSLDQSFVKCTMEEIMNIPTAKTLI----  233

Query  992   LKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD-KSHNKCKM  816
              KRLYYI+ SSI  LQ LAS         +RRTKIEA SAYIWK MV A+D KSH  CKM
Sbjct  234   -KRLYYIEDSSIKHLQSLASR------NGKRRTKIEAVSAYIWKTMVTAIDTKSHGMCKM  286

Query  815   GWLVDGRTRIP------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTAT  654
             GWLVDGR+R+         MS+YIGNVLSL FGE S+ +LK G+IS +AS V  AIS  T
Sbjct  287   GWLVDGRSRMHKKENQINPMSNYIGNVLSLAFGEASVGDLKQGSISDVASIVGEAISKVT  346

Query  653   NAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTV  474
             N EHFLDLIDWIECHRPGLMLSK+VLG+ GP  A+V+SSGR+FPV EL+FGFGSPVLGTV
Sbjct  347   NEEHFLDLIDWIECHRPGLMLSKVVLGQGGP--ALVLSSGRKFPVAELDFGFGSPVLGTV  404

Query  473   CSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             CSTIERIGV Y+NQR SA+GDGSWTVS+ILWP++ AALES S  IFQPIT   L L
Sbjct  405   CSTIERIGVAYMNQRSSAKGDGSWTVSSILWPELAAALESDS--IFQPITTTHLQL  458



>ref|XP_003612550.1| Omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
 gb|AES95508.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=458

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 266/465 (57%), Positives = 341/465 (73%), Gaps = 27/465 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPY-ILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V FI +SVVK +   PKP+ ++ LSNLDLLSGRFPVTYLYF++ P   +  S   ++N
Sbjct  16    FEVKFIKKSVVKALNHFPKPFSVINLSNLDLLSGRFPVTYLYFYKKPKLGNFKS--FVNN  73

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK SL+Q L+ +YPFAG IV N KTDEP+I+CDN G LV+EAQ N+ L+ L+FYNLN+ +
Sbjct  74    LKTSLAQILNHYYPFAGHIVQNHKTDEPQIICDNNGSLVIEAQVNVPLRNLDFYNLNETL  133

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E  K+V         DF +QIQ+T +TCGG+ + FTFDHALGDA+SF KF+++W E+A N
Sbjct  134   EE-KIVSIEL-----DFPLQIQVTEFTCGGISIAFTFDHALGDATSFGKFISSWCEIAQN  187

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
             KP SC P+H+R L        Y   LD+ F+ C++++I NM+    +  +I LKRLY+ID
Sbjct  188   KPLSCIPNHKRNLCARSPLI-YQPYLDQIFIKCTMEEIQNMK----MSKNISLKRLYHID  242

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD-KSHNKCKMGWLVDGRT  792
             ASSI+ LQ+LAS   +GI    +RTKIEAFSAY+WK M+N VD K + KCKMGWLVDGR 
Sbjct  243   ASSINMLQRLASV--NGI----KRTKIEAFSAYVWKKMINTVDQKLYKKCKMGWLVDGRE  296

Query  791   RI---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDW  621
             R+      MS+YIGNVLSL FGE  + ELK G++S I   VH AIS  +N EH+LDLIDW
Sbjct  297   RMSVSKNSMSNYIGNVLSLAFGEARIQELKEGSLSDIGEIVHDAISKVSNEEHYLDLIDW  356

Query  620   IECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGY  441
             IE HRPGLML+K VLG+D  G  +VVSSG+RFPV E++ GFGSP+LGTV ++IER+GVGY
Sbjct  357   IEFHRPGLMLAKAVLGQDD-GPVLVVSSGQRFPVSEVDLGFGSPLLGTVYTSIERVGVGY  415

Query  440   VNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             +NQR S +GDGSWTVSAILWP++V AL+   + IFQP+TA  L L
Sbjct  416   MNQRQSGKGDGSWTVSAILWPELVDALK--DDPIFQPMTASYLQL  458



>ref|XP_003519086.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Glycine 
max]
Length=454

 Score =   511 bits (1315),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 263/464 (57%), Positives = 338/464 (73%), Gaps = 29/464 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK-IIDN  1509
             F V F  +SVVK +  + +P+ +TLSNLDLLSGRFPVTYLYF+R   +  S + K  +D 
Sbjct  16    FEVTFSRKSVVKALNPSLEPFSITLSNLDLLSGRFPVTYLYFYR---KLESDNFKAFVDA  72

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +L+Q L  +YPFAG+IV NPKT EPEI+CDN G LV+EA  NI LK L+FYNLN+ +
Sbjct  73    LKNTLAQVLDHYYPFAGQIVQNPKTSEPEIICDNNGALVIEAHTNIPLKSLDFYNLNETL  132

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             +  K+V         DF +QIQ T YTCGG+ + FTFDHALGDA+SF KF+ +W E+A  
Sbjct  133   QE-KVVSV-----EPDFPLQIQATEYTCGGISIAFTFDHALGDATSFGKFIASWCEIAQK  186

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
             KP S  PDH R L     P  Y  SLD+TF+ C++ +I NM      ++ ++LKRLY+I+
Sbjct  187   KPLSSIPDHTRHLRARSSPK-YQPSLDQTFMKCTMKEIQNMP-----MNHVLLKRLYHIE  240

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTR  789
             ASSI  LQKLAS   +G+    +RTKIEAFSAY+WK+M+  +D+ H  CKMGWLVDGR R
Sbjct  241   ASSIDMLQKLASL--NGV----KRTKIEAFSAYVWKIMIGTIDERHKTCKMGWLVDGRER  294

Query  788   I---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWI  618
             +     +MS+YIGNVLSL FGE S+ ELK  +IS+IA  VH AIS   N +HFLDLIDWI
Sbjct  295   MGRGKNLMSNYIGNVLSLAFGEASIQELKEASISEIAKTVHEAISKVNNEDHFLDLIDWI  354

Query  617   ECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYV  438
             ECHRPGLML+K VLG++GP   +VVSSG+RFPV E++FGFGSP+LGTV ++I+++GV Y+
Sbjct  355   ECHRPGLMLAKAVLGQEGP--TLVVSSGQRFPVKEVDFGFGSPLLGTVYTSIQKVGVSYM  412

Query  437   NQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             NQR SA+GDGSWTVSAILWP++ AAL+   + IF P++A  L L
Sbjct  413   NQRLSAKGDGSWTVSAILWPELEAALQ--DDPIFHPMSASHLQL  454



>ref|XP_008238079.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Prunus 
mume]
Length=460

 Score =   509 bits (1312),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 280/474 (59%), Positives = 349/474 (74%), Gaps = 32/474 (7%)
 Frame = -1

Query  1691  SDFRVDFITESVVK-TVGLTPKPYILTLSNLDLLSGRFPVTYLYFF-RSPNQFHSSS--P  1524
             +DF V+F T+ +VK T  +   P+IL+LSNLDLLSGRFPV+Y YF+   P+  H+++   
Sbjct  5     ADFEVNFTTKFIVKPTNPMVDHPHILSLSNLDLLSGRFPVSYFYFYPNEPHDLHAATDFS  64

Query  1523  KIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYN  1344
              II++L  SL+  L+ +YPFAGRIVPN  T+EPEI+CDN GVLVVEA ANI LK+L FY+
Sbjct  65    SIIESLNTSLASTLNSYYPFAGRIVPNQHTNEPEIMCDNSGVLVVEAHANIPLKKLNFYD  124

Query  1343  LNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWS  1164
             L++ ++  KL          DF  Q+Q+T YTCGG+ +TFTFDHALGDA+SF  FL +WS
Sbjct  125   LDQSLQSNKLASI-----SPDFPFQVQVTLYTCGGVSITFTFDHALGDATSFGNFLLSWS  179

Query  1163  ELATNKPPSCSPDHrrfllrprf-ppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLK  987
             E+A  KP SC PDHRR L      PP Y++SLD++FV C++++I+N+    TL+     K
Sbjct  180   EIARKKPVSCVPDHRRNLHLRARCPPSYHSSLDQSFVKCTMEEIMNIPTAKTLI-----K  234

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD-KSHNKCKMGW  810
             RLYYI+ SSI  LQ LAS         ++RTKIE+ SAYIWK MV A+D KSH  CKMGW
Sbjct  235   RLYYIEDSSIKHLQSLASR------NGKKRTKIESVSAYIWKTMVTAIDTKSHGMCKMGW  288

Query  809   LVDGRTRIP------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNA  648
             LVDGR+R+         MS+YIGNVLSL FGE S+ +LK G+IS +AS V  AIS  TN 
Sbjct  289   LVDGRSRMHKKENQINPMSNYIGNVLSLAFGEASVGDLKQGSISDVASIVGEAISKVTNE  348

Query  647   EHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCS  468
             EHFLDLIDWIECHRPGLMLSK+VLG+ GP  A+V+SSGR+FPV EL+FGFGSPVLGTVCS
Sbjct  349   EHFLDLIDWIECHRPGLMLSKVVLGQGGP--ALVLSSGRKFPVAELDFGFGSPVLGTVCS  406

Query  467   TIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             TIERIGV Y+NQR SA+GDGSWTVS+ILWP++ AALE  S+ IFQPIT   L+ 
Sbjct  407   TIERIGVAYMNQRSSAKGDGSWTVSSILWPELAAALE--SDTIFQPITTAHLNF  458



>ref|XP_004512355.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=458

 Score =   507 bits (1305),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 263/473 (56%), Positives = 343/473 (73%), Gaps = 27/473 (6%)
 Frame = -1

Query  1709  AAVDSCSDFRVDFITESVVKTVGLTPKPY-ILTLSNLDLLSGRFPVTYLYFFRSPNQFHS  1533
              A      F V F  +SVVK+     KP+ ++ LSNLDLLSGRFPVTYLYF++ P Q + 
Sbjct  8     VAYKEYEKFEVKFTRKSVVKSSNPLTKPFSVINLSNLDLLSGRFPVTYLYFYKKPKQGNF  67

Query  1532  SSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELE  1353
              S   +D+LK SL+Q L+ +YPFAG+IV NPKT+EP+I+CDN G L++EAQ NI LK L+
Sbjct  68    KS--FVDSLKTSLAQILNHYYPFAGQIVQNPKTNEPQIICDNNGSLLIEAQVNIPLKSLD  125

Query  1352  FYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLT  1173
             FYNLN+ +E  K+V     +   +F +QIQ+T+YTCGG+ ++FTFDHALGDA+SF KF++
Sbjct  126   FYNLNETLEE-KIV-----KVQPNFPLQIQVTQYTCGGISISFTFDHALGDATSFGKFIS  179

Query  1172  TWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIM  993
             +W E++ NKP SC P+H R L     P  Y   LD+ F+ C++++I NM       ++I 
Sbjct  180   SWCEISQNKPLSCIPNHTRNLCTNSPPK-YKPYLDKIFIKCTMEEIQNMSMEN---NNIS  235

Query  992   LKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS-HNKCKM  816
             LKRLY+IDASSI+ LQ+LAS      GT  +RTKIE+FSAY+WK+M+  +D+S + KCKM
Sbjct  236   LKRLYHIDASSINTLQRLASIN----GT--KRTKIESFSAYVWKIMIGTIDQSKYKKCKM  289

Query  815   GWLVDGRTRI---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAE  645
             GWLVDGR R+      MS+YIGNVLSL FGE  + ELK  ++SKI   VH +IS   N E
Sbjct  290   GWLVDGRERMNQNKNSMSNYIGNVLSLAFGEAMIQELKEASLSKICDIVHDSISKVNNEE  349

Query  644   HFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCST  465
             HFLDLIDWIE HRPGLML+K VLG+DGP   +VVSSG+RFPV E++ GFG P+LGTV ++
Sbjct  350   HFLDLIDWIEIHRPGLMLAKAVLGKDGP--VLVVSSGQRFPVCEVDLGFGCPLLGTVYTS  407

Query  464   IERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             I+R+GVGY+NQR S +GDGSWTVSAILWP++ AAL + S  IFQP+ A  L L
Sbjct  408   IKRVGVGYMNQRQSGKGDGSWTVSAILWPELEAALMNDS--IFQPMNASHLQL  458



>ref|XP_010244192.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Nelumbo 
nucifera]
Length=517

 Score =   508 bits (1307),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 272/480 (57%), Positives = 345/480 (72%), Gaps = 29/480 (6%)
 Frame = -1

Query  1724  SIPTMAAVDSCSD-FRVDFITESVVKTVGLTPKP-YILTLSNLDLLSGRFPVTYLYFFRS  1551
             S+ +MA  +   D F V F    VVK       P ++LTLSNLDLLSGRFPVTY Y +R 
Sbjct  60    SMVSMAIENQIHDGFSVIFTQNMVVKASSSASSPPHVLTLSNLDLLSGRFPVTYFYVYRK  119

Query  1550  PNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANI  1371
             P     S   +++ L +SL+  L+ +YPFAGRIV N KT EPEI+CDN G LVVEA ANI
Sbjct  120   PPA--ESFASVLNGLTSSLADTLTHYYPFAGRIVTNAKTSEPEIICDNHGALVVEAHANI  177

Query  1370  RLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASS  1191
              L EL++YNL+++++ GKLV         ++ + +Q+T YTCGG+ +TFTFDHALGDASS
Sbjct  178   PLDELDYYNLDQFLQ-GKLVSI-----NHEYPLHVQVTNYTCGGISITFTFDHALGDASS  231

Query  1190  FAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPT  1011
             F +FL  WSE+A  K  SC PDHRR L+    P  Y+ SLD+ F+SCS+++I N+    T
Sbjct  232   FGRFLLAWSEIAQGKTISCIPDHRRNLVARSPPT-YDPSLDDAFISCSIEEIANIPTKHT  290

Query  1010  LLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSH  831
             LL     K LY+IDASS+ +LQ+L+    DG+    +RTKIEAFSAYIWKVMV  +++S 
Sbjct  291   LL-----KLLYHIDASSVDRLQRLSCV--DGV----KRTKIEAFSAYIWKVMVRTIEESE  339

Query  830   NKCKMGWLVDGRTRI----PGI-MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAI  666
               CKMGWLVDGRTR+    P   M++YIGNVLS+ FGE S+++LK G++S +A  VH AI
Sbjct  340   THCKMGWLVDGRTRMCRDDPNYSMANYIGNVLSVVFGEASVEDLKRGSLSDVARIVHGAI  399

Query  665   STATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPV  486
             + ATN  HFLDLIDW+E HRPGLMLS++VLGR GP  A+V+SSGRRFPV E+ FGFG PV
Sbjct  400   AKATNEAHFLDLIDWVESHRPGLMLSRIVLGRGGP--ALVLSSGRRFPVAEMNFGFGPPV  457

Query  485   LGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             LGTVC+T+E+IGVGY+NQRPSARGDGSW VSAILWP++  ALES  E IFQP++   L L
Sbjct  458   LGTVCTTVEKIGVGYMNQRPSARGDGSWVVSAILWPELADALESDPERIFQPMSRTHLGL  517



>ref|XP_007145597.1| hypothetical protein PHAVU_007G252100g [Phaseolus vulgaris]
 gb|ESW17591.1| hypothetical protein PHAVU_007G252100g [Phaseolus vulgaris]
Length=452

 Score =   504 bits (1298),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 258/472 (55%), Positives = 337/472 (71%), Gaps = 27/472 (6%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHS  1533
             +  + +  +F V    +SVVK +    +P+ +TLSNLDLLSGRFPVTYLYF+R P     
Sbjct  5     LKKIAAPENFDVKLSKKSVVKALNPPAEPFKITLSNLDLLSGRFPVTYLYFYRKPQS--D  62

Query  1532  SSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELE  1353
             +    +D LK+SL+Q L  +YPFAG+IV NPKT EPEI+CDN G LV+EA  NI +K+++
Sbjct  63    NFKAFVDALKSSLAQILDHYYPFAGQIVQNPKTSEPEIICDNNGALVIEAHTNIPIKDID  122

Query  1352  FYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLT  1173
             FYNLN+ ++  K+V         DF  QIQ+T Y+CGG+ + FTFDHALGDASSF KF+ 
Sbjct  123   FYNLNETLQ-DKVVSV-----EPDFPTQIQVTEYSCGGMSIAFTFDHALGDASSFGKFIA  176

Query  1172  TWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIM  993
             +W E+A  KP SC PDH R L     P  Y   LD+ F+ C++++I NM      ++ I 
Sbjct  177   SWCEIAQKKPLSCVPDHTRHLRARSSPK-YQPFLDQNFIRCTMEEIQNMP-----MNQIS  230

Query  992   LKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMG  813
             LKRLY+I ASSI+ LQKLAS   DG+    ++TKIEAFSAY+WK+++  +D+ H KCKMG
Sbjct  231   LKRLYHIKASSINMLQKLASA--DGV----KKTKIEAFSAYVWKIIIGTIDQRHEKCKMG  284

Query  812   WLVDGRTRI---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEH  642
             WLVDGR R+     +MS+YIGNVLS+ FGE S+ ELK  +IS IA+ VH AIS   N  H
Sbjct  285   WLVDGRERMGRGENLMSNYIGNVLSVGFGEASIQELKESSISDIANTVHEAISKVNNEVH  344

Query  641   FLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTI  462
             FLDLIDW+ECHRPGLML+K VLG + P   +VVSSG+RFPV +++FGFGSP+LGTV +TI
Sbjct  345   FLDLIDWVECHRPGLMLAKAVLGGEVP--TLVVSSGQRFPVTDVDFGFGSPLLGTVYTTI  402

Query  461   ERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
              R+GVGY+NQR SA+GDGSWTVSAILWP++  AL+  ++ IF P++A  L L
Sbjct  403   PRVGVGYMNQRLSAKGDGSWTVSAILWPELEDALQ--NDPIFHPMSASHLEL  452



>ref|XP_008451859.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Cucumis 
melo]
Length=477

 Score =   503 bits (1294),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 272/466 (58%), Positives = 338/466 (73%), Gaps = 30/466 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVG---LTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKII  1515
              +V F  +S+VK         +P IL LSNLDLLSGRFP+TY YF+R P    +SS  II
Sbjct  36    LQVTFANKSIVKPTNNPLSESEPLILHLSNLDLLSGRFPITYFYFYRRPTT--NSSTGII  93

Query  1514  DNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
             D LK SL++ L+ +YPFAG+IV NP T+EPEI+C+N G LVVEA+AN+RL  L F++LN+
Sbjct  94    DALKISLAKTLNHYYPFAGKIVQNPTTNEPEIICNNFGALVVEAKANLRLDALNFHDLNE  153

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              ++ GKLV         DF +QIQIT Y CGG+ +TFTFDHALGDA++F KFL  WSE+ 
Sbjct  154   LLQ-GKLVTV-----NPDFPLQIQITCYACGGISITFTFDHALGDATAFGKFLLAWSEIT  207

Query  1154  TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYY  975
               KP S  PDHRR +L    P  Y+  L+ T V C+++DI N+   PTL    ++KRLYY
Sbjct  208   RGKPISTIPDHRRNILPRSPPT-YHPDLNNTMVKCTMEDINNI---PTLKK--LIKRLYY  261

Query  974   IDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGR  795
             ID +SI +LQKLAS   +G+    +RTKIEAFSAY+WK MV+A++  H KCKMGWLVDGR
Sbjct  262   IDQTSIDQLQKLAS--SNGV----KRTKIEAFSAYVWKKMVSAMETEHTKCKMGWLVDGR  315

Query  794   TRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLID  624
             +R+ G    MSDYIGNVLS+ FGE S++ELK  +I +IA  VH AIS ATN  HFLDL+D
Sbjct  316   SRLGGDRNYMSDYIGNVLSVVFGEASIEELKCNSIPEIADVVHEAISKATNKAHFLDLVD  375

Query  623   WIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVG  444
             WIEC RPGLM+S++VLG  GPG  +VVSSG+RFPV EL+FGFG PVLGTV STIERIGV 
Sbjct  376   WIECRRPGLMMSRIVLGLGGPG--LVVSSGQRFPVSELDFGFGGPVLGTVGSTIERIGVS  433

Query  443   YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             Y+NQRPSA+GDGSWTVSAIL P++   LE  S  +FQP+T   L L
Sbjct  434   YLNQRPSAKGDGSWTVSAILEPELATTLELDS--VFQPMTTTLLQL  477



>ref|XP_006303518.1| hypothetical protein CARUB_v10010922mg [Capsella rubella]
 gb|EOA36416.1| hypothetical protein CARUB_v10010922mg [Capsella rubella]
Length=444

 Score =   501 bits (1291),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 342/462 (74%), Gaps = 25/462 (5%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V FI E +VK  G  P K   L LSNLDLLSGRFPVTY YF+  P + + S   I+ +
Sbjct  4     FDVSFIREFIVKASGDQPEKVNSLALSNLDLLSGRFPVTYFYFY--PKKQNLSFETIVKS  61

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKT-DEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             LKASLS+ L+ FYPFAG+IV N  + +EP I+C++ G L+VEA+A++ LK L+FYNL+ +
Sbjct  62    LKASLSETLNYFYPFAGQIVTNETSQEEPIIICNDNGALLVEARASVDLKSLDFYNLDAF  121

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELAT  1152
             ++  KLV     R   DF +QIQ T + CGGL +TFTFDHALGDASSF  FLT+WSE++ 
Sbjct  122   LQ-SKLV-----RVNQDFPLQIQATEFECGGLAITFTFDHALGDASSFGNFLTSWSEISR  175

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYI  972
             N+P SC PDHRR LLR R PPRY+  LD+TF+ CS DDI N+  P TL+     KRLY+I
Sbjct  176   NQPVSCVPDHRRNLLRARSPPRYDPHLDKTFIKCSEDDIKNIPTPKTLI-----KRLYHI  230

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT  792
             +ASS++ LQ LA+   +       RTKIEAFSAY+WK MV++++ SH  CKMGWLVDGR 
Sbjct  231   NASSLYTLQALATVNGES------RTKIEAFSAYVWKKMVDSIESSHKTCKMGWLVDGRG  284

Query  791   RIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIEC  612
             R+  + S+YIGNVLS+  GE +++ L+   +S+IA+ VH +I+  TN  HF DLIDWIE 
Sbjct  285   RLETVTSNYIGNVLSVAVGEATIENLRQNHVSEIANIVHKSITQVTNDIHFTDLIDWIES  344

Query  611   HRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQ  432
             HRPGLML+++VLG++GP  A+V+SSGRRFPV EL+FGFG+P LGTVCSTIE+IGVGY+NQ
Sbjct  345   HRPGLMLARVVLGQEGP--ALVLSSGRRFPVAELDFGFGAPFLGTVCSTIEKIGVGYLNQ  402

Query  431   RPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             RPSA  DGSW+VSAI+WP++  ALES S  +FQP++A  L L
Sbjct  403   RPSACNDGSWSVSAIVWPELAEALESDS--VFQPMSAKHLQL  442



>ref|XP_002891141.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67400.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score =   498 bits (1283),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 337/462 (73%), Gaps = 25/462 (5%)
 Frame = -1

Query  1685  FRVDFITESVVKTVG-LTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V F  E +VK  G    K   LTLSNLDLLSGRFPVTY YF+  P Q   S   I+ +
Sbjct  4     FDVSFTGEFIVKASGDQLEKVSSLTLSNLDLLSGRFPVTYFYFY--PKQPQLSFESIVKS  61

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKT-DEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             LK+SLS+ L+ FYPFAG+IV N  + +EP I+C+N G L+VEA+A+I  K L+FYNL+ +
Sbjct  62    LKSSLSETLTYFYPFAGQIVTNETSQEEPMIICNNNGALLVEARAHIDFKSLDFYNLDVF  121

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELAT  1152
             ++  KLVP        DFA+QIQ+T + CGGL +TFTFDHALGDASSF KFLT WSE++ 
Sbjct  122   LQ-SKLVPV-----NPDFALQIQVTEFECGGLAITFTFDHALGDASSFGKFLTLWSEISR  175

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYI  972
             N+  SC PDHRR LLR R PPRY+  LD+ FV CS +DI N+      +S  ++KRLY+I
Sbjct  176   NQQVSCVPDHRRNLLRARSPPRYDPHLDKKFVKCSKEDIKNIP-----MSKTLIKRLYHI  230

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT  792
             DASSI  LQ LA+   +       RTKIEAFSAY+WK MV++++  H  CKMGWLVDGR 
Sbjct  231   DASSIDALQALATVNGES------RTKIEAFSAYVWKKMVDSIESGHKTCKMGWLVDGRG  284

Query  791   RIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIEC  612
             R+  + S+YIGNVLS+  GE S++ LK   +S+IA+ VH +I+  TN  HF DLIDWIE 
Sbjct  285   RLETVTSNYIGNVLSVAVGEASIENLKQNHVSEIANIVHKSITDVTNNTHFTDLIDWIES  344

Query  611   HRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQ  432
             HRPGLML+++VLG++GP  A+V+SSGRRFPV EL+FGFG+P LGTVCST+E+IGVGY+NQ
Sbjct  345   HRPGLMLARVVLGQEGP--ALVLSSGRRFPVAELDFGFGAPFLGTVCSTVEKIGVGYLNQ  402

Query  431   RPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             RPSA  DGSW+VSAI+WP++  ALES S  +FQP++A  L L
Sbjct  403   RPSACNDGSWSVSAIVWPELATALESDS--VFQPMSAKHLQL  442



>ref|XP_004148999.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Cucumis 
sativus]
 gb|KGN53458.1| hypothetical protein Csa_4G056000 [Cucumis sativus]
Length=453

 Score =   498 bits (1283),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 272/471 (58%), Positives = 338/471 (72%), Gaps = 38/471 (8%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPY--------ILTLSNLDLLSGRFPVTYLYFFRSPNQFHSS  1530
               V F  +S+VK    T  P+        IL LSNLDLLSGRFP+TY YF+R P    +S
Sbjct  10    LHVTFTNKSIVKP---TNNPFSESESDSPILHLSNLDLLSGRFPITYFYFYRRPTT--NS  64

Query  1529  SPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEF  1350
             S  IID LK SL++ L+ +YPFAG+IV NP T+EPEI+C+N G LVVEA+AN+ L  L F
Sbjct  65    STGIIDALKISLAKTLNHYYPFAGKIVQNPTTNEPEIICNNFGALVVEAKANLPLNALNF  124

Query  1349  YNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTT  1170
             ++LN+ ++  KLV         DF +QIQIT YTCGG+ +TFTFDHALGDA++F KFL  
Sbjct  125   HDLNELLQE-KLVTV-----NPDFPLQIQITSYTCGGISITFTFDHALGDATAFGKFLLA  178

Query  1169  WSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIML  990
             WSE++  K  S  PDHRR +L    P  Y+  L+ T V C+++DI N+   PTL    ++
Sbjct  179   WSEISRGKQISTIPDHRRSILPRSPPT-YHPDLNNTMVKCTMEDINNI---PTLKK--LI  232

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGW  810
             KRLYYID +SI +LQKL S   +G+    +RTKIEAFSAY+WK MV+A+   H KCKMGW
Sbjct  233   KRLYYIDQTSIDQLQKLGSS--NGV----KRTKIEAFSAYVWKKMVSAMGTEHTKCKMGW  286

Query  809   LVDGRTRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHF  639
             LVDGR+R+ G    MSDYIGNVLS+ FGE S++ELK  +I++IA  VH AIS ATN  HF
Sbjct  287   LVDGRSRLGGDRNYMSDYIGNVLSVVFGEASIEELKCSSIAEIADVVHEAISKATNKAHF  346

Query  638   LDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIE  459
             LDL+DWIECHRPGLM+S++VLG  GPG  +VVSSG+RFPV EL+FGFG PVLGTV STIE
Sbjct  347   LDLVDWIECHRPGLMMSRIVLGLGGPG--LVVSSGQRFPVSELDFGFGGPVLGTVGSTIE  404

Query  458   RIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             RIGV Y+NQRPSA+GDGSWTVSAIL P++ A LE  S  +FQP+T   L L
Sbjct  405   RIGVSYMNQRPSAKGDGSWTVSAILEPELAATLELDS--VFQPMTTTLLQL  453



>ref|NP_174434.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AAG51274.1|AC027135_15 N-hydroxycinnamoyl/benzoyltransferase, putative [Arabidopsis 
thaliana]
 gb|AAG60146.1|AC074360_11 hypothetical protein [Arabidopsis thaliana]
 gb|AEE31361.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=444

 Score =   497 bits (1280),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 334/462 (72%), Gaps = 25/462 (5%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V F  E +VK  G  P K   L LSN DLLSGRFPVTY YF+  P Q   S   I+ +
Sbjct  4     FDVSFTGEFIVKASGDQPEKVNSLNLSNFDLLSGRFPVTYFYFY--PKQPQLSFETIVKS  61

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKT-DEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             L++SLSQ LS FYPFAG+IVPN  + +EP I+C+N G L VEA+A++ LK L+FYNL+ +
Sbjct  62    LQSSLSQTLSYFYPFAGQIVPNETSQEEPMIICNNNGALFVEARAHVDLKSLDFYNLDAF  121

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELAT  1152
             ++  KLV         DF++QIQ T + CGGL LTFTFDHALGDASSF KFLT WSE++ 
Sbjct  122   LQ-SKLVQV-----NPDFSLQIQATEFECGGLALTFTFDHALGDASSFGKFLTLWSEISR  175

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYI  972
             NKP SC PDHRR LLR R PPRY+  LD+TF+ CS +DI N+      +S  ++KRLY+I
Sbjct  176   NKPVSCVPDHRRNLLRARSPPRYDPHLDKTFIKCSEEDIKNIP-----MSKTLIKRLYHI  230

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT  792
              ASS+  LQ LA+   +       RTKIEAFSAY+WK MV++++  H  CKMGWLVDGR 
Sbjct  231   GASSLDALQALATVNGES------RTKIEAFSAYVWKKMVDSIESGHKTCKMGWLVDGRG  284

Query  791   RIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIEC  612
             R+  + S YIGNVLS+  GE S++ LK   +S IA+ VH +I+  TN  HF DLIDWIE 
Sbjct  285   RLETVTSSYIGNVLSIAVGEASIENLKKNHVSDIANIVHKSITEVTNDTHFTDLIDWIES  344

Query  611   HRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQ  432
             HRPGLML+++VLG++GP  A+V+SSGRRFPV EL+FGFG+P LGTVCST+E+IGVGY+NQ
Sbjct  345   HRPGLMLARVVLGQEGP--ALVLSSGRRFPVAELDFGFGAPFLGTVCSTVEKIGVGYLNQ  402

Query  431   RPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             RPSA  DGSW+VSAI+WP++  ALES S  +FQP++A  L L
Sbjct  403   RPSACNDGSWSVSAIVWPELATALESDS--VFQPMSAKHLQL  442



>ref|XP_010478899.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Camelina 
sativa]
Length=444

 Score =   492 bits (1267),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 265/463 (57%), Positives = 336/463 (73%), Gaps = 27/463 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFF-RSPNQFHSSSPKIID  1512
             F V F  E +VK  G  P K   LTLSNLDLLSGRFPVTY YF+ + PN    S   I  
Sbjct  4     FDVSFTGEFIVKASGNQPEKVSSLTLSNLDLLSGRFPVTYFYFYTKQPN---VSFETIFK  60

Query  1511  NLKASLSQCLSRFYPFAGRIVPNPKT-DEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
             +L+ASLS+ L+ FYPFAG+IV N  + +EP I+C+N G L+VEA+A++ LK L+F+NL+ 
Sbjct  61    SLQASLSETLNYFYPFAGQIVTNEASQEEPIIICNNNGALLVEARASVDLKSLDFHNLDA  120

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              ++  KLV     R   DFA+QIQ T + CGGL +TFTFDHALGDASSF KFLT WSE++
Sbjct  121   LLQ-SKLV-----RVNPDFALQIQATEFECGGLAITFTFDHALGDASSFGKFLTLWSEIS  174

Query  1154  TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYY  975
              N+P SC PDHRR LLR R PPRY+  LD+ F+ CS +DI N+  P TL+     KRLY+
Sbjct  175   RNQPVSCVPDHRRNLLRARSPPRYDPHLDKIFIKCSEEDIKNIPMPKTLI-----KRLYH  229

Query  974   IDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGR  795
             IDASSI  LQ LA+   +       RTKIEAFSAY+WK MV++++  H  CKMGWLVDGR
Sbjct  230   IDASSIDTLQVLATVNGES------RTKIEAFSAYVWKKMVDSIESGHKTCKMGWLVDGR  283

Query  794   TRIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIE  615
              R+  + S YIGNVLS+  GE +++ LK   +S+IA+ VH +I+  TN  HF DLIDWIE
Sbjct  284   GRLETVTSSYIGNVLSVAVGEATIENLKQNHVSEIANIVHKSITEVTNDTHFTDLIDWIE  343

Query  614   CHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVN  435
              HRPGLML+++VLG++GP  A+V+SSGRRFPV EL+FGFG+P LGTVCST+E+IGVGY+N
Sbjct  344   SHRPGLMLARVVLGQEGP--ALVLSSGRRFPVAELDFGFGAPFLGTVCSTVEKIGVGYLN  401

Query  434   QRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             QRPSA  DGSW+VSAI+WP++  A ES S  +FQP++A  L L
Sbjct  402   QRPSACNDGSWSVSAIVWPELAEAFESDS--VFQPMSAKHLQL  442



>ref|XP_010056138.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Eucalyptus 
grandis]
 gb|KCW72727.1| hypothetical protein EUGRSUZ_E01171 [Eucalyptus grandis]
Length=454

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 268/466 (58%), Positives = 340/466 (73%), Gaps = 28/466 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVG-LTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V+   +S+VK++  L   P +L+LSNLDLLSGRFPVTY YF+R P     +   I++ 
Sbjct  11    FMVNVSKKSIVKSITPLEDPPQVLSLSNLDLLSGRFPVTYFYFYRKPANDGGNFASIVEA  70

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK+SL+  LS FYPFAGRI+ N  T EPEI+CDN G L++EA A+  LK+L+F ++N+++
Sbjct  71    LKSSLAVTLSYFYPFAGRILSNLSTGEPEIVCDNTGALLLEADASSDLKKLDFRDINQFM  130

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             + GKLV         DF VQ+Q+T+YTCGG+ LTF+FDHALGDA++F +FL +WSE++ N
Sbjct  131   Q-GKLVHI-----QPDFPVQVQVTKYTCGGISLTFSFDHALGDATAFHRFLLSWSEISRN  184

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
              P SC PDH R L     P  Y+ SLD+ F+ C+++DILN+  P TLL     KRLY+++
Sbjct  185   VPISCRPDHSRNLRARIPPT-YHPSLDQAFLKCTMEDILNIPTPKTLL-----KRLYHVE  238

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD-KSHNKCKMGWLVDGRT  792
               SI+KLQKLAS +       R RTKIEAFSAY+WK+MV A+D K H  CKMGWLVDGR 
Sbjct  239   YESINKLQKLASSD------GRSRTKIEAFSAYLWKMMVRAIDVKFHATCKMGWLVDGRR  292

Query  791   RIPGIMSD----YIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLID  624
             R+    SD    YIGNVLSL  GE S+ ELK+GTI+ ++S VH AIS  T   HFLDLID
Sbjct  293   RMRNGESDPSPDYIGNVLSLAVGEASIAELKNGTIADVSSKVHEAISKVTTRSHFLDLID  352

Query  623   WIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVG  444
             WIECHRPGLML+++VLG+ GP   +VVSSGRRFPV EL+FGFG PVLGTVCSTIE+IGVG
Sbjct  353   WIECHRPGLMLARVVLGQGGP--TLVVSSGRRFPVAELDFGFGRPVLGTVCSTIEKIGVG  410

Query  443   YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             YVNQR SARGDGSWT+SAILWP++ AA +  S+ I QP++   L L
Sbjct  411   YVNQRASARGDGSWTLSAILWPELAAAFD--SDPIIQPMSTRYLQL  454



>ref|XP_004166659.1| PREDICTED: LOW QUALITY PROTEIN: anthranilate N-benzoyltransferase 
protein 1-like [Cucumis sativus]
Length=453

 Score =   489 bits (1260),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 269/471 (57%), Positives = 335/471 (71%), Gaps = 38/471 (8%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPY--------ILTLSNLDLLSGRFPVTYLYFFRSPNQFHSS  1530
               V F  +S+VK    T  P+        IL LSNLDLLSGRFP+TY YF+R P    +S
Sbjct  10    LHVTFTNKSIVKP---TNNPFSESESDSPILHLSNLDLLSGRFPITYFYFYRRPTT--NS  64

Query  1529  SPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEF  1350
             S  IID LK SL++ L+ +YPFAG+IV NP T+EPEI+C+N G LVVEA+AN+ L  L F
Sbjct  65    STGIIDALKISLAKTLNHYYPFAGKIVQNPTTNEPEIICNNFGALVVEAKANLPLNALNF  124

Query  1349  YNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTT  1170
             ++LN+ ++  KLV         DF +QIQIT Y CGG+ +TFTFDHALGDA++F KFL  
Sbjct  125   HDLNELLQE-KLVTV-----NPDFPLQIQITSYACGGISITFTFDHALGDATAFGKFLLA  178

Query  1169  WSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIML  990
             WSE++  K  S  PDHRR +L    P  Y+  L+ T V C+++DI N+   PTL  + ++
Sbjct  179   WSEISRGKQISTIPDHRRNILPRSPPT-YHPDLNNTMVKCTMEDINNI---PTL--NKLI  232

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGW  810
             KRLYYID +SI +LQKL S   +G+    +RTKIEAFSAY+WK MV+A+   H KCKMGW
Sbjct  233   KRLYYIDQTSIDQLQKLGSS--NGV----KRTKIEAFSAYVWKKMVSAMGTEHTKCKMGW  286

Query  809   LVDGRTRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHF  639
             LVDGR+R+ G    MSDYIGNVLS+ FGE S++ELK  +I++IA  VH AIS ATN  HF
Sbjct  287   LVDGRSRLGGDRNYMSDYIGNVLSVVFGEASIEELKCNSIAEIADVVHEAISKATNKAHF  346

Query  638   LDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIE  459
             LDL+DWIECH PGLM+S++VLG  GPG  +VVSSG+ FPV EL+FGFG PVLGTV STIE
Sbjct  347   LDLVDWIECHWPGLMMSRIVLGLGGPG--LVVSSGQMFPVSELDFGFGGPVLGTVGSTIE  404

Query  458   RIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             RIGV Y+NQRPSA GDGSWTVSAIL P++ A LE  S  +FQP+T   L L
Sbjct  405   RIGVSYMNQRPSANGDGSWTVSAILEPELAATLELDS--VFQPMTTTLLQL  453



>ref|XP_009114984.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Brassica 
rapa]
Length=440

 Score =   488 bits (1255),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 269/462 (58%), Positives = 342/462 (74%), Gaps = 27/462 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V F  ES+VK  G  P +P+ L+LSNLDLLSGRFPVTY YF+  P Q H  S    ++
Sbjct  2     FDVCFTGESIVKASGNNPERPHSLSLSNLDLLSGRFPVTYFYFY--PKQPHLVS--TFES  57

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKT-DEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             LKASL++ L+ FYPFAG+IVPN  + +EP ILC+N G L+V+A+AN  LK L+FYNL+ +
Sbjct  58    LKASLAETLNYFYPFAGQIVPNETSHEEPIILCNNNGALLVQARANTDLKSLDFYNLDAF  117

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELAT  1152
             ++  KLV     R   DF +QIQ T + CGG  LTFTFDHALGDASSFAKFLTTWSE++ 
Sbjct  118   LQ-AKLV-----RVNPDFPLQIQATEFECGGFSLTFTFDHALGDASSFAKFLTTWSEISR  171

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYI  972
              +P SC PDHRR LL PR P RY+  LD+TF+ CS+++I N+  P TL+     KRLY+I
Sbjct  172   KQPVSCEPDHRRNLLLPRSPLRYHPLLDKTFIKCSVEEIKNIPTPKTLI-----KRLYHI  226

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT  792
             +ASSI+ LQ LA+   +       RTKIEAFSAY+WK MV++++  H  CKMGWLVDGR 
Sbjct  227   NASSINALQDLANVNGES------RTKIEAFSAYVWKKMVDSIESGHKTCKMGWLVDGRG  280

Query  791   RIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIEC  612
             R+  + S YIGNVLS+  GE  ++ LK   +S+IA  VH +I+  TN  HF DLIDWIE 
Sbjct  281   RLETVASSYIGNVLSIAVGEAPIENLKQNKVSEIAKIVHESITEVTNNTHFTDLIDWIES  340

Query  611   HRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQ  432
             HRPGLML+++VLG++GP  A+V+SSGRRFPV EL+FGFG+PVLGTVCST+E+IGVGY+NQ
Sbjct  341   HRPGLMLARVVLGQEGP--ALVLSSGRRFPVAELDFGFGAPVLGTVCSTVEKIGVGYLNQ  398

Query  431   RPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             RPSA  DGSW+VSAI+WP++ AALES S  +FQP++A  L L
Sbjct  399   RPSACNDGSWSVSAIVWPELAAALESDS--LFQPMSAKHLQL  438



>ref|XP_010499698.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=444

 Score =   488 bits (1255),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 262/461 (57%), Positives = 335/461 (73%), Gaps = 25/461 (5%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V F  E +VK  G  P K   LTLSNLDLLSGRFPVTY YF+  P Q + S   I  +
Sbjct  4     FDVSFTGEFIVKASGDQPEKVNSLTLSNLDLLSGRFPVTYFYFY--PKQPNVSFQTIFKS  61

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKT-DEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             L+ASLS+ L+ F+PFAG+IV N  + +EP I+C+N G L++EA+A++ LK L+F+NL+  
Sbjct  62    LQASLSETLNYFHPFAGQIVTNEASQEEPIIICNNNGALLLEARASVDLKSLDFHNLDAL  121

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELAT  1152
             ++  KLV     R   DF++QIQ T + CGGL +TFTFDHALGDASSF KFLT WSE++ 
Sbjct  122   LQ-SKLV-----RVNPDFSLQIQATEFECGGLAMTFTFDHALGDASSFGKFLTLWSEISR  175

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYI  972
             N+P S  PDHRR LLR R PPRY+  LD+TF+ CS +DI N+  P TL+     KRLY+I
Sbjct  176   NQPLSFVPDHRRNLLRARSPPRYDPHLDKTFIKCSEEDIKNIPMPKTLI-----KRLYHI  230

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT  792
             DASSI  LQ LA+   +       RTKIEAFSAY+WK MV++++  H  CKMGWLVDGR 
Sbjct  231   DASSIDMLQVLATVNRES------RTKIEAFSAYVWKKMVDSIESGHKTCKMGWLVDGRG  284

Query  791   RIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIEC  612
             R+  + S YIGNVLS+  GE +++ LK   +S+IA+ VH +I+  TN  HF DLIDWIE 
Sbjct  285   RLETVTSSYIGNVLSVAVGEATIENLKQNHVSEIANIVHKSITEVTNDTHFTDLIDWIES  344

Query  611   HRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQ  432
             HRPGLML++MVLG++GP  A+V+SSGRRFPV EL+FGFG+P LGTVCST+E+IGVGY+NQ
Sbjct  345   HRPGLMLARMVLGQEGP--ALVLSSGRRFPVAELDFGFGAPFLGTVCSTVEKIGVGYLNQ  402

Query  431   RPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLH  309
             RPSA  DGSW+VSAI+WP++  A ES S  +FQP++A  L 
Sbjct  403   RPSACNDGSWSVSAIVWPELAEAFESDS--VFQPMSAKHLQ  441



>emb|CDY12305.1| BnaA09g25050D [Brassica napus]
Length=440

 Score =   479 bits (1232),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 268/462 (58%), Positives = 339/462 (73%), Gaps = 27/462 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V F  ESVVK  G  P + + L+LSNLDLLSGRFPVTY YF+  P Q H  S    ++
Sbjct  2     FDVCFTGESVVKASGNNPERSHSLSLSNLDLLSGRFPVTYFYFY--PKQPHLVS--TFES  57

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKT-DEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             LKASL++ L+ FYPFAG+IVPN  + +EP ILC N G L+V+A+AN  LK L+FYNL+ +
Sbjct  58    LKASLAETLNYFYPFAGQIVPNETSHEEPIILCSNNGALLVQARANTDLKSLDFYNLDAF  117

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELAT  1152
             ++  KLV     R   DF  QIQ T + CGG  LTFTFDHALGDASSF KFLTTWSE++ 
Sbjct  118   LQ-AKLV-----RVNPDFPFQIQATEFECGGFSLTFTFDHALGDASSFGKFLTTWSEISR  171

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYI  972
              +P SC PDHRR LL PR PP Y+  LD+TF+ CS++DI N+  P TL+     KRLY+I
Sbjct  172   KEPVSCVPDHRRNLLLPRSPPHYHPLLDKTFIKCSVEDIKNIPTPKTLI-----KRLYHI  226

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT  792
             +ASSI+ LQ LA+   +       RTKIEAFSAY+WK MV++++  H  CKMGWLVDGR 
Sbjct  227   NASSINALQDLANVNGES------RTKIEAFSAYVWKKMVDSIESCHKTCKMGWLVDGRG  280

Query  791   RIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIEC  612
             R+  + S YIGNVLS+  GE +++ LK   +S+IA  VH +I+  TN  HF DLIDWIE 
Sbjct  281   RLETVTSSYIGNVLSIAVGEATIENLKLNHVSEIAKIVHESITEVTNNTHFTDLIDWIES  340

Query  611   HRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQ  432
             HRPGLML+++VLG++GP  A+V+SSGRRFPV EL+FGFG+PVLGTVCST+E+IGVGY+NQ
Sbjct  341   HRPGLMLARVVLGQEGP--ALVLSSGRRFPVAELDFGFGAPVLGTVCSTVEKIGVGYLNQ  398

Query  431   RPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             RPSA  DGSW+VSA++WP++ AALES S  +FQP++A  L L
Sbjct  399   RPSACNDGSWSVSAMVWPELAAALESDS--VFQPMSAKHLQL  438



>gb|KFK44930.1| hypothetical protein AALP_AA1G321300 [Arabis alpina]
Length=443

 Score =   479 bits (1233),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 338/459 (74%), Gaps = 22/459 (5%)
 Frame = -1

Query  1679  VDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLK  1503
             V F  E +VK  G  P K + L+LSNLDLLSGRFPVTY YF+        +   I+ +LK
Sbjct  4     VTFTGEFIVKASGDQPEKIHSLSLSNLDLLSGRFPVTYFYFYTKQPHLLLTFDSIVKSLK  63

Query  1502  ASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVER  1323
              SL++ L+ FYPFAG+IVP+  T EP I+C+N G L+VEA+AN+ LK L FYNL+ +++ 
Sbjct  64    TSLAETLNYFYPFAGQIVPDETTQEPMIICNNNGALLVEARANLDLKSLNFYNLDMFLQ-  122

Query  1322  GKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKP  1143
              KLV     R   D+A+QIQ T + CGGL +TFTFDHALGDASSF KFLT+WSE++  +P
Sbjct  123   AKLV-----RVNPDYALQIQATEFQCGGLSITFTFDHALGDASSFGKFLTSWSEISRKQP  177

Query  1142  PSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDAS  963
              SC PDHRR LLR R PPRY+  LD+TF+ C+ ++I N+      +S  ++KRLY+IDAS
Sbjct  178   VSCEPDHRRNLLRARSPPRYHPLLDKTFIKCNEEEIKNIP-----MSKTLIKRLYHIDAS  232

Query  962   SIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIP  783
             SI  LQ LA+ + +       RTKIEAFSAY+WK MV+A++  H  CKMGWLVDGR R+ 
Sbjct  233   SIDALQALATVKGES------RTKIEAFSAYVWKKMVDAIESGHKTCKMGWLVDGRGRLE  286

Query  782   GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRP  603
              + S YIGNVLS+  GE +++ LK   +S++A+ VH +I+ ATN  HF DLIDWIE +RP
Sbjct  287   TVTSSYIGNVLSVAVGEATVENLKQNHVSEVANIVHKSITEATNDTHFRDLIDWIENNRP  346

Query  602   GLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPS  423
             GLML+++VLG++GP  A+V+SSGRRFPV EL+FGFGSP LGTVCST+E+IGVGY+NQRPS
Sbjct  347   GLMLARVVLGQEGP--ALVLSSGRRFPVAELDFGFGSPFLGTVCSTVEKIGVGYLNQRPS  404

Query  422   ARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             A  DGSW+VSAI+WP++ AALES S  IFQP++A  L L
Sbjct  405   ACNDGSWSVSAIVWPELAAALESDS--IFQPMSAKCLQL  441



>emb|CDY62304.1| BnaA09g54240D [Brassica napus]
Length=440

 Score =   478 bits (1230),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 266/465 (57%), Positives = 344/465 (74%), Gaps = 33/465 (7%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKII--  1515
             F V F  ES+VK     P +P+ L+LSNLDLLSGRFPVTY YF+  P Q     P ++  
Sbjct  2     FDVCFTGESIVKASDNNPERPHNLSLSNLDLLSGRFPVTYFYFY--PKQ-----PLLVST  54

Query  1514  -DNLKASLSQCLSRFYPFAGRIVPNPKT-DEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
              ++LKASL++ L+ FYPFAG+IVPN  + +EP ILC+N G L+V+A+AN  LK L+F NL
Sbjct  55    FESLKASLAETLNYFYPFAGQIVPNETSHEEPIILCNNNGALLVQARANTDLKSLDFNNL  114

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             + +++  KLV     R   DF +QIQ T + CGG  LTFTFDHALGDASSF+KFLTTWSE
Sbjct  115   DAFLQ-AKLV-----RVNPDFPLQIQATEFECGGFSLTFTFDHALGDASSFSKFLTTWSE  168

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             ++  +P SC PDHRR LL PR PPRY+  LD+TF+ CS+++I N+  P TL+     KRL
Sbjct  169   ISRKQPVSCEPDHRRNLLLPRSPPRYHPLLDKTFIKCSVEEIKNIPTPKTLI-----KRL  223

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVD  801
             Y+I+ASSI+ LQ LA+   +       RTKIEAFSAY+WK MV++++  H  CKMGWLVD
Sbjct  224   YHINASSINALQDLANVNGES------RTKIEAFSAYVWKKMVDSIESCHKTCKMGWLVD  277

Query  800   GRTRIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDW  621
             GR R+  + S YIGNVLS+  GE +++ LK   +S+IA  VH +I+  TN  HF+DLIDW
Sbjct  278   GRGRLETVTSSYIGNVLSIAVGEATIENLKQNKVSEIAKIVHESITEVTNNTHFIDLIDW  337

Query  620   IECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGY  441
             IE HRPGLML+++VLG++GP  A+V+SSGRRFPV EL+FGFG+PVLGTVCST+E+IGVGY
Sbjct  338   IESHRPGLMLARVVLGQEGP--ALVLSSGRRFPVAELDFGFGAPVLGTVCSTVEKIGVGY  395

Query  440   VNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             +NQRPSA  DGSW+VSAI+WP++ AALES S  +FQP++A  L L
Sbjct  396   LNQRPSACNDGSWSVSAIVWPELAAALESDS--LFQPMSAKHLQL  438



>ref|XP_006415323.1| hypothetical protein EUTSA_v10009746mg [Eutrema salsugineum]
 gb|ESQ33676.1| hypothetical protein EUTSA_v10009746mg [Eutrema salsugineum]
Length=446

 Score =   474 bits (1221),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 264/460 (57%), Positives = 336/460 (73%), Gaps = 23/460 (5%)
 Frame = -1

Query  1679  VDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLK  1503
             V F  E VVK  G  P K + L+LSNLDLLSGRFPVTY YF+        +   I+ +LK
Sbjct  6     VSFTGEFVVKASGDKPEKVHSLSLSNLDLLSGRFPVTYFYFYPKQPHLLLTFDSIVKSLK  65

Query  1502  ASLSQCLSRFYPFAGRIVPNPKT-DEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVE  1326
             A+L++ L+ FYPFAG+IV N  T +EP I+C+N G L+VEA+AN  LK L+FYNL+  ++
Sbjct  66    ATLAETLNYFYPFAGQIVQNETTQEEPMIVCNNNGALLVEARANQDLKSLDFYNLDALLQ  125

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK  1146
               KLV     R   DFA+QIQ T + CGGL +TFTFDHALGDA+SF KFLT+WSE++ N+
Sbjct  126   -AKLV-----RVNPDFALQIQATEFECGGLSITFTFDHALGDANSFGKFLTSWSEISRNQ  179

Query  1145  PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDA  966
             P SC PDHRR LLR R PPRY+  LD+TF+ CS ++I N+  P TL+     KRLY+IDA
Sbjct  180   PVSCIPDHRRNLLRARSPPRYHPLLDKTFIKCSEEEIKNIPMPKTLI-----KRLYHIDA  234

Query  965   SSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI  786
              SI+ L  LA+   +       RTKIEAFSAY+WK MV++++  H  CKMGWLVDGR R+
Sbjct  235   LSINALHALATVNGES------RTKIEAFSAYVWKKMVDSIESGHKTCKMGWLVDGRGRL  288

Query  785   PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHR  606
               + S YIGNVLS+  GE +++ LK   +S+IA+ VH +I+  TN  HF DLIDWIE HR
Sbjct  289   ETVTSSYIGNVLSVAVGEATVENLKQNHVSEIANIVHNSINEVTNDSHFKDLIDWIESHR  348

Query  605   PGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRP  426
             PGLML+++VLG++GP  A+V+SSGRRFPV EL+FGFG+P LGTVCSTIE+IGVGY+NQRP
Sbjct  349   PGLMLARVVLGQEGP--ALVLSSGRRFPVAELDFGFGAPFLGTVCSTIEKIGVGYLNQRP  406

Query  425   SARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             SA  DGSW+VSAI+WPD+ AALES S  +FQP++A  L L
Sbjct  407   SACNDGSWSVSAIVWPDLAAALESDS--VFQPMSAKHLQL  444



>ref|XP_006432870.1| hypothetical protein CICLE_v10003778mg [Citrus clementina]
 gb|ESR46110.1| hypothetical protein CICLE_v10003778mg [Citrus clementina]
Length=414

 Score =   470 bits (1210),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 261/463 (56%), Positives = 322/463 (70%), Gaps = 65/463 (14%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNL  1506
             F V    +S+VK +G  P+P+ L LSNLDLLSGRFPVTY YF+R P  F  + P II  L
Sbjct  12    FEVKPTGKSIVKAIGPLPEPHTLQLSNLDLLSGRFPVTYFYFYRRP--FGKNYPLIIQTL  69

Query  1505  KASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVE  1326
             + SL++ L+ +YPFAGRI+ NP+T+EPEI+CDN G LV+EA+ANI L   +FYNLN+ ++
Sbjct  70    RISLAKTLNFYYPFAGRIIQNPQTNEPEIICDNNGALVLEAEANIPLVNHDFYNLNESLQ  129

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK  1146
              GKLV         DF +QIQ+T YTCGG+ +TF+FDHALGDASSF KFL +WSE+A  K
Sbjct  130   -GKLVSI-----QPDFPLQIQVTSYTCGGISITFSFDHALGDASSFGKFLVSWSEIAQQK  183

Query  1145  PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDA  966
             P +CSPD  R  LR RFPP Y+ SLD+TFV C++++I N+  P T   +I+LKRLY+IDA
Sbjct  184   PITCSPD-LRRNLRARFPPSYHPSLDQTFVKCTIEEISNI--PST---NILLKRLYHIDA  237

Query  965   SSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI  786
             SSI +LQ+LAS +       ++RTK+EAFSAYIWK+MV ++D+ H KCKMGWLVDGR RI
Sbjct  238   SSISRLQQLASVK------GKKRTKVEAFSAYIWKIMVTSIDEKHGKCKMGWLVDGRCRI  291

Query  785   ---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIE  615
                   MS YIGNVLSL  GE S                                     
Sbjct  292   LKHENPMSSYIGNVLSLAVGEAS-------------------------------------  314

Query  614   CHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVN  435
             CHRPGLML+++VLGRDGP   +VVSSGRRFPV EL+FGFG+PVLG V S IER GVGY+N
Sbjct  315   CHRPGLMLARVVLGRDGP--TVVVSSGRRFPVAELDFGFGNPVLGAVSSIIERSGVGYIN  372

Query  434   QRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             QRPSA  DGSWTVSAILWP++  ALES S  IFQP++A D HL
Sbjct  373   QRPSATCDGSWTVSAILWPELATALESDS--IFQPMSAAD-HL  412



>emb|CBI29221.3| unnamed protein product [Vitis vinifera]
Length=450

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 258/468 (55%), Positives = 320/468 (68%), Gaps = 64/468 (14%)
 Frame = -1

Query  1700  DSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK  1521
             D    F V+F +++V+K +G  P+P+I+TLSNLDLLSGRFPVTY YF+  P     SS  
Sbjct  44    DVHGKFEVNFTSKTVIKAIGPLPEPHIITLSNLDLLSGRFPVTYFYFYHRPVLDDFSS--  101

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             II+ LK SL++ L+ +YPF+GRI  NP T+EPEI+CDN G LVVEA ANI LK+L+F+NL
Sbjct  102   IIEALKCSLAKILNHYYPFSGRIAENPNTNEPEIICDNSGALVVEAHANIPLKDLDFHNL  161

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             N  ++ GKLV         +F  Q+Q+T YTCGG+ +TFTFDHALGDAS+F KFL +WSE
Sbjct  162   NLSLQ-GKLVSI-----NPEFPFQVQVTNYTCGGISITFTFDHALGDASAFGKFLFSWSE  215

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             +A  +P SC PDHRR L     P  Y+  LD TFV C++++I+N+   PT+  + +LKRL
Sbjct  216   IALRRPLSCIPDHRRNLHARCPPT-YDPLLDRTFVKCTMEEIVNI---PTM--NTLLKRL  269

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVD  801
             Y++DASSI+ LQKLA           +RTKIEAFSAY+WKVMV A+D+ H KC MGWLVD
Sbjct  270   YHVDASSINHLQKLACLN------GHKRTKIEAFSAYLWKVMVKAIDEKHEKCNMGWLVD  323

Query  800   GRTRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDL  630
             GR  + G    +S+YIGNVLS+  GE S                                
Sbjct  324   GRMSMCGGQNSLSNYIGNVLSVAVGEAS--------------------------------  351

Query  629   IDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIG  450
                  CHRPGLMLS+ VLGR GP   +VVSSGRRFPV EL+FGFG+PVLGTVCSTIER+G
Sbjct  352   -----CHRPGLMLSRTVLGRGGP--TLVVSSGRRFPVSELDFGFGTPVLGTVCSTIERLG  404

Query  449   VGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             VGY+NQR SARGDGSWTVSAILWP++ AALES S  I QP+TA  L L
Sbjct  405   VGYINQRQSARGDGSWTVSAILWPELAAALESDS--ILQPMTATHLQL  450



>ref|XP_010519084.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Tarenaya 
hassleriana]
Length=446

 Score =   466 bits (1200),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 241/460 (52%), Positives = 322/460 (70%), Gaps = 24/460 (5%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNL  1506
               V    E  VK  G  P+   L LSNLDLLSGRFPVTY Y +  P Q   S   II++L
Sbjct  9     LEVRVTRELRVKASGDLPEFQTLFLSNLDLLSGRFPVTYFYLY--PKQPVLSFGSIIESL  66

Query  1505  KASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVE  1326
             + SLS+ L+ FYPFAG+I+ N  + EP I+C+N G L+V+AQA   L++++FYN++  V 
Sbjct  67    RKSLSETLTYFYPFAGQIIHNKASQEPVIICNNNGALLVQAQAEYELQDIDFYNID-LVL  125

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK  1146
             + KLV         DF +Q+Q+T +TCGG+ + FTFDHALGDASSF KFL +WSE++  +
Sbjct  126   QAKLVQV-----NPDFPLQVQVTGFTCGGVSVAFTFDHALGDASSFGKFLKSWSEISRKQ  180

Query  1145  PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDA  966
             P SC PDHRR L     P  Y+  LD++F+ C++++I ++      +S  ++KRLY++D 
Sbjct  181   PISCMPDHRRGLRPRSPPT-YHPLLDKSFIKCTVEEIKSIP-----VSKKLIKRLYHVDV  234

Query  965   SSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI  786
             SSI  LQ  A            RTKIEAFSAY+WK MV+ ++KSH  CKMGWL+DGR R+
Sbjct  235   SSIKALQARAC------ANGEIRTKIEAFSAYVWKKMVDCIEKSHTTCKMGWLIDGRGRL  288

Query  785   PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHR  606
                 ++YIGNVLS+  GE S+ +LK  ++S IA  VH AI+ ATN  HF DLIDW+ECHR
Sbjct  289   RAATTNYIGNVLSVAVGEASIQQLKEDSVSDIADIVHKAITEATNETHFADLIDWVECHR  348

Query  605   PGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRP  426
             PGLMLS++VLG+ GP  A+V+SSGRRFPV EL+FGFG+P+LGTVCST++ IGV Y+NQRP
Sbjct  349   PGLMLSRVVLGQGGP--ALVLSSGRRFPVAELDFGFGAPLLGTVCSTVKNIGVCYLNQRP  406

Query  425   SARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             SA  +GSWT+SAI+WP++ AALE  S+ +FQP++A  L L
Sbjct  407   SAWSNGSWTISAIVWPELAAALE--SDTVFQPMSAKHLQL  444



>ref|XP_002519902.1| transferase, putative [Ricinus communis]
 gb|EEF42506.1| transferase, putative [Ricinus communis]
Length=392

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 255/460 (55%), Positives = 308/460 (67%), Gaps = 82/460 (18%)
 Frame = -1

Query  1673  FITE-SVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKAS  1497
             FIT+ S+++ +   PKP ILTLSNLDLLSGRFPVTYLYF+  PN   +S   II+++K S
Sbjct  11    FITKKSIIRAINSLPKPQILTLSNLDLLSGRFPVTYLYFY--PNPEAASFTSIIESVKCS  68

Query  1496  LSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGK  1317
             L++ LS +YPFAGRIV NP T EPEI+CDN G LVVE  ANI LK+LEFYNLN+ ++ GK
Sbjct  69    LAETLSYYYPFAGRIVQNPVTAEPEIVCDNNGALVVEGHANISLKKLEFYNLNQCLQ-GK  127

Query  1316  LVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPS  1137
             LV         DF + +Q+T YTCGG+ + F F                           
Sbjct  128   LVSI-----SPDFPLHVQVTHYTCGGISIAFNF---------------------------  155

Query  1136  CSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSI  957
                DH                           DI+NM   PT  ++I+LKRLY+IDASSI
Sbjct  156   ---DHAL-------------------------DIINM---PT--TNILLKRLYHIDASSI  182

Query  956   HKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIPGI  777
             +KLQ +A           +RTKIEAFSAYIWK+MV A+DK H +CKMGWLVDGR R+ G 
Sbjct  183   NKLQHIAC------ANGNKRTKIEAFSAYIWKIMVTAIDKKHERCKMGWLVDGRGRMHGA  236

Query  776   ---MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHR  606
                MSDYIGNVLS+T GE S+ ELK G+IS IA+ VH  IS  T+ +HF DLIDWIECHR
Sbjct  237   QDPMSDYIGNVLSVTVGEASVAELKLGSISDIAAIVHETISKVTDEKHFQDLIDWIECHR  296

Query  605   PGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRP  426
             PGLML K+VLGR GP  A+V+SSGRRFPV EL FGFGSPVLGTVCSTIE+IGVGY NQRP
Sbjct  297   PGLMLPKIVLGRGGP--AVVLSSGRRFPVAELNFGFGSPVLGTVCSTIEKIGVGYFNQRP  354

Query  425   SARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             SA+ DGSWTVSAILWP++ AALE  S+ IF+P++ + L L
Sbjct  355   SAQNDGSWTVSAILWPELAAALE--SDPIFEPMSVNHLQL  392



>gb|EPS71697.1| hypothetical protein M569_03062 [Genlisea aurea]
Length=449

 Score =   406 bits (1043),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 224/444 (50%), Positives = 302/444 (68%), Gaps = 29/444 (7%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P++++ SNLDLLSGRFPVTYL+ +      HSS      N  ASLS+ L  FYPFA RI 
Sbjct  27    PHVISPSNLDLLSGRFPVTYLFIYA-----HSSPSS--SNFLASLSESLRIFYPFAARIA  79

Query  1448  PNPKTDEPEILCDNR---GVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDF  1278
              NP + + EI+C +    GVL V A AN+ L + + Y+L++ +E GKLVP     G  D 
Sbjct  80    HNPNSGDLEIVCGDTSTGGVLFVHAAANVSLDDFDLYDLDRILE-GKLVPV----GDTDL  134

Query  1277  AVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrpr  1098
               +IQIT + CG   +TFTFDH LGDAS+FAKFL+T+SE+A  KP SCSPDH R L    
Sbjct  135   GFKIQITTFACGSTAVTFTFDHLLGDASAFAKFLSTFSEIALRKPVSCSPDHTRNLKPRN  194

Query  1097  fppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDG  918
              P  Y+ ++D++FV+C+++ I NM   PT+ +  ++KRLY ++ +SI +LQ LA E    
Sbjct  195   PPV-YDPAMDDSFVACTMEQIRNM---PTI-ALPLIKRLYRVEKASIERLQGLAGEN---  246

Query  917   IGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIPGI-MSDYIGNVLSLT  741
              GT  +RTKIEAFS+YIWK+M  ++     +C+MGWLVDGR R+    M +YIGNV+S+ 
Sbjct  247   -GT--KRTKIEAFSSYIWKIMAASIKNKGKRCRMGWLVDGRRRMSSKSMENYIGNVVSIA  303

Query  740   FGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHR--PGLMLSKMVLGRD  567
              GE+ +  ++  +I+ +A  VH +IS  T   HF +LIDWIEC +   GL+ SK+VLG  
Sbjct  304   SGEMEVRAIRESSIADMAETVHRSISEVTVESHFRNLIDWIECKKRAGGLVSSKLVLGDG  363

Query  566   GPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAI  387
             G    IVVSSGRRFPV E++ GFG+PVLGTVCS++ER+GVGY+NQR    GDGSWTVS I
Sbjct  364   GDCPCIVVSSGRRFPVREVDLGFGNPVLGTVCSSVERLGVGYINQREGGSGDGSWTVSVI  423

Query  386   LWPDMVAALESHSECIFQPITAHD  315
             LW +MV A+ESH + IF+P+  H+
Sbjct  424   LWREMVDAMESHPDSIFRPLHHHN  447



>ref|XP_010918051.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=454

 Score =   368 bits (944),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 202/466 (43%), Positives = 284/466 (61%), Gaps = 24/466 (5%)
 Frame = -1

Query  1691  SDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIID  1512
             S   +  I++S++K       P +L +SN D LSGR+PVT  Y +  P+     S  +I+
Sbjct  9     SKLSIRLISKSIIKAANSNTPPSVLPVSNFDHLSGRYPVTIFYAYSKPSTGDFDS--VIN  66

Query  1511  NLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
              +K SL++ L  F+PFAGRIVPNP++ E EILC+N G+ ++EA A++ +  L FY+LN  
Sbjct  67    TIKTSLAETLDYFFPFAGRIVPNPESGELEILCNNEGIELIEASADVSITSLNFYDLNDS  126

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELAT  1152
             V+R  ++P+  +       + +Q+T Y CGG  + ++FDH L D + F KFL  WSELA 
Sbjct  127   VKR-VMLPSTTE-----IPLSVQVTSYACGGFSIAWSFDHLLADGNGFVKFLFLWSELAR  180

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYI  972
                    P+H R + RPR PP Y   LD TF +C+L D+L M       + I LKR+YYI
Sbjct  181   TGRIPAMPNHDRSIFRPRSPPSYGPLLDRTFTACTLHDVLAMP-----RNDISLKRMYYI  235

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT  792
               S I +LQ    E   G+G  R RT  EA SAY+WKV+  ++ ++  +C+MGWLVDGR 
Sbjct  236   HGSCIDRLQATVKE---GVGVERTRT--EAISAYLWKVLARSLGETDTECRMGWLVDGRP  290

Query  791   RI---PGI-MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLID  624
              +   PG  +SDY+GNV+S+  GE S  ELK G++S +A  V   I+   N  HFL+L+D
Sbjct  291   WMVSEPGEDLSDYVGNVVSMAVGEASTRELKEGSLSYVAGMVAQVIAEVKNKAHFLELLD  350

Query  623   WIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVG  444
             WIEC RP ++L++++LG  GP  A+VVSS    PV   +FGFGSP LGT  + ++ IG G
Sbjct  351   WIECRRPEMVLARILLGLQGP--AMVVSSCHNMPVMATDFGFGSPRLGTFNTALDAIGAG  408

Query  443   YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             YVN   S R DGSW + A +WP +   LES  E +F PIT   + L
Sbjct  409   YVNLVSSGREDGSWFIFAFIWPRLALELESDPEQVFLPITVDYIGL  454



>ref|XP_010943006.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=457

 Score =   363 bits (931),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 208/475 (44%), Positives = 289/475 (61%), Gaps = 29/475 (6%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHS  1533
             +A  +  S      I + ++K      +P IL LSN D L G FPVT  Y +R P+    
Sbjct  2     VAGENHDSGIAAKLINQGIIKVTDDHRQPSILPLSNFDRLMGGFPVTIFYAYRKPSTGDF  61

Query  1532  SSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELE  1353
              S  I+  +K SLS+ L+ FYPFAGRIV N  T E EILC+N G+  +EA+A++ L  L+
Sbjct  62    DS--IVAAIKTSLSETLTHFYPFAGRIVRNSATGEAEILCNNAGINFMEARASVPLATLD  119

Query  1352  FYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLT  1173
             F++ N+ + R  L+P   +       + +Q+T YTCGG  + + FDH L DA++F KFL 
Sbjct  120   FHDQNQSI-RKVLLPVLPEH-----PLSVQVTGYTCGGFSVAWCFDHRLADATAFIKFLN  173

Query  1172  TWSELA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI  996
             +WS++A   +  S + +H R + RPR PP Y  S+  T+  C++DDIL+M P     + I
Sbjct  174   SWSQIARAEQVSSVAINHDRSIFRPRSPPLYGPSVGRTYTVCTMDDILSMPP-----NGI  228

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD--KSHNKC  822
               KR YY++   + +L++ +S      G S+R T+ EA SAY+WKVM  A     S+N+C
Sbjct  229   SQKRSYYVEGPCLERLREASSR-----GVSKR-TRTEALSAYLWKVMARACGGGDSNNRC  282

Query  821   KMGWLVDGRTRIPG-----IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTA  657
             KMGWL+DGR R+        MS+Y+GNV+S+  GE S  ELKH  +S +A  V  AI+ A
Sbjct  283   KMGWLIDGRRRMAARNHDDSMSNYVGNVVSIAVGEESAQELKHRPLSHVAGIVSGAITEA  342

Query  656   TNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGT  477
              N  HFLDLIDWIECHRPG+ML +++LG   P  A+VVSS    PV  ++FGFG P LG 
Sbjct  343   ANDGHFLDLIDWIECHRPGMMLPELLLGLRVP--ALVVSSCHNMPVMAVDFGFGRPSLGM  400

Query  476   VCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDL  312
               ST+++IG GYVN   S R D  W VS  +WP++  ALES  + +FQPITA  L
Sbjct  401   FYSTVDQIGAGYVNLVSSGREDEGWLVSTFIWPELADALESDPDHVFQPITADHL  455



>ref|XP_008800447.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=454

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 197/467 (42%), Positives = 280/467 (60%), Gaps = 26/467 (6%)
 Frame = -1

Query  1691  SDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIID  1512
             S+  +  I++S+VK         ++ +SN D LSGR+PVT  Y +R P+    +S  +++
Sbjct  9     SELSIRLISKSIVKAANSNAPLSVIPVSNFDHLSGRYPVTIFYAYRKPSTGDFNS--VVN  66

Query  1511  NLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
              +K SL++ L+ F PFAGRIVPNP+T EPEILC+N G+ ++EA A++ +  L F++LN  
Sbjct  67    AIKTSLAETLNYFLPFAGRIVPNPETGEPEILCNNEGIELIEASADVSITSLNFHDLNDS  126

Query  1331  VERGKL-VPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
             V+R  L +P        +  + +Q+T + CGG  + ++FDH L D + F KFL  WSELA
Sbjct  127   VKRVMLPLPT-------EIPLSVQVTGFACGGFSMVWSFDHLLADGAGFIKFLHLWSELA  179

Query  1154  TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYY  975
                    +P+H R + RPR PP Y   LD TF  C L D+L M       + I LKR YY
Sbjct  180   RTGRIPVTPNHDRSIFRPRSPPSYGPLLDRTFTGCKLHDVLAMP-----RNDISLKRAYY  234

Query  974   IDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGR  795
             I  S I +LQ  AS+     G    RT+ EA SAY+WK++  ++ ++   CKMGWLVDGR
Sbjct  235   IHGSCIDRLQAAASK-----GGGVERTRTEAISAYLWKLLARSLGETDTGCKMGWLVDGR  289

Query  794   ----TRIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLI  627
                 +   G +S+Y+GN++S+  GE S  ELK G++S +A      I    N  HFL+L+
Sbjct  290   PWMRSEPDGDLSNYVGNLVSMAVGEASAGELKEGSLSYVAEMAAQVIEEVKNKAHFLELL  349

Query  626   DWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGV  447
             DWIEC RP ++L++++LG  GP  A+VVSS    PV   +FGFGSP LGT  + ++ IG 
Sbjct  350   DWIECRRPEMVLARILLGLKGP--AVVVSSCHNMPVMATDFGFGSPRLGTFYTVLDAIGA  407

Query  446   GYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             GYVN   S R DGS  V A +WP +   LES  E +F P+TA  + L
Sbjct  408   GYVNLISSGREDGSSFVFAFIWPRLALELESDPEQVFLPVTADYIGL  454



>gb|KDO46398.1| hypothetical protein CISIN_1g039950mg, partial [Citrus sinensis]
Length=221

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 182/230 (79%), Gaps = 14/230 (6%)
 Frame = -1

Query  986  RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWL  807
            RLY+IDASSI +LQ+LAS +       ++RTK+EAFSAYIWK+MV ++D+ H KCKMGWL
Sbjct  1    RLYHIDASSISRLQQLASVK------GKKRTKVEAFSAYIWKIMVTSIDEKHGKCKMGWL  54

Query  806  VDGRTRI---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFL  636
            VDGR RI      MS YIGNVLSL  GE S+ ELK G+IS+IA+ VH +I+  TN  HFL
Sbjct  55   VDGRCRILKHENPMSSYIGNVLSLAVGEASVTELKQGSISEIANRVHDSITKVTNEAHFL  114

Query  635  DLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIER  456
            DLIDWIECHRPGLML+++VLGRDGP   +VVSSGRRFPV EL+FGFG+PVLG V S IER
Sbjct  115  DLIDWIECHRPGLMLARVVLGRDGP--TVVVSSGRRFPVAELDFGFGNPVLGAVSSIIER  172

Query  455  IGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             GVGY+NQRPSA  DGSWTVSAILWP++  ALES S  IFQP++A D HL
Sbjct  173  SGVGYINQRPSATCDGSWTVSAILWPELATALESDS--IFQPMSAAD-HL  219



>gb|KHN23945.1| Anthranilate N-benzoyltransferase protein 1 [Glycine soja]
Length=239

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/254 (59%), Positives = 195/254 (77%), Gaps = 18/254 (7%)
 Frame = -1

Query  1058  VSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAF  879
             + C++ +I NM      ++ ++LKRLY+I+ASSI  LQKLAS   +G+    +RTKIEAF
Sbjct  1     MKCTMKEIQNMP-----MNHVLLKRLYHIEASSIDMLQKLASL--NGV----KRTKIEAF  49

Query  878   SAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI---PGIMSDYIGNVLSLTFGELSMDELKH  708
             SAY+WK+M+  +D+ H  CKMGWLVDGR R+     +MS+YIGNVLSL FGE S+ ELK 
Sbjct  50    SAYVWKIMIGTIDERHKTCKMGWLVDGRERMGRGKNLMSNYIGNVLSLAFGEASIQELKE  109

Query  707   GTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRR  528
              +IS+IA  VH AIS   N +HFLDLIDWIECHRPGLML+K VLG++GP   +VVSSG+R
Sbjct  110   ASISEIAKTVHEAISKVNNEDHFLDLIDWIECHRPGLMLAKAVLGQEGP--TLVVSSGQR  167

Query  527   FPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHS  348
             FPV E++FGFGSP+LGTV ++I+++GV Y+NQR SA+GDGSWTVSAILWP++ AAL+   
Sbjct  168   FPVKEVDFGFGSPLLGTVYTSIQKVGVSYMNQRLSAKGDGSWTVSAILWPELEAALQ--D  225

Query  347   ECIFQPITAHDLHL  306
             + IF P++A  L L
Sbjct  226   DPIFHPMSASHLQL  239



>ref|XP_010463047.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=362

 Score =   288 bits (738),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 209/301 (69%), Gaps = 21/301 (7%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTP-KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V F  E +VK  G  P K   LTLSNLDLLSGRFPVTY YF+  P Q + S   I  +
Sbjct  4     FDVSFTGEFIVKASGDQPEKVNSLTLSNLDLLSGRFPVTYFYFY--PKQPNVSFETIFKS  61

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKT-DEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             L+ASLS+ L+ F+PFAG+IV N  + +EP I+C+N G L+VEA+A++ LK L+FYNL+  
Sbjct  62    LQASLSETLNYFHPFAGQIVTNEASQEEPIIICNNNGALLVEARASVDLKSLDFYNLDAL  121

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELAT  1152
             ++  KLV     R   DF++QIQ T + CGGL +TFTFDHALGDASSF KFLT WSE++ 
Sbjct  122   LQ-SKLV-----RVNPDFSLQIQATEFECGGLAITFTFDHALGDASSFGKFLTLWSEISR  175

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYI  972
             N+P SC PDHRR LLR R PP Y+  LD+TF+ CS +DI N+  P TL     +KRL +I
Sbjct  176   NQPVSCVPDHRRNLLRARSPPCYDPHLDKTFIKCSEEDIKNIAMPKTL-----IKRLNHI  230

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT  792
             DASSI KLQ LA+   +       RTKIEAFSAY+WK MV++++  H  CKMGWLVDGR 
Sbjct  231   DASSIDKLQVLATVNGES------RTKIEAFSAYVWKKMVDSIESGHKTCKMGWLVDGRG  284

Query  791   R  789
             R
Sbjct  285   R  285


 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 11/109 (10%)
 Frame = -1

Query  632  LIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERI  453
            ++D IE       +  +V GR            RRFPV EL+FGFG+P LGTVCST+E+I
Sbjct  263  MVDSIESGHKTCKMGWLVDGR---------GRRRRFPVAELDFGFGAPFLGTVCSTVEKI  313

Query  452  GVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
            GVGY+NQRPSA  DGSW+VSAI+WP++  A ES S  +FQP++A  L L
Sbjct  314  GVGYLNQRPSACNDGSWSVSAIVWPELAEAFESDS--VFQPMSAKHLQL  360



>ref|XP_008778760.1| PREDICTED: rosmarinate synthase-like [Phoenix dactylifera]
Length=450

 Score =   278 bits (711),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 166/423 (39%), Positives = 242/423 (57%), Gaps = 26/423 (6%)
 Frame = -1

Query  1577  VTYLYFFRSP--NQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNR  1404
             V   + ++ P   Q  ++   ++  LKASL+Q L  +YPFAG ++ NP  DEPE+LC+NR
Sbjct  42    VGVFFCYKKPPAKQSKTTFGSMVSALKASLAQALVTYYPFAGEVLTNP-VDEPELLCNNR  100

Query  1403  GVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTF  1224
             GV  +EA A++ L+EL   N ++ VER KL+P  +++ G    + +Q T   CGGL L  
Sbjct  101   GVDFIEAYADVELQELRLNNPDESVER-KLLP--KKKEG---VLCVQATELKCGGLVLAC  154

Query  1223  TFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSL  1044
             TFDH + DA S   FL  W+E A +KP S +P  RR LL PR P  +++S D  +   S 
Sbjct  155   TFDHRIADAYSANMFLVAWAETAASKPISLAPSFRRSLLIPRRPGSHDSSPDRLYALVS-  213

Query  1043  DDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIW  864
                 +++PPP+      + R+ Y+ A  I ++Q  A           RRTK E+F+AY+W
Sbjct  214   ----SLQPPPSPDQEAAVNRICYVAADDIARIQAAAGG---------RRTKFESFTAYLW  260

Query  863   KVMVNAVDKSHNKCKMGWLVDGRTRIP--GIMSDYIGNVLSLTFGELSMDELKHGTISKI  690
             +V+          C+MG +VDGRTR+   G M+ Y GNVLS+ +G L ++ELK   +++ 
Sbjct  261   RVLARGARPEDKVCRMGAVVDGRTRLARGGEMAGYFGNVLSIPYGTLGVEELKDMDLAET  320

Query  689   ASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGEL  510
             A+ VH  +  AT  EHF  L+DW+E  RP   ++++ LG +  G   VVSSGR FPVGE+
Sbjct  321   AAAVHGWLRQATTEEHFRGLVDWVEARRPEPAVARIYLGEEDGGVGCVVSSGRAFPVGEV  380

Query  509   EFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQP  330
             EFG+G  V G+          GYV   PSAR +G W V   L    +  LE+    +F+P
Sbjct  381   EFGWGRAVFGSYHFPWGS-SAGYVMPMPSARRNGDWVVYMHLLKRFLDVLEAEKPPVFRP  439

Query  329   ITA  321
             +TA
Sbjct  440   LTA  442



>ref|XP_002270252.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=461

 Score =   274 bits (701),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 182/476 (38%), Positives = 270/476 (57%), Gaps = 36/476 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             DF V    + VV  V L  + Y L  SNLDLL     V   + ++ P+     S  +I  
Sbjct  5     DFTVTVSRKEVVAAV-LPVQEYWLPTSNLDLLLPPVDVGVFFCYKKPHDLTFGS--MIGV  61

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +L+Q L  +YPFAG ++ N    EPE+LC+NRGV  +EA A+++L+ L  YN ++ +
Sbjct  62    LKEALAQALVSYYPFAGEVLSN-SAGEPELLCNNRGVDFMEAYADVQLQNLNLYNPDESI  120

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E  KLVP  +++ G    + +Q+T   CGG+ +  TFDH + DA S   FL +W+E+A +
Sbjct  121   E-SKLVP--KKKHG---VLSVQVTELKCGGVVVACTFDHRIADAYSANMFLVSWAEMAQS  174

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPP--PTLLSSIMLKRLYY  975
             KP S  P  RR LL PR P  Y+ SLD  +V  S      + PP  P     +++ RLYY
Sbjct  175   KPLSVLPSFRRSLLNPRRPGSYDPSLDNMYVPMSA-----LPPPKAPQPGDDLLINRLYY  229

Query  974   IDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMV-NAVDKSHNK--CKMGWLV  804
             +    +  LQ LA+ + +    S +RTK+E+ SA++WK++  +AV ++ N+  C+MG +V
Sbjct  230   VTGEQLSLLQSLATSKSN----SCKRTKLESLSAFLWKMVAKSAVTENANQKVCRMGTVV  285

Query  803   DGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAE  645
             DGR R+         +++ Y GNVLS+ FG+ +++ELK   +S +A  +   +  A   E
Sbjct  286   DGRKRLSSGDEVKAAMLASYFGNVLSIPFGKKTINELKEKPLSWVADAIREYLEGAVTKE  345

Query  644   HFLDLIDWIECHRPGLMLSKMVL--GRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVC  471
             HFL LIDW+E HRP   L+K+     RDGP  A VVSSG+RFPV  ++FG+G P LG+  
Sbjct  346   HFLGLIDWVEAHRPEPALAKIYNSGSRDGP--AFVVSSGQRFPVSRVDFGWGMPALGSYH  403

Query  470   STIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
                     GYV   PS   DG W V   L    +  +E+ +  IF+P+ +  L+LS
Sbjct  404   FPWGG-EAGYVMPMPSPVRDGDWVVYMHLSVGQIEWIETQAAHIFRPLNSEYLNLS  458



>gb|KDO38871.1| hypothetical protein CISIN_1g035783mg, partial [Citrus sinensis]
Length=195

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 164/218 (75%), Gaps = 25/218 (11%)
 Frame = -1

Query  959  IHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIPG  780
            I +LQ+LAS         ++RTK+EAFSAYIWK+MV ++D+ H KCKMG           
Sbjct  1    ISRLQQLASV------NGKKRTKVEAFSAYIWKIMVTSIDEKHGKCKMGC----------  44

Query  779  IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPG  600
                YIGNVLSL  GE S+ ELK G+IS+IAS VH +I+  TN  HFLDLIDWIECHRPG
Sbjct  45   ----YIGNVLSLAVGEASVTELKQGSISEIASRVHDSITKVTNEAHFLDLIDWIECHRPG  100

Query  599  LMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSA  420
            LML+++VLGRDGP  A+++SSGRRFPV EL+FGFGSPVLG V S IER GVGY+NQRPSA
Sbjct  101  LMLARVVLGRDGP--AVLMSSGRRFPVVELDFGFGSPVLGAVSSIIERSGVGYINQRPSA  158

Query  419  RGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
            + DGSWTVSAILWP++  ALE  S+ IFQP+++ D HL
Sbjct  159  KCDGSWTVSAILWPELATALE--SDFIFQPMSSAD-HL  193



>ref|XP_002270251.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=471

 Score =   272 bits (695),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 183/479 (38%), Positives = 264/479 (55%), Gaps = 36/479 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKI---  1518
             DF V    + VV    L  + Y L  SNLDLL     V   + ++ P+   +   ++   
Sbjct  6     DFMVTVSRKEVV-AAALPVQEYWLPQSNLDLLLPPVDVGVFFCYKKPHGSGNGGDELRFG  64

Query  1517  --IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYN  1344
               +  +K +L+Q L  +Y FAG +V N    EPE+LC+NRGV   EA A+++L++L  YN
Sbjct  65    SMVRVVKEALAQALVSYYAFAGEVVSN-SVGEPELLCNNRGVDFTEAYADVQLQDLNLYN  123

Query  1343  LNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWS  1164
              +  +E GKLVP  +++ G    + +Q+T   CGG  +  TFDH + DA S   F+ +W+
Sbjct  124   PDDSIE-GKLVP--KKKNG---VLSVQVTELKCGGAVVGCTFDHRIADAYSANLFIVSWA  177

Query  1163  ELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPP--PTLLSSIML  990
             E+A +KP S  P  RR LL PR P  Y+ SLDE +V  S      + PP  P   +  ++
Sbjct  178   EMAQSKPLSVIPSFRRSLLNPRRPGSYHPSLDEMYVPIS-----ALPPPKAPQPGAEHLI  232

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMV-NAVDKSHNK--CK  819
              RLYY+ A  +  LQ LAS      G  R+RTK+E+ SA++WK++  +AV ++ NK  CK
Sbjct  233   SRLYYVSAEQLSLLQTLASS-----GGIRKRTKLESLSAFLWKMIAKSAVMENANKKICK  287

Query  818   MGWLVDGRTRIP-------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
             MG +VDGR R+         +M+ Y GNVLS+ FGE  + +LK   +S +A  VH  +  
Sbjct  288   MGIVVDGRGRLSSGDEDKTALMATYFGNVLSIPFGEKIICDLKEQPLSWVADAVHDFLER  347

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLG  480
             A   EHFL LIDW+E HRP   L+K+       G A VVSSG+RFP  +++FG+G P LG
Sbjct  348   AVTKEHFLGLIDWVETHRPEPALAKIYCSGSSDGPAFVVSSGQRFPASKVDFGWGRPALG  407

Query  479   TVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
             +          GYV   PS   DG W V   L    +  +E+    IF+P+T+  L L+
Sbjct  408   SYHFPWGG-DAGYVMPMPSPARDGDWVVYMHLLNGQIELIENQGAHIFRPLTSDYLKLA  465



>gb|AHA90802.1| cinnamyl alcohol acyltransferase 1 [Larrea tridentata]
Length=463

 Score =   270 bits (689),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 181/480 (38%), Positives = 262/480 (55%), Gaps = 42/480 (9%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSP----K  1521
             +F+V    + VV  V L  + + L LSNLDL+     V   + ++ P    +  P     
Sbjct  6     EFKVTVSKKEVVAAV-LPMQEHWLPLSNLDLILPPVDVGVFFCYKKPISPSTGEPLTFAA  64

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             +++ LK +L+Q L  FY F G +V N    EPE+LC+NRG   VEA A+I L+ L  YN 
Sbjct  65    MVNALKKALAQALVSFYAFGGEVVLN-TVGEPELLCNNRGADFVEAYADIELENLNLYNP  123

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ VE GKLVP  +++ G      +Q T+  CGGL +  TFDH + DA S   FL +W+E
Sbjct  124   DESVE-GKLVP--KKKHG---VFAVQATQLKCGGLVVACTFDHRIADAYSTNMFLVSWAE  177

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI---ML  990
             +A +KP    P  RR LL PR P   + +LD+ +V       +N  PPP         ++
Sbjct  178   IAQSKPSYYRPSFRRSLLNPRRPGFIDPALDDMYVP------INTLPPPKEPEQTDDHLI  231

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNK---CK  819
              R+YY+ +  ++ LQ LAS       +  +RTK+E+FSAY+WK++     K++ +    K
Sbjct  232   SRIYYVTSEQLNLLQGLASS------SGCKRTKLESFSAYLWKMVAKYASKNYPRNVITK  285

Query  818   MGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
             MG +VDGRTR+         +MS Y GNVLS+ FG   M EL    +S +A  VH  +  
Sbjct  286   MGIVVDGRTRLGDGDEKKAKMMSKYFGNVLSIPFGGKKMHELTEKPLSWVADEVHDFLDV  345

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLG--RDGPGAAIVVSSGRRFPVGELEFGFGSPV  486
             A   EHFL LIDW+E HRP   L+K+      DGPG   VVSSG+RFPVG+++FG+G P 
Sbjct  346   AVTKEHFLGLIDWVEAHRPVPALAKIYCQGTEDGPG--FVVSSGQRFPVGKIDFGWGKPG  403

Query  485   LGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
              G+          GYV   PS  G+G W V   L    +  +E+ +  +F+P+T+  L+ 
Sbjct  404   FGSYHFPWGG-DSGYVMPMPSPSGNGDWIVYMHLSKGQLELIETEAAAVFRPLTSDYLNF  462



>ref|XP_010938319.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Elaeis 
guineensis]
Length=458

 Score =   267 bits (683),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 165/410 (40%), Positives = 235/410 (57%), Gaps = 18/410 (4%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++ +LK SL Q L  +YPFAG +V N  T EPE+LC+NRGV  +EA A++ L+EL  Y  
Sbjct  61    MLSSLKGSLVQALVSYYPFAGEVVTN-STGEPELLCNNRGVDFIEAYADVELRELSLYKP  119

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +  GKL+P  ++ GG    + +Q T   CGGL +   FDH + DA S   FL  W+E
Sbjct  120   DESLG-GKLMP--KKEGG---VLCVQATELRCGGLVVACAFDHRIADAVSADMFLVAWAE  173

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             LAT+KP S  P  RR LL PR P R+++  D  +   S             L   ++ R+
Sbjct  174   LATSKPVSRIPSFRRSLLNPRRPGRHDSFPDRLYAPISSLSRPPSP---PPLQQPVVSRI  230

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVD  801
             YYI A  +  +Q  AS      G +  RTK+EAF+AY+W+V+          C+MG +VD
Sbjct  231   YYITAEDVDSMQTAAS-----AGGAAYRTKVEAFTAYLWRVLAKGTVSGDKPCRMGLVVD  285

Query  800   GRTRIPG-IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLID  624
             GR+R+    M++Y GNVL+L +G LS  EL    + ++A  VH  +  A  AEHF  L+D
Sbjct  286   GRSRLDARAMANYFGNVLTLPYGTLSAAELGRMELPEVADAVHEFLRPAVTAEHFRGLVD  345

Query  623   WIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVG  444
             W+E HRP   ++++ L  +  G A +VSSGRRFP  ELEFG+G P L +          G
Sbjct  346   WVESHRPEPAVARVYLEDEEGGMACIVSSGRRFPSSELEFGWGKPTLASYYFPWGG-SAG  404

Query  443   YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS*LQ  294
             +V   PSA+G+G W V A L  D+V  LE+ S  + +P+T  D +LS L+
Sbjct  405   FVMPTPSAKGNGDWVVYAYLLKDLVEVLEAQSPQVLRPLTP-DYYLSLLK  453



>ref|XP_002270079.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=461

 Score =   267 bits (682),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 185/477 (39%), Positives = 272/477 (57%), Gaps = 38/477 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             DF V    + VV  V L  + Y L LSNLDLL     V   + ++ P+     S  +I  
Sbjct  5     DFTVTVSRKEVVAAV-LPVQEYWLPLSNLDLLLPPVDVGVFFCYKKPHDLTFGS--MIGV  61

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +L+Q L  +YPF G ++ N    EPE+LC+NRGV  +EA A+++L+ L  YN ++ +
Sbjct  62    LKEALAQALVSYYPFGGEVLSN-SAGEPELLCNNRGVDFMEAYADVQLQNLNLYNPDESI  120

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E  KLVP  +++ G    + +Q+T   CGG+ +  TFDH + DA S   FL +W+E+A +
Sbjct  121   E-SKLVP--KKKHG---VLSVQVTELKCGGVVVACTFDHRIADAYSANMFLVSWAEMAQS  174

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS---IMLKRLY  978
             KP S  P  RR LL  R P  Y+ SLD+ +V  S        PPP    S   +++ RLY
Sbjct  175   KPLSVLPSFRRSLLNARRPGSYDPSLDDMYVPMS------ALPPPKAPQSGDDLLINRLY  228

Query  977   YIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMV-NAVDKSHNK--CKMGWL  807
             Y+ A  +  LQ LA+ +     +S +RTK+E+ SA++WK++  +AV ++ N+  C+MG +
Sbjct  229   YVTAEQLSLLQSLATSKS----SSCKRTKLESLSAFLWKMVAKSAVTENANQKICRMGTV  284

Query  806   VDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNA  648
             VDGR R+         +M+ Y GNVLS+ FG+ +++ELK   +S +A  +H  +  A   
Sbjct  285   VDGRKRLSSGDEVKAAMMASYFGNVLSIPFGKKTINELKEKPLSWVADAIHEYLEGAVTK  344

Query  647   EHFLDLIDWIECHRPGLMLSKMVL--GRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTV  474
             EHFL LIDW+E HRP   L+K+     RDGP  A VVSSG+RFP   ++FG+G P LG+ 
Sbjct  345   EHFLGLIDWVEAHRPEPALAKIYSSGSRDGP--AFVVSSGQRFPASRVDFGWGMPALGSY  402

Query  473   CSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
                      GYV   PS   DG W V   L    V  +E+ +  IF+P+++  L+LS
Sbjct  403   HFPWGG-EAGYVMPMPSPVRDGDWVVYMHLSVGQVEWIETEAAHIFRPLSSEYLNLS  458



>ref|XP_002270076.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=470

 Score =   266 bits (680),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 167/415 (40%), Positives = 238/415 (57%), Gaps = 31/415 (7%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             L+ +L+Q L  +Y FAG +V N    EPE+LC+N+GV   EA A+ +L +L  YN +  +
Sbjct  71    LRKALAQALVSYYAFAGEVVSN-SVGEPELLCNNQGVDFTEAYADAKLHDLSLYNPDDSI  129

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E GKLVP  +Q G     + +Q+T   CGG+ +  TFDH + DA S   FL +W+E+A  
Sbjct  130   E-GKLVPK-KQHG----VLCVQVTELKCGGVVVGCTFDHRIADAYSANMFLVSWAEMALC  183

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLL----SSIMLKRL  981
             KP S  P  RR LL  R P  Y+ SLDE +V      +++  PPP       +   + R+
Sbjct  184   KPLSVVPSFRRSLLNIRRPGSYDPSLDEMYV------LISALPPPRAPQPGGADPFISRI  237

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWK-VMVNAVDKSHNK--CKMGW  810
             YY+ A  +  LQ LAS      G+S +RTK+E+FSA++WK V  +AV ++ NK  CKMG 
Sbjct  238   YYVTAEQLSLLQTLASISK---GSSYKRTKLESFSAFLWKMVAASAVMENDNKMICKMGI  294

Query  809   LVDGRTRIP-------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATN  651
             +VDGR R+         +M+ Y GNVLS+ FGE  +DELK   +S +A  VH  +  A  
Sbjct  295   VVDGRRRLSSGDEDKSAVMASYFGNVLSIPFGEKMIDELKEKPLSWVADAVHEYLEGAVT  354

Query  650   AEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVC  471
              EHFL LIDW+E HRP   L+++       G A+VVSSG+RF V +++FG+G P LG+  
Sbjct  355   KEHFLGLIDWVEAHRPEPALARIYCSGSSDGPALVVSSGQRFAVSKVDFGWGRPALGSFH  414

Query  470   STIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
                     GYV   PS   DG W V   L    +  +E+ +  +F+P+T+  L+L
Sbjct  415   FPWGG-EAGYVMPMPSPARDGDWVVYMHLLKGQIEFIETEAAHVFRPVTSEYLNL  468



>emb|CAN61304.1| hypothetical protein VITISV_040201 [Vitis vinifera]
Length=467

 Score =   265 bits (678),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 161/416 (39%), Positives = 234/416 (56%), Gaps = 25/416 (6%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK ++SQ L  +Y F+G +V N    EPE+LC+NRGV  +EA A++RL+ L  YN 
Sbjct  67    MVGALKIAMSQALVSYYAFSGEVVSN-SAGEPELLCNNRGVDFMEAHADVRLENLNLYNP  125

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  +E GKLVP  ++  G    + +Q+T   C G+ +  TFDH + DA S   FL +W+E
Sbjct  126   DVSIE-GKLVP--KKENG---VLSVQVTELKCSGVVVACTFDHRIADAYSANMFLVSWAE  179

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             +A +KP S +P   R LL  R P  Y+ S D+ +V  S    L     P   +  ++ RL
Sbjct  180   MAQSKPLSVTPSFLRSLLNTRRPGSYDPSFDDMYVPIS---ALPPSKAPQPSADPLMSRL  236

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD-KSHNK--CKMGW  810
             YY+ A  +  LQ LA+ +     +S +RTK+E+ SA++WK++  + D    NK  CKMG 
Sbjct  237   YYVTAEQLSLLQMLATSKS----SSCKRTKLESLSAFLWKMVAKSADLDDDNKKICKMGI  292

Query  809   LVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATN  651
             +VDGR R+          M++Y GNVLS+ FGE  +DELK   +S +   VH  +  A  
Sbjct  293   VVDGRRRLSSGDEDKAAAMANYFGNVLSVPFGEKIIDELKEKPLSWVGDAVHEYLEGAVT  352

Query  650   AEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVC  471
              EHFL LIDW+E HRP   ++K+       G A VVSSG+RFPV ++ FG+G P LG+  
Sbjct  353   REHFLGLIDWVEAHRPEPAVAKIYCSGSNDGPAFVVSSGQRFPVSKVNFGWGRPALGSYH  412

Query  470   STIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
                     GYV   PS   DG W V   L  D +  +E+ +  +F+P+T   L L+
Sbjct  413   FPWGG-EAGYVMPMPSPVRDGDWVVYVHLLKDQIDLIETEAAHVFRPLTPEYLKLA  467



>ref|XP_008783080.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=452

 Score =   264 bits (674),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 166/414 (40%), Positives = 230/414 (56%), Gaps = 26/414 (6%)
 Frame = -1

Query  1556  RSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQA  1377
             +SP  F +    ++  LK SL++ L  +YPFAG++V N    EPE+LC+NRGV  +EA A
Sbjct  55    QSPATFAT----MVSALKTSLARALVTYYPFAGKVVTN-SVGEPELLCNNRGVDFIEAYA  109

Query  1376  NIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDA  1197
             ++ L EL  YN ++ VER KLVP  ++       + +Q T   CGG+ L  TFDH + DA
Sbjct  110   DVELHELRLYNPDESVER-KLVPKKKEG-----VICVQATELKCGGMVLACTFDHRIADA  163

Query  1196  SSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPP  1017
              S   FL  W+E A +K  S  P  RR LL PR P  Y+ SLD  +V  S    L     
Sbjct  164   YSANMFLVAWAETAASKAISLPPSFRRSLLTPRRPGSYDPSLDRLYVPVSSLPALPPP--  221

Query  1016  PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDK  837
              +      + R+YYI A  I ++Q         +    +RTKIEAF+AY+W+V+  A   
Sbjct  222   -SPDQEPAVNRIYYIVADDIARIQ---------VAAGGQRTKIEAFTAYLWRVLSRATRL  271

Query  836   SHNKCKMGWLVDGRTRIP--GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIS  663
                 C+MG +VDGR+R+   G M+ Y GNVLS+  G L + ELK   ++++A  VH  + 
Sbjct  272   DDKVCRMGAVVDGRSRLARGGEMAGYFGNVLSIPCGSLRVGELKDMGLAEVAEVVHGWLR  331

Query  662   TATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVL  483
              A   EHF  L+DW+E  RP  + +++ LG +  G   VVSSGR FPVG++EFG+G PV 
Sbjct  332   PALTEEHFRGLVDWVEARRPEPVGARICLGYEDGGVGCVVSSGRGFPVGQVEFGWGRPVF  391

Query  482   GTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITA  321
             G+          GYV   PSARG+G W V   L    V  LE+     F+P+TA
Sbjct  392   GSYHFPWGSPA-GYVMPMPSARGNGDWVVYVHLLGSFVDVLEAEEPPFFRPLTA  444



>ref|XP_008795534.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Phoenix 
dactylifera]
Length=458

 Score =   263 bits (673),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 160/400 (40%), Positives = 228/400 (57%), Gaps = 17/400 (4%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++ +LK SL Q L  +YPFAG ++ N  T EPE+LC+NRGV  +EA A++ L+EL  Y  
Sbjct  61    MLSSLKGSLVQALVTYYPFAGEVITN-STGEPELLCNNRGVDFIEAYADVELRELCLYKP  119

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +   +  KLVP  ++ GG      +Q T   CGGL +  +FDH + DA S   FL  W+E
Sbjct  120   DDSFKE-KLVP--KKEGG---VFCVQATELKCGGLVVACSFDHRIADAVSADMFLVAWAE  173

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             LA++KP S  P  RR LL PR P R+++  D  F   S     +       L    + R+
Sbjct  174   LASSKPISRIPSFRRSLLNPRRPGRHDSFPDRLFAPISSLVPPSSP---PQLQQPTVSRI  230

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVD  801
             YYI A  + ++Q  AS      G +  RTK+EAF+AY+W+V+          C+MG +VD
Sbjct  231   YYITAEDVDRMQTAASS-----GGAAHRTKVEAFTAYLWRVLAKGTVSGDKPCRMGLVVD  285

Query  800   GRTRIPG-IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLID  624
             GR+RI    M++Y GNVL+  +G LS +EL    + ++A  VH  +  A  AEHF  L+D
Sbjct  286   GRSRIDARAMANYFGNVLTPPYGTLSAEELGRMALPEVADVVHEFLRPAMTAEHFRGLVD  345

Query  623   WIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVG  444
             W+E HRP   ++++ L  +  G A VVSSGRRFP  E+EFG+G P L +          G
Sbjct  346   WVESHRPEPAVARIYLEDEEGGVACVVSSGRRFPASEVEFGWGKPALASYFFPWGG-STG  404

Query  443   YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             +V   PS +G+G W V A L  D+V  LE+ S  +F+P+T
Sbjct  405   FVMPMPSPKGNGDWVVYAYLLRDLVEVLEAESPQVFRPLT  444



>ref|XP_002271221.2| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase 
[Vitis vinifera]
Length=461

 Score =   262 bits (669),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 183/477 (38%), Positives = 271/477 (57%), Gaps = 38/477 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             DF V    + VV  V L  + Y L LSNLDLL     V   + ++ P+     S  +I  
Sbjct  5     DFTVTVSRKEVVAAV-LPVQEYWLPLSNLDLLLPPVDVGVFFCYKKPHDLTFGS--MIGV  61

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +L+Q L  +YPF G ++ N    EPE+LC+NRGV  +EA A+++L+ L  YN ++ +
Sbjct  62    LKEALAQALVSYYPFGGEVLSN-SAGEPELLCNNRGVDFMEAYADVQLQNLNLYNPDESI  120

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E  KLVP  +++ G    + +Q+T   CGG+ +  TFDH + DA S   FL +W+E+A +
Sbjct  121   E-SKLVP--KKKHG---VLSVQVTELKCGGVVVACTFDHRIADAYSANMFLVSWAEMAQS  174

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS---IMLKRLY  978
             KP S  P  RR LL  R P  Y+ SLD+ +V  S        PPP    S   +++ RLY
Sbjct  175   KPLSVLPSFRRSLLNARRPGSYDPSLDDMYVPMS------TLPPPKAPQSGDDLLINRLY  228

Query  977   YIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMV-NAVDKSHNK--CKMGWL  807
              + A  +  LQ LA+ +     +S +RTK+E+ SA++WK++  +AV ++ N+  C+MG +
Sbjct  229   XVTAEQLSLLQSLATSKS----SSCKRTKLESLSAFLWKMVAKSAVTENANQKICRMGTV  284

Query  806   VDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNA  648
             VDGR R+         +M+ Y GNVLS+ FG+ +++ELK   +S +A  +H  +  A   
Sbjct  285   VDGRKRLSSGDEVKAAMMASYFGNVLSIPFGKKTINELKEKPLSWVADAIHEYLEGAVTK  344

Query  647   EHFLDLIDWIECHRPGLMLSKMVL--GRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTV  474
             EHFL LIDW+E HRP   L+K+     RDGP  A VVSSG+RFP   ++FG+G P LG+ 
Sbjct  345   EHFLGLIDWVEAHRPEPALAKIYSSGSRDGP--AFVVSSGQRFPGSRVDFGWGMPALGSY  402

Query  473   CSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
                      GYV   PS   DG W V   L    +  +E+ +  IF+P+++  L+LS
Sbjct  403   HFPWGG-EAGYVMPMPSPVRDGDWVVYMHLSVGQIEWIETEAAHIFRPLSSEYLNLS  458



>ref|XP_002270325.2| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Vitis 
vinifera]
Length=467

 Score =   262 bits (669),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 161/416 (39%), Positives = 233/416 (56%), Gaps = 25/416 (6%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK ++SQ L  +Y F+G +V N    EPE+LC+NRGV  +EA A++RL+ L  YN 
Sbjct  67    MVGALKIAMSQALVSYYAFSGEVVSN-SAGEPELLCNNRGVDFMEAHADVRLENLNLYNP  125

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  +E GKLVP  ++  G    + +Q+T   C G+ +  TFDH + DA S   FL +W+E
Sbjct  126   DVSIE-GKLVP--KKENG---VLSVQVTELKCSGVVVACTFDHRIADAYSANMFLVSWAE  179

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             +A +KP S +P  RR LL  R P  Y+ S D  +V  S    L     P   +  ++ RL
Sbjct  180   MAQSKPLSVTPAFRRSLLNTRRPGSYDPSFDNMYVPIS---ALPPSKAPQPSADPLMSRL  236

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD-KSHNK--CKMGW  810
             YY+ A  +  LQ LA+ +     +S +RTK+E+ SA++WK++  + D    NK  CKMG 
Sbjct  237   YYVTAEQLSLLQMLATSKS----SSCKRTKLESLSAFLWKMVAKSADLDDDNKKICKMGI  292

Query  809   LVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATN  651
             +VDGR R+          M++Y GNVLS+ FGE  +DELK   +S +   VH  +  A  
Sbjct  293   VVDGRRRLSSGDEDKAAAMANYFGNVLSVPFGEKIIDELKEKPLSWVGDAVHEYLEGAVT  352

Query  650   AEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVC  471
              EHFL LIDW+E HRP   ++K+       G A VVSSG+RFPV ++ FG+G P LG+  
Sbjct  353   REHFLGLIDWVEAHRPEPAVAKIYCSGSNDGPAFVVSSGQRFPVSKVNFGWGRPALGSYH  412

Query  470   STIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
                     GYV   PS   DG W V   L    +  +E+ +  +F+P+T   L L+
Sbjct  413   FPWGG-EAGYVMPMPSPVRDGDWVVYVHLLKGQIELIETEAAHVFRPLTPEYLKLA  467



>ref|XP_009408072.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=442

 Score =   260 bits (664),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 163/421 (39%), Positives = 235/421 (56%), Gaps = 27/421 (6%)
 Frame = -1

Query  1577  VTYLYFFRSPNQFHSSS-PKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRG  1401
             V   + ++ P   H  S   ++ +LKASL++ L  +YPFAG +V N    EPE+LC+NRG
Sbjct  42    VGVFFCYKKPRGKHYPSLASMVCSLKASLAETLETYYPFAGEVVAN-SAGEPELLCNNRG  100

Query  1400  VLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFT  1221
             V  V AQA++ L+ L   + ++ VE GKLVP   ++GG    + +Q T   CGGL L   
Sbjct  101   VDFVVAQADVELRALRLCHPSESVE-GKLVPP--KKGG---VLCVQATELKCGGLVLACA  154

Query  1220  FDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             FDH + DA S   FL  WSEL+T+KP SC P  RR LL PR P R + S D  +V  S  
Sbjct  155   FDHRVADACSTNMFLVAWSELSTSKPLSCLPAFRRSLLFPRSPLRVDHSFDHLYVPFS--  212

Query  1040  DILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWK  861
                ++ PP    S   + R+YYI A+ I ++Q           +++ RTKIEAF+AY+W+
Sbjct  213   ---SLPPPEHDHSEEAINRIYYIAAADIDRMQS----------STKGRTKIEAFTAYLWR  259

Query  860   VMVNAVDKSHNKCKMGWLVDGRTRI-PGIMSDYIGNVLSLTFGELSMDELKHGTISKIAS  684
              +        N C+MG +VDGR R+   +MS Y GNVLS+ +G L ++EL+   ++++A 
Sbjct  260   ALAITAAPGDNWCRMGIVVDGRARLRDTVMSSYFGNVLSIPYGTLRVEELRRMEVAEVAE  319

Query  683   HVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEF  504
              VH+ +      EHF  L+DW+E HRP   ++++     GP  A VVSSGR FPV E++F
Sbjct  320   VVHSWLQQEATEEHFRGLVDWVEAHRPEPAVARIYSKEGGP--ACVVSSGREFPVAEVQF  377

Query  503   GFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             G+G    G+          GYV   PSA   G W V   L   +   LE+    +F+ +T
Sbjct  378   GWGKAAFGSYHFPWGG-STGYVMPMPSATAAGDWVVYVYLLKKVAEVLEAEQPPVFRTLT  436

Query  323   A  321
             +
Sbjct  437   S  437



>emb|CDO99661.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   259 bits (663),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 160/413 (39%), Positives = 243/413 (59%), Gaps = 32/413 (8%)
 Frame = -1

Query  1511  NLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             ++  +L+Q L  +Y FAG +V N  + EPE+LC+NRGV  VEA A+I L+EL+ YN ++ 
Sbjct  41    DVGKALAQTLVSYYAFAGEMVQN-LSGEPELLCNNRGVDFVEAFADIELRELDLYNPDES  99

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELAT  1152
             VE GKLVP  +++G     + +Q T+  CGGL +  TFDH + DA S   FL +W+E+A 
Sbjct  100   VE-GKLVPQ-KEQG----VLSVQATQLKCGGLVIGCTFDHRVADAYSANMFLVSWAEMAQ  153

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIM------L  990
             +KP +  P HRR LL  R P  ++ S+++ ++      I  M PP   L+  +      +
Sbjct  154   SKPVTTLPSHRRSLLSSRRPGHFDISINDMYMK-----IPQMPPPDKELNDRINNNQAPI  208

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSR-RRTKIEAFSAYIWKVMVNAVDKSHNKCKMG  813
              R+YY+ A  +H+LQ LA+  DD  G+ +  RTK+EAF+A++WK++          C++G
Sbjct  209   SRIYYVKAEQVHQLQSLAN--DDKRGSKKFVRTKLEAFTAFLWKLIAKGTGAGDKYCRLG  266

Query  812   WLVDGRTRIPG----IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAE  645
              +VDGRTR+ G    +M+ Y GNVLS+ FGE    ELK   +S IA  VH  +  A   E
Sbjct  267   IVVDGRTRLNGGDESMMNKYFGNVLSIPFGEKRNKELKEMNLSMIADEVHNFLDGAVTRE  326

Query  644   HFLDLIDWIECHRPGLMLSKMV---LGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTV  474
             HFL LID++E HRP    S++    + R+ P  A VVSSG++FP+ +++FG+G P+ G+ 
Sbjct  327   HFLGLIDYVEAHRPEPAFSRIYGSKVTREEP--AFVVSSGQQFPIRKIDFGWGVPIFGSY  384

Query  473   CSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHD  315
                      G+V   P A G+G W V   L  + +  +E ++  +F+P   HD
Sbjct  385   HFPWGAQS-GFVMPMPCASGNGDWIVYMHLRQEQIEVIELNAPHVFRPF-CHD  435



>ref|XP_007023566.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY26188.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=458

 Score =   259 bits (661),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 161/429 (38%), Positives = 246/429 (57%), Gaps = 34/429 (8%)
 Frame = -1

Query  1577  VTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             V   + ++ P     S   ++  LK +L+Q L  +Y FAG +V N    EPE+LC+NRGV
Sbjct  43    VGLFFCYKKPTMSFGS---MVSVLKKALAQALLSYYAFAGEVVTN-ALGEPELLCNNRGV  98

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
               +EA A+I L+ L  +N  + +E GK VP  ++ G     + IQ T   CGG+ +  +F
Sbjct  99    DFIEAYADIELENLNLHNPEESIE-GKFVPE-KKHG----VISIQATELKCGGIMVACSF  152

Query  1217  DHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDD  1038
             DH + DA S   FL +W+E+A +KP S +P  RR LL PR P R++ SLDE +V      
Sbjct  153   DHRMADAYSTNMFLVSWAEIARSKPGSVAPSFRRSLLNPRRPGRFDPSLDEMYVP-----  207

Query  1037  ILNMRPPPTLLSSI--MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIW  864
             I ++ PP         ++ R+YY+ A  +++LQ LAS +        +RTK+E+FSA++W
Sbjct  208   IPSLPPPEEFHEPTDHLISRIYYVTADKLNELQSLASSD------GHKRTKLESFSAFLW  261

Query  863   KVMVNAVDKSHNK-CKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKH  708
             K++     K  +K  KMG +VDGR+R+         +M  + GNVLS+ +G  ++ EL  
Sbjct  262   KMVATVAAKDGDKISKMGIVVDGRSRLGEGDQDKATLMGSHFGNVLSIPYGSQTVGELVE  321

Query  707   GTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKM-VLGRDGPGAAIVVSSGR  531
               +S +A  VH  +  A + EHFL LIDW+E HRP   ++++  +G+D  G A+VVSSG+
Sbjct  322   KPVSWVAKQVHDFLKPAADEEHFLGLIDWVEAHRPEPAMTRVYCVGKDD-GPALVVSSGQ  380

Query  530   RFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESH  351
             RFPV +++FG+GSP  G+       +  GYV   PS  GDG W V  +L    +  +E  
Sbjct  381   RFPVSKVDFGWGSPTFGSYHFPWGGL-CGYVMPMPSPAGDGDWVVYMLLLKGQLELIEKE  439

Query  350   SECIFQPIT  324
             +  +F+P+T
Sbjct  440   AANVFRPVT  448



>ref|XP_009385887.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=448

 Score =   257 bits (657),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 161/415 (39%), Positives = 234/415 (56%), Gaps = 26/415 (6%)
 Frame = -1

Query  1559  FRSP--NQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVE  1386
             +R P    FHS+   ++  LKASL+Q L  +YPFAG+++ N    EPE+ C+NRGV  V 
Sbjct  48    YRKPEGKHFHSTFASMVSLLKASLAQALVTYYPFAGQVMAN-SVGEPELQCNNRGVDFVV  106

Query  1385  AQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHAL  1206
               A++ L+EL   N +  VE GKLVP  +++ G    + +Q T   CG L L  TFDH +
Sbjct  107   VFADVELRELRLCNPDDSVE-GKLVP--KKKEG---VLCVQATELKCGSLVLACTFDHRV  160

Query  1205  GDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNM  1026
              DA S   FL  WSE+A  KP S  P  RR LL PR P + + S D  FV  S     ++
Sbjct  161   ADAYSANMFLVAWSEIAMLKPLSRLPSFRRSLLTPRHPLQLHPSFDRLFVPVS-----SL  215

Query  1025  RPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA  846
              PP    S   + R+YYI A+ I+++Q           +++RR+KI  F+AY+W+V+  A
Sbjct  216   PPPKHHYSDQAVNRIYYIAAADINRMQS----------SAKRRSKIVVFTAYLWRVLAKA  265

Query  845   VDKSHNKCKMGWLVDGRTRI-PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAA  669
                    C+MG +VDGR+R+    MS Y GNVLS+ +G L+++ L+   ++++A  V+  
Sbjct  266   AAPEDRWCRMGVVVDGRSRLGNAAMSSYFGNVLSIPYGRLNVESLRRMELAEVAEVVYGW  325

Query  668   ISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSP  489
             +   T  EHF  L+DW+E HRP   ++++  G    G   VVSSGR FPV E+EFG+G  
Sbjct  326   LRPGTTEEHFRGLVDWVEVHRPEPAVARIYCGEADEGPGCVVSSGRAFPVAEVEFGWGKA  385

Query  488   VLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
               G+          GYV   PSA+G+G W V   +  ++VAALE     + +P+T
Sbjct  386   AFGSYHFPWGG-SAGYVMPMPSAKGNGDWVVYMHIQKEVVAALEEEQPPVLRPLT  439



>ref|XP_010928753.1| PREDICTED: rosmarinate synthase [Elaeis guineensis]
Length=452

 Score =   257 bits (657),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 160/414 (39%), Positives = 226/414 (55%), Gaps = 26/414 (6%)
 Frame = -1

Query  1556  RSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQA  1377
             +SP  F +    ++  LK SL++ L  + PFAG +V N    EPE+LC+NRGV  +EA A
Sbjct  55    QSPATFAT----MVSALKTSLARALVTYQPFAGEVVTN-SMGEPELLCNNRGVDFIEAYA  109

Query  1376  NIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDA  1197
             N+ L+EL  YN ++ VE GKLVP       ++  + +Q T   CGGL L  TFDH + DA
Sbjct  110   NVELQELRLYNPDESVE-GKLVPK-----KEEGVLCVQATELKCGGLVLACTFDHRIADA  163

Query  1196  SSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPP  1017
              S   FL  W+E A +KP S SP  RR LL PR    ++ SLD  FV  S    L     
Sbjct  164   YSTNIFLVAWAETAGSKPISLSPSFRRSLLTPRRSGSHDPSLDRLFVPFSSLPPLPPP--  221

Query  1016  PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDK  837
              +      + R+YYI A  I ++Q         +    +RTK+EAF AY+W+V+      
Sbjct  222   -SPDQEAAVSRIYYIVADDIARIQ---------VAAGGQRTKMEAFIAYLWRVLSRTARP  271

Query  836   SHNKCKMGWLVDGRTRIP--GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIS  663
                 C++G +VDGR+R+   G M+ Y GNVLS  +G L ++ELK   + ++A  VH  + 
Sbjct  272   EDKVCRIGAVVDGRSRLAPGGEMAGYFGNVLSFPYGSLGVEELKDMGLEEVAEVVHGWLR  331

Query  662   TATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVL  483
              A   EHF  L+DW+E  R   ++ +++LG    G   +VSSGRR PVGE+EFG+G  V 
Sbjct  332   PAVTEEHFRGLVDWVEFQRREPVVPRILLGHKEEGVGCMVSSGRRLPVGEVEFGWGRAVF  391

Query  482   GTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITA  321
              +    +E    GY    PSA+G+G W V   L       LE+    +F+P+TA
Sbjct  392   ASYHFPLEN-PTGYAMPMPSAKGNGDWVVYMHLRKSFADLLEAEEPPVFRPLTA  444



>ref|XP_009603729.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=469

 Score =   256 bits (654),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 156/410 (38%), Positives = 238/410 (58%), Gaps = 22/410 (5%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LKASL++ L  +Y FAG IV N    EPE+LC+N GV   EA A++ LKE+ FYN ++ +
Sbjct  72    LKASLAETLVSYYAFAGEIVQN-LAGEPEVLCNNSGVNFTEAFADVELKEINFYNPDESI  130

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E G LVP  +++ G    + +Q+T+  CGGL +   FDH + DA S   FL +WSELA +
Sbjct  131   E-GNLVP--KKKHG---VLAVQVTQLKCGGLVVGCAFDHRVADAYSANLFLVSWSELAQS  184

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
             KP +  P  R+  L PR P  Y+ S+D  +V   +  I  ++P     +   + R+YY+ 
Sbjct  185   KPLTQLPSFRKSFLFPRHPGYYDDSIDGLYVP--IPTIPLIKPETLNPNDQAISRIYYVT  242

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN--KCKMGWLVDGR  795
                I+ LQ LA+   D   T  +R+K+E+FSA++WK +   + ++ N    + G +VDGR
Sbjct  243   GEKINHLQSLANR--DQKSTKFQRSKLESFSAFLWKTIACGIKETSNSKNFRFGIIVDGR  300

Query  794   TRIPG-------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFL  636
             TR+         ++  Y GNVLS+ FG   ++ELK  ++S +A+ +H  I  A   EHFL
Sbjct  301   TRLSNGDDNQEKLLKGYFGNVLSIPFGNKKIEELKEKSLSWVANAIHEIIEKAVTREHFL  360

Query  635   DLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIER  456
              LIDW+E HRP   ++K +   D  G A+VVSSG++FP  E++FG+G PV  +       
Sbjct  361   GLIDWVEAHRPEPAVTK-IYATDDDGPAVVVSSGQQFPAREIDFGWGEPVFWSYHFPWAG  419

Query  455   IGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
                GYV   PS +G+G W +   L    +  +E+ +  +F+P+TA+ L+L
Sbjct  420   KS-GYVMPMPSPKGNGDWIIYMHLMKWQLELIETSASHVFKPVTANYLNL  468



>gb|KDP25022.1| hypothetical protein JCGZ_22557 [Jatropha curcas]
Length=453

 Score =   255 bits (651),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 163/404 (40%), Positives = 232/404 (57%), Gaps = 24/404 (6%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++ +LK +L+Q L  +Y FAG +V N    EPEILC NRGV   EA A+I L+ L  YN 
Sbjct  63    MVGSLKKALAQVLVSYYAFAGEVVAN-SAGEPEILCSNRGVDFYEAFADIELQHLNLYNP  121

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E  KLVP       +D  + +Q T+  CGG+ L  TFDH + DA S   F+ +W+E
Sbjct  122   DQSIE-AKLVPK-----KEDGVLAVQATKLKCGGIVLGCTFDHRIADAYSANMFVVSWAE  175

Query  1160  LATNKPPSCS--PDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI--M  993
             +A +K  S S  P  RR LL PR P   + SLD+ +V  S      ++PP    S    +
Sbjct  176   MAQSKAISDSVVPSFRRSLLNPRRPACIHPSLDDMYVPIS-----KLQPPKDSDSDDDHL  230

Query  992   LKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKC-KM  816
             + R+YY+ A S++KLQ LAS     IG   +RTK+E+FSA +W+++  +      K  KM
Sbjct  231   ISRIYYVKADSLNKLQSLASS----IGC--QRTKLESFSALLWQLVAKSAKNGMAKVSKM  284

Query  815   GWLVDGRTRIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFL  636
             G +VDGRTR+   M  Y GNVLS+ +G+  +DEL    +S +A+ VH  + +A   EHFL
Sbjct  285   GIVVDGRTRLGDTMDSYFGNVLSIPYGKKKIDELIANPLSWVANEVHDFLESAATKEHFL  344

Query  635   DLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIER  456
              LIDW+E HRP   L+K+       G A VVSSG+RFPV +++FG+G+P  G+       
Sbjct  345   GLIDWVEAHRPEPALAKIYGSGSDDGPAFVVSSGQRFPVSKVDFGWGAPFFGSYHFPWGG  404

Query  455   IGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
                GYV   PS   +G W V   L    +  +E+ S  +FQP+T
Sbjct  405   -NAGYVMPMPSPLCNGDWIVYMHLLKTQIHLIEAESSNLFQPLT  447



>ref|XP_006343272.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=463

 Score =   254 bits (650),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 163/423 (39%), Positives = 238/423 (56%), Gaps = 35/423 (8%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             I+  LK SL++ L  +Y F+G IV N    EPE+LC+N GV  +EA  ++ LKE+ FYN 
Sbjct  57    IVKILKTSLAETLVSYYAFSGEIVEN-SAGEPELLCNNGGVSFIEAFGDVELKEINFYNP  115

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GK VP  +++ G    + IQ+T+  CGG+ L  TFDH + DA S   FL +WSE
Sbjct  116   DESIE-GKFVP--KKKHG---VLAIQVTQLKCGGIILGCTFDHRVADAYSANLFLVSWSE  169

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSL-----DDILNMRPPPTLLSSI  996
             LA  KP S  P  RR  L PR P  Y  S+D+ +V  S       +ILN  P   ++S  
Sbjct  170   LAQCKPLSQLPSFRRSSLFPRHPGYYEDSIDDLYVPISTLPPMKSEILN--PNDQVIS--  225

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS---HNK  825
                R+YY+    I  LQ LA+  D   G   +R+K+E+FSA++WK +   ++K     N 
Sbjct  226   ---RIYYVTGDKIEHLQSLANCHDQK-GMKSQRSKLESFSAFLWKTIACGINKETSGFNN  281

Query  824   CKMGWLVDGRTRIPGIMSD----------YIGNVLSLTFGELSMDELKHGTISKIASHVH  675
              + G +VDGRTR+     D          Y GNVLS+ FGE  +++LK  +++ +A+ VH
Sbjct  282   FRFGIVVDGRTRLISTNVDDYNQDKSLKGYFGNVLSIPFGEKKVEDLKEKSLNWVANVVH  341

Query  674   AAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFG  495
               +  A   EHFL LIDW+E HRP   ++K +   +G G A+VVSSG+ FP  ++ FG+G
Sbjct  342   EFLDIAKTQEHFLGLIDWVEAHRPEPSMAK-IYAMNGDGPAVVVSSGQHFPAKKINFGWG  400

Query  494   SPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHD  315
              PV  +          GYV   PS +G+G W V   L    +  +E+    +F+P+TA+ 
Sbjct  401   QPVFWSYHFPWAG-KAGYVMPMPSPKGNGDWIVYMHLLKWQMELIEASPSNVFEPVTANY  459

Query  314   LHL  306
             L+L
Sbjct  460   LNL  462



>ref|XP_007023568.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY26190.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=463

 Score =   254 bits (649),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 174/476 (37%), Positives = 255/476 (54%), Gaps = 35/476 (7%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHS--SSPKII  1515
             D+ V    + VV  V L  + + L  SNLDLL     V   + ++         S   ++
Sbjct  6     DYTVTVSKKEVVAAV-LPLQEHWLPFSNLDLLLPAVDVGVFFCYKKAVGVGDAMSFGSMV  64

Query  1514  DNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
               LK +++Q L  +Y FA  +VPN    EPE++C+NRGV  +EA A++ L+ L+ +N ++
Sbjct  65    SVLKKAMAQALVSYYAFASEVVPN-TVGEPELVCNNRGVDFIEAYADVELRNLDLHNPDE  123

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              +E GKLVP  +Q       + +Q T   CGGL +  TFDH + DA S   FL +W+E+A
Sbjct  124   SIE-GKLVPKKKQG-----VLSVQATELRCGGLVVACTFDHRIADAYSANMFLVSWAEMA  177

Query  1154  TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL---LSSIMLKR  984
              +K  S  P  RR LL PR P R + SLD+ ++  S        PPP      +  ++ R
Sbjct  178   RSKSISVVPSFRRSLLNPRRPGRIDPSLDDMYMPIS------SLPPPKQHHQATDQLISR  231

Query  983   LYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKV--MVNAVDKSHNKCKMGW  810
             +YYI A  +++LQ LA           +RTKIE+FSA++WK+  +V A D      KMG 
Sbjct  232   IYYIAAEQLNELQSLACS------NGYKRTKIESFSAFLWKMVALVAAKDDDSEVTKMGI  285

Query  809   LVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATN  651
             +VDGR R+         +MS Y GNVLS+ +G   ++EL    +S +A+ VH  +  A  
Sbjct  286   VVDGRGRLGEGDKDRASLMSCYFGNVLSIPYGSQRVNELIERPLSWVANQVHNFLDQAVT  345

Query  650   AEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVC  471
              EHFL LIDW+E HRP   L+K+       G A VVSSG+RFPV +++FG+G PV G+  
Sbjct  346   KEHFLGLIDWVEAHRPEPALAKIYSNGSDDGPAFVVSSGQRFPVSKVDFGWGCPVFGSYH  405

Query  470   STIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
                     GYV   PS   +G W V   L+   +  +E+ +  +F+P+T   L  S
Sbjct  406   FPWGG-DAGYVMPMPSPAREGDWVVYMHLFKRQLDLIETEASHVFRPLTFDYLDFS  460



>gb|KDO67093.1| hypothetical protein CISIN_1g011528mg [Citrus sinensis]
Length=483

 Score =   254 bits (650),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 168/483 (35%), Positives = 249/483 (52%), Gaps = 41/483 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK----  1521
             DF V    + VV  V L  + + L  SNLDLL     V   + ++ P     +  K    
Sbjct  6     DFTVTVSKKEVVAAV-LPLQEHWLPQSNLDLLLPAIDVGVFFCYKKPAAAADNINKSFGF  64

Query  1520  --IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFY  1347
               ++D LK ++++ L  +Y  AG +V N    EPE+LC+NRGV  VEA AN+ LK+L  Y
Sbjct  65    GSMVDVLKKAMAEALVSYYALAGEVVYN-DVGEPELLCNNRGVDFVEAYANVELKDLNLY  123

Query  1346  NLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTW  1167
             N +  +E GKLV   ++ G     + +Q T   CGG+ +  TFDH + DA S   FL +W
Sbjct  124   NPDDTIE-GKLVAKKKKNG----VLSVQATELKCGGIVVACTFDHRIADAYSTDMFLVSW  178

Query  1166  SELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCS---LDDILNMRPPPTLLSSI  996
             +E+A +KP S  P  RR +L PR P   +   D  +V  S            P     + 
Sbjct  179   AEIAQSKPISVMPSFRRSMLNPRRPLCIDHEFDNMYVPISTLPPPPPPPHNNPQEANCNK  238

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKM  816
             ++ R+YYI +  +++LQ LA+      G++ RRTK+E+FSA++WK++  + +      KM
Sbjct  239   LVSRIYYIKSEQLNELQLLAT-----TGSNGRRTKLESFSAFLWKMVARSANDGMMITKM  293

Query  815   GWLVDGRTRIP-------------------GIMSDYIGNVLSLTFGELSMDELKHGTISK  693
             G +VDGRTR+                      M  Y GNVLS+ FG  ++ EL    +S 
Sbjct  294   GIVVDGRTRLSISSNKGDHNNNNVNKSISCMAMGSYFGNVLSIPFGGQNVKELVEKPLSW  353

Query  692   IASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGE  513
             +A+ VH  +  A   +HFL LIDW+E H+P   L+K+       G A VVSSG+RFPV +
Sbjct  354   VATQVHNFLENAVTKDHFLGLIDWVEAHKPDPALAKIYCTPSSDGPAFVVSSGQRFPVSK  413

Query  512   LEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQ  333
             ++FG+G P  G+          GYV   PS  G+G W V   L    V  +E+ +  +F+
Sbjct  414   VDFGWGKPAFGSYHFPWGG-DAGYVMPMPSPAGNGDWVVYMHLSEKQVDLIETQASNVFK  472

Query  332   PIT  324
             P+ 
Sbjct  473   PMA  475



>ref|XP_009619139.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=469

 Score =   253 bits (646),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 163/417 (39%), Positives = 238/417 (57%), Gaps = 28/417 (7%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             +I  LKASL++ L  +Y FAG IV N    EPE+LC+N GV   EA A++ LKE+ FY+ 
Sbjct  68    MIKILKASLAETLVSYYAFAGEIVQN-LAGEPEVLCNNSGVNFTEAFADVELKEINFYDP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVP  +++ G    + +Q+T+ TCGG+ +  TFDH + DA S   FL +WSE
Sbjct  127   DESIE-GKLVP--KKKYG---VLAVQVTQLTCGGIVVGCTFDHRVADAYSANLFLVSWSE  180

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRP--PPTL-LSSIML  990
             LA +KP +  P  RR  L PR P  Y+ S+D  +V      I  + P  P TL  +   +
Sbjct  181   LAQSKPLTQLPSFRRSFLFPRRPGYYDNSIDGLYVP-----ITTLPPSIPETLNTNDQAI  235

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN--KCKM  816
              R+YY+    I  LQ LA+   D   T   R+K+E+FSA++WK +   + ++ N    + 
Sbjct  236   SRIYYVTGEKISHLQSLAN--SDQKSTKFHRSKLESFSAFLWKTIACGIKETSNSKNFRF  293

Query  815   GWLVDGRTRIPG-------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTA  657
             G +VDGRTR+          +  Y GNVLS+ FG   ++ELK   +S +A+ VH  I  A
Sbjct  294   GIVVDGRTRLSNGDDNQEKSLKGYFGNVLSIPFGNKKIEELKEKPLSWVANAVHEFIEKA  353

Query  656   TNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGT  477
                EHFL LIDW+E HRP   ++K +   D  G A+VVSSG++FP  E+ FG+G PV  +
Sbjct  354   VTREHFLGLIDWVEAHRPEPAVAK-IYATDDDGPAVVVSSGQQFPAREINFGWGEPVFWS  412

Query  476   VCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
                       GYV   PS  G+G W +   L    +  +E+ +  +F+P+TA+ L+L
Sbjct  413   YHFPWAGKS-GYVMPMPSPTGNGDWIIYMHLMKWQLELIEASASHVFEPLTANYLNL  468



>ref|XP_010654977.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Vitis 
vinifera]
Length=470

 Score =   253 bits (645),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 158/418 (38%), Positives = 232/418 (56%), Gaps = 31/418 (7%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +++Q L  +Y FAG I+ N    E E+LC+NRGV  ++A A+++L++L  YN 
Sbjct  67    MVRVLKEAMAQALVPYYAFAGEILSN-SLGEAELLCNNRGVDFLDAYADVKLQDLNLYNP  125

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVP  R+ G     + +Q+T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  126   DESIE-GKLVPT-RKHG----VLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSWAE  179

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLL---SSIML  990
             +A +KP S  P  RR LL PR P  Y  SLD  +V  S        PPP +    +  ++
Sbjct  180   MAQSKPLSVIPSFRRSLLNPRHPGSYAPSLDHMYVPIS------ALPPPKVPQPGADPLI  233

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV---DKSHNKCK  819
              RLYY+ A  +  LQ LA+ +     +S +RTK+E+ SA++WK++  +    + +   CK
Sbjct  234   SRLYYVTAEKLSLLQTLATSK----SSSYKRTKLESLSAFLWKIVAKSAHMENANQKICK  289

Query  818   MGWLVDGRTRIPG-------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
             M  +VDGR R+          M+ Y GNVLS  FGE  +++LK   +S +   VH  +  
Sbjct  290   MSVVVDGRKRLSSGDEDMTTAMASYFGNVLSFPFGEKIVNDLKEKPLSWVGDEVHDFLEA  349

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLG  480
             A   EHFL LIDW+E HRP      M    +  G   +VSSG+RFPV +++FG+G P LG
Sbjct  350   AMTKEHFLGLIDWVEAHRPEPATLNMCCSGNSDGPGFMVSSGQRFPVTKVDFGWGRPALG  409

Query  479   TVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             +         VGYV   PS   DG W V   L    +  +E+ +  IF P+TA  L+L
Sbjct  410   SYHFPWGE-EVGYVMPMPSPTVDGDWVVYMHLLKAQIELIETEAADIFSPLTADRLNL  466



>ref|XP_006425196.1| hypothetical protein CICLE_v10028328mg [Citrus clementina]
 gb|ESR38436.1| hypothetical protein CICLE_v10028328mg [Citrus clementina]
Length=482

 Score =   252 bits (644),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 168/483 (35%), Positives = 250/483 (52%), Gaps = 42/483 (9%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK----  1521
             DF V    + VV  V L  + + L  SNLDLL     V   + ++ P     +  K    
Sbjct  6     DFTVTVSKKEVVAAV-LPLQEHWLPQSNLDLLLPAIDVGVFFCYKKPAAAADNINKSFGF  64

Query  1520  --IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFY  1347
               ++D LK ++++ L  +Y  AG +V N    EPE+LC+NRGV  VEA AN+ LK+L  Y
Sbjct  65    GSMVDVLKKAMAEALVSYYALAGEVVYN-DVGEPELLCNNRGVDFVEAYANVELKDLNLY  123

Query  1346  NLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTW  1167
             N +  +E GKLV   +++ G    + +Q T   CGG+ +  TFDH + DA S   FL +W
Sbjct  124   NPDDTIE-GKLVA--KKKNG---VLSVQATELKCGGIVVACTFDHRIADAYSTDMFLVSW  177

Query  1166  SELATNKPPSCSPDHrrfllrprfppRYNTSLDETFV---SCSLDDILNMRPPPTLLSSI  996
             +E+A +KP S  P  RR +L PR P   +   D  +V   S           P     + 
Sbjct  178   AEIAQSKPISVMPSFRRSMLNPRRPLCIDHEFDNMYVPISSLPPPPPPPHNNPQEANCNK  237

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKM  816
             ++ R+YYI +  +++LQ LA+      G++ RRTK+E+FSA++WK++  + +      KM
Sbjct  238   LVSRIYYIKSEQLNELQLLAT-----TGSTGRRTKLESFSAFLWKMVARSANDGMMISKM  292

Query  815   GWLVDGRTRIP-------------------GIMSDYIGNVLSLTFGELSMDELKHGTISK  693
             G +VDGRTR+                      M  Y GNVLS+ FG  ++ EL    +S 
Sbjct  293   GIVVDGRTRLSISSNKGDNNNNNFNKSISCMAMGSYFGNVLSIPFGGQNVKELVEKPLSW  352

Query  692   IASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGE  513
             +A+ VH  +  A   +HFL LIDW+E H+P   L+K+       G A VVSSG+RFPV +
Sbjct  353   VATQVHNFLENAVTKDHFLGLIDWVEAHKPDPALAKIYCTPSSDGHAFVVSSGQRFPVSK  412

Query  512   LEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQ  333
             ++FG+G P  G+          GYV   PS  G+G W V   L    V  +E+ +  +F+
Sbjct  413   VDFGWGKPAFGSYHFPWGG-DAGYVMPMPSPAGNGDWVVYMHLSEKQVDLIETQASNVFK  471

Query  332   PIT  324
             P+ 
Sbjct  472   PMA  474



>ref|XP_002269682.3| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Vitis 
vinifera]
Length=470

 Score =   252 bits (643),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 158/418 (38%), Positives = 231/418 (55%), Gaps = 31/418 (7%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +++Q L  +Y FAG I+ N    E E+LC+NRGV  +EA A+++L++L  YN 
Sbjct  67    MVRVLKEAMAQALVPYYAFAGEILSN-SLGEAELLCNNRGVDFLEAYADVKLQDLNLYNP  125

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKL P  R+ G     + +Q+T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  126   DESIE-GKLAPT-RKHG----VLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSWAE  179

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLL---SSIML  990
             +A +KP S  P  RR LL PR P  Y  SLD  +V  S        PPP +    +  ++
Sbjct  180   MAQSKPLSVIPSFRRSLLNPRHPGSYALSLDHMYVPIS------ALPPPKVPQPGADPLI  233

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV---DKSHNKCK  819
              RLYY+ A  +  LQ LA+ +     +S +RTK+E+ SA++WK++  +    + +   CK
Sbjct  234   SRLYYVTAEKLSLLQTLATSKS----SSYKRTKLESLSAFLWKIVAKSAHMENANQKICK  289

Query  818   MGWLVDGRTRIPG-------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
             M  +VDGR R+          M+ Y GNVLS  FGE  +++LK   +S +   VH  +  
Sbjct  290   MSVVVDGRKRLSSGDEDMTTAMASYFGNVLSFPFGEKIVNDLKEKPLSWVGDEVHDFLEA  349

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLG  480
             A   EHFL LIDW+E HRP      M    +  G   +VSSG+RFPV +++FG+G P LG
Sbjct  350   AMTKEHFLGLIDWVEAHRPEPAALNMCCSGNSDGPGFMVSSGQRFPVTKVDFGWGKPALG  409

Query  479   TVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             +         VGYV   PS   DG W V   L    +  +E+ +  IF P+TA  L+L
Sbjct  410   SYHFPW-GAEVGYVMPMPSPTVDGDWVVYMHLLKAQIELIETEAADIFSPLTADHLNL  466



>ref|XP_009104555.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brassica 
rapa]
Length=455

 Score =   251 bits (640),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 173/469 (37%), Positives = 262/469 (56%), Gaps = 33/469 (7%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             DF V    + ++ T  L  + + L LSNLDL+     V+  + ++ P    +S     + 
Sbjct  12    DFHVTSNRKQLI-TAALPLQDHWLPLSNLDLILPPVHVSVCFCYKKPRNMTNSMAH--ET  68

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +L++ L  +Y FAG IV NP T EPEILC+NRGV  +EA A++ L+EL  Y+ ++ +
Sbjct  69    LKTALAETLVSYYAFAGEIVTNP-TGEPEILCNNRGVDFMEAGADVDLRELNLYDPDESI  127

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-T  1152
                KLVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   FL +W+E++ +
Sbjct  128   V--KLVP-IKKHG----VIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLVSWAEISRS  180

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP---TLLSSIMLKRL  981
             + P SC P  RR LL PR P   ++++D+ ++  +        PPP   T   SI+  RL
Sbjct  181   DVPISCVPSFRRSLLNPRRPLVMDSAIDQMYIPVT------SLPPPQETTNPDSILASRL  234

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVN--AVDKSHNK-CKMGW  810
             YYI A ++  LQ LAS        S+RRTK+E+FSA++WK++    A D   +K  K+G 
Sbjct  235   YYIKADALDDLQALAS-------GSKRRTKLESFSAFLWKLVAKHAATDPVPSKNSKLGI  287

Query  809   LVDGRTRI-PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLD  633
             +VDGR R+     + Y GNVLS+ FG   +D+L +  +S +   VH  + ++   EHFL+
Sbjct  288   VVDGRRRVMEQEKNTYFGNVLSIPFGGQKIDDLVNKPLSWVTEVVHRFLESSVTKEHFLN  347

Query  632   LIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERI  453
             LIDW+E  RP   +S++       G A VVSSGR FPV +++FG+GSPV G+        
Sbjct  348   LIDWVETRRPTPTVSRIYSTGSEDGPAFVVSSGRSFPVTQVDFGWGSPVFGSYHFPWGG-  406

Query  452   GVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
               GYV   PS+  DG W V   L    +  +E  +  + +PI  + L +
Sbjct  407   NAGYVMPMPSSVEDGDWMVYLHLTKGQLKFIEEEASQVLKPIDNNYLKI  455



>ref|XP_009783339.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=469

 Score =   251 bits (641),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 157/410 (38%), Positives = 237/410 (58%), Gaps = 22/410 (5%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK+SL++ L  +Y FAG IV N    EPE+LC+N GV   EA A++ LK++ FYN ++ +
Sbjct  72    LKSSLAETLVIYYAFAGEIVQN-LGGEPEVLCNNSGVNFTEAFADVELKDINFYNPDESI  130

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E GKLVP  +++ G    + +Q+T+  CGGL +  TFDH + DA S   FL +WSELA +
Sbjct  131   E-GKLVP--KKKHG---VLAVQVTQLKCGGLVVGCTFDHRVADAYSANLFLVSWSELAQS  184

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
             KP S  P  RR  L PR P  Y+ S+D  +V   +  + +++P     + + + R+YYI 
Sbjct  185   KPLSQLPSFRRSFLFPRRPGYYDDSIDGLYVP--IPTLPSVKPETLNPNDLAISRIYYIT  242

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN--KCKMGWLVDGR  795
                +  LQ LA+   D   T  +R+K+E+FSAY+WK +     ++ N    + G +VDGR
Sbjct  243   GEKMGHLQALANR--DQKSTKFQRSKLESFSAYLWKTIACGSKETSNSKNFRFGIVVDGR  300

Query  794   TRIPG-------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFL  636
              R+         ++  Y GNVLS+ FG   ++ELK   +S +A+ +H  I  A   EHFL
Sbjct  301   ARLSNGDDNQEKLLKGYFGNVLSIPFGNKKIEELKEKPLSWVANSIHEFIEKAVTREHFL  360

Query  635   DLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIER  456
              LIDW+E HRP   ++K +   D  G A+VVSSG++FP  E++FG+G PV  +       
Sbjct  361   GLIDWVEAHRPEQAVAK-IYATDDDGPAVVVSSGQQFPAREIDFGWGEPVFWSYHFPWAG  419

Query  455   IGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
                GYV   PS +G+G W V   L    +  +E+ +  + +P+TA+ L+L
Sbjct  420   KS-GYVMPMPSPKGNGDWIVYMHLMKWQLELIETSASHVVKPVTANYLNL  468



>ref|XP_011087026.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Sesamum 
indicum]
Length=475

 Score =   251 bits (641),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 168/442 (38%), Positives = 253/442 (57%), Gaps = 28/442 (6%)
 Frame = -1

Query  1607  NLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDE  1428
             NLDLL     V   + + + +    S   ++  LK +L+Q L  +Y FAGR+V N    E
Sbjct  40    NLDLLLPPVDVGVFFCYDNKHNMGLSYGHMVGILKKALAQTLVSYYAFAGRLVKN-AAGE  98

Query  1427  PEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYT  1248
             PE+LC+N GV  VEA A++ LK++  YN ++ VE GKLVP  R+RG     + +Q T+  
Sbjct  99    PELLCNNCGVDFVEAFADVELKDINLYNPDESVE-GKLVPE-RKRG----VLAVQATQLK  152

Query  1247  CGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLD  1068
             CGGL +  TF H + DA S   FL +W+E+A  KP S  P  RR LL PR P RY  S++
Sbjct  153   CGGLVVACTFAHLVADAYSANMFLVSWAEMAQFKPVSQPPSFRRSLLLPRRPGRYELSVE  212

Query  1067  ETFVSCSLDDILNMRPPPT-----LLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSR  903
               +V  S        PPP         + ++ R+YYI A  +++LQ LA+ + +      
Sbjct  213   NMYVPMS------AIPPPEDEPEDAQPAAVISRIYYIKADVVNELQALANLDKNNTSKGN  266

Query  902   RRTKIEAFSAYIWKVMVNAVDKS-HNKCKMGWLVDGRTRI-------PGIMSDYIGNVLS  747
             +RTK+E+F  ++WK++V+  D +  N C++G +VDGR+R+         +M+ Y GNVLS
Sbjct  267   KRTKLESFCGFLWKMIVSGNDSAGDNCCRLGIVVDGRSRLIDGDESEAKLMASYFGNVLS  326

Query  746   LTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGR-  570
             + FGE  ++ELK   ++ +A+ VH  + +A   EHFL LIDW+E HRP + LSK+   + 
Sbjct  327   IPFGEKKIEELKEKPLNWVANEVHEFLQSAMTKEHFLGLIDWVEEHRPEVGLSKIYAAKV  386

Query  569   DGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSA  390
                  A+VVSSG+ FPV +++FG+G PV G+          GYV   PS +G+G W V  
Sbjct  387   TKEEPAVVVSSGQCFPVRKMDFGWGIPVFGSYHFPWGGKS-GYVMPMPSPKGNGDWIVYM  445

Query  389   ILWPDMVAALESHSECIFQPIT  324
              L    +  +E+++  +F P+T
Sbjct  446   HLLKGQLELIETNAAHVFSPLT  467



>emb|CAN75148.1| hypothetical protein VITISV_027192 [Vitis vinifera]
Length=470

 Score =   251 bits (641),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 158/418 (38%), Positives = 231/418 (55%), Gaps = 31/418 (7%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +++Q L  +Y FAG I+ N    E E+LC+NRGV  +EA A+++L++L  YN 
Sbjct  67    MVRVLKEAMAQALVPYYAFAGEILSN-SLGEAELLCNNRGVDXLEAYADVKLQDLNLYNP  125

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKL P  R+ G     + +Q+T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  126   DESIE-GKLAPT-RKHG----VLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSWAE  179

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLL---SSIML  990
             +A +KP S  P  RR LL PR P  Y  SLD  +V  S        PPP +    +  ++
Sbjct  180   MAQSKPLSVIPSFRRSLLNPRHPGSYAPSLDHMYVPIS------ALPPPKVPQPGADPLI  233

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV---DKSHNKCK  819
              RLYY+ A  +  LQ LA+ +     +S +RTK+E+ SA++WK++  +    + +   CK
Sbjct  234   SRLYYVTAEKLSLLQTLATSKS----SSYKRTKLESLSAFLWKMVAKSAHMENANQKICK  289

Query  818   MGWLVDGRTRIP-------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
             M  +VDGR R+          M+ Y GNVLS  FGE  +++LK   +S +   VH  +  
Sbjct  290   MSVVVDGRKRLSCGDEDMTTAMASYFGNVLSFPFGEKIVNDLKEKPLSWVGDEVHDFLEA  349

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLG  480
             A   EHFL LIDW+E HRP      M    +  G   +VSSG+RFPV +++FG+G P LG
Sbjct  350   AMTKEHFLGLIDWVEAHRPEPATLNMCCNGNSDGPGFMVSSGQRFPVTKVDFGWGRPALG  409

Query  479   TVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             +         VGYV   PS   DG W V   L    +  +E+ +  IF P+TA  L+L
Sbjct  410   SYHFPWGE-EVGYVMPMPSPTVDGDWVVYMHLLKAQIELIETEAADIFSPLTADHLNL  466



>ref|XP_008344964.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=458

 Score =   251 bits (640),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 158/430 (37%), Positives = 235/430 (55%), Gaps = 37/430 (9%)
 Frame = -1

Query  1562  FFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEA  1383
             FF   N+   S   ++  LK +++Q L  FY F+G +VPN    EPEILC+NRGV   EA
Sbjct  44    FFCYKNKQSMSFGSMVGVLKKAMAQALMTFYAFSGEVVPN-SVGEPEILCNNRGVDFAEA  102

Query  1382  QANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALG  1203
              A++ LKEL  Y+ ++ +E GKLVP  ++ G     + +Q T   CGG+ +  TFDH + 
Sbjct  103   FADVELKELNLYDPDESIE-GKLVPN-KKHG----VLAVQATLLKCGGIVVACTFDHRIA  156

Query  1202  DASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMR  1023
             DA S   FL +W+E+A +K  +  P  RR LL PR P   + SL+  +V       L   
Sbjct  157   DAYSTNMFLVSWAEMAQSKSLTIQPTFRRSLLNPRRPGHIDPSLNNMYVP------LTAL  210

Query  1022  PPPTLLSSI-----MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKV  858
             PPP+  S+      ++ R+YY+ +  +  LQ LA+          +RTK+E+F A++WK+
Sbjct  211   PPPSKGSTTDDHDHLISRIYYVTSEQLENLQDLATS------NGCKRTKLESFCAFLWKM  264

Query  857   MVNAV---DKSHNKCKMGWLVDGRTRI---------PGIMSDYIGNVLSLTFGELSMDEL  714
             +  +    D++   CKMG +VDGR R+         P +M+ Y GNVLS+ FG   +++L
Sbjct  265   VAKSETSNDRAQKLCKMGIVVDGRARLSEGNYQNDHPTLMATYFGNVLSIPFGGEKVEDL  324

Query  713   KHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSG  534
                 ++ +A  VH  +  A   EHFL LIDW+E HRP   L+K+       G A VVSSG
Sbjct  325   TEKPLNWVAEEVHNFLECAVTKEHFLGLIDWVEAHRPVPGLAKIYSSGSDEGPAFVVSSG  384

Query  533   RRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALES  354
             +RFP  +++FG+GSPV G+          GYV   PS  G+G W V   +    V  +E 
Sbjct  385   QRFPASKMDFGWGSPVFGSYHFPWGG-NAGYVMPMPSPVGNGDWIVYMHMLKGQVELIEK  443

Query  353   HSECIFQPIT  324
              +  + +P+T
Sbjct  444   EAADVLKPLT  453



>ref|XP_009786591.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=474

 Score =   251 bits (640),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 175/484 (36%), Positives = 270/484 (56%), Gaps = 37/484 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSP---NQFHSSSPKI  1518
             DF V  I   VV    L  + + L  SNLDLL     V   + +++P        SS  +
Sbjct  6     DFNVKVIKTEVV-AASLPMQEHWLPQSNLDLLLPPMDVGVFFCYQNPIISGMPQYSSGSM  64

Query  1517  IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLN  1338
             +  LK SL++ L  +Y FAG +V N    EPEILC+N GV   EA A+I LKE+  YN +
Sbjct  65    VKVLKVSLAETLVSYYAFAGELVQN-LAGEPEILCNNAGVNFTEAWADIELKEINLYNPD  123

Query  1337  KYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSEL  1158
             + +E GKLVP  +++ G    + IQ T+  CGG+ +  TFDH + DA S   FL +W+E+
Sbjct  124   ESIE-GKLVP--KKKHG---VLAIQATQLKCGGIVVACTFDHRVADAYSTNMFLVSWAEI  177

Query  1157  ATNKPPSCSPDHrrfllrprfppRYNT-SLDETFVSCSLDDILNMRPPPTLLSSI-----  996
             A +KP S  P  RR  L PR P  Y+   +D  ++  S     +++     +++I     
Sbjct  178   AQSKPLSQLPSFRRSFLSPRRPSHYDPLVIDSMYIPIS-----SLKQETRAVTNIDDDEQ  232

Query  995   MLKRLYYIDASSIHKLQKLASE-EDDGIGTSRRR-TKIEAFSAYIWKVMVNAVDKS----  834
             ++ R+YY+ A  I +LQ LA+   +D I T   R TK+E FSA++WK + N + ++    
Sbjct  233   VISRIYYVKAEEISRLQSLANNCNNDMISTKFHRFTKLETFSAFLWKTIANGMGENSTPN  292

Query  833   HNKCKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVH  675
             +   + G +V+GR+R+         ++  Y GNVLS+ FGE  +++LK   +S +A+ VH
Sbjct  293   YENFRFGIVVNGRSRLSDGVEEQAKVLKGYFGNVLSIPFGEKKVEKLKEKPLSWVANAVH  352

Query  674   AAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFG  495
               +  A   EHFL LI+W+E HRP   L++ +   +    A+VVSSG++FPVG++EFG+G
Sbjct  353   EFLEPAKTKEHFLGLINWVEDHRPEPALAR-IYATNEDAVAVVVSSGQQFPVGKIEFGWG  411

Query  494   SPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHD  315
              PV G+     E    GYV   PS +G+G W V   +    +  +E+ +  +F+P+TA  
Sbjct  412   EPVFGSYHFPWEG-KAGYVMPMPSPKGNGDWVVYMHMLKWQLELVEASASNVFKPLTADY  470

Query  314   LHLS  303
             L+L+
Sbjct  471   LNLN  474



>ref|XP_008380698.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Malus domestica]
 ref|XP_008348468.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=458

 Score =   250 bits (638),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 163/468 (35%), Positives = 249/468 (53%), Gaps = 54/468 (12%)
 Frame = -1

Query  1625  YILTLSNLDLLSGRFPVTYLY-----------------FFRSPNQFHSSSPKIIDNLKAS  1497
             + +T+SN ++++   P+   +                 FF   N+   S   ++  LK +
Sbjct  6     FKVTMSNQEVVAAALPLQEYWLPLSNLDLLLPPLDVGVFFCYKNKQSMSFGSMVGVLKKA  65

Query  1496  LSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGK  1317
             ++Q L  FY F+G +VPN    EPEILC NRGV   EA A+I LKEL FY+ ++ VE GK
Sbjct  66    MAQALVTFYAFSGEVVPN-SDGEPEILCHNRGVDFTEAFADIELKELNFYDPDQSVE-GK  123

Query  1316  LVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPS  1137
             LVP  +++ G    + +Q+T   CGG+ +  TFDH + DA S   FL +W+E+A +K  +
Sbjct  124   LVP--KKKHG---VLAVQVTELNCGGVVVACTFDHRIADAYSTNMFLVSWAEMAQSKSLT  178

Query  1136  CSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI-----MLKRLYYI  972
               P  RR LL PR P   + SL++ +V  +        PPP+   +      ++ R+YYI
Sbjct  179   IQPTXRRSLLNPRRPGHIDXSLNDMYVPVT------ALPPPSKGRTTDDHDHLISRIYYI  232

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA---VDKSHNKCKMGWLVD  801
              +  +  LQ LA+          +RTK+E+F A++WK++  +    D++   CKMG +VD
Sbjct  233   TSEQLENLQALATS------NGYKRTKLESFCAFLWKMVAKSDTSNDRAQKLCKMGIVVD  286

Query  800   GRTRI---------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNA  648
             GR R+            M+ Y GNVLS+ FG  ++++L    +S +A  VH  +  A   
Sbjct  287   GRXRLSEGNYQNDHATXMAAYFGNVLSIPFGGENIEDLTEKPLSWVAEEVHDFLECAVTK  346

Query  647   EHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCS  468
             EHFL LIDW+E HRP   L+K+       G A VVSSG+RFP  +++FG+GSPV G+   
Sbjct  347   EHFLGLIDWVESHRPVPGLAKIYYSGSXEGPAFVVSSGQRFPSSKVDFGWGSPVFGSYHF  406

Query  467   TIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
                    GYV   PS  G+G W V   +    +  +E  +  + +P+T
Sbjct  407   PWGG-SAGYVMPMPSPVGNGDWIVYMHMMKGQMELMEKEAAHVLRPLT  453



>ref|XP_002270539.2| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Vitis 
vinifera]
Length=468

 Score =   250 bits (638),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 156/418 (37%), Positives = 232/418 (56%), Gaps = 31/418 (7%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +++Q L  +Y FAG ++ N    E E+LC+NRGV  +EA A+++L++L  YN 
Sbjct  67    MVRVLKEAMAQALVPYYAFAGEVLSN-SLGEAELLCNNRGVDFLEAYADVKLQDLNLYNP  125

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKL P  R+ G     + +Q+T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  126   DESIE-GKLAPT-RKHG----VLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSWAE  179

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLL---SSIML  990
             +A +KP S  P  RR LL PR P  Y  SLD  +V  S        PPP +    +  ++
Sbjct  180   MAQSKPLSVIPSFRRSLLNPRHPGSYAPSLDHMYVPIS------ALPPPKVPQPGADPLI  233

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV---DKSHNKCK  819
              RLYY+ A  +  LQ LA+ +     +S +RTK+E+ SA++WK++  +    + +   CK
Sbjct  234   SRLYYVTAEKLSLLQTLATSKS----SSYKRTKLESLSAFLWKMVAKSAHMENANQKICK  289

Query  818   MGWLVDGRTRIPG-------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
             M  +VDGR R+          M+ Y GNVLS  FGE ++++LK   +S +   VH  +  
Sbjct  290   MSVVVDGRKRLSSGDEDRTTAMASYFGNVLSFPFGEKTVNDLKEKPLSWVGDEVHDFLEA  349

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLG  480
             A   EHFL LIDW+E HRP      M    +  G   +VSSG+RFPV +++FG+G P LG
Sbjct  350   AMTKEHFLGLIDWVEAHRPEPAALNMCCSGNSDGPGFMVSSGQRFPVTKVDFGWGKPALG  409

Query  479   TVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             +         VGYV   PS   D  W V   L    +  +E+ +  IF+P+TA  L+L
Sbjct  410   SYHFPW-GAEVGYVMPMPSPTVDDDWVVYMHLLKAQIELIETEAAHIFRPLTADHLNL  466



>ref|XP_006347188.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=457

 Score =   249 bits (637),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 173/476 (36%), Positives = 264/476 (55%), Gaps = 40/476 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKI---  1518
             DF+V  I   VV  + L  + + L+ SNLDLL     V  L  +++P       PKI   
Sbjct  6     DFKVKLIKTEVVAAM-LPMQEHWLSQSNLDLLLPPVDVGVLLCYQNPIT-SGILPKIWSF  63

Query  1517  ---IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFY  1347
                ++ LK SL + L  +Y  AG +V N    EPEILC+N GV  +EA A++ LKE+ FY
Sbjct  64    DSMVNILKVSLGETLVSYYAIAGELVQN-LAGEPEILCNNAGVNFIEAWADVELKEINFY  122

Query  1346  NLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTW  1167
             N ++ +E  KLVP  +++ G    + +Q+T   CGG+ +  TFDH + DA SF  FL +W
Sbjct  123   NPDESIE-AKLVP--KKKHG---VLAVQVTELKCGGVVVGCTFDHRVADAYSFNMFLVSW  176

Query  1166  SELATNKPPSCSPD-HrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLS-SIM  993
             +ELA +KP S  P   R FL   R    Y+  +D  ++  S      ++   T +    +
Sbjct  177   AELALSKPLSQLPSFQRSFLSPRRPASFYDPVIDTMYLPISA-----LKQETTNIDHDQV  231

Query  992   LKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMG  813
             + R+YY+ A  I +LQ LA+        + + TK+E FSA++WK +  A+D + N  ++G
Sbjct  232   ISRIYYVKAEEIRRLQSLAN------CNNTKFTKLETFSAFLWKTI--AIDTNKN-FRLG  282

Query  812   WLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTAT  654
              +V+GR+R+         I+  Y GNVLS+ FGE  ++ELK  ++S +A  VH  +  A 
Sbjct  283   IVVNGRSRLSDGDEEQAKILKGYFGNVLSIPFGEKRVEELKEKSLSCVARAVHEFLERAV  342

Query  653   NAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTV  474
             N EHFL LI+W+E HRP   L++ +   D    A+VVSSG++FPV ++EFG+G  V G+ 
Sbjct  343   NKEHFLGLINWVENHRPEPALAR-IYATDEDTPALVVSSGQQFPVRKIEFGWGEAVFGSY  401

Query  473   CSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
                 E    GYV    S +G+G W V   +    +  +E+ +  +F+P+TA  L+L
Sbjct  402   HFPWEGKS-GYVMPMLSPKGNGDWIVYMHMLKGQIDLVEAIASNVFKPLTADYLNL  456



>ref|XP_008808376.1| PREDICTED: agmatine coumaroyltransferase-2-like [Phoenix dactylifera]
Length=465

 Score =   249 bits (636),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 161/473 (34%), Positives = 251/473 (53%), Gaps = 28/473 (6%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHS  1533
             MA+    S F+V  I+++++K    T +PY+L  SNLD L    P  +L  +  P     
Sbjct  1     MASAGDSSSFQVKIISKTLIKASDTTIQPYVLYPSNLDHLPSNIPSPFLTIYPKPPSGGD  60

Query  1532  SSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELE  1353
              S  +   L+ +L   L+ F+PF GRI P+ +   PE+ C+N G  +V A+A+IRL ++ 
Sbjct  61    YS-SVAATLRRTLPTFLNYFFPFTGRIRPD-RNGVPEVYCNNEGAELVVARADIRLADVN  118

Query  1352  FYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLT  1173
             F++ +K +ER +L         ++  + IQ+  + CGG  + +   H L D    +   T
Sbjct  119   FHDKSKSLERIELPYE------EEIPLSIQVVGFACGGFSIVWGGTHLLSDGHGLSFLPT  172

Query  1172  TWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIM  993
              W+E       S  P+H R + RPR PP Y+   D +    + DD++N     +L +   
Sbjct  173   LWTEYVRTGELSRIPNHDRSIFRPRSPPSYSPETDRSLACLTPDDLIN-----SLSAGAF  227

Query  992   LKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMG  813
             +KRLY++D   I +L++LAS E       R  T++EAFSAY+WK +  AV  S   C+M 
Sbjct  228   VKRLYHVDGKHIDRLRELASRE------GRSATRMEAFSAYLWKSLAKAVGDSDVGCRMA  281

Query  812   WLVDGRTRI----PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAI-STATNA  648
             WLVD R R+       M DY+GNV++    E  + EL +G+ S++A  V AA+   A NA
Sbjct  282   WLVDARQRLGPKYTEAMKDYMGNVITFATKEAGVAELVNGSYSQVAGMVSAAVKEVADNA  341

Query  647   E-HFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVC  471
             E HF ++IDW+E H+ G   +++ +G   P  A+VVSS     +  L+FG G   L    
Sbjct  342   EDHFQEMIDWVEGHKVGKRANRVQVGLGSP--ALVVSSFHHMNM-NLDFGLGQAALAIPD  398

Query  470   STIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDL  312
                 R+G  +V    S +GDGS  ++A +W  +   LES  + +F+P TA  L
Sbjct  399   LPWGRLGSAFVIVLASPKGDGSLYMNAYIWSQLAVVLESDPDRVFKPATAEGL  451



>ref|XP_006488699.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
Length=482

 Score =   249 bits (636),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 166/483 (34%), Positives = 249/483 (52%), Gaps = 42/483 (9%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK----  1521
             DF V    + VV  V L  + + L  SNLDLL     V   + ++ P     +  K    
Sbjct  6     DFTVTVSKKEVVAAV-LPLQEHWLPQSNLDLLLPAIDVGVFFCYKKPAAAADNINKSFGF  64

Query  1520  --IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFY  1347
               ++D LK ++++ L  +Y  AG +V N    EPE+LC+NRGV  VEA AN+ LK+L  Y
Sbjct  65    GSMVDVLKKAMAEALVSYYALAGEVVYN-DVGEPELLCNNRGVDFVEAYANVELKDLNLY  123

Query  1346  NLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTW  1167
             N +  +E GKLV   +++ G    + +Q T   CGG+ +  TFDH + DA S   FL +W
Sbjct  124   NPDDTIE-GKLVA--KKKNG---VLSVQATELKCGGIVVACTFDHRIADAYSTDMFLVSW  177

Query  1166  SELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCS---LDDILNMRPPPTLLSSI  996
             +E+A +KP S  P  RR +L PR P   +   D  +V  S            P     + 
Sbjct  178   AEIAQSKPISVMPSFRRSMLNPRRPLCIDHEFDNMYVPISTLPPPPPPPHNNPQEANCNK  237

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKM  816
             ++ R+YYI +  +++LQ LA+      G++ RRTK+E+FSA++WK++  + +      KM
Sbjct  238   LVSRIYYIKSEQLNELQLLAT-----TGSNGRRTKLESFSAFLWKMVARSANDGMMITKM  292

Query  815   GWLVDGRTRIP-------------------GIMSDYIGNVLSLTFGELSMDELKHGTISK  693
             G +VDGRTR+                      M  Y GN LS+ FG  ++ EL    +S 
Sbjct  293   GIVVDGRTRLSISSNKGDHNNNNVNKSISCMAMGSYFGNALSIPFGGQNVKELVEKPLSW  352

Query  692   IASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGE  513
             +A+ VH  +  A   +HFL LIDW+E HRP   L+K+       G A VVSSG+RFPV +
Sbjct  353   VATQVHDFLENAVTKDHFLGLIDWVEAHRPDPALAKIYCTPSSDGPAFVVSSGQRFPVSK  412

Query  512   LEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQ  333
             ++FG+G P  G+          GYV   PS  G+  W +   L    +  +E+ +  +F+
Sbjct  413   VDFGWGKPAFGSYHFPWGG-DAGYVMPMPSPAGNSDWVIYMHLSEKQLDLIETQASNVFK  471

Query  332   PIT  324
             P+T
Sbjct  472   PMT  474



>emb|CBI18361.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   247 bits (630),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 160/419 (38%), Positives = 235/419 (56%), Gaps = 32/419 (8%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +++Q L  +Y F G ++ N    EPE+LC+N GV  +EA A+++LK+L+ YN 
Sbjct  1     MVRVLKEAMAQALVPYYAFGGEVLSN-SLGEPELLCNNHGVDFLEAYADVKLKDLDLYNP  59

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVP  +++ G    + +Q+T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  60    DESIE-GKLVP--KKKHG---VLSVQVTELKCGGVVVACTFDHRIADAYSTNMFLVSWAE  113

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLL---SSIML  990
             +A  KP S  P  RR LL PR P  Y+ S+D  ++  S        PPP      +  ++
Sbjct  114   IAQCKPLSVIPSFRRSLLNPRHPGSYDPSIDNMYIPYS------ALPPPRAQQRQADPLI  167

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVN--AVDKSHNK--C  822
              RL+Y+ A  I  LQ LA  +    G+S RRTK+E+ +A++WK++    AV  + NK  C
Sbjct  168   SRLFYVMAEQIILLQTLAISK----GSSYRRTKLESLTAFLWKMVAKSAAVVGNSNKQIC  223

Query  821   KMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIS  663
             KMG +VDGR R+          M+ YIGNVLS+  GE ++ ELK   +S +A  VH  + 
Sbjct  224   KMGIVVDGRQRLSIGDEDKETAMASYIGNVLSIAIGEKTIHELKEKPLSWVADAVHDYLE  283

Query  662   TATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVL  483
              A   E FL LIDW+E HRP   L+K+         A V+SSG+RFPV +++FG+G P L
Sbjct  284   GAATKELFLGLIDWVEAHRPEPALTKIYCSSSSDEPAFVMSSGQRFPVSKVDFGWGRPAL  343

Query  482   GTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             G+          GYV   PS   DG W V   L    +  +E  +  IF+P+ +  L L
Sbjct  344   GSYHFPWGG-ETGYVMPMPSPARDGDWVVYMHLLKGQMDLIEKEAAHIFRPLASEYLKL  401



>ref|XP_010429767.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=456

 Score =   248 bits (633),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 155/406 (38%), Positives = 236/406 (58%), Gaps = 29/406 (7%)
 Frame = -1

Query  1517  IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLN  1338
             ++ LK +L++ L  +Y FAG IV N  T EPEILC+NRGV  VEA A++ L+EL  Y+ +
Sbjct  64    LETLKTALAETLVSYYAFAGEIVTN-TTGEPEILCNNRGVDFVEAGADVELRELNLYDPD  122

Query  1337  KYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSEL  1158
             + +   KLVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   FL +W+E+
Sbjct  123   ESI--AKLVP-IKKHG----VIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEI  175

Query  1157  A-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS---IML  990
             + ++ P SC P  RR LL PR P   ++S+D+ F+  +        PPP  +++   ++ 
Sbjct  176   SRSDVPISCVPSFRRSLLNPRRPLVIDSSIDQIFMPVT------SLPPPQEITNPENLLT  229

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSH----NKC  822
              R+YYI A ++ +LQ LAS  ++G     +RTK+E+FSA++WK++     K H       
Sbjct  230   SRIYYIKADALEELQTLASSSNNG-----KRTKLESFSAFLWKLVAEKTAKDHPVLCKTS  284

Query  821   KMGWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAE  645
             K+G +VDGR R+    ++ Y GNVLS+ FG   +D+L +  +S +A  VH  +  +   E
Sbjct  285   KLGIVVDGRRRLMEQENNTYFGNVLSIPFGGQRIDDLTNKPLSWVAEEVHRFLERSATKE  344

Query  644   HFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCST  465
             HFL+LIDW+E  RP   +S++       G A VVSSGR FPV +++FG+GSPV G+    
Sbjct  345   HFLNLIDWVETRRPTPAVSRIYSVGSDDGPAFVVSSGRSFPVTQVDFGWGSPVFGSYHFP  404

Query  464   IERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                   GYV   PS+  DG W V   L    +  +E  +  +F+PI
Sbjct  405   WGG-SAGYVMPMPSSVDDGDWMVYLHLTKGQLKFIEEKASHVFKPI  449



>ref|XP_009344995.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Pyrus x bretschneideri]
Length=458

 Score =   248 bits (633),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 163/467 (35%), Positives = 251/467 (54%), Gaps = 52/467 (11%)
 Frame = -1

Query  1625  YILTLSNLDLLSGRFPVTYLY-----------------FFRSPNQFHSSSPKIIDNLKAS  1497
             + +T+SN ++++G  P+   +                 FF   N+   S   ++  LK +
Sbjct  6     FKVTMSNQEVVAGALPLQEYWLPLSNLDLLLPPLDVGVFFCYKNKQSMSFGSMVGVLKKA  65

Query  1496  LSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGK  1317
             ++Q L  FY  +G +V N    EPEILC+NRGV   EA A+I LKEL FY+ ++ +E GK
Sbjct  66    MAQALVTFYALSGEVVTN-SDGEPEILCNNRGVDFTEAFADIELKELNFYDPDQSIE-GK  123

Query  1316  LVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPS  1137
             LVP  +++ G    + +Q+T   CGG+ +  TFDH + DA S   FL +W+E+A +K  +
Sbjct  124   LVP--KKKHG---VLAVQVTELNCGGVVVACTFDHRIADAYSTNMFLVSWAEMAQSKSLT  178

Query  1136  CSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS----IMLKRLYYID  969
               P  RR LL PR P   + SL++ +V      I  +  P   L++     ++ R+YYI 
Sbjct  179   IQPTFRRSLLNPRRPGHIDPSLNDMYVP-----ITALPLPSKGLTTDDHDHLISRIYYIT  233

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVN---AVDKSHNKCKMGWLVDG  798
             +  +  LQ LA+          +RTK+E+F A++WK++     + D++   CKMG +VDG
Sbjct  234   SEQLENLQALATS------NGYKRTKLESFCAFLWKMVAKCDTSNDRAQKLCKMGIVVDG  287

Query  797   RTRI---------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAE  645
             RTR+           +M+ Y GNVLS+ FG  ++++L    +S +A  VH  +  A   E
Sbjct  288   RTRLSEGNYQNDHATLMAAYFGNVLSIPFGGENIEDLTEKPLSWVAKEVHDFLECAVTKE  347

Query  644   HFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCST  465
             HFL LIDW+E HRP   L+K+       G A VVSSG+RFP  +++FG+GSPV G+    
Sbjct  348   HFLGLIDWVEAHRPVPYLTKIYDSGSNEGPAFVVSSGQRFPSSKVDFGWGSPVFGSYHFP  407

Query  464   IERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
                   GYV   PS  G+G W V   +    V  +E  +  + +P+T
Sbjct  408   WGG-SAGYVMAMPSPVGNGDWIVYMHMMKGQVELMEKEAAHVLRPLT  453



>ref|XP_002519354.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF43218.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=462

 Score =   248 bits (632),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 157/434 (36%), Positives = 237/434 (55%), Gaps = 31/434 (7%)
 Frame = -1

Query  1577  VTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             V   + +R P     S   ++  LK +++Q L  +Y F+G IV N    EPEI+C+NRGV
Sbjct  47    VGVFFCYRKPLIGDQSFGSMVTVLKKAMAQVLVSYYAFSGEIVGN-SIGEPEIICNNRGV  105

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
               +EA A+  L++L  YN ++ +E GKLVP  +++ G    + +Q T   CGG+ +  TF
Sbjct  106   DFIEASADTELEQLNLYNPDQSIE-GKLVP--KKKNG---VLAVQATELKCGGVVVGCTF  159

Query  1217  DHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDD  1038
             DH + DA S   FL +W+E A +K  S  P  RR LL PR     +  LD  +V  S   
Sbjct  160   DHRIADAYSANMFLVSWAETARSKAISMVPSFRRSLLHPRRLACLDPFLDNMYVPIS---  216

Query  1037  ILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKV  858
                 +  PT  +  ++ R+YY+ +  +++LQKLAS  D       +RTK+E+FSA++W++
Sbjct  217   ----KLQPTKEADHLISRIYYVKSDQLNQLQKLASSTD------CKRTKLESFSAFLWQL  266

Query  857   MVNAVDKSHNK-----CKMGWLVDGRTRI-----PGIMSDYIGNVLSLTFGELSMDELKH  708
             +  +  +          KMG +VDGR R+        M  Y GNVLS+ +G   +DEL  
Sbjct  267   IAKSTKRGQASGKAWVSKMGIVVDGRRRLNIDPLTTQMDAYFGNVLSIPYGGKRVDELTE  326

Query  707   GTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRR  528
              ++S +A+ VH  + +A   EHFL LIDW+E HRP   L+K+       G A VVSSG+R
Sbjct  327   NSLSWVANEVHDFLESAVTKEHFLGLIDWVEAHRPEPGLAKIYSSGSDDGPAFVVSSGQR  386

Query  527   FPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHS  348
             FP+ +++FG+G P+ G+          GYV   PS  G+G W V   L  + V  +E  +
Sbjct  387   FPISKVDFGWGVPIFGSYHFPWGG-SAGYVMPMPSPIGNGDWIVYMHLLKEQVELIEIEA  445

Query  347   ECIFQPITAHDLHL  306
                F+P+T   L+L
Sbjct  446   AHFFRPVTCDYLNL  459



>ref|XP_004971568.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Setaria 
italica]
Length=462

 Score =   247 bits (631),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 156/481 (32%), Positives = 247/481 (51%), Gaps = 34/481 (7%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGL-TPKPYILTLSNLDLLSGRFPVTYLYFFRSP--NQ  1542
             MA+V+  +D  V  ++  +VK     + KP++L +SNLDL+      +    +  P    
Sbjct  1     MASVNGSNDLHVRVVSRRLVKASDDDSIKPHVLAVSNLDLIPQTIQTSMFCIYPRPPTGD  60

Query  1541  FHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLK  1362
             F++    ++   +A L   L+ F+P AGRI  NP +  PE  C N+G  +V  +A + L 
Sbjct  61    FNA----VVAAFEAGLPSFLNHFFPLAGRIATNPSSGLPEFHCHNQGAELVVGEAGVPLA  116

Query  1361  ELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAK  1182
              L+F  +   V R       +Q   +D A+ +Q+  + CGG  + +  +H L D S+ + 
Sbjct  117   SLDFGTMTASVRR------VQQPYCEDMALSVQLVSFACGGFAVAWCTNHVLVDGSALSM  170

Query  1181  FLTTWSELATNKP--PSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
              ++ WSELA +     S  P+H R + RPR  P Y+ S +E F+    +  +N+      
Sbjct  171   LVSAWSELARSGTLCASSRPNHDRSVFRPRATPSYSASFNEAFMPLHAERQVNV----LT  226

Query  1007  LSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN  828
                  ++RLYYI+AS + +L++ AS   DG   S R T+ +A SAY+WK +   V  +  
Sbjct  227   AEQSFVERLYYIEASDVARLREAASR--DG---SERATRFQAVSAYLWKALAGVVGTADA  281

Query  827   KCKMGWLVDGRTRIP------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAI  666
              C+M W VDGR R+         M +YIGNV +    E S+DE++   +  +A+ V  AI
Sbjct  282   HCRMQWWVDGRRRLTDEPELRAAMRNYIGNVTTFAIREASVDEVQRMALPDVAAMVGEAI  341

Query  665   STATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPV  486
             +  +  +HF +L+DW+E  R    +    LG   P   + V++   FP+ + +FGFG   
Sbjct  342   AAPSYGQHFQELVDWVEERRADRYVETASLGLGSP--TVGVTAFTSFPL-DTDFGFGHAA  398

Query  485   LGT-VCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLH  309
             +     S   R+  G+V       GDGSW  SA LWP + AALES   C+F+P+TA  L 
Sbjct  399   MAMPTTSPTARLCSGFVQIAARPDGDGSWISSAFLWPRLAAALESDEPCVFKPVTAEYLG  458

Query  308   L  306
             L
Sbjct  459   L  459



>ref|XP_009126112.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=454

 Score =   246 bits (629),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 165/445 (37%), Positives = 245/445 (55%), Gaps = 36/445 (8%)
 Frame = -1

Query  1634  PKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGR  1455
             P+  I++LSNLDLL     +   +F++ P  +++++    D LK SL++ L  +Y  AG 
Sbjct  30    PENRIISLSNLDLLLPPVDINVCFFYKKP-LYNTTN----DVLKTSLAEALVSYYVLAGE  84

Query  1454  IVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFA  1275
             +V NP T EPEILC+N GV VVEA A++ L+EL  ++   Y   GK VP    +  + FA
Sbjct  85    VVANPITGEPEILCNNSGVEVVEAAADVELRELNLHD--PYQSIGKFVPL---KVHEVFA  139

Query  1274  VQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-TNKPPSCSPDHrrfllrpr  1098
               IQ+T   CG L +  TFDH + DA S   FL +W+E + ++ P S  P   R LL PR
Sbjct  140   --IQLTELRCGSLVVGCTFDHRIADAYSMNMFLLSWAETSRSDVPTSYMPSFNRSLLNPR  197

Query  1097  fppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDG  918
              P   +TS+D+ ++  +    L +    T L +I+  R+YYI A ++ +LQ         
Sbjct  198   RPLIIDTSVDQMYMPVT---SLPLPQETTNLDNILTSRIYYIKAEAVQELQ---------  245

Query  917   IGTSRRRTKIEAFSAYIWKVMVN----AVDKSHNKCKMGWLVDGRTRI-PGIMSDYIGNV  753
               T   RTK+E+FSA++WK++        D      K+G +VDGR ++     S Y GNV
Sbjct  246   --TQAGRTKLESFSAFLWKLVAKHAATTTDSKLLNSKLGIVVDGRKKLTEQETSTYFGNV  303

Query  752   LSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLG  573
             LS+ FGE  +D+L H  +S +A  VH  + ++   +HFL+LIDWIE  RP  +LS++   
Sbjct  304   LSVPFGEQIIDDLTHKPLSWVADEVHKVLESSVTKDHFLNLIDWIETRRPVPVLSRIYGA  363

Query  572   RDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGD---GSW  402
                 G A VVSSG+ FPV  ++FG+GSPV G+    +     GYV   PS   D   G W
Sbjct  364   GSEDGPAFVVSSGKSFPVTRIDFGWGSPVFGSYHLPLGS-RTGYVMTMPSPVVDNSAGDW  422

Query  401   TVSAILWPDMVAALESHSECIFQPI  327
              V   L    +  +E  +  +F+P+
Sbjct  423   IVYLHLEKGQLKFIEQEAPHVFKPV  447



>ref|XP_010087075.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB26130.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=476

 Score =   246 bits (629),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 164/455 (36%), Positives = 235/455 (52%), Gaps = 58/455 (13%)
 Frame = -1

Query  1577  VTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             V + Y    P  F S    ++  LK +L+Q L  FY FAG +V NP   EPE+LC+NRGV
Sbjct  46    VFFCYGVSKPTSFAS----MVGVLKKALAQALVSFYAFAGEVVHNP-DGEPELLCNNRGV  100

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
               +EA A++ L  L  YN +  VE GKLVPA ++ G     + +Q T   CGG+ +  TF
Sbjct  101   DFIEAFADVELCHLNLYNPDDCVE-GKLVPA-KKHG----VLAVQATELKCGGIVVACTF  154

Query  1217  DHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDD  1038
             DH + DA S   FL +W+ ++ +KP S  P  RR LL PR P  ++ SLD+ +V  S   
Sbjct  155   DHRIADAYSANMFLVSWANMSQSKPFSLLPSFRRSLLNPRRPGLFHPSLDDMYVPVS---  211

Query  1037  ILNMRPPPTLLSSI---MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYI  867
                  PPP    S    ++ R+YY+ A  + +LQ L          + +RTK+E+FSA++
Sbjct  212   ---ALPPPKDSPSAADHLISRIYYVKAEQLERLQAL---------CNNKRTKLESFSAFL  259

Query  866   WKVMVN--AVDKSHNKCKMGWLVDGRTRIP--------------------------GIMS  771
             WK++    A+D S   CKMG +VDGR R+                            +M 
Sbjct  260   WKMVAEGAALDGSEKVCKMGIVVDGRRRLSSTVDDEVEEDNGSADKGINVIRSARSALME  319

Query  770   DYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLML  591
              Y GNVLS+ FG   ++EL    +  +A  VH  +  A   EHFL LIDW+E  RP   L
Sbjct  320   SYFGNVLSIPFGGKKVEELVEKPLGWVAGEVHEFLEGAVTKEHFLGLIDWVEARRPVPGL  379

Query  590   SKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGD  411
             +++       G A VVSSG+RFPV +++FG+G PV G+      R   GYV   PS  G+
Sbjct  380   ARIYCRGSEDGPAFVVSSGQRFPVSKIDFGWGKPVFGSYHFPW-RGDAGYVMPMPSPAGN  438

Query  410   GSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             G W V   +    +  +E  +  +F+P     L++
Sbjct  439   GDWVVYMHMPKKQLEVIEKEASHVFRPFKFEYLNI  473



>gb|KFK22998.1| hypothetical protein AALP_AAs66525U000100 [Arabis alpina]
Length=456

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 161/425 (38%), Positives = 238/425 (56%), Gaps = 29/425 (7%)
 Frame = -1

Query  1577  VTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             V+  + ++ P     S  K  + LK +L++ L  +Y FAG IV N  T EPEI+C+NRGV
Sbjct  46    VSVCFCYKKPLNLTISVAK--ETLKTALAETLVSYYAFAGEIVTN-STGEPEIICNNRGV  102

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
               VEA A++ L++L  Y+ ++ +   KLVP  +        + IQ+T+  CG L +  TF
Sbjct  103   DFVEAGADVELRDLNLYDPDESI--AKLVPINKHG-----IIAIQVTQLKCGSLVVGCTF  155

Query  1217  DHALGDASSFAKFLTTWSELA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             DH + DA S   FL +W+E A ++ P SC+P  RR LL PR P   ++S+DE +V  +  
Sbjct  156   DHRIADAYSMNMFLVSWAETARSDVPISCAPSFRRSLLNPRRPVIMDSSIDEMYVPVT--  213

Query  1040  DILNMRPPP---TLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAY  870
                   PPP   T   +I++ R+YYI A ++ +LQ LAS    G     +RTKIE+FSA 
Sbjct  214   ----SLPPPQETTNPDNILVSRIYYIKADALEELQALAS----GSEIKDKRTKIESFSAL  265

Query  869   IWKVMVNAVDKS---HNKCKMGWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGT  702
             +WK++     K        K+G +VDGR R     ++ Y GNVLS+ FG   +++L +  
Sbjct  266   LWKLVAKHAAKDPFPSKNSKLGIVVDGRRRFMEQQTNTYFGNVLSIPFGGQRINDLINKP  325

Query  701   ISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFP  522
             +S + + VH  + ++   +HFL+LIDW+E HRP   LS++       G AIVVSSGR FP
Sbjct  326   LSWVTTEVHKFLESSVTKDHFLNLIDWVEAHRPTPALSRIYCTGADDGPAIVVSSGRSFP  385

Query  521   VGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSEC  342
             V  ++FG+GSPV G+          GYV   PS+  DG W V   L    +  +E  +  
Sbjct  386   VTRVDFGWGSPVFGSYHFPWGG-SAGYVMPMPSSVDDGDWMVYLHLTKGQLKFIEEEASH  444

Query  341   IFQPI  327
             +F+PI
Sbjct  445   VFKPI  449



>ref|XP_011031277.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Populus euphratica]
Length=492

 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 165/444 (37%), Positives = 241/444 (54%), Gaps = 49/444 (11%)
 Frame = -1

Query  1580  PVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRG  1401
             P T  Y FRS          ++  LK +++Q L  +Y FAG +V N    EPE+LC+NRG
Sbjct  72    PATNSYNFRS----------MVGVLKKAMAQVLVSYYAFAGEVVAN-SVGEPELLCNNRG  120

Query  1400  VLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFT  1221
             V   EA A+I L +L  YN +  +E GKLVP  R++ G    + +Q T+  CGGL +  T
Sbjct  121   VDFFEAVADIELMDLNLYNPDDSIE-GKLVP--RKKDG---VLAVQATQLKCGGLVVACT  174

Query  1220  FDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             FDH + DA S   FL +W+E A +KP S  P  RR LL PR P   + SLD  +V  S  
Sbjct  175   FDHRIADAYSANMFLVSWAETAQSKPISLLPSFRRSLLNPRRPSCVDASLDNMYVPVS--  232

Query  1040  DILNMRPP--PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYI  867
                 + PP  P   +  ++ R+YY+ A  +++LQ LAS + +      RRTK+E+FS ++
Sbjct  233   ---TLSPPKEPAPDADQLVSRIYYVKADDLNQLQSLASSKGN------RRTKMESFSGFL  283

Query  866   WKVMVNAV-------DKSHNKCK----MGWLVDGRTRIPG------IMSDYIGNVLSLTF  738
             W+++           D   N CK    MG +VDGRTR+        +M  Y GNVLS+ +
Sbjct  284   WQLVAKYCAIKDDDDDNISNACKKISKMGIVVDGRTRLSSDLERGDVMEAYFGNVLSIPY  343

Query  737   GELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVL-GRDGP  561
             G  ++ EL    +S +A+ VH  +  A + EHFL LIDW+E  RP   ++K+   G D  
Sbjct  344   GSKTVRELIENPLSWVANEVHDFLENAVSKEHFLGLIDWVEARRPEPAVAKIYCGGGDND  403

Query  560   GAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILW  381
             G A+VVSSG+RFPV +++FG+G P+ G+          GYV   P+  G+G W V   L 
Sbjct  404   GPALVVSSGQRFPVSKVDFGWGVPLFGSYHFPWGGTA-GYVMPLPNPAGNGDWMVYMHLL  462

Query  380   PDMVAALESHSECIFQPITAHDLH  309
                +  +E+ +    +P+T + L 
Sbjct  463   RGQLEFIETEASNFLRPLTCNYLR  486



>gb|KEH33678.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=470

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 157/430 (37%), Positives = 232/430 (54%), Gaps = 29/430 (7%)
 Frame = -1

Query  1562  FFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEA  1383
             FF   N    +   ++ +LK +L++ L  +Y FAG +V N    EPE+LC+NRGV  VEA
Sbjct  47    FFCYKNPMILTFESMVVSLKKALAKVLVSYYAFAGEVVSN-SVGEPELLCNNRGVDFVEA  105

Query  1382  QANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALG  1203
              A++ L+ L FYN ++ VE GK VP  +++ G    + IQ T   CGG+ +  TFDH + 
Sbjct  106   VADVELQCLNFYNPDESVE-GKFVP--KKKHG---VLAIQATSLKCGGIVVACTFDHRIA  159

Query  1202  DASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDD----I  1035
             DA S   FL +W+E+A    P   P       +P F     +    +F+  SLDD    I
Sbjct  160   DAYSTNMFLVSWAEMAHPVKP-IKPTTITITNKPCFRRSLLSPRHPSFIHPSLDDMYIPI  218

Query  1034  LNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVM  855
               + PP    +  +L R+YY+ A  +H+LQ L +   +G   + + +K+E+FSAY+WK++
Sbjct  219   SKLPPPSATATKPLLSRIYYVTAEELHRLQSLGASAKNG---TTKPSKLESFSAYLWKLV  275

Query  854   VNAVDKSHNK---CKMGWLVDGRTRIP----------GIMSDYIGNVLSLTFGELSMDEL  714
               AV +  +K    KMG +VDGR RI            +M+ Y GNVLS+ FG  S++EL
Sbjct  276   AKAVTRDGSKMVIAKMGIVVDGRRRIANNSSDEDRGEALMTHYFGNVLSIPFGGKSVEEL  335

Query  713   KHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSG  534
                 +  +   V   +S AT  EHFL LIDW+E HRP   L+K+  G    G A VVSSG
Sbjct  336   VDKPLGWVVDEVREFVSVATTEEHFLGLIDWVEAHRPVPGLAKIYSGGTNEGPAFVVSSG  395

Query  533   RRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALES  354
             +RFP  +++FG+G  V  +          GYV   PS   +G W V   L  + +  +ES
Sbjct  396   QRFPEDKVDFGWGKVVFASYHFPWGG-EAGYVMPMPSPLRNGDWVVYMHLLKEQLDIIES  454

Query  353   HSECIFQPIT  324
              ++ +F P+T
Sbjct  455   EADHVFMPLT  464



>ref|XP_010251800.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=457

 Score =   246 bits (627),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 153/412 (37%), Positives = 232/412 (56%), Gaps = 28/412 (7%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +LS+ L  +YP +G IV N    EP +LC+NRGV  +EA A++ L++++FYN +  +
Sbjct  63    LKKALSEALVSYYPLSGEIVIN-SVGEPMLLCNNRGVDFIEACADVDLQDVQFYNPDSSL  121

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
                 +VP  R+ G     + +Q T   CG + +  TFDH + DA S   FL  W+EL  +
Sbjct  122   --ANIVPE-RKEG----VLCVQATELRCGAILVACTFDHRVVDAHSANMFLVAWAELVQS  174

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLL---SSIMLKRLY  978
             +P S  P   R LL PR P  Y+ S D+ +V+       +M PPPT+    +  ++ R+Y
Sbjct  175   RPISIIPSFTRSLLNPRSPTCYDPSFDDMYVAVPR----SMLPPPTVPKPGADHLISRIY  230

Query  977   YIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDG  798
             Y+ A  I  LQ L++  +      ++R+KIE+FSA++WK++         +CKMG +VDG
Sbjct  231   YVRAQDIDYLQSLSNSNN-----YKKRSKIESFSAFLWKIIAKTSSDDAERCKMGIVVDG  285

Query  797   RTRIP-GI------MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHF  639
             R R+  G+      M +Y GNVLS+ FG+ ++ +LK   +  +A+ VH  +  A   EHF
Sbjct  286   RRRLSNGVEDTTCSMVNYFGNVLSIPFGKKAVGDLKTKPLDWVANVVHDYLKDAVTKEHF  345

Query  638   LDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIE  459
             L LIDW+E HRP   L+ +   +   G A VVSSG+ FPV +++FG+G PV G+      
Sbjct  346   LGLIDWVEEHRPEAALATIYCSKREDGPAFVVSSGQGFPVSKVDFGWGRPVFGSYHFPWN  405

Query  458   RIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
                 GYV   PS+ G+G W V   L    +  LE  +  +F+P+T+  L LS
Sbjct  406   G-EAGYVMPMPSSSGNGDWIVYMHLLKGQLEFLEVEASDVFRPLTSDYLGLS  456



>ref|XP_002270208.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=466

 Score =   246 bits (627),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 160/419 (38%), Positives = 235/419 (56%), Gaps = 32/419 (8%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +++Q L  +Y F G ++ N    EPE+LC+N GV  +EA A+++LK+L+ YN 
Sbjct  66    MVRVLKEAMAQALVPYYAFGGEVLSN-SLGEPELLCNNHGVDFLEAYADVKLKDLDLYNP  124

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVP  +++ G    + +Q+T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  125   DESIE-GKLVP--KKKHG---VLSVQVTELKCGGVVVACTFDHRIADAYSTNMFLVSWAE  178

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLL---SSIML  990
             +A  KP S  P  RR LL PR P  Y+ S+D  ++  S        PPP      +  ++
Sbjct  179   IAQCKPLSVIPSFRRSLLNPRHPGSYDPSIDNMYIPYS------ALPPPRAQQRQADPLI  232

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVN--AVDKSHNK--C  822
              RL+Y+ A  I  LQ LA  +    G+S RRTK+E+ +A++WK++    AV  + NK  C
Sbjct  233   SRLFYVMAEQIILLQTLAISK----GSSYRRTKLESLTAFLWKMVAKSAAVVGNSNKQIC  288

Query  821   KMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIS  663
             KMG +VDGR R+          M+ YIGNVLS+  GE ++ ELK   +S +A  VH  + 
Sbjct  289   KMGIVVDGRQRLSIGDEDKETAMASYIGNVLSIAIGEKTIHELKEKPLSWVADAVHDYLE  348

Query  662   TATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVL  483
              A   E FL LIDW+E HRP   L+K+         A V+SSG+RFPV +++FG+G P L
Sbjct  349   GAATKELFLGLIDWVEAHRPEPALTKIYCSSSSDEPAFVMSSGQRFPVSKVDFGWGRPAL  408

Query  482   GTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             G+          GYV   PS   DG W V   L    +  +E  +  IF+P+ +  L L
Sbjct  409   GSYHFPWGG-ETGYVMPMPSPARDGDWVVYMHLLKGQMDLIEKEAAHIFRPLASEYLKL  466



>ref|XP_009589974.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   246 bits (627),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 179/486 (37%), Positives = 268/486 (55%), Gaps = 43/486 (9%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK----  1521
             DF V+ I   VV    L  + + L  SNLDLL    P+    FF   N   S  PK    
Sbjct  6     DFNVNVIKTEVV-AASLPMQEHWLPQSNLDLLLP--PMDVGVFFCYQNPIISGLPKYSFG  62

Query  1520  -IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYN  1344
              +I  LK SL++ L  +Y FAG +V N    EPEILC+N GV   EA A++ LKE+  YN
Sbjct  63    SMIKVLKVSLAETLVSYYAFAGELVQN-LAGEPEILCNNAGVNFTEAWADVELKEINLYN  121

Query  1343  LNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWS  1164
              ++ +E GKLVP  +++ G    + +Q T   CGG+ +  TFDH + DA S   FL +W+
Sbjct  122   PDESIE-GKLVP--KKKHG---VLAVQATHLKCGGIVVACTFDHRVADAYSTNLFLVSWA  175

Query  1163  ELATNKPPSCSPDHrrfllrprfppRYN-TSLDETFVSCSLDDILNMRPPPTLLSSI---  996
             E+A +KP S  P  RR  L PR P  Y+   +D  ++  S      ++     +++I   
Sbjct  176   EIAQSKPLSQLPSFRRSFLFPRRPSYYDPLVIDSMYIPISA-----LKQETRAVTNIDDN  230

Query  995   --MLKRLYYIDASSIHKLQKLASE-EDDGIGTSRRR-TKIEAFSAYIWKVMVNAVDKS--  834
               ++ R+YY+ A  I +LQ LA+   +D I T   R TK+E FSA++WK + N ++K+  
Sbjct  231   DQVISRIYYVKAEDIIRLQSLANSCNNDMISTKFHRFTKLETFSAFLWKTIANGMEKNST  290

Query  833   --HNKCKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASH  681
               +     G +V+GR+R+         ++  Y GNVLS+ FGE  +++LK   +S +A  
Sbjct  291   PYYENFMFGIVVNGRSRLSDGDKEQAKVLKGYFGNVLSIPFGEKKVEKLKEKPLSWVARA  350

Query  680   VHAAISTATNAEHFLDLIDWIECHRPGLMLSKM-VLGRDGPGAAIVVSSGRRFPVGELEF  504
             VH  +  A   EHFL LI+W+E HRP   L+++     D P  A+VVSSG++FPVG+++F
Sbjct  351   VHEFLEHAETKEHFLGLINWVEDHRPEPALARIYATNEDAP--AVVVSSGQQFPVGKIDF  408

Query  503   GFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             G+G PV G+     E    GYV   PS +G+G W V   +    +  +E+ +  +F+P+T
Sbjct  409   GWGEPVFGSYHFPWEG-KAGYVMPMPSPKGNGDWVVYMHMLKWQLELVEASASNVFKPLT  467

Query  323   AHDLHL  306
             A  L+L
Sbjct  468   ADYLNL  473



>ref|XP_010058993.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Eucalyptus grandis]
Length=487

 Score =   246 bits (627),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 166/439 (38%), Positives = 236/439 (54%), Gaps = 54/439 (12%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             +I  LKA+L+Q L  +Y  AG +V N    EPE+LC+N+GV  +EA A++ L+ L  YN 
Sbjct  68    VIGVLKAALAQALVSYYALAGEVVQN-SAGEPELLCNNQGVDFIEAFADVELRHLNLYNP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  VE GKLVP  ++RG     + +Q T   CGG+ +  TFDH + DA S   F+  W+E
Sbjct  127   DNTVE-GKLVPT-KKRG----VLAVQATELKCGGIVVACTFDHRIADAYSINMFMVFWAE  180

Query  1160  LATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----  996
              A +  P S  P  RR LL PR P  ++ SLD  ++  S      + PPP     +    
Sbjct  181   TARSATPISLPPSFRRSLLNPRHPLYFDPSLDRMYIPVSA-----LPPPPKHKLQVDEQC  235

Query  995   ----------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA  846
                       +L RLYY+ A+ + +LQ+ A           +RTK+E+FSA++W+++  +
Sbjct  236   ETVTLRDDDHLLSRLYYVTAAKLSELQQSA------CSNGSKRTKLESFSAFLWRMVAES  289

Query  845   VDKSHNK-----CKMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGELSMDELKHG  705
                ++N       +MG +VDGR R+        P  MS Y GNVLS+ FGE    E+   
Sbjct  290   SSVANNDDNKTMSRMGIVVDGRCRLMSQGEDDKPTPMSSYFGNVLSVPFGETRAREVVEK  349

Query  704   TISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGP------GAAIVV  543
              +S +A  VH  +  A   EHFLDLIDW+E HRP +  S  +  + G         A+VV
Sbjct  350   PLSWVADVVHEFVERAAKKEHFLDLIDWVEGHRP-VPASARIFCKPGNEEEEEGSTALVV  408

Query  542   SSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAA  363
             SSG+RFPV E++FG+G PVLG+          GYV   PS   +G W V   L    VA 
Sbjct  409   SSGQRFPVTEMDFGWGKPVLGSYHFPWGGKS-GYVMPMPSPLSNGDWVVYLHLSRSQVAF  467

Query  362   LESHSECIFQPITAHDLHL  306
             +ESH+  IF+P+T H L+L
Sbjct  468   IESHAPTIFRPLTPHYLNL  486



>gb|KFK42277.1| hypothetical protein AALP_AA2G235000 [Arabis alpina]
Length=456

 Score =   244 bits (624),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 161/425 (38%), Positives = 237/425 (56%), Gaps = 29/425 (7%)
 Frame = -1

Query  1577  VTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             V+  + ++ P    +S  K  + LK +L++ L  +Y FAG IV N  T EPEILC+NRGV
Sbjct  46    VSVCFCYKKPLNLTNSVAK--ETLKTALAETLVSYYAFAGEIVTN-STGEPEILCNNRGV  102

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
               VEA A++ L++L  Y+ ++ +   KLVP  +        + IQ+T+  C  L +  TF
Sbjct  103   DFVEAGADVELRDLNLYDPDESI--AKLVPINKHG-----IIAIQVTQLKCRSLVVGCTF  155

Query  1217  DHALGDASSFAKFLTTWSELA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             DH + DA S   FL +W+E A ++ P SC P  RR LL PR P   ++S+DE +V  +  
Sbjct  156   DHRIADAYSMNMFLVSWAETARSDVPISCVPSFRRSLLNPRRPLIMDSSIDEMYVPVT--  213

Query  1040  DILNMRPPP---TLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAY  870
                   PPP   T   +I++ R+YYI A ++ +LQ LAS    G     +RTKIE+FSA 
Sbjct  214   ----SLPPPQETTNPDNILVSRIYYIKADALEELQTLAS----GSEIKDKRTKIESFSAL  265

Query  869   IWKVMVNAVDKS---HNKCKMGWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGT  702
             IWK++     K        K+G +VDGR R     ++ Y GNVLS+ FG   +++L +  
Sbjct  266   IWKLVAKHAAKDPFPSKNSKLGIVVDGRRRFMEQQTNTYFGNVLSIPFGGQRINDLINKP  325

Query  701   ISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFP  522
             +S + + VH  + ++   +HFL+LIDW+E HRP   LS++       G A VVSSGR FP
Sbjct  326   LSWVTTEVHKFLESSVTKDHFLNLIDWVEAHRPTPALSRIYCTGADDGPAFVVSSGRSFP  385

Query  521   VGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSEC  342
             V +++FG+GSPV G+          GYV   PS+  DG W V   L    +  +E  +  
Sbjct  386   VSQVDFGWGSPVFGSYHFPWGG-SAGYVMPMPSSVDDGDWMVYLHLTKGQLKFIEEEASH  444

Query  341   IFQPI  327
             +F+PI
Sbjct  445   VFKPI  449



>ref|XP_010417515.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
 ref|XP_010417516.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=456

 Score =   244 bits (624),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 155/405 (38%), Positives = 233/405 (58%), Gaps = 29/405 (7%)
 Frame = -1

Query  1514  DNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
             + LK +L++ L  +Y FAG IV N  T EPEILC+NRGV  VEA A++ L+EL  Y+ ++
Sbjct  65    ETLKTALAETLVSYYAFAGEIVTN-TTGEPEILCNNRGVDFVEASADVELRELNLYDPDE  123

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              +  GKLVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   FL +W+E++
Sbjct  124   SI--GKLVP-IKKHG----VIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEIS  176

Query  1154  -TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP---TLLSSIMLK  987
              ++ P SC P  RR LL PR P   ++S+D+ F+  +        PPP   T   +++  
Sbjct  177   RSDVPISCVPSFRRSLLNPRRPLVIDSSIDQIFMPVT------SLPPPQETTNPENLLTS  230

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSH----NKCK  819
             R+YYI A ++ +LQ LAS   +G     +RTK+E+FSA++WK++     K H       K
Sbjct  231   RIYYIKADALDELQTLASSSKNG-----KRTKLESFSAFLWKLVAEQTAKDHPVPSKTSK  285

Query  818   MGWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEH  642
             +G +VDGR R+    ++ Y GNVLS+ FG   +D+L +  +S +   VH  +  +   EH
Sbjct  286   LGIVVDGRRRLMEQENNTYFGNVLSIPFGGQRIDDLINKPLSWVTDEVHRFLERSATKEH  345

Query  641   FLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTI  462
             FL+LIDW+E  RP   +S++       G A VVSSGR FPV ++++G+GSPV G+     
Sbjct  346   FLNLIDWVETRRPTPSVSRIYSVGSDDGPAFVVSSGRSFPVTQVDYGWGSPVFGSYHFPW  405

Query  461   ERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                  GYV   PS+  DG W V   L    +  +E  +  +F+PI
Sbjct  406   GG-SAGYVMPMPSSVDDGDWMVYLHLTKGQLKFIEEEASHVFKPI  449



>ref|XP_004305787.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=454

 Score =   244 bits (623),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 157/420 (37%), Positives = 239/420 (57%), Gaps = 39/420 (9%)
 Frame = -1

Query  1532  SSPKI----IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRL  1365
             SSP +    +  LK  L+Q L  +Y F+G +V N    EPEILC+NRGV   EA A++ L
Sbjct  52    SSPSVAASRVGVLKKGLAQALVTYYAFSGEVVAN-SVGEPEILCNNRGVDFTEAFADVEL  110

Query  1364  KELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFA  1185
             KEL  +N ++ +E GKLVP  ++ G     + +Q T   CGG+ +  TFDH + DA S  
Sbjct  111   KELNLHNPDESIE-GKLVPN-KKHG----ILAVQATELKCGGMVVACTFDHRIADAYSAN  164

Query  1184  KFLTTWSELATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
              FL +W+++A +K P +  P  RR  L PR P + + SL++ +V      + ++ PPP +
Sbjct  165   MFLVSWAKMANSKSPLTMVPSFRRSFLNPRRPGKIHPSLNDLYVP-----VTSLPPPPKM  219

Query  1007  LSS----IMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMV----  852
              ++     +L R+YY+ A  + KLQ LAS       +  +R+K+ +FSA++WK++     
Sbjct  220   ETNDHEDRLLSRIYYVKAEQLIKLQALASS------SGCKRSKLVSFSAFLWKMVAGSET  273

Query  851   -NAVDKSHNKCKMGWLVDGRTRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIAS  684
              N V++S   CKMG +VDGR+R+     +M+ Y GNVLS+ FG   + EL   +++ +A 
Sbjct  274   GNDVERS---CKMGIIVDGRSRLADENDLMASYFGNVLSIPFGGKKIQELNEKSLNWVAD  330

Query  683   HVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEF  504
              VH  + +A   EHFL LIDW+E HRP   L+K+       G A VVSSG+RFPV E++F
Sbjct  331   EVHEFLESAATKEHFLGLIDWVEAHRPVPGLAKIYCNGSEEGPAFVVSSGQRFPVSEVDF  390

Query  503   GFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             G+G+P+ G+          GYV   PS  G+G W V   +    +  +      +F+P+T
Sbjct  391   GWGAPLFGSYHFPWGG-SSGYVMPMPSPVGNGDWVVYMHMLKGQLDVIGKEGGHVFKPLT  449



>ref|XP_004305788.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   244 bits (622),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/406 (38%), Positives = 234/406 (58%), Gaps = 30/406 (7%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +L+Q L  +Y F+G +V N    EPEILC+NRGV   EA A++ LKEL  +N ++ +
Sbjct  64    LKKALAQALVTYYAFSGEVVAN-SVGEPEILCNNRGVDFTEAFADVELKELNLHNPDESI  122

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E GKLVP  ++ G     + +Q T   CGG+ +  TFDH + DA S    L +W+++A +
Sbjct  123   E-GKLVPN-KKHG----VLAVQATELKCGGMVVACTFDHRIADAYSTNMLLISWAKMANS  176

Query  1148  KPPSCS--PDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS----IMLK  987
             K P  +  P  RR LL PR P + + SL++ +V      + ++ PPP + ++     ++ 
Sbjct  177   KSPLTNKVPSFRRSLLNPRRPGQIHPSLNDMYVP-----VTSLPPPPKMETNGHEDHLIS  231

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNK--CKMG  813
             R+YY+ A  + KLQ LAS          +R+K+E+F A++WK++  +   +  K  CKMG
Sbjct  232   RIYYVAAEQLIKLQALASS------NGCKRSKLESFCAFLWKMVAGSETGNDVKKLCKMG  285

Query  812   WLVDGRTRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEH  642
              +VDGR+R+     +MS Y+GNVLS+ FG   + EL   +++ +A  VH  +  A   EH
Sbjct  286   IVVDGRSRLADGNDLMSSYVGNVLSIPFGGKKIQELNEKSLNWVADEVHEFLECAVTKEH  345

Query  641   FLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTI  462
             FL LIDW+E HRP   L+K+       G A VVSSG+RFPV +++FG+G+PV G+     
Sbjct  346   FLGLIDWVEAHRPVPGLAKIYCNGSKEGPAFVVSSGQRFPVSKVDFGWGAPVFGSYHFPW  405

Query  461   ERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
                  GYV   PS  G+G W V   +    +  +E  +  +F+P+T
Sbjct  406   GG-SSGYVMPMPSPVGNGDWVVYMHMLKGQLDVIEKKAGHVFKPLT  450



>ref|XP_011094024.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Sesamum 
indicum]
Length=447

 Score =   243 bits (620),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 162/418 (39%), Positives = 234/418 (56%), Gaps = 23/418 (6%)
 Frame = -1

Query  1547  NQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIR  1368
             N+   S    +  LK +L+Q L  FYPFAG +V N +  EPE+LC+NRGV    A A++ 
Sbjct  48    NKITESPENAVAVLKKALAQALVSFYPFAGELVQN-RHGEPEMLCNNRGVDFTVAYADVE  106

Query  1367  LKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSF  1188
             LK+++ Y  +  V  GKLVP  +  G     + IQ T   CGGL +  TFDH + DA S 
Sbjct  107   LKDVDLYRPDVSVH-GKLVPV-KMHG----VLSIQATELKCGGLFIGCTFDHRVADAYSA  160

Query  1187  AKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
               FLT W+E+A  KP +  P  RR L  PR PP+ + S+D  +       +L+M P P+ 
Sbjct  161   DMFLTAWAEIARAKPITRLPSFRRSLFNPRRPPQPHKSIDRLYAP-----LLSMPPTPSA  215

Query  1007  LSSIML-KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSH  831
                  L  R+Y + +  I +LQ  AS      GT  +R+KIE+FSA++WK +  A D   
Sbjct  216   DDDDHLTSRIYCVKSDEIDRLQSQASYN----GT--KRSKIESFSAFLWKSLAAACDDRS  269

Query  830   NKCKMGWLVDGRTRIPGIMSD---YIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
                K+G +VDGRTR+ G  +    Y GNVLS+ + E S+ EL+  +++ +A  VH  ++ 
Sbjct  270   KAVKLGIVVDGRTRLSGRTTSLDCYFGNVLSIPYVEASVGELQTTSLTGVADMVHECVAM  329

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLG  480
             A+ AEHFL LIDW+E  RP   + K+    +   AA+VVSSG+RFPV E++FG+G P  G
Sbjct  330   ASTAEHFLALIDWVEVLRPKPAVVKVYCKDENDEAAVVVSSGQRFPVQEVDFGWGRPEFG  389

Query  479   TVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             +          GYV   PSA G+G+W V   L    +  +E+ +  +F+P     L+L
Sbjct  390   SYHFPWGG-ETGYVMPMPSASGNGNWIVYVHLKKKHLDLVEARAPHVFRPFNCEYLNL  446



>ref|XP_010058984.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Eucalyptus grandis]
Length=487

 Score =   244 bits (622),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 167/435 (38%), Positives = 235/435 (54%), Gaps = 54/435 (12%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LKA+L+Q L  +Y  AG +VPN   DEPE+LC+N+GV  +EA A++ L  L  YN +  V
Sbjct  72    LKAALAQALVSYYALAGEVVPN-SADEPELLCNNQGVDFIEAFADVELCHLNLYNPDDTV  130

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E GKLVP  ++RG     + +Q T   CGG+ +  TFDH + DA S   F+  W+E A +
Sbjct  131   E-GKLVPT-KKRG----VLAVQATELKCGGIVVACTFDHRIADAYSINMFMVFWAETARS  184

Query  1148  KPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP--------------  1014
               P S  P  RR LL PR P  ++ SLD  ++  S        PPP              
Sbjct  185   AAPISLPPSFRRSLLNPRHPLCFDPSLDRMYIPVS------ALPPPLKHKLQVDEQCETM  238

Query  1013  TLLSSI-MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA---  846
             TL     +L RLYY+  + + +LQ+ A           +RTK+E+FSA++W+++  +   
Sbjct  239   TLRDDDHLLSRLYYVTNAKLSELQQSA------CSNGSKRTKLESFSAFLWRMVAESSLV  292

Query  845   VDKSHNKC--KMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGELSMDELKHGTIS  696
              D   NK   +MG +VDGR R+        P  MS Y GNVLS+ FGE    E+    +S
Sbjct  293   ADNDDNKTMSRMGIVVDGRCRLMSQGKDDKPTPMSSYFGNVLSVPFGEKRAREVVEKPLS  352

Query  695   KIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMV-----LGRDGPGAAIVVSSGR  531
              +A  VH  + +A   EHFLDLIDW+E HRP   L+++         +    A+VVSSG+
Sbjct  353   WVADVVHEFVESAAKKEHFLDLIDWVEGHRPVPALARIFCKPGSEEEEEGSTALVVSSGQ  412

Query  530   RFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESH  351
             RFPV E++FG+G P+LG+          GYV   PS   +G W V   L    VA +ESH
Sbjct  413   RFPVTEMDFGWGKPMLGSYHFPWGG-KAGYVMPMPSPLSNGDWVVYLHLSRSQVAFIESH  471

Query  350   SECIFQPITAHDLHL  306
             +  +F+P+T H L+L
Sbjct  472   APTVFRPLTPHHLNL  486



>ref|XP_010942972.1| PREDICTED: agmatine coumaroyltransferase-2-like [Elaeis guineensis]
Length=485

 Score =   243 bits (621),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 159/466 (34%), Positives = 248/466 (53%), Gaps = 28/466 (6%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNL  1506
             F+V  I+++++K    T +PY+L  SNLD L    P  ++  +  P      S  +   L
Sbjct  29    FQVKVISKTLIKASDTTIQPYVLHPSNLDHLPSNIPSPFITIYPKPPSGGDYS-SVAAIL  87

Query  1505  KASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVE  1326
             + +L   L+ F+PF GRI P+ +   PE+ C+N G  +V A+A+IRL ++ F++ +K +E
Sbjct  88    RRTLPTFLNYFFPFTGRIRPD-ENGVPEVHCNNEGAELVVARADIRLADVNFHDKSKSLE  146

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK  1146
               +L P   Q       + IQ+  + CGG  + +   H L D    +   T W+E     
Sbjct  147   PIQL-PYDEQ-----IPLSIQVVGFACGGFSIVWGGTHLLSDGHGLSFLPTLWTEYVRTG  200

Query  1145  PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDA  966
               S  P+H R + RPR PP Y+   D +    + DD++N     +L +   +KRLY+++ 
Sbjct  201   QLSRIPNHDRSIFRPRSPPTYSPETDRSLACLTPDDLIN-----SLSAGAFVKRLYHVEG  255

Query  965   SSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI  786
               I +L++LAS E  G       T++EAFSAY+WK +  AV  S   C+M WLVD R R+
Sbjct  256   KHIDRLRELASREGRGA------TRMEAFSAYLWKALATAVGDSDVSCRMAWLVDARQRL  309

Query  785   ----PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAI-STATNAE-HFLDLID  624
                    M DY+GNV++    E  + EL +G+ S++A    AA+   A NAE HF ++ID
Sbjct  310   GPKYAQAMKDYMGNVITFATKEAGVAELVNGSYSQVAGMASAAVKEVADNAEDHFQEMID  369

Query  623   WIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVG  444
             W+E H+ G   +++ +G   P  A+VVSS     +  L+FG G P L        R+G  
Sbjct  370   WVESHKLGKRANRVQVGLGSP--ALVVSSFHHIGL-NLDFGLGQPALAMADLPWGRLGSA  426

Query  443   YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             +V    S +GDGS  ++A +W  +   LES  + +F+P TA DL L
Sbjct  427   FVIVLASPKGDGSLYMNAYIWSQLADVLESDPDRVFKPATAEDLGL  472



>ref|XP_002310897.2| hypothetical protein POPTR_0007s15050g [Populus trichocarpa]
 gb|EEE91347.2| hypothetical protein POPTR_0007s15050g [Populus trichocarpa]
Length=494

 Score =   243 bits (621),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 164/446 (37%), Positives = 241/446 (54%), Gaps = 51/446 (11%)
 Frame = -1

Query  1580  PVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRG  1401
             P T  Y FRS          ++  LK +++Q L  +Y FAG +V N    EPE+LC+NRG
Sbjct  71    PATNSYNFRS----------MVGVLKKAMAQVLVSYYAFAGEVVAN-SVGEPELLCNNRG  119

Query  1400  VLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFT  1221
             V   EA A+I L +L  YN +  +E GKLVP  R++ G    + +Q T+  CGGL +  T
Sbjct  120   VDFFEAVADIELMDLNLYNPDDSIE-GKLVP--RKKNG---VLAVQATQLKCGGLVVACT  173

Query  1220  FDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             FDH + DA S   FL +W+E A +KP S  P  RR LL PR P   + SLD  +V  S  
Sbjct  174   FDHRIADAYSANMFLVSWAETAQSKPISLLPSFRRSLLNPRRPSCVDASLDNMYVPVS--  231

Query  1040  DILNMRPP--PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYI  867
                 + PP  P   +  ++ R+YY+ A  +++LQ LAS + +      +RTK+E+FS ++
Sbjct  232   ---TLSPPKEPAPDADQLVSRIYYVKADDLNQLQSLASSKGN------KRTKMESFSGFL  282

Query  866   WKVMVN---------AVDKSHNKCK----MGWLVDGRTRIPG------IMSDYIGNVLSL  744
             W+++             D  +N CK    MG +VDGRTR+        +M  Y GNVLS+
Sbjct  283   WQLVAKYCAIKDDDDDDDNINNACKKISKMGIVVDGRTRLSSDLERGDVMEAYFGNVLSI  342

Query  743   TFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVL-GRD  567
              +G  ++ EL    +S +A+ VH  +  A   EHFL LIDW+E  RP   ++K+   G D
Sbjct  343   PYGGKTVRELIENPLSWVANEVHDFLENAVTKEHFLGLIDWVEARRPEPAVAKIYCGGGD  402

Query  566   GPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAI  387
               G A VVSSG+RFPV +++FG+G P+ G+          GYV   P+  G+G W V   
Sbjct  403   SDGPAFVVSSGQRFPVSKVDFGWGVPLFGSYHFPWGGTA-GYVMPMPNPAGNGDWMVYMH  461

Query  386   LWPDMVAALESHSECIFQPITAHDLH  309
             L+   +  +E+ +    +P+T + L 
Sbjct  462   LFRGQLEFIETEASNFLRPLTCNYLR  487



>ref|XP_004242867.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Solanum lycopersicum]
Length=468

 Score =   243 bits (619),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 160/418 (38%), Positives = 238/418 (57%), Gaps = 30/418 (7%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             I+  LK SL++ L  +Y F+G IV N    E EILC+N GV  +EA   + LKE+ FYN 
Sbjct  67    IVKILKTSLAETLVSYYAFSGDIVEN-SAGELEILCNNGGVSFIEAFGAVELKEINFYNP  125

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GK VP  +++ G    + IQ+T+  CGG+ +  TFDH + DA S   FL +WSE
Sbjct  126   DESIE-GKFVP--KKKHG---VLAIQVTQLKCGGIIVGCTFDHRVADAYSANLFLVSWSE  179

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSL-----DDILNMRPPPTLLSSI  996
             LA +KP S  P  RR    PR P  Y+ S+D+ +V  S       +ILN  P   ++S  
Sbjct  180   LAQSKPLSQLPSFRRSSFFPRHPGYYDDSIDDLYVPLSTLPPMKSEILN--PNDQVIS--  235

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS---HNK  825
                R+YY+    I  LQ LA+  DD  GTS+R +K+E+FSA++WK +   ++K     N 
Sbjct  236   ---RIYYVTGGKIEHLQSLANCHDDQKGTSQR-SKLESFSAFLWKTIACGINKETWGFNN  291

Query  824   CKMGWLVDGRTR-----IPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
              + G +VDGRTR     +   +  Y GNVLS+ FGE  ++E+K  +++ +A+ +H  +  
Sbjct  292   FRFGIMVDGRTRLIINNVDKSLKGYFGNVLSIPFGEKKVEEVKEKSLNWVANVIHEFLDI  351

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLG  480
             A   EHFL L DW+E HRP   ++K +   +G G A+VVSSG+ FP  ++ FG+G P   
Sbjct  352   AKTQEHFLGLTDWVEAHRPKPSMAK-IYAMNGDGPAVVVSSGQHFPAKKINFGWGEPAFW  410

Query  479   TVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             +          GYV   PS +G+G W V   L    +  +E+    +F+P+TA+ L+L
Sbjct  411   SYHFPWAG-KAGYVMPMPSPKGNGDWIVYMHLLKWQIELIEASPYEVFKPVTANYLNL  467



>ref|XP_004232772.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=458

 Score =   242 bits (618),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 172/476 (36%), Positives = 266/476 (56%), Gaps = 39/476 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPN-----QFHSSSP  1524
             DF V  I   VV  + L  + + L+ SNLDLL     V     +++P        + S  
Sbjct  6     DFNVKLIKTEVVAAM-LPMQEHWLSQSNLDLLLPPVDVGVFLCYQNPIISGILSKNWSFD  64

Query  1523  KIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYN  1344
              +++ LK SL + L  +Y FAG ++ N    EPEILC+N GV  +E+ A++ LKE+ F+N
Sbjct  65    SMVNVLKVSLGETLVSYYAFAGELIQN-LAGEPEILCNNAGVDFIESWADVELKEINFHN  123

Query  1343  LNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWS  1164
              ++ +E GKLVP  +++ G    + +Q+T   CGG+ +  TFDH + DA SF  FL +W+
Sbjct  124   PDESIE-GKLVP--KKKHG---VLAVQVTELKCGGVVVGCTFDHRVADAYSFNMFLVSWA  177

Query  1163  ELATNKPPSCSPDHrrfllrprfppRYNTSLDETF--VSCSLDDILNMRPPPTLLSSIML  990
             ELA +KP S  P  RR  L PR P  Y+  +D  +  +S    +  N+       +  ++
Sbjct  178   ELAQSKPLSQLPSFRRSFLTPRCPSFYDPIIDTMYLPISALKQETANIDHD----ADEII  233

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGW  810
              R+YY+ A  I +LQ LA+  +         TK+EAFSA++WK + +    ++NK ++G 
Sbjct  234   SRIYYVKAEEIRRLQSLANCNNTTF------TKLEAFSAFLWKTIAS---DTNNKFRLGI  284

Query  809   LVDGRTRIPG-------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATN  651
             +V+GR+R+         I+  Y GNVLS+ FGE  ++ELK  ++S +AS VH  +     
Sbjct  285   VVNGRSRLSNGDEEQAKILEGYFGNVLSIPFGEKKVEELKEKSLSWVASAVHEFLEHVVT  344

Query  650   AEHFLDLIDWIECHRPGLMLSKM-VLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTV  474
              EHFL LI+W+E HRP   L+++     D P  A+VVSSG++FPV ++EFG+G  V G+ 
Sbjct  345   REHFLGLINWVENHRPEPALARIYATNEDTP--ALVVSSGQQFPVRKIEFGWGEAVFGSY  402

Query  473   CSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
                 E    GYV   PS +G+G W V   +    +  +E+ +  +F+P+TA  L L
Sbjct  403   HFPWEGKS-GYVMPMPSPKGNGDWIVYMHMLKGQIDLIEAIASNVFKPLTADYLSL  457



>ref|XP_003617368.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AET00327.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=471

 Score =   243 bits (619),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 166/469 (35%), Positives = 258/469 (55%), Gaps = 35/469 (7%)
 Frame = -1

Query  1670  ITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLS  1491
             +T   +    L  + + L LSNLDL+     V   + +++P    ++   I+  LK SL+
Sbjct  12    VTNKEIVAAALPMQEHWLPLSNLDLILPPVDVGVFFCYKNPIITTATHHSIVGCLKNSLT  71

Query  1490  QCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLV  1311
             + L  +Y FAG ++ N    EPE+LC+NRGV  VEA A++ L+ L  YN ++ VE GKLV
Sbjct  72    EALVSYYAFAGEVMTN-SMGEPELLCNNRGVDFVEAFADVELQSLNLYNPDETVE-GKLV  129

Query  1310  PAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA---TNKP-  1143
             P  +++ G    + +Q T   CGGL +  TFDH + DA S   FL +W+E+A    NK  
Sbjct  130   P--KKKHG---VLAVQATWMKCGGLVVACTFDHRIADAYSANMFLVSWAEIARPNDNKSL  184

Query  1142  -PSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----MLKRLY  978
              P+  P  RR LL PR PP  + S+ + +V  S     ++ PPP   S I    ++ R+Y
Sbjct  185   IPTTQPCFRRSLLTPRRPPSIHPSIYDMYVPIS-----DLPPPPEPESDIKTDPIISRIY  239

Query  977   YIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA--VDKSHNKCKMGWLV  804
             Y+ +  ++ +Q LA+  ++G   S +R+K+E+FSA++WK++  A  ++  +   KMG +V
Sbjct  240   YVTSKELNNMQSLANSNNNG--GSSKRSKLESFSAFLWKMVAEAASINNENIVAKMGLVV  297

Query  803   DGRTRIPG-------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAE  645
             DGR R+         +M+ Y GNVLS+ +G    +EL    +  +A  VH  +  A   E
Sbjct  298   DGRKRLSNGDKNKEELMNSYFGNVLSIPYGGRLAEELVDNPLCWVADRVHEFLEAAVTEE  357

Query  644   HFLDLIDWIECHRPGLMLSKMVLGRDG--PGAAIVVSSGRRFPVGELEFGFGSPVLGTVC  471
             HFL LIDW+E HRP   L+++  G  G   G   VVSSG+RFP  +++FG+G PV G+  
Sbjct  358   HFLGLIDWVEEHRPVPGLARIYCGSTGGEEGPTFVVSSGQRFPESKVDFGWGKPVFGSYH  417

Query  470   STIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
                     GYV   PS + +G W +   L    +  +E+ +   F+PI+
Sbjct  418   FPWGG-SAGYVMPMPSPKRNGDWLLYMHLPKGHLHFMEAQAPHFFRPIS  465



>ref|XP_010539596.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Tarenaya hassleriana]
Length=459

 Score =   242 bits (617),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 166/479 (35%), Positives = 257/479 (54%), Gaps = 35/479 (7%)
 Frame = -1

Query  1706  AVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSS  1527
             A +    F V  + + VV T  L  + + L LSNLD L     V+  + ++ PN   +SS
Sbjct  4     AAEESRAFHVTTVRKDVV-TALLPLQEHWLALSNLDPLLPPLAVSVCFCYKKPNSL-TSS  61

Query  1526  PKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFY  1347
               I + LK +L++ L  +Y FAG +V N  T EPE+LC+NRGV  V+  A++ L+EL  Y
Sbjct  62    LAINNTLKKALAEVLVTYYAFAGEVVTN-STGEPELLCNNRGVDFVDGFADVALRELNLY  120

Query  1346  NLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTW  1167
             + ++ +   K VP  + + G    + IQ+T   CG + +  TFDH + DA S   F  +W
Sbjct  121   DPDESI--AKFVP--KNKHG---VISIQVTELKCGSIVVGSTFDHRIADAYSANMFFVSW  173

Query  1166  SELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP--TLLSSIM  993
             ++++ ++P S  P  RR LL PR P   ++S+D  ++  S        PPP  T    ++
Sbjct  174   AQMSRSEPISLVPSFRRSLLNPRRPLLIDSSIDLMYMPVS------SLPPPQETCGQDVL  227

Query  992   LKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNK--CK  819
               R+YYI +  +++LQ LAS          R TK+E+FSA +WK++     K   K   K
Sbjct  228   TSRIYYIKSDVMNQLQALASS------NGFRCTKLESFSALLWKLVAKHARKYPRKITSK  281

Query  818   MGWLVDGRTRIPGIMSD--------YIGNVLSLTFGELSMDELKHGTISKIASHVHAAIS  663
             +G +VDGR R+    +D        Y GNVLS+ FG   +D+L   ++S +AS +H  ++
Sbjct  282   LGIVVDGRRRLADQETDKKESNMKTYFGNVLSIPFGGRRVDDLMEKSLSWVASEIHEFLN  341

Query  662   TATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVL  483
              A   +HFL+LIDW+E  RP   +S++       G A+VVSSG  FPV +++FG+G PV 
Sbjct  342   GAITKDHFLNLIDWVETQRPKPAVSRIYSTGSDDGPAVVVSSGTGFPVNKVDFGWGPPVF  401

Query  482   GTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             G+          GYV   PSA G+G W V   L    +  +E  +  +F+P+ +  L +
Sbjct  402   GSYHFPWGG-SAGYVMPMPSAAGNGDWVVYLHLTQGQLKFIEEEASHVFKPLNSDYLKI  459



>ref|XP_004305786.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=454

 Score =   242 bits (617),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 157/408 (38%), Positives = 230/408 (56%), Gaps = 36/408 (9%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +L+Q L  +Y F+G +V N    EPEILC+NRGV  VEA A++ LKEL  YN ++ +
Sbjct  65    LKKALTQALVAYYAFSGEVVTN-SFGEPEILCNNRGVGFVEAFADVELKELNLYNPDESI  123

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E GK VP  ++RG     + +Q T   CGG+ +  TFDH + DA S   FL +W+++A +
Sbjct  124   E-GKFVPN-KKRG----VLAVQATELKCGGMVVACTFDHRVADAYSANMFLVSWAKMANS  177

Query  1148  KPPSCS--PDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS----IMLK  987
             K P     P  RR LL PR P + + SL++ +V       +   PPP + ++     +  
Sbjct  178   KSPVPEDVPSFRRSLLNPRRPCQIHPSLNDMYVP------VTSLPPPKMETNDHEDQLAN  231

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMV-----NAVDKSHNKC  822
             R+YY+ A  + KLQ LAS          +R+K+E+F A++WK++      N V+K    C
Sbjct  232   RIYYVKAEQLIKLQALASS------NGCKRSKLESFCAFLWKMVAGSETGNDVEK---LC  282

Query  821   KMGWLVDGRTRIP--GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNA  648
             KMG +VDGR+R+     M+ Y GNVLS+ FG   + EL   +++ +A  VH  +  A   
Sbjct  283   KMGIVVDGRSRLADENKMASYFGNVLSIPFGGKVIQELNEKSLNWVADEVHEFLECAVTK  342

Query  647   EHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCS  468
             EHFL LIDW+E HRP   L+K+       G A VVSSG+RFPV E++FG+G+P+ G+   
Sbjct  343   EHFLGLIDWVEAHRPVPGLAKIYCSGSEEGPAFVVSSGQRFPVSEVDFGWGAPLFGSYHF  402

Query  467   TIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
                    GYV   PS  G+G W V   +    +  +E     +F+P+T
Sbjct  403   PWGG-SSGYVMPMPSPVGNGDWVVYMHMLKGQLDVIEKEGGHVFKPLT  449



>ref|XP_006471641.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=232

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 170/228 (75%), Gaps = 14/228 (6%)
 Frame = -1

Query  1664  ESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQC  1485
             +S+VK +G  P+P+ L LSNLDLLSGRFPVTY YF+R P  F  + P II  L+ SL++ 
Sbjct  19    KSIVKAMGPLPEPHTLQLSNLDLLSGRFPVTYFYFYRRP--FGKNYPLIIQTLRISLAKT  76

Query  1484  LSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPA  1305
             L+ +YPFAGRI+ NP+T+EPEI+CDN G LV+EA+ANI L   +FYNLN+ ++ GKLV  
Sbjct  77    LNFYYPFAGRIIQNPQTNEPEIICDNNGALVLEAEANIPLVNHDFYNLNESLQ-GKLVSI  135

Query  1304  FRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPD  1125
                    DF +QIQ+T YTCGG+ +TF+FDHALGDASSF KFL +WSE+A  KP +CSPD
Sbjct  136   -----QPDFPLQIQVTSYTCGGISITFSFDHALGDASSFGKFLVSWSEIAQQKPITCSPD  190

Query  1124  HrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
               R  LR RFPP Y+ SLD+TFV C++++I N+   P+  ++I+LKRL
Sbjct  191   -LRRNLRARFPPSYHPSLDQTFVKCTIEEISNI---PS--TNILLKRL  232



>ref|XP_003617366.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AET00325.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=471

 Score =   242 bits (618),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 166/469 (35%), Positives = 256/469 (55%), Gaps = 35/469 (7%)
 Frame = -1

Query  1670  ITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLS  1491
             +T   +    L  + + L LSNLDL+     V   + +++P    ++   I+  LK SL+
Sbjct  12    VTNKEIVAAALPMQEHWLPLSNLDLILPPVDVGVFFCYKNPIITTATHHSIVGCLKNSLT  71

Query  1490  QCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLV  1311
             + L  +Y FAG ++ N    EPE+LC+NRGV  VEA A++ L+ L  YN ++ VE GKLV
Sbjct  72    EALVSYYAFAGEVMTN-SMGEPELLCNNRGVDFVEAFADVELQSLNLYNPDETVE-GKLV  129

Query  1310  PAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA---TNKP-  1143
             P  +++ G    +  Q T   CGGL +  TFDH + DA S   FL +W+E+A    NK  
Sbjct  130   P--KKKHG---VLAAQTTWMKCGGLVVACTFDHRIADAYSANMFLVSWAEIARPNNNKSL  184

Query  1142  -PSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----MLKRLY  978
              P+  P  RR L+ PR PP  + SL + +V  S     +M PPP L S      ++ R+Y
Sbjct  185   IPTMQPCFRRSLMTPRRPPSIHPSLYDMYVPIS-----DMPPPPQLESDQKTDPIISRIY  239

Query  977   YIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA--VDKSHNKCKMGWLV  804
             Y+ +  ++ +Q LA+  ++G   S +R+K+E+FSA++WK++  A  ++  +   KMG +V
Sbjct  240   YVTSKELNNMQSLANSNNNG--GSSKRSKLESFSAFLWKMVAEAASINNENIVAKMGLVV  297

Query  803   DGRTRIPG-------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAE  645
             DGR R+         +M+ Y GNVLS+ +G    +EL    +  +A  VH  +  A   E
Sbjct  298   DGRKRLSNGDKNKEELMNSYFGNVLSIPYGGRLAEELVDNPLCWVADRVHEFLEAAVTEE  357

Query  644   HFLDLIDWIECHRPGLMLSKMVLGRDG--PGAAIVVSSGRRFPVGELEFGFGSPVLGTVC  471
             HFL LIDW+E HRP   L+++  G  G   G   VVSSG+RFP  +++FG+G PV G+  
Sbjct  358   HFLGLIDWVEEHRPVPGLARIYCGSTGGEEGPTFVVSSGQRFPESKVDFGWGKPVFGSYH  417

Query  470   STIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
                     GYV   PS + +G W +   L    +  +E  +   F+P++
Sbjct  418   FPWGG-SAGYVMPMPSPKRNGDWLLYMHLPKGHLHFMEVQAPHFFRPVS  465



>ref|XP_009348540.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=466

 Score =   242 bits (618),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 155/430 (36%), Positives = 231/430 (54%), Gaps = 37/430 (9%)
 Frame = -1

Query  1562  FFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEA  1383
             FF   N+   S   ++  LK +++Q L  FY F+G +VPN    EPEILC+NRGV   EA
Sbjct  44    FFCYNNKQSMSFGSMVGVLKKAMAQALVTFYAFSGEVVPN-SVGEPEILCNNRGVDFAEA  102

Query  1382  QANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALG  1203
              A++ LKEL  Y+ ++ +E GKLVP   Q       + +Q T   CGG+ +  TFDH + 
Sbjct  103   FADVELKELNLYDPDESIE-GKLVPNKNQG-----ILAVQATELKCGGIVVACTFDHRIA  156

Query  1202  DASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMR  1023
             DA S   FL +W+E+A +K  +  P  RR LL PR P   + SL+  +V  +        
Sbjct  157   DAYSTNMFLVSWAEMAQSKSLTIHPTFRRSLLNPRRPGHIDPSLNNMYVPVT------AL  210

Query  1022  PPPTLLSSI-----MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKV  858
             PPP+  S+      ++ R+YY+ A  +   + LA+          +RTK+E F A++WK+
Sbjct  211   PPPSKGSTTDDHDHLISRIYYVTAEQLKNFKDLATS------NGCKRTKLECFCAFLWKM  264

Query  857   MVNAV---DKSHNKCKMGWLVDGRTRI---------PGIMSDYIGNVLSLTFGELSMDEL  714
             +  +    D++   CKMG +VDGR R+           +M+ Y GNVLS+ FG   +++L
Sbjct  265   VAKSETSNDRAQKICKMGIVVDGRRRLRDRNYQNDHSTLMATYFGNVLSIPFGGEKVEDL  324

Query  713   KHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSG  534
                 ++ +A  VH  +  A   EHFL LIDW+E HRP   L+K+       G A VVSSG
Sbjct  325   TKKPLNWVAEEVHNFLECAVTKEHFLGLIDWVEAHRPVPGLAKIYGCGSDEGPAFVVSSG  384

Query  533   RRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALES  354
             +RFPV +++FG+GSPV G+          GYV   PS  G+G W V   +    +  +E 
Sbjct  385   QRFPVSKVDFGWGSPVFGSYHFPWGG-NAGYVMPMPSPVGNGDWIVYMHMLKGQIELIEK  443

Query  353   HSECIFQPIT  324
              +  + +P+T
Sbjct  444   EAAHVLKPLT  453



>ref|XP_004491310.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cicer 
arietinum]
Length=477

 Score =   242 bits (618),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 258/476 (54%), Gaps = 36/476 (8%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNL  1506
             F V+   E VV  + L  + + L LSNLDL+     V   + +  P    S++  I+  L
Sbjct  10    FTVNVTNEEVVSAM-LPMQEHWLPLSNLDLILPPVDVGVFFCYNKPMISISTTHNIVGCL  68

Query  1505  KASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVE  1326
             K SL+Q L  +Y F G +V N    EPE+LC+NRGV  VEA A++ L+ L  YN ++ +E
Sbjct  69    KNSLAQSLVSYYAFGGEVVTN-SIGEPELLCNNRGVDFVEAVADVDLQSLNLYNPDETIE  127

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA--T  1152
              GKLVP  +++ G    + +Q+T   CGGL +  TFDH + DA S   FL +W+E+A   
Sbjct  128   -GKLVP--KKKHG---VLAVQVTWMRCGGLVVACTFDHRIADAYSTNMFLVSWAEIARPN  181

Query  1151  NKP--PSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPT------LLSSI  996
             NKP  P+  P  RR LL PR P   + SL + +V      I ++ PPP       + +  
Sbjct  182   NKPMSPTTQPCFRRSLLTPRRPSSIHPSLYDMYVP-----ITDLPPPPDPKFKSDIQTDQ  236

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRR-RTKIEAFSAYIWKVMVNA--VDKSHNK  825
             ++ R+YY+    ++ +Q LA+     +   ++  +K+E+FSA++WK++  A  +D  +  
Sbjct  237   IISRIYYVTNEQLNNMQSLANSNKTNLDPLQQLHSKLESFSAFLWKMVAEAASIDNKNVI  296

Query  824   CKMGWLVDGRTRIPG-------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAI  666
              K+G +VDGR R+         IMS Y GNV+S+ +G  S +EL    ++ +A  VH  +
Sbjct  297   AKIGIVVDGRKRLSNGDKNKEEIMSSYFGNVISIPYGGRSTEELVEKPLNWVADQVHEFL  356

Query  665   STATNAEHFLDLIDWIECHRPGLMLSKMVLGRDG--PGAAIVVSSGRRFPVGELEFGFGS  492
              T    EHFL LIDW+E HRP   L+++  G      G   VVSSG+RFP  +++FG+G 
Sbjct  357   ETTMTEEHFLGLIDWVEEHRPIPGLARIYCGSTSGEEGPTFVVSSGQRFPESKIDFGWGK  416

Query  491   PVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             P+ G+          GYV   PS + +G W +   L    +  +E H+   F+P++
Sbjct  417   PLFGSYHFPWGG-DAGYVMPMPSPKRNGDWLLYMHLPKGYLHFMEFHAPHFFKPMS  471



>ref|XP_006301720.1| hypothetical protein CARUB_v10022178mg [Capsella rubella]
 gb|EOA34618.1| hypothetical protein CARUB_v10022178mg [Capsella rubella]
Length=456

 Score =   240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 153/404 (38%), Positives = 231/404 (57%), Gaps = 27/404 (7%)
 Frame = -1

Query  1514  DNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
             D LK +L++ L  +Y F+G IV NP T EPEILC+NRGV  VEA A++ L+EL  Y+ ++
Sbjct  65    DTLKTALAETLVSYYAFSGEIVTNP-TGEPEILCNNRGVDFVEADADVELRELNLYDPDE  123

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              +   KLVP  ++ G     + IQ+T+  CG + +  TFDH   DA S   FL +W+E++
Sbjct  124   SI--AKLVP-IKKHG----VIAIQVTQLKCGSIVVGCTFDHRGADAYSMNMFLLSWAEIS  176

Query  1154  -TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP---TLLSSIMLK  987
              ++ P SC P  RR LL PR P   ++++D+ ++  +        PPP   T   +I+  
Sbjct  177   RSDVPISCVPSFRRSLLNPRRPLIVDSTIDQIYMPVT------SLPPPKETTNPENILAS  230

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS---HNKCKM  816
             R+YYI A ++ +LQ LAS   +G     +RTK+E+FSA++WK++     K        K+
Sbjct  231   RIYYIKADALEELQTLASSSKNG----NKRTKLESFSAFLWKLVAEHTAKDPVPSKTSKL  286

Query  815   GWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHF  639
             G +VDGR R+    ++ Y GNVLS+ FG   +D+L +  +S +   VH  +  +   EHF
Sbjct  287   GIVVDGRRRLMEQENNTYFGNVLSVPFGGQRVDDLINKPLSWVTEEVHRFLERSVTKEHF  346

Query  638   LDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIE  459
             L+LIDW+E  RP   +S++       G A VVSSGR FPV +++FG+GSPV G+      
Sbjct  347   LNLIDWVETRRPTPAVSRIYSVGSDDGPAFVVSSGRSFPVNKVDFGWGSPVFGSYHFPWG  406

Query  458   RIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                 GYV   PS+  +G W V   L    +  +E  +  +F+PI
Sbjct  407   G-SAGYVMPMPSSLDNGDWMVYLHLTKGQLKFIEEEASHVFKPI  449



>ref|XP_010539595.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Tarenaya 
hassleriana]
Length=457

 Score =   240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 154/419 (37%), Positives = 230/419 (55%), Gaps = 33/419 (8%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             I   LK +L++ L  FY FAG +V +P   EPE+LC+NRGV  VE  A++ L+EL FY+ 
Sbjct  56    IAKTLKEALAEALVTFYAFAGEVVTSP-AGEPELLCNNRGVDFVEGFADMALRELNFYDP  114

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +     VP  ++RG     + +Q+T   CG + +  TFDH + DA S   FL +WS+
Sbjct  115   DESI--AMFVPK-KRRG----VISVQVTELKCGSIAVGLTFDHRVADAYSTNMFLVSWSQ  167

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLL---SSIML  990
             ++ ++P S  P  RR LL PR P   ++S+D  F+       L   PPP         + 
Sbjct  168   ISRSEPISLVPSFRRSLLNPRRPLLVDSSIDRLFIP------LTSLPPPQETCDQDHALT  221

Query  989   KRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV--DKSHNKCKM  816
              R+YYI++  +  LQ++AS      G+  RRTKIE+FSA++WK++      D+S    K+
Sbjct  222   SRIYYIESDVLDDLQRMASS-----GSCTRRTKIESFSAFLWKLLAKHAGNDQSTIISKL  276

Query  815   GWLVDGRTRIPG--------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
             G +VDGR R+ G        +M  Y GNVLS+ FG   + +L    +S +A  VH  +  
Sbjct  277   GVVVDGRRRLAGQETGEKENVMETYFGNVLSVPFGGQRISDLIEKPLSWVADEVHEFLKE  336

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLG  480
             AT  +HFL+LIDW+E HRP   ++ +       G A VVSSGR FPV  ++FG+G PV G
Sbjct  337   ATTKDHFLNLIDWVETHRPVPAVAAVYCTGPNEGPAFVVSSGRGFPVTGVDFGWGPPVFG  396

Query  479   TVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
             +          GYV   PS  G+G W V   L    +  +E  +  +F+PI +  L+++
Sbjct  397   SYHFPWGG-RTGYVMPTPSPTGNGDWIVYLHLKKGQLKFVEEEAPHVFKPINSDYLNIN  454



>ref|XP_004303785.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 156/419 (37%), Positives = 238/419 (57%), Gaps = 38/419 (9%)
 Frame = -1

Query  1532  SSPKI----IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRL  1365
             SSP +    +  LK  L+Q L  +Y F+G +V N    EPEILC+NRGV   EA A++ L
Sbjct  52    SSPSVAASRVGVLKKGLAQALVTYYAFSGEVVAN-SVGEPEILCNNRGVDFTEAFADVEL  110

Query  1364  KELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFA  1185
             KEL  +N ++ +E GKLVP  ++ G     + +Q T   CGG+ +  TFDH + DA S  
Sbjct  111   KELNLHNPDESIE-GKLVPN-KKHG----ILAVQATELKCGGMVVACTFDHRIADAYSAN  164

Query  1184  KFLTTWSELATNKPPSC-SPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
              FL +W+++A ++ P    P  RR LL PR P + + SL++ +V      + ++ PPP +
Sbjct  165   MFLVSWAKMANSESPVIIVPSFRRSLLNPRRPGQIHPSLNDLYVP-----VTSLPPPPKM  219

Query  1007  LSS----IMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMV----  852
              ++     +L R+YY+ A  + KLQ LAS       +  +R+K+ +FSA++WK++     
Sbjct  220   ETNDHEDRLLSRIYYVKAEQLIKLQALASS------SGCKRSKLVSFSAFLWKMVAGSET  273

Query  851   -NAVDKSHNKCKMGWLVDGRTRIP--GIMSDYIGNVLSLTFGELSMDELKHGTISKIASH  681
              N V+K    CKMG +VDGR+R+     M+ Y GNVLS+ FG+  + EL   +++ +A  
Sbjct  274   GNDVEK---LCKMGIVVDGRSRLADENKMASYFGNVLSIPFGDKVIQELNEKSLNWVADE  330

Query  680   VHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFG  501
             VH  +  A   EHFL LIDW+E HRP   ++K+       G A VVSSG+R PV E++FG
Sbjct  331   VHEFLECAVTKEHFLGLIDWVEAHRPVPGMAKICCSGSEEGPAFVVSSGQRLPVSEVDFG  390

Query  500   FGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             +G+P+ G+   +      GYV   PS  G+G W V   +    +  +E     +F+P+T
Sbjct  391   WGAPLFGSYHFSWGG-SSGYVMPMPSPVGNGDWVVYMHMLKGQLDVIEKEGGHVFKPLT  448



>gb|KFK42268.1| hypothetical protein AALP_AA2G233500, partial [Arabis alpina]
Length=397

 Score =   238 bits (607),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 155/402 (39%), Positives = 231/402 (57%), Gaps = 23/402 (6%)
 Frame = -1

Query  1514  DNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
             + LK +L++ L  +Y FAG IV NP T EPEILC+NRGV +VEA A++ LK+L  Y+ ++
Sbjct  6     ETLKTALAETLVSYYAFAGEIVTNP-TGEPEILCNNRGVDLVEAGADVDLKDLNLYDPDE  64

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              +   KLVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   FL +W+E+A
Sbjct  65    SI--AKLVP-IKKHG----IIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLVSWAEIA  117

Query  1154  -TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSC-SLDDILNMRPPPTLLSSIMLKRL  981
              ++ P SC P  RR LL PR P   ++SLD  ++   SL  +     P  +L+S    R+
Sbjct  118   RSDVPISCVPSFRRSLLNPRRPLIIDSSLDNMYMPVTSLPPLEETTHPDNILAS----RI  173

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS---HNKCKMGW  810
             YYI A ++ +LQ LAS     +    +RTK+E+FSA +WK++     K        K+G 
Sbjct  174   YYIKADALEELQTLASCSKMKV----QRTKLESFSALLWKLVAKHAAKDPFPSKNSKLGI  229

Query  809   LVDGRTRI-PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLD  633
             +VDGR R+     + Y GNVLS+ FG   +++L +  +S + + VH  + ++    HFL+
Sbjct  230   VVDGRKRLMEQKHNTYFGNVLSIPFGGQRINDLINKPLSWVTTEVHKFLESSVTKVHFLN  289

Query  632   LIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERI  453
             LIDW+E HRP   +S++       G A VVSSGR FPV +++FG+GSPV G+        
Sbjct  290   LIDWVETHRPTPAVSRIYSTGSNDGPAFVVSSGRSFPVTQVDFGWGSPVFGSYHFPWGG-  348

Query  452   GVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
               GYV   PS+  DG W V   L    +  +E  +  +F+PI
Sbjct  349   SAGYVMPMPSSVDDGDWMVYLHLTKGQLKFIEEEASHVFKPI  390



>emb|CDX88496.1| BnaC06g39400D [Brassica napus]
Length=456

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 158/404 (39%), Positives = 233/404 (58%), Gaps = 27/404 (7%)
 Frame = -1

Query  1514  DNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
             + LK +L++ L  +Y FAG IV NP T EPEILC+NRGV  VEA A++ L+EL  Y+ ++
Sbjct  65    ETLKTALAETLVSYYAFAGEIVTNP-TGEPEILCNNRGVDYVEAGADVDLRELNLYDPDE  123

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              + R  LVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   FL +W+E++
Sbjct  124   SIAR--LVP-IKKHG----VIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLISWAEIS  176

Query  1154  -TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP---TLLSSIMLK  987
              ++ P SC P  RR LL PR P   ++S+D+ ++  +        PPP   T   SI+  
Sbjct  177   RSDVPISCVPSFRRSLLNPRRPLIIDSSIDQMYMPVT------SLPPPQETTDPDSILAS  230

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVN--AVDKSHNK-CKM  816
             RLYYI A ++ +LQ LAS    G  T+ +RTK+EAFSA++WK++    A D    K  K+
Sbjct  231   RLYYIKADALDELQTLAS----GSKTTLKRTKLEAFSAFLWKLVAKHAANDPVPTKNSKL  286

Query  815   GWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHF  639
             G +VDGR R+    ++ Y GNVLS+ FG   +D+L +  +S +   VH  + ++   EHF
Sbjct  287   GIVVDGRRRLMEQENNTYFGNVLSIPFGGQKIDDLINKPLSWVTDEVHKFLESSVTKEHF  346

Query  638   LDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIE  459
             L+LIDW+E  RP   +S++       G A VVSSGR FPV ++ FG+GSPV G+      
Sbjct  347   LNLIDWVETRRPIPAVSRIYSTGSDDGPAFVVSSGRGFPVNQVNFGWGSPVFGSYHFPWG  406

Query  458   RIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                 GYV   PS+  D  W V   L    +  +E  +  + +P+
Sbjct  407   G-NAGYVMPMPSSVNDKDWIVYLHLTKGQLKFIEKEASHVLKPV  449



>ref|XP_009799016.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=514

 Score =   241 bits (615),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 175/484 (36%), Positives = 264/484 (55%), Gaps = 41/484 (8%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK-----  1521
             F V  I   VV    L  + + L  SNLDLL    P+    FF   N   S  PK     
Sbjct  47    FNVKVIKTEVV-AASLPMQEHWLPQSNLDLLLP--PMDVGVFFCYQNPIISGMPKYSFGS  103

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK SL++ L  +Y FAG +V N    EPEILC+N GV   EA A+I LKE+  YN 
Sbjct  104   MVKVLKVSLAETLVSYYAFAGELVQN-LAGEPEILCNNAGVNFTEAWADIELKEINLYNP  162

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVP  +  G     + +Q T+  CGG+ +  TFDH + DA S   FL +W+E
Sbjct  163   DESIE-GKLVPK-KNHG----VLAVQATQLKCGGIVVACTFDHRVADAYSTNMFLVSWAE  216

Query  1160  LATNKPPSCSPDHrrfllrprfppRYN-TSLDETFVSCSLDDILNMRPPPTLLSSI----  996
             +A +KP S  P  RR  L PR P  Y+   +D  ++  S      ++     +++I    
Sbjct  217   IAQSKPLSQLPSFRRSFLSPRRPSHYDPLVIDSMYIPISA-----LKQETRAVTNIDDDE  271

Query  995   -MLKRLYYIDASSIHKLQKLASE-EDDGIGTSRRR-TKIEAFSAYIWKVMVNAV----DK  837
              ++ R+YY+ A  I +LQ LA+   +D I T   R TK+E FSA++WK + N +     +
Sbjct  272   QVISRIYYVKAEEISRLQSLANNCNNDMISTKFHRFTKLETFSAFLWKTIANGMGENSTR  331

Query  836   SHNKCKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHV  678
             ++   + G +V+GR+R+         ++  Y GNVLS  FGE  +++LK   +S +A+ V
Sbjct  332   NYENFRFGIVVNGRSRLSDGVEEQAKVLKGYFGNVLSTPFGEKKVEKLKEKPLSWVANAV  391

Query  677   HAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGF  498
             H  +  A   EHFL LI+W+E HRP   L++ +   +    A+VVSSG++FPVG++EFG+
Sbjct  392   HEFLEPAKTKEHFLGLINWVEDHRPEPALAR-IYATNEDAVAVVVSSGQQFPVGKIEFGW  450

Query  497   GSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAH  318
             G PV G+     E    GYV   PS +G+G W V   +    +  +++ +  +F+P+TA 
Sbjct  451   GEPVFGSYHFPWEG-KAGYVMPMPSPKGNGDWVVYMHMLKWQLELVDASAANMFKPLTAD  509

Query  317   DLHL  306
              L+L
Sbjct  510   YLNL  513



>ref|XP_002889224.1| hypothetical protein ARALYDRAFT_316796 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65483.1| hypothetical protein ARALYDRAFT_316796 [Arabidopsis lyrata subsp. 
lyrata]
Length=572

 Score =   242 bits (617),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 155/404 (38%), Positives = 229/404 (57%), Gaps = 28/404 (7%)
 Frame = -1

Query  1514  DNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
             + LK +L++ L  +Y FAG +V NP T EPEILC+NRGV  VEA A++ L+EL  Y+ ++
Sbjct  182   ETLKTALAETLVSYYAFAGEVVTNP-TGEPEILCNNRGVDFVEAGADVELRELNLYDPDE  240

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              +   KLVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   FL +W+E+A
Sbjct  241   SI--AKLVP-IKKHG----VIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEIA  293

Query  1154  -TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP---TLLSSIMLK  987
              ++ P SC P  RR LL PR P   ++S+D+ F+       +   PPP   T   +++  
Sbjct  294   RSDGPISCVPSFRRSLLNPRRPLIVDSSIDQIFMP------VTSLPPPQETTNPENLLAS  347

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS---HNKCKM  816
             R+YYI A ++ +LQ LAS   +      +RTK+E+FSA++WK++     K        K+
Sbjct  348   RIYYIKADALEELQTLASSSKNS-----KRTKLESFSAFLWKLVAEHAAKDPVPSKTSKL  402

Query  815   GWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHF  639
             G +VDGR R+    +  Y GNVLS+ FG   +D+L    +S +   VH  +  +   EHF
Sbjct  403   GIVVDGRRRLMEQENKTYFGNVLSIPFGGQRIDDLISKPLSWVTEEVHRFLERSVTKEHF  462

Query  638   LDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIE  459
             L+LIDW+E  RP   +S++       G A VVSSGR FPV +++FG+GSPV GT      
Sbjct  463   LNLIDWVETRRPTPAVSRIYGDGSDNGPAFVVSSGRSFPVTQVDFGWGSPVFGTYHFPWG  522

Query  458   RIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                 GYV   PSA  DG W V  +L    +  +E  +  + +PI
Sbjct  523   G-SAGYVMPMPSAVEDGDWMVYLLLTKGQLKFIEEEASHVLKPI  565



>ref|XP_010472736.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Camelina sativa]
Length=460

 Score =   239 bits (609),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 155/412 (38%), Positives = 234/412 (57%), Gaps = 39/412 (9%)
 Frame = -1

Query  1514  DNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
             + LK +L++ L  +Y FAG IV N  T EPEILC+NRGV  VEA A++ L+EL  Y+ ++
Sbjct  65    ETLKTALAETLVSYYAFAGEIVTN-TTGEPEILCNNRGVDFVEAGADVELRELNLYDPDE  123

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              +   KLVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   FL +W+E++
Sbjct  124   SI--AKLVP-IKKHG----VIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEIS  176

Query  1154  -TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS---IMLK  987
              ++ P SC P  RR LL PR P   ++S+D+ F+  +        PPP  +++   ++  
Sbjct  177   RSDVPISCVPSFRRSLLNPRRPLVIDSSIDQIFMPVT------SLPPPQEITNPENLLTS  230

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKC-----  822
             R+YYI A ++ +LQ LAS  ++G     +RTK+E+FSA++WK++     K H K      
Sbjct  231   RIYYIKADALEELQTLASSSNNG-----KRTKLESFSAFLWKLVAEKTAKDHPKTAKDHP  285

Query  821   ------KMGWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAIS  663
                   K+G +VDGR R+    ++ Y GNVLS+ FG   +D+L +  +S +A  VH  + 
Sbjct  286   VPCKTSKLGIVVDGRRRLMEQENNTYFGNVLSIPFGGQRIDDLTNKPLSWVAEEVHRFLE  345

Query  662   TATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVL  483
              +   EHFL+LIDW+E  RP   +S++       G A VVSSGR FPV +++FG+GSPV 
Sbjct  346   RSATKEHFLNLIDWVETRRPTPSVSRIYSVGSDDGPAFVVSSGRSFPVTQVDFGWGSPVF  405

Query  482   GTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
             G+          GYV   PS    G W V   L    +  +E  +  +F+PI
Sbjct  406   GSYHFPWGG-SAGYVMPMPSY---GDWMVYLHLTKGQLKFIEEEASHVFKPI  453



>gb|KEH33677.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=474

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 151/426 (35%), Positives = 232/426 (54%), Gaps = 52/426 (12%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++ +LK +L++ L  +Y FAG +V N    EPEILC+NRGV  VEA A++ L+ L FYN 
Sbjct  68    MVVSLKKALAKVLVSYYAFAGEVVSN-SVGEPEILCNNRGVDFVEAVADVELQCLNFYNP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ VE GK VP  +++ G    + IQ T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  127   DESVE-GKFVP--KKKHG---VLAIQATSLNCGGIVVACTFDHRIADAYSTNMFLVSWAE  180

Query  1160  LA----------TNKP----PSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMR  1023
             +A          TN+P       +P H   +         + SLD+ ++  S      + 
Sbjct  181   MAHPTKSKSITMTNEPCFRRSLLNPRHPGSI---------HPSLDDMYIPIS-----ELS  226

Query  1022  PPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV  843
             PP    +  +L R+Y++ +  +++LQ LA   ++G   + + TK+E+FSAY+WK++ N+ 
Sbjct  227   PPSATTAKSLLSRIYFVTSEELYRLQSLADWTNNG---TTKPTKLESFSAYLWKLVANSA  283

Query  842   DKSHNK---CKMGWLVDGRTRI----------PGIMSDYIGNVLSLTFGELSMDELKHGT  702
              +  +K    KMG +VDGR R+            +M+ Y GNVLS+ FG  S++EL    
Sbjct  284   TRGGSKMGIAKMGIVVDGRRRLGNDSSDGDGREAMMTHYFGNVLSIPFGGKSVEELIDKP  343

Query  701   ISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFP  522
             +  +   V   +S AT  EHFL LIDW+E HRP   L+K+  G    G A VVSSG+RFP
Sbjct  344   LGWVVDKVREFVSVATTEEHFLGLIDWVEAHRPVPGLTKIYCGDPNEGPAFVVSSGQRFP  403

Query  521   VGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSEC  342
               +++FG+G  V  +          GYV   PS   +G W V   L  + +  +ES ++ 
Sbjct  404   EDKVDFGWGKVVFASYHFPWGG-ETGYVMPMPSPLRNGDWIVYMHLSKEQLEIIESEADH  462

Query  341   IFQPIT  324
             +F+P+T
Sbjct  463   VFKPLT  468



>ref|XP_002532044.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF30334.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=455

 Score =   238 bits (608),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 155/408 (38%), Positives = 226/408 (55%), Gaps = 25/408 (6%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK ++++ L  +YPFAG +V NP   EPE+LC+NRGV   EA  +  L +L  YN 
Sbjct  61    MVSVLKKAMAEALVLYYPFAGEVVANP-LGEPELLCNNRGVDFSEAFTDAELVDLNLYNP  119

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  ++ GKLVP   ++    FAVQ   T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  120   DVCID-GKLVP---EKKNGVFAVQA--TELKCGGVVVGCTFDHRIADAYSTNMFLVSWAE  173

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI--MLK  987
              A +KP S +P  RR LL PR P   + SLD  ++  SL   L   P    L     ++ 
Sbjct  174   AAQSKPISTTPSLRRSLLNPRRPGHIHPSLDNIYLPISLF-ALPKDPKTNNLDDHDHLIS  232

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNK------  825
             R+YY+ A  + +LQ LAS          +RTK+E+FSA++W+++     K++ K      
Sbjct  233   RIYYVKADELTQLQSLAS------SNGNKRTKLESFSAFLWQLIAQCASKNNTKNGKTKV  286

Query  824   CKMGWLVDGRTRI--PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATN  651
              KMG +VDGR+R+     M  Y GNVLS+ +G + +DEL    +S +A+ VH  + +   
Sbjct  287   SKMGIVVDGRSRLLSDDKMCTYFGNVLSIPYGCMKIDELIEHKLSWVANKVHDFLESEVT  346

Query  650   AEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVC  471
              EHFL LIDW+E HRP   +SK+       G A V+SSG+RFPV E++FG+G P  G+  
Sbjct  347   KEHFLGLIDWVEAHRPEPAVSKIYASYKEDGPAFVISSGQRFPVCEVDFGWGIPAFGSYH  406

Query  470   STIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                     GYV   PS  G+G W +   L+ + +  LE  +   F+P 
Sbjct  407   FPWGG-NTGYVMPMPSPAGNGDWVLYMHLFREQLEFLEIEAASFFKPF  453



>ref|XP_009106615.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
 emb|CDX87417.1| BnaA07g34560D [Brassica napus]
Length=457

 Score =   238 bits (606),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 155/402 (39%), Positives = 230/402 (57%), Gaps = 26/402 (6%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +L++ L  +Y FAG IV NP T EPEILC+NRGV  VEA A++ L+EL  Y+ ++ +
Sbjct  67    LKTALAETLVSYYAFAGEIVTNP-TGEPEILCNNRGVDYVEAGADVDLRELNLYDPDESI  125

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-T  1152
              R  LVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   FL +W+E++ +
Sbjct  126   AR--LVP-IKKHG----VIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLISWAEISRS  178

Query  1151  NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP---TLLSSIMLKRL  981
             + P SC P  RR LL PR P   ++S+D+ ++  +        PPP   T   SI+  RL
Sbjct  179   DVPISCVPSFRRSLLNPRRPLIIDSSIDQMYMPVT------SLPPPQETTDPDSILASRL  232

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS---HNKCKMGW  810
             YYI A ++ +LQ LAS       T  +RTK+EAFSA++WK++     K        K+G 
Sbjct  233   YYIKADALDELQTLASGSKT---TLIKRTKLEAFSAFLWKLVAKHAAKDPVPTKNSKLGI  289

Query  809   LVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLD  633
             +VDGR R+    ++ Y GNVLS+ FG   +D+L + ++S +   VH  + ++   EHFL+
Sbjct  290   VVDGRRRLMTQENNTYFGNVLSIPFGGQKIDDLVNKSLSWVTDEVHNFLESSVTKEHFLN  349

Query  632   LIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERI  453
             LIDW+E  RP   +S++       G A VVSSGR FPV +++FG+GSPV G+        
Sbjct  350   LIDWVETRRPIPAVSRIYSTGSDDGPAFVVSSGRGFPVNQVDFGWGSPVFGSYHFPWGG-  408

Query  452   GVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
               GYV   PS+  D  W V   L    +  +E  +  + +P+
Sbjct  409   NAGYVMPMPSSVDDKDWMVYLHLTKGQLEFIEKEASHVLKPV  450



>ref|XP_008245068.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Prunus 
mume]
Length=460

 Score =   237 bits (605),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 163/472 (35%), Positives = 250/472 (53%), Gaps = 40/472 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             +F+V    + VV    L  + + L LSNLDL     PV    FF   N+   S   ++  
Sbjct  5     EFKVTVSKQEVV-AAALPLQEHWLPLSNLDLPLP--PVDVGVFFCYKNEQRMSFWSMVGV  61

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             L+ +++Q L  FY F+G +VPN    EPEI+C+NRGV   EA A++ LK+L  Y+ ++ +
Sbjct  62    LRKAMAQALVTFYAFSGEVVPN-SVGEPEIMCNNRGVDFFEAFADVELKDLNLYDPDESI  120

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E GKLVP  +++ G    + +Q T   CGG+ +  +FDH + DA S   FL +W+E+A +
Sbjct  121   E-GKLVP--KKKHG---VLAVQATELKCGGMVVACSFDHRIADAYSTNMFLVSWAEMAQS  174

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----MLKRL  981
             K  S  P  RR LL PR P   + SL++ +V       +   PPP   + +    ++ R+
Sbjct  175   KSLSLLPTFRRSLLNPRRPGHIDPSLNDMYVP------ITALPPPKNDTDVDQDHLISRI  228

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDK---SHNKCKMGW  810
             YY+    +  LQ LA           +RTK+E+F A++WK++  +  K   +   CKMG 
Sbjct  229   YYVTVEQLDNLQALAC------SNGFKRTKLESFCAFLWKMVAKSDTKIGYAQKLCKMGI  282

Query  809   LVDGRTRI----------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
             +VDGRTR+             M+ Y GNVLS+ FG   +++L   +++ +A  VH  +  
Sbjct  283   VVDGRTRLSERENYRSHQASHMATYFGNVLSIPFGGEKVEDLVEKSLNWVADEVHDFLKC  342

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLG  480
             A   EHFL LIDW+E H+P   L+K+       G A VVSSG RFPV +++F +G PV G
Sbjct  343   ALTEEHFLGLIDWVEVHKPVPALAKIYYSGSEEGPAFVVSSGLRFPVSKVDFRWGLPVFG  402

Query  479   TVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             +   +      GYV   PS    G W V   ++   +  +E  +  +F+ +T
Sbjct  403   SYHFSWGG-NAGYVMPMPSPARKGDWIVYMHIFKGQLELIEKEAAHVFRRLT  453



>ref|XP_009391475.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=457

 Score =   237 bits (605),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 152/444 (34%), Positives = 237/444 (53%), Gaps = 28/444 (6%)
 Frame = -1

Query  1625  YILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVP  1446
             ++L +SNLDL    F V     +  P         + D L+  L   L  ++PF GRIV 
Sbjct  26    HVLPVSNLDLFPNDFQVALCSIY--PRHTTGDFASVADALRTCLPAFLDHYHPFTGRIVT  83

Query  1445  NPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQI  1266
             NP+T  PE+ C+N G  +V A +++ L  ++F++ +  +   ++V  F      D  + +
Sbjct  84    NPETGLPEVHCNNEGAELVVAYSDVPLAHVDFHDTDGSLN--QIVLPF----AHDVPLSV  137

Query  1265  QITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppR  1086
             Q   + CGG  +++  +H L D  S     T   EL      S  P+H R L  PR P  
Sbjct  138   QAVEFACGGFSISWGTNHLLVDGYSICMLATHLCELVRTGKLSVYPNHDRSLFLPRVPRT  197

Query  1085  YNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTS  906
             Y+ +L  +FV C+ D++ N+     L   + ++RLYYI+A  I +L++ +S+        
Sbjct  198   YSPALARSFVPCTSDNLFNV-----LNCEVNVRRLYYIEAGDIDRLRESSSK------AG  246

Query  905   RRRTKIEAFSAYIWKVMVNAV-DKSHNKCKMGWLVDGRTRIPGI--MSDYIGNVLSLTFG  735
             RR T++EA SAYIWK+    V D     C+M WLV+GR+R+  I  M +YIGN  +    
Sbjct  247   RRATRMEAVSAYIWKLFAGIVEDAGDTCCRMAWLVEGRSRLKEISDMQNYIGNTTTFATK  306

Query  734   ELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECH-RPGLMLSKMVLGRDGPG  558
             E S +EL  G++S+IA  V A+I      EHF +++DW+E H R G  + ++ +G   P 
Sbjct  307   EASTEELGSGSLSQIARVVSASIREVAKKEHFQEMVDWMEEHKREGRWVERVSVGFGSP-  365

Query  557   AAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWP  378
              A+V++S   F V +L+FG G PVL        R+   ++    S +GDGSW VSA++WP
Sbjct  366   -AVVLTSFHNFGV-DLDFGLGRPVLVMPVVPKGRLCSAFLQVVGSPKGDGSWNVSALMWP  423

Query  377   DMVAALESHSECIFQPITAHDLHL  306
              +  ALE   + +F+PIT+  L L
Sbjct  424   KLAKALE--LDGLFKPITSRYLGL  445



>gb|AHA90803.1| cinnamyl alcohol acyltransferase 2 [Larrea tridentata]
Length=463

 Score =   236 bits (603),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 159/449 (35%), Positives = 246/449 (55%), Gaps = 53/449 (12%)
 Frame = -1

Query  1577  VTYLYFFRSPNQFHSSS----PKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCD  1410
             V   + +R+PN   +        ++ +LK +L+Q L  +Y FAG +V N    EP +LC+
Sbjct  43    VGLFFCYRNPNSALTGKKLTLANMVSSLKRALAQALVSYYAFAGELVLN-SVGEPMLLCN  101

Query  1409  NRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCL  1230
              +GV   EA A++ L+EL  YN ++ +E GKLVP  R+ G     + +Q+T+  CGGL +
Sbjct  102   EKGVDFTEAFADVELQELSLYNPDESIE-GKLVPE-RKHG----VLAVQVTQLKCGGLVV  155

Query  1229  TFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSC  1050
               TFDH + DA S   FL +W+E++  +P    P  RR LL PR P   + SL++ +V  
Sbjct  156   GCTFDHRIADAYSANMFLVSWAEISQFQPTLFQPSFRRSLLDPRRPILIDPSLNDMYV--  213

Query  1049  SLDDILNMRPPPTLLSSI---------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRR  897
                       P   LSS          ++ R+YY+ +  I+ +Q +AS    GI    +R
Sbjct  214   ----------PINTLSSAKEEDSDVDHLVSRIYYVTSEQINLMQSIAS--SSGI----KR  257

Query  896   TKIEAFSAYIWKVMVNAV---DKSHNKCKMGWLVDGRTRIPG-------IMSDYIGNVLS  747
             TK+E+FSA++WK++       D  + + ++G +VDGRTR+         +M+ Y GNV+S
Sbjct  258   TKLESFSAFLWKMIAKHAMQSDARNTRTRLGIVVDGRTRLGNGNEEKTKLMATYFGNVIS  317

Query  746   LTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKM--VLG  573
             + FG + + EL    ++ +A  VH  +  A   EHFL LIDW+E H+P   L+K+  V  
Sbjct  318   IPFGSMKVTELIEKPLNCVADEVHDILDVAMTKEHFLGLIDWVEAHKPTPALAKIYCVGF  377

Query  572   RDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVS  393
              DGPG   VVSSG RFPV +++F +G P  G+      R   GYV   PS +G+G W V 
Sbjct  378   EDGPG--FVVSSGLRFPVEKVDFRWGKPAFGSYHFPW-RGNSGYVMPMPSPKGNGDWIVY  434

Query  392   AILWPDMVAALESHSECIFQPITAHDLHL  306
               L  + +  +ES +  +F+P+T++ L L
Sbjct  435   MHLSREQLEFIESEAPAVFRPLTSNYLDL  463



>ref|XP_007146240.1| hypothetical protein PHAVU_006G024000g [Phaseolus vulgaris]
 gb|ESW18234.1| hypothetical protein PHAVU_006G024000g [Phaseolus vulgaris]
Length=474

 Score =   237 bits (604),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 154/419 (37%), Positives = 228/419 (54%), Gaps = 43/419 (10%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++ +LK +L+Q L  +Y FAG +V N   DEPE+LC+NRGV  VEA+A++ LK L FYN 
Sbjct  73    MVGSLKKALAQTLISYYVFAGEVVLN-NMDEPEVLCNNRGVDFVEAEADVELKNLNFYNP  131

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GK VP  +++ G    + +Q T   CGG+ +  TFDH + DA S   FL +W+ 
Sbjct  132   DQSIE-GKFVP--KKKNG---VLAVQATALRCGGIIVGCTFDHRIADAYSANMFLVSWAA  185

Query  1160  LA---TNKPP------SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
             +A   T+KP       SC P  RR LL PR P   + SL   +   S     ++ P PT 
Sbjct  186   MAHPTTSKPTTILAATSCHPCFRRSLLSPRRPGSIHPSLHHLYTPIS-----HLPPAPTT  240

Query  1007  LSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN  828
              +S +L R+YY+ A  +H +Q LA+           RTK+E FSA++WK++  A  +  N
Sbjct  241   AASALLSRIYYVTAEQLHHMQSLAA----------TRTKLECFSAFLWKMVARAASRDRN  290

Query  827   ----KCKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASH  681
                   KMG +V+GR R+         +M  Y GNVLS+ FG   ++EL    +  +   
Sbjct  291   GKRVTAKMGIVVEGRKRLGNGDKESEAMMECYFGNVLSIPFGGKLVEELVKEPLGFVVEA  350

Query  680   VHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFG  501
             VH  ++ A   EHFL LIDW+E  RP   ++++   R   G A VVSSG+RFP  +++FG
Sbjct  351   VHEFLAAAATEEHFLGLIDWVEGQRPIPGVARIYCNRADEGPAFVVSSGQRFPQEKVDFG  410

Query  500   FGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             +G  V  +          GYV   PS  G+G W V   L    +  +E+ +  +F+P+T
Sbjct  411   WGKAVFASYHFPWGG-EAGYVMPMPSPLGNGDWVVYMHLAKKQLHTIETEAAHVFKPLT  468



>gb|EYU33936.1| hypothetical protein MIMGU_mgv1a005884mg [Erythranthe guttata]
Length=466

 Score =   236 bits (601),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 160/403 (40%), Positives = 228/403 (57%), Gaps = 20/403 (5%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK SL+Q L  +YPFAG +V N    EPE+LC+N GV  VEA A++  K+L+FYN +  V
Sbjct  67    LKNSLAQTLVPYYPFAGELVKN-GAGEPELLCNNCGVDFVEASADVEFKDLDFYNPDDTV  125

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
             E GKL+PA R  G     + +Q T+   GGL +  TF H + DA S   FL +W+E A +
Sbjct  126   E-GKLIPA-RNHG----VLAVQATQLKNGGLVVACTFAHQVADAYSANMFLVSWAETAQS  179

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCS---LDDILNMRPPPTLLSSIMLKRLY  978
             KP S  P  RR LL PR P  Y+ S+D+ +V+ S           P      +  + R+Y
Sbjct  180   KPLSRPPSFRRSLLLPRLPGGYHQSVDDMYVNVSSIPPPPPPENHPQDNDRLATAMSRIY  239

Query  977   YIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS-HNKCKMGWLVD  801
             Y+ A  +++LQ  A+ ++ G     RRTK+EAF A+IWK + +  D +  N C++G +VD
Sbjct  240   YMKADQVNQLQAQANVDNSGT----RRTKMEAFCAFIWKTIASGEDSAGDNHCRLGVVVD  295

Query  800   GRTRI---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDL  630
             GR R+      +  Y GNVLS+ FGE  + EL    ++  A  VHA +  A   EHFL L
Sbjct  296   GRNRLIDDGDEIESYFGNVLSIPFGEKKIAELTGKPLNWAAREVHAFLQAAVTREHFLGL  355

Query  629   IDWIECHRPGLMLSKM-VLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERI  453
             IDW+E  RP   +S++     +   AA+VVSSG+RFPV E+++G+G+P  G+        
Sbjct  356   IDWVEERRPEKGVSRIYAAAEEEEEAAVVVSSGQRFPVREMDYGWGNPAFGSYHFPWGGK  415

Query  452   GVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
               GYV   PS  G+G W V   L    +  +ES++  +F PIT
Sbjct  416   S-GYVMPMPSPNGNGDWIVYIHLMKAQLDLIESNAARVFNPIT  457



>ref|XP_010552395.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Tarenaya 
hassleriana]
Length=457

 Score =   235 bits (599),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 170/468 (36%), Positives = 246/468 (53%), Gaps = 30/468 (6%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             DF V  ++++   +  L  + Y L LSNLDL+    PV +  FF   +    +    +  
Sbjct  6     DFLVK-VSKTEAVSAALPVQEYWLPLSNLDLMLP--PVDFCVFF-CYDHVDVTFASTVVT  61

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +L+  L+ +Y FAG I  N    EPE+LC+N GV   EA+A + L +L+ Y L K +
Sbjct  62    LKKALADTLAPYYAFAGEITTN-SLGEPELLCNNYGVEFSEARAYVNLHDLDLYRLEKSI  120

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
              R  L P  ++RG     + +Q T   CG L +T    H + DA S   F  +W+E A +
Sbjct  121   YR--LFPE-KKRG----VMAVQATELNCGSLIVTCRVHHRIADAYSANLFFVSWAESARS  173

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFV---SCSLDDILNMRPPPTLLSSIMLKRLY  978
              P S  P  RR LL  R PP+++ S+DE ++   S S        P  + L    + R++
Sbjct  174   MPISVVPSFRRSLLSSRHPPKHSPSMDELYMPLPSVSSPPKPKRNPDSSDLDEF-VSRVF  232

Query  977   YIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS--HNKCKMGWLV  804
             Y+ AS I ++Q LAS E        R TK+EAF A++WK+      KS    K  +G ++
Sbjct  233   YVAASKIDEIQCLASSE------YSRVTKLEAFCAFLWKLTAKTEQKSGGARKAALGIVI  286

Query  803   DGRTRI--PGI--MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFL  636
             DGRTR+   G+  M  YIGNVL+  F +  M EL    +  +A  VH  I T  + EHF+
Sbjct  287   DGRTRLGDNGVNNMGSYIGNVLTAPFRQCEMAELVRNPLGSVAREVHGVIETGASKEHFM  346

Query  635   DLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIER  456
              LIDWIE  RP  +  K     DGP  A++VSSGRRFPV E++FG+G P LG+   +   
Sbjct  347   GLIDWIEAQRPKPITPKAYWVNDGP--AVMVSSGRRFPVREVDFGWGPPALGSYYFSEWG  404

Query  455   IGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDL  312
               +GYV   PSA  DG W V  +L   ++  +   +  +F+P+T   L
Sbjct  405   SPMGYVMPMPSATVDGDWVVYTVLPRRVIHVITEEAADMFRPMTNQYL  452



>gb|KCW54004.1| hypothetical protein EUGRSUZ_J03198 [Eucalyptus grandis]
Length=487

 Score =   235 bits (599),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 161/438 (37%), Positives = 236/438 (54%), Gaps = 52/438 (12%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +L+Q L  +Y  AG +V N    EPE+LC+NRGV  +EA A+I L  L  YN 
Sbjct  68    MVGILKVALAQALVSYYALAGEVVKN-SVSEPELLCNNRGVDFIEAFADIELCHLNLYNP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVP  ++RG     + +Q T   CGG+ +  TFDH + DA+S   F+  W+E
Sbjct  127   DETIE-GKLVPT-KKRG----VLAVQATELKCGGIVVACTFDHRIADATSANMFMVFWAE  180

Query  1160  LA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----  996
              A ++ P S  P  RR LL PR P   + SLD  +V  S      + PPP          
Sbjct  181   TARSDAPFSLPPCFRRSLLNPRRPLCIDPSLDRMYVPISA-----LPPPPQHKQQAGGEF  235

Query  995   ----------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA  846
                       ++ R+YY+ A+ + +LQ+ AS          +R+K+E+FSA++WK++  +
Sbjct  236   EPTTSREDDRLVSRMYYVTATQLSELQQSAS------SNGGKRSKLESFSAFLWKMVAES  289

Query  845   VDKSHNK-----CKMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGELSMDELKHG  705
                ++N+      +MG +VDGR R+        P  M+ Y GNVLS+ FGE    E+   
Sbjct  290   SLVANNEDNKAISRMGIVVDGRCRLMSQDGDDKPTPMASYFGNVLSIPFGEKRAREVVEK  349

Query  704   TISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMV--LGRDGP---GAAIVVS  540
              +S +A  VH  +  A   EHFLDLIDW+E HRP   ++++   LG +       A VVS
Sbjct  350   PLSWVAEAVHDFVERAATREHFLDLIDWVEGHRPAPGVTRIYCKLGSEEEQEGSTAFVVS  409

Query  539   SGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAAL  360
             SG+RFPV +++FG+G PVLG+          GYV   PS   +G W V   L    VA +
Sbjct  410   SGQRFPVAKMDFGWGKPVLGSYHFPWGG-ETGYVMPMPSPLSNGDWVVYLHLSRSQVAFV  468

Query  359   ESHSECIFQPITAHDLHL  306
             ES +  +F+P+  H LHL
Sbjct  469   ESKAPTVFRPLNPHYLHL  486



>ref|XP_010034102.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW54003.1| hypothetical protein EUGRSUZ_J03197 [Eucalyptus grandis]
Length=487

 Score =   235 bits (599),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 157/438 (36%), Positives = 232/438 (53%), Gaps = 52/438 (12%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LKA+L+Q L  +Y  AG +V N    EPE+LC+NRGV  +EA A+I L+ L  YN 
Sbjct  68    MVGILKAALAQALVSYYALAGEVVQN-SVGEPELLCNNRGVDFIEAFADIELRHLNLYNP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVPA +Q       + +Q T   CGG+ +  TFDH + DA S   FL  W+E
Sbjct  127   DETIE-GKLVPAKKQG-----VLAVQATELKCGGIVVACTFDHRIADAYSANMFLVFWAE  180

Query  1160  LATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----  996
              A +  P S  P  RR LL PR P   + SLD  ++      +  + PPP          
Sbjct  181   TARSAAPISLPPSFRRSLLNPRRPLCVDPSLDSMYIP-----VTALPPPPQQKQKADEEQ  235

Query  995   ----------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA  846
                       ++ R+YY+ A+ + +LQ+ A        +   R+K+EAFSA++WK++  +
Sbjct  236   ETTTSRDDDCLVSRMYYVTAAKLSELQQRA------CSSGSNRSKLEAFSAFLWKMVAES  289

Query  845   VDKSHNK-----CKMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGELSMDELKHG  705
                ++N       +MG +VDGR R+        P  M+ Y GNVLS+ FGE    E+   
Sbjct  290   SSVANNDDNKMMSRMGIVVDGRCRLMSRAVDDKPTPMASYFGNVLSIPFGEKRAMEVVEK  349

Query  704   TISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKM-----VLGRDGPGAAIVVS  540
              +S +A  VH  +      EHFLDLIDW+E HRP   ++++     +   +    A VVS
Sbjct  350   PLSWVAEAVHEFVERGATREHFLDLIDWVEEHRPVPAVARIYCKPGIEEEEEGSTAFVVS  409

Query  539   SGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAAL  360
             SG+RFPV E++FG+G PV+G+          GYV   PS   +G W V   L    VA +
Sbjct  410   SGQRFPVTEMDFGWGKPVVGSYHFPWGG-EAGYVMPMPSPLSNGDWVVYLHLSRSQVAFI  468

Query  359   ESHSECIFQPITAHDLHL  306
             ESH+  +F+P+T   L++
Sbjct  469   ESHAPTLFRPLTPRYLNV  486



>gb|EMT15648.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=461

 Score =   234 bits (597),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 148/471 (31%), Positives = 246/471 (52%), Gaps = 31/471 (7%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFF-RSPNQFHSSSPKIID  1512
             D  +  ++  +VK    + KP++   SNLDL  G    + +  + + PN      P ++ 
Sbjct  11    DLSIRVLSRRLVKASDPSTKPHVAAFSNLDLYPGNEQASIVCLYPKLPNA--GDFPAVVA  68

Query  1511  NLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
                + L   L+ FY FAGRI  NP +  PE+LCDN+G  +V  +A + +  L+ Y L + 
Sbjct  69    TFDSILPSLLNDFYHFAGRIRTNPSSGLPELLCDNQGAELVVGEAGVAMASLD-YGLAEQ  127

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-  1155
               +  ++P       +D  + +Q+  +TCGG  + +  ++ + D  +F  F+  WSELA 
Sbjct  128   SLKKIMLPY-----AEDVTLSVQLLSFTCGGFSVVWATNNLVCDGQAFTMFVRRWSELAR  182

Query  1154  TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYY  975
             T +     P+H R +  PR PP Y  S+ + F +   D ++N+           ++RLYY
Sbjct  183   TGRIVDGPPNHDRSVFSPRRPPSYGASIRDMFATYDHDRLVNV----LTAHDSFVERLYY  238

Query  974   IDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS---HNKCKMGWLV  804
             I+AS I  L++ AS +       +R ++++A SAY+WK +   V  S     +C MGW+V
Sbjct  239   IEASDIAALREAASSK------LQRPSRVQAVSAYLWKALARVVAASRVPEERCCMGWMV  292

Query  803   DGRTRIPG-----IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHF  639
             D R R+        M +Y GNV +   GE +++E++   +S++A+ V   I++    E+ 
Sbjct  293   DARRRVKAPELVRAMGNYFGNVTAYALGEAAVEEIQEKELSEVAAMVRETITSIDYDEYT  352

Query  638   LDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIE  459
              +L+DW+E H+   ++ K V+G   P     V +   FP+ + +FGFG  VL        
Sbjct  353   QELVDWVEEHKTERLMEKGVIGLGTPTLNQTVFAS--FPL-DTDFGFGHAVLAMPMCDYG  409

Query  458   RIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
             R+  GY++      GDGSW V+A +WP + AALES  + IF+P+TA  L L
Sbjct  410   RLSSGYLSIGARPGGDGSWLVNAYIWPRLAAALESDQQRIFKPLTAEYLGL  460



>ref|NP_174567.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AAF31274.1|AC006424_3 Highly similar to YUP8H12R.39 [Arabidopsis thaliana]
 gb|AEE31538.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=464

 Score =   234 bits (597),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 156/434 (36%), Positives = 244/434 (56%), Gaps = 27/434 (6%)
 Frame = -1

Query  1577  VTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             ++  + ++ P  F S    + + LKASL++ L  +Y FAG +V N  + EPEILC+NRGV
Sbjct  46    ISVCFCYKKPRHFLS----VAETLKASLAEALVSYYAFAGELVKN-SSGEPEILCNNRGV  100

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
               +EA A++ L+EL  ++ ++ +   KLVP  +++ G    + IQ+T+  CG + +  TF
Sbjct  101   DFLEAVADVELRELNLHDPDESI--AKLVP--KKKHG---VIAIQVTQLKCGSIVVGCTF  153

Query  1217  DHALGDASSFAKFLTTWSELAT-NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             DH + DA S   FL +W+E++  N P S  P  RR +L PR P   ++S+D+ ++  +  
Sbjct  154   DHRIADAFSMNMFLVSWAEISRFNAPISSVPSFRRSILNPRRPLIIDSSIDKMYMPVTSL  213

Query  1040  DILNMRPPPTL--LSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYI  867
              +    P  T   L +I+  R+YYI  +++  LQ LAS      G  +R TK+E+FSA++
Sbjct  214   PL----PQETTNDLDNILTSRIYYIKENALEDLQTLASGSSPKTGYGQR-TKLESFSAFL  268

Query  866   WKVMVNAVDK---SHNKCKMGWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTI  699
             WK++     +   S+   KMG +VDGR R+     + Y GNVLS+ FG  S+D+L    +
Sbjct  269   WKLVAKHTGRDLVSNKNSKMGIVVDGRRRLMEKEDNTYFGNVLSIPFGGQSIDDLIDKPL  328

Query  698   SKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPV  519
             S + + VH  +  A   EHFL+LIDW+E HRP   +S++       G A VVSSGR FPV
Sbjct  329   SWVTNEVHRFLEEAVTKEHFLNLIDWVEIHRPIPAVSRIYSTGTDDGPAFVVSSGRSFPV  388

Query  518   GELEFGFGSPVLGTVCSTIERIGVGYVNQRPSA--RGDGSWTVSAILWPDMVAALESHSE  345
              +++FG+G PV G+     E    GYV   PS    G+G W V   L    +  +E  + 
Sbjct  389   NKVDFGWGLPVFGSYHFPWEG-SSGYVMPMPSPVDDGNGDWVVYLHLTKGQLKFIEEEAS  447

Query  344   CIFQPITAHDLHLS  303
              + +PI  + L ++
Sbjct  448   HVLKPIDNYYLKIN  461



>ref|XP_010040471.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45195.1| hypothetical protein EUGRSUZ_L01181 [Eucalyptus grandis]
Length=487

 Score =   234 bits (598),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 161/457 (35%), Positives = 239/457 (52%), Gaps = 57/457 (12%)
 Frame = -1

Query  1562  FFRSPNQFHSSSPKI-----IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             FF   N   ++SP++     +  LKA+L+Q L  +Y  AG +V N    EPE+LC+NRGV
Sbjct  49    FFCYANPTTTASPRLGYGSMVGILKAALAQALVSYYALAGEVVQN-LVGEPELLCNNRGV  107

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
               +EA A+I L+ L  YN ++ +E GKLVP  +Q       + +Q T   CGG+ +  TF
Sbjct  108   DFIEAFADIELRHLNLYNPDETIE-GKLVPEKKQG-----VLAVQATELKCGGIVVACTF  161

Query  1217  DHALGDASSFAKFLTTWSELATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             DH + DA S   FL  W+E A +  P S  P  RR LL PR P   + SLD  ++     
Sbjct  162   DHRIADAYSANMFLVFWAETARSAAPISLPPSFRRSLLNPRRPLCVDPSLDSMYIP----  217

Query  1040  DILNMRPPPTLLSSI--------------MLKRLYYIDASSIHKLQKLASEEDDGIGTSR  903
              +  + PPP                    ++ R+YY+ A+ + +LQ+ A        +  
Sbjct  218   -VTALPPPPQQKQKADEEQETTTSRDDDCLVSRMYYVTAAKLSELQQRA------CSSGS  270

Query  902   RRTKIEAFSAYIWKVMVNAVDKSHNK-----CKMGWLVDGRTRI--------PGIMSDYI  762
              R+K+EAFSA++WK++  +   ++N       +MG +VDGR R+        P  M+ Y 
Sbjct  271   NRSKLEAFSAFLWKMVAESSSVANNDDNKMMSRMGIVVDGRCRLMSRAVDDKPTPMASYF  330

Query  761   GNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKM  582
             GNVLS+ FGE    E+    +S +A  VH  +      EHFLDLIDW+E HRP   ++++
Sbjct  331   GNVLSIPFGEKRAMEVVEKPLSWVAEAVHEFVERGATREHFLDLIDWVEEHRPVPAVARI  390

Query  581   -----VLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSAR  417
                  +   +    A VVSSG+RFPV E++FG+G PV+G+          GYV   PS  
Sbjct  391   YCKPGIEEEEEGSTAFVVSSGQRFPVTEMDFGWGKPVVGSYHFPWGG-EAGYVMPMPSPL  449

Query  416   GDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
              +G W V   L    VA +ESH+  +F+P+T   L++
Sbjct  450   SNGDWVVYLHLSRSQVAFIESHAPTLFRPLTPRYLNV  486



>ref|NP_178020.1| HXXXD-type acyl-transferase [Arabidopsis thaliana]
 gb|AEE36189.1| HXXXD-type acyl-transferase [Arabidopsis thaliana]
Length=455

 Score =   234 bits (596),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 152/413 (37%), Positives = 232/413 (56%), Gaps = 28/413 (7%)
 Frame = -1

Query  1541  FHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLK  1362
              H ++    + LK +L++ L  +Y FAG +V NP T EPEILC+NRGV  VEA A++ L+
Sbjct  56    LHFTNTVAYETLKTALAETLVSYYAFAGELVTNP-TGEPEILCNNRGVDFVEAGADVELR  114

Query  1361  ELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAK  1182
             EL  Y+ ++ +   KLVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   
Sbjct  115   ELNLYDPDESI--AKLVP-IKKHG----VIAIQVTQLKCGSIVVGCTFDHRVADAYSMNM  167

Query  1181  FLTTWSELA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP---  1014
             FL +W+E++ ++ P SC P  RR LL PR P   + S+D+ ++  +        PPP   
Sbjct  168   FLLSWAEISRSDVPISCVPSFRRSLLNPRRPLVMDPSIDQIYMPVT------SLPPPQET  221

Query  1013  TLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS  834
             T   +++  R+YYI A+++ +LQ LAS   +G     +RTK+E+FSA++WK++     K 
Sbjct  222   TNPENLLASRIYYIKANALQELQTLASSSKNG-----KRTKLESFSAFLWKLVAEHAAKD  276

Query  833   H---NKCKMGWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAI  666
                    K+G +VDGR R+    ++ Y GNVLS+ FG   +D+L    +S +   VH  +
Sbjct  277   PVPIKTSKLGIVVDGRRRLMEKENNTYFGNVLSVPFGGQRIDDLISKPLSWVTEEVHRFL  336

Query  665   STATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPV  486
               +   EHFL+LIDW+E  RP   +S++       G A VVSSGR FPV +++FG+GSPV
Sbjct  337   KKSVTKEHFLNLIDWVETCRPTPAVSRIYSVGSDDGPAFVVSSGRSFPVNQVDFGWGSPV  396

Query  485   LGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
              G+          GYV   PS+  D  W V   L    +  +E  +  + +PI
Sbjct  397   FGSYHFPWGG-SAGYVMPMPSSVDDRDWMVYLHLTKGQLRFIEEEASHVLKPI  448



>ref|XP_006586058.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Glycine 
max]
Length=478

 Score =   234 bits (597),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 153/422 (36%), Positives = 225/422 (53%), Gaps = 46/422 (11%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++ +LK +L+Q L  +Y FAG +VPN    EPE+LC+NRGV  VEA+A++ LK L FYN 
Sbjct  72    MVRSLKNALAQTLVSYYVFAGEVVPN-NMGEPEVLCNNRGVDFVEAEADVELKCLNFYNP  130

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  +E GK V   +++ G    + +Q T   CGG+ +  TFDH + DA S   FL +W++
Sbjct  131   DDTIE-GKFVT--KKKNG---VLAVQATSLKCGGIIVACTFDHRVADAYSTNMFLVSWAD  184

Query  1160  LATNKPPSCS------------PDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPP  1017
             +A    P+ +            P  RR LL PR P   + SL   +   S      + PP
Sbjct  185   MAQPTKPNNTLVVTVAPTASRHPCFRRSLLSPRRPGSIHPSLHHMYTPIS-----ELPPP  239

Query  1016  PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDK  837
             P++ S+ +L R+YY+ A  +H +Q  A+           RTK+E FSA++WK++  A  K
Sbjct  240   PSIASAALLSRIYYVTAEQLHLMQVFAA----------TRTKLECFSAFLWKMVARAASK  289

Query  836   SHNK----CKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKI  690
               N      KMG +VDGR R+         +M  Y GNVLS+ FG   ++EL    +  +
Sbjct  290   EKNGKRVVAKMGIVVDGRKRLGNGDKESEAMMESYFGNVLSIPFGGKPVEELVEEPLGFL  349

Query  689   ASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGEL  510
             A  VH  ++ AT  EHFL LIDW+E HRP   ++K+       G A VVSSG+RFP  ++
Sbjct  350   AEAVHEFLAAATTEEHFLGLIDWVEAHRPVPGITKIYCNNADDGPAFVVSSGQRFPEDKV  409

Query  509   EFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQP  330
             +FG+G  V  +          GYV   PS   +G W V   L    +  +ES +  +F+P
Sbjct  410   DFGWGKVVFASYHFPWGG-ETGYVMPMPSPLRNGDWIVYMHLAKKQLEIIESEAAHVFKP  468

Query  329   IT  324
             +T
Sbjct  469   LT  470



>ref|XP_010034103.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=530

 Score =   235 bits (599),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 161/438 (37%), Positives = 236/438 (54%), Gaps = 52/438 (12%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +L+Q L  +Y  AG +V N    EPE+LC+NRGV  +EA A+I L  L  YN 
Sbjct  111   MVGILKVALAQALVSYYALAGEVVKN-SVSEPELLCNNRGVDFIEAFADIELCHLNLYNP  169

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVP  ++RG     + +Q T   CGG+ +  TFDH + DA+S   F+  W+E
Sbjct  170   DETIE-GKLVPT-KKRG----VLAVQATELKCGGIVVACTFDHRIADATSANMFMVFWAE  223

Query  1160  LA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----  996
              A ++ P S  P  RR LL PR P   + SLD  +V  S      + PPP          
Sbjct  224   TARSDAPFSLPPCFRRSLLNPRRPLCIDPSLDRMYVPIS-----ALPPPPQHKQQAGGEF  278

Query  995   ----------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA  846
                       ++ R+YY+ A+ + +LQ+ AS          +R+K+E+FSA++WK++  +
Sbjct  279   EPTTSREDDRLVSRMYYVTATQLSELQQSASSNGG------KRSKLESFSAFLWKMVAES  332

Query  845   VDKSHNK-----CKMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGELSMDELKHG  705
                ++N+      +MG +VDGR R+        P  M+ Y GNVLS+ FGE    E+   
Sbjct  333   SLVANNEDNKAISRMGIVVDGRCRLMSQDGDDKPTPMASYFGNVLSIPFGEKRAREVVEK  392

Query  704   TISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMV--LGRDGP---GAAIVVS  540
              +S +A  VH  +  A   EHFLDLIDW+E HRP   ++++   LG +       A VVS
Sbjct  393   PLSWVAEAVHDFVERAATREHFLDLIDWVEGHRPAPGVTRIYCKLGSEEEQEGSTAFVVS  452

Query  539   SGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAAL  360
             SG+RFPV +++FG+G PVLG+          GYV   PS   +G W V   L    VA +
Sbjct  453   SGQRFPVAKMDFGWGKPVLGSYHFPWGG-ETGYVMPMPSPLSNGDWVVYLHLSRSQVAFV  511

Query  359   ESHSECIFQPITAHDLHL  306
             ES +  +F+P+  H LHL
Sbjct  512   ESKAPTVFRPLNPHYLHL  529



>ref|XP_010058994.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Eucalyptus grandis]
Length=504

 Score =   234 bits (597),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 161/433 (37%), Positives = 229/433 (53%), Gaps = 58/433 (13%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LKA+L+Q L  +Y  AG +V N    EPE++C+N+GV  +EA A++ L+ L  YN 
Sbjct  68    VVGVLKAALAQALVSYYALAGEVVQN-LAGEPELMCNNQGVDFIEAFADMELRHLNLYNP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  VE GKLVP  ++RG     + +Q T   CGG+ +  TFDH + DA S   F+  W+E
Sbjct  127   DDTVE-GKLVPT-KKRG----VLAVQATELKCGGIVVACTFDHRIADAYSVNMFMVFWAE  180

Query  1160  LATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----  996
              A +  P S  P  RR LL PR P  ++ SLD  ++  S      M PPP     +    
Sbjct  181   TARSTAPISLPPSFRRSLLNPRHPLYFDPSLDCMYIPVSA-----MPPPPKHNLQVDEQC  235

Query  995   ----------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA  846
                       +L R+YY+ A+ + +LQ+ A           +RTK+E+FSA++WK++  +
Sbjct  236   ETVTLRDDDRLLSRMYYVTAAKLSELQQSA------CSNGSKRTKLESFSAFLWKMVAES  289

Query  845   V-----DKSHNKCKMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGELSMDELKHG  705
                   D      +MG +VDGR R+        P  MS Y GNVLS+ FGE    E+   
Sbjct  290   SSVANDDDKKTMSRMGIVVDGRCRLMSQGEDNKPTPMSSYFGNVLSVPFGEKRAREVVEK  349

Query  704   TISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGA--------AI  549
              +S +A  VH  +  A   EHFLDLIDW+E HRP   +S++      PG+        A 
Sbjct  350   PLSWVADVVHEFVERAAKKEHFLDLIDWVEGHRPVPAMSRIFC---KPGSKEEEEGSTAF  406

Query  548   VVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMV  369
             VVSSG+RF V E++FG+G PVLG+      R   GYV   PS   +G W V   L    V
Sbjct  407   VVSSGQRFLVTEMDFGWGKPVLGSYHFPW-RGKTGYVMPMPSPLSNGDWVVYLHLSKSQV  465

Query  368   AALESHSECIFQP  330
             A +ESH+  +F+P
Sbjct  466   AFIESHAPTVFRP  478



>gb|KHN38347.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=471

 Score =   233 bits (594),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 163/455 (36%), Positives = 242/455 (53%), Gaps = 32/455 (7%)
 Frame = -1

Query  1619  LTLSNLDLLSGRFPVTYLYFFRSP-NQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPN  1443
             L LSNLDLL     V+  + ++ P  + +     ++ +LK +L+Q L  +YPFAG +V N
Sbjct  31    LPLSNLDLLIPPMDVSVFFCYKKPLPEKYYCFGTMVGSLKNALAQALVYYYPFAGEMVAN  90

Query  1442  PKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQ  1263
                 EPE+ C NRG   VEA A + L+ L  YN +  V+ GK VP  R++ G    + +Q
Sbjct  91    -TMGEPELFCSNRGADFVEAVAEVELQCLNLYNPDDTVQ-GKFVP--RKKHG---LLAVQ  143

Query  1262  ITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPP--SCSPDHrrfllrprfpp  1089
              T   CG L +  TFDH + DA S   FL +W+E+A +  P  S  P   R L  PR PP
Sbjct  144   ATELKCGSLVVACTFDHRIADAYSANMFLVSWAEIAQSNKPIISIQPSFARSLFIPRNPP  203

Query  1088  RYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGT  909
              +++SL + +VS S     +  P P   S  ++ R+YY+   +++ +QKLAS   +G+  
Sbjct  204   SFHSSLHDLYVSISASPRPS-DPKPEFQSEPLINRIYYVTGENLNLMQKLAS--SNGV--  258

Query  908   SRRRTKIEAFSAYIWKVMVNAVDKSHNK-----CKMGWLVDGRTRI-------PGIMSDY  765
               +RTK+E+FSA++WK++  A             KMG +VDGR R+         IM  Y
Sbjct  259   --KRTKLESFSAFLWKMVAEAAAAKVKGKKNLVAKMGVVVDGRKRLSNGDKNKEAIMGSY  316

Query  764   IGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSK  585
              GNV+S+ +G   ++EL    +S +A  VH  +      EHFL L+DW+E HRP   LS+
Sbjct  317   FGNVVSIPYGGKPVEELMEKPLSWVAEKVHEFLEIGLTEEHFLGLVDWVEVHRPAPGLSR  376

Query  584   MVLGR-DGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDG  408
             +  G     G + VVSSG+RFP  +++FG+G PV  +          GYV   PS+ G+G
Sbjct  377   IYCGHGKEEGPSFVVSSGQRFPESKVDFGWGKPVFASYHFPWGG-DSGYVMPMPSSTGNG  435

Query  407   SWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
              W V   L    +  +E  +  IF P +  D H +
Sbjct  436   DWLVYMHLLEAHLNFMEVRAPQIFWPFS-RDYHFN  469



>ref|XP_010040470.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45194.1| hypothetical protein EUGRSUZ_L01180 [Eucalyptus grandis]
Length=487

 Score =   233 bits (594),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 159/438 (36%), Positives = 234/438 (53%), Gaps = 52/438 (12%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +L+Q L  +Y  AG +V N    EPE+LC+NRGV  +EA A+I L  L  YN 
Sbjct  68    MVGILKVALAQALVSYYALAGEVVKN-SVSEPELLCNNRGVDFIEAFADIELCHLNLYNP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVP  ++RG     + +Q T   CGG+ +  TFDH + DA+S   F+  W+E
Sbjct  127   DETIE-GKLVPT-KKRG----VLAVQATELKCGGIVVACTFDHRIADATSANMFMVFWAE  180

Query  1160  LA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----  996
              A ++ P S  P  RR LL PR P   + SLD  +V  S      + PPP          
Sbjct  181   TARSDAPFSLPPCFRRSLLNPRRPLCIDPSLDRMYVPIS-----ALPPPPQHKQQAGGEF  235

Query  995   ----------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA  846
                       ++ R+YY+ A+ + +LQ+ AS          +R+K+E+FSA++WK++  +
Sbjct  236   EPTTSREDDRLVSRMYYVTATQLSELQQSASSNGG------KRSKLESFSAFLWKMVAES  289

Query  845   VDKSHNK-----CKMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGELSMDELKHG  705
                ++N+      +MG +VDGR R+        P  M+ Y GNVLS+ FGE    E+   
Sbjct  290   SLVANNEDNKAISRMGIVVDGRCRLMSLDGDDKPTPMASYFGNVLSIPFGEKRAREVVEK  349

Query  704   TISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKM-----VLGRDGPGAAIVVS  540
              +S +A  VH  +  A   EHFLDLIDW+E HRP   ++++         +    A VVS
Sbjct  350   PLSWVAEAVHDFVERAATREHFLDLIDWVEGHRPAPGVTRIYCKLGSEEEEEGSTAFVVS  409

Query  539   SGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAAL  360
             SG+RFPV +++FG+G PVLG+          GYV   PS   +G W V   L    VA +
Sbjct  410   SGQRFPVAKMDFGWGKPVLGSYHFPWGG-ETGYVMPMPSPLSNGDWVVYLHLSRSQVAFV  468

Query  359   ESHSECIFQPITAHDLHL  306
             ES +  +F+P+  H LHL
Sbjct  469   ESKAPTVFRPLNPHYLHL  486



>ref|XP_007146239.1| hypothetical protein PHAVU_006G023900g [Phaseolus vulgaris]
 gb|ESW18233.1| hypothetical protein PHAVU_006G023900g [Phaseolus vulgaris]
Length=475

 Score =   233 bits (593),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 148/411 (36%), Positives = 222/411 (54%), Gaps = 32/411 (8%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++ +LK +L+Q L  +Y FAG +V N   DEPE+LC+NRGV  VEA+A++ LK L FYN 
Sbjct  73    MVGSLKKALAQTLISYYVFAGEVVLN-NMDEPEVLCNNRGVDFVEAEADVELKNLNFYNP  131

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GK VP   ++ G    + +Q T   CGG+ +  +FDH + D  S   FLT+W+E
Sbjct  132   DQSIE-GKFVP--NKKNG---VLAVQATSLKCGGIVVACSFDHRIADGYSANMFLTSWAE  185

Query  1160  LAT-NKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKR  984
             +A   KP + SP   R LL PR P     SL + +   S      + PP T+ ++    R
Sbjct  186   MAQPTKPTTMSPCFLRSLLSPRRPCSIPHSLHQMYTPIS-----KLTPPETI-TTPHFSR  239

Query  983   LYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNK----CKM  816
             +YY+ A  +H +Q L S      G   +RTK+E FSA +WK++  A  +         +M
Sbjct  240   IYYVTAQKLHSMQALVS------GNGSKRTKLECFSALLWKMVARAASRERRGKRVVARM  293

Query  815   GWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTA  657
             G +VDGR R+         +M  Y GNV+S+ FGE  ++EL    +  +A  VH  +  A
Sbjct  294   GVVVDGRRRLCQSEKVKEALMGCYFGNVVSIPFGEKVVEELMEKPLGFVADAVHEFLEEA  353

Query  656   TNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGT  477
                EHFL L+DW+E HRP   ++++       G + VVS G+RF  G+++FG+G  V G+
Sbjct  354   MTEEHFLGLVDWVEAHRPESGVARIYSDGSSEGGSFVVSCGQRFLEGKMDFGWGKVVFGS  413

Query  476   VCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
                       GYV    S  G+G W V   L  + +  +E  +  +F+PIT
Sbjct  414   FHFPWGG-EAGYVMPMKSPLGNGDWVVYMHLTKEQLEVIECEAGDVFRPIT  463



>ref|XP_010472737.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Camelina sativa]
Length=459

 Score =   231 bits (589),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 153/406 (38%), Positives = 234/406 (58%), Gaps = 28/406 (7%)
 Frame = -1

Query  1514  DNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNK  1335
             + LK +L++ L  +Y FAG IV N  T EPEILC+NRGV  VEA A++ L+EL  Y+ ++
Sbjct  65    ETLKTALAETLVSYYAFAGEIVTN-TTGEPEILCNNRGVDFVEAGADVELRELNLYDPDE  123

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              +   KLVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   FL +W+E++
Sbjct  124   SI--AKLVP-IKKHG----VIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEIS  176

Query  1154  -TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS---IMLK  987
              ++ P SC P  RR LL PR P   ++S+D+ F+  +        PPP  +++   ++  
Sbjct  177   RSDVPISCVPSFRRSLLNPRRPLVIDSSIDQIFMPVT------SLPPPQEITNPENLLTS  230

Query  986   RLYYIDASSIHKLQKLASEEDDGIGTSR-RRTKIEAFSAYIWKVMVNAVDKSH----NKC  822
             R+YYI A ++ +LQ LAS  ++   ++  +RTK+E+FSA++WK++     K H       
Sbjct  231   RIYYIKADALEELQTLASSSNNASSSNNGKRTKLESFSAFLWKIVAEKTAKDHPVPCKTS  290

Query  821   KMGWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAE  645
             K+G +VDGR R+    ++ Y GNVLS+ FG   +D+L +  +S +A  VH  +  +   E
Sbjct  291   KLGIVVDGRRRLMEQENNTYFGNVLSIPFGGQRIDDLTNKPLSWVAEEVHRFLERSATKE  350

Query  644   HFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCST  465
             HFL+LIDW+E  RP   +S++       G A VVSSGR FPV +++FG+GSPV G+    
Sbjct  351   HFLNLIDWVETRRPTPSVSRIYSVGSDDGPAFVVSSGRSFPVTQVDFGWGSPVFGSYHFP  410

Query  464   IERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                   GYV   PS    G W V   L    +  +E  +  +F+PI
Sbjct  411   WGG-SAGYVMPMPSY---GDWMVYLHLTKGQLKFIEEEASHVFKPI  452



>ref|XP_007217230.1| hypothetical protein PRUPE_ppa005452mg [Prunus persica]
 gb|EMJ18429.1| hypothetical protein PRUPE_ppa005452mg [Prunus persica]
Length=460

 Score =   231 bits (589),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 152/430 (35%), Positives = 232/430 (54%), Gaps = 37/430 (9%)
 Frame = -1

Query  1562  FFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEA  1383
             FF   N+   S   ++  L+ +++Q L  FY F+G +V N    EP ILC+NRGV   EA
Sbjct  44    FFCYKNEQSMSFWSMVGVLRKAMAQALVTFYAFSGEVVQN-SVGEPAILCNNRGVDFFEA  102

Query  1382  QANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALG  1203
              A++ LK+L  Y+ ++ +E GKLVP  +++ G    + +Q T   CGG+ +  +FDH + 
Sbjct  103   FADVELKDLNLYDPDESIE-GKLVP--KKKHG---VLAVQATELKCGGMVVACSFDHRIA  156

Query  1202  DASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMR  1023
             DA S   FL +W+E+A +K  S  P  RR LL PR P   + SL++ +V       +   
Sbjct  157   DAYSTNMFLVSWAEMAQSKSLSLLPTFRRSLLNPRRPGHIDPSLNDMYVP------ITAL  210

Query  1022  PPPTLLSSI----MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVM  855
             PPP   + +    ++ R+YY+ A  +  LQ LAS          +RTK+E+F A++WK++
Sbjct  211   PPPKNDTDVNQDHLISRIYYVTAEQLDNLQALASS------NGFKRTKLESFCAFLWKMV  264

Query  854   VNAVDK---SHNKCKMGWLVDGRTRI----------PGIMSDYIGNVLSLTFGELSMDEL  714
               +  K   +   CKMG +VDGRTR+             M+ Y GNVLS+ FG   +++L
Sbjct  265   AKSDTKIGCAKKLCKMGIVVDGRTRLSERGNYRSHQASHMATYFGNVLSIPFGGEKVEDL  324

Query  713   KHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSG  534
                +++ +A  VH  +  A   EHFL LIDW+E H+P   L+K+       G A VVSSG
Sbjct  325   VEKSLNWVADEVHDFLKCAVTKEHFLGLIDWVEVHKPVPALAKIYCSGSEEGPAFVVSSG  384

Query  533   RRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALES  354
             +RFPV E++FG+G PV G+          GYV   PS    G W V   ++   +  +E 
Sbjct  385   QRFPVSEVDFGWGLPVFGSYHFPWGG-NAGYVMPMPSPARKGDWIVYMHIFKGQLELIEK  443

Query  353   HSECIFQPIT  324
              +  +F+ +T
Sbjct  444   AAAHVFRRLT  453



>ref|XP_006389934.1| hypothetical protein EUTSA_v10018518mg [Eutrema salsugineum]
 gb|ESQ27220.1| hypothetical protein EUTSA_v10018518mg [Eutrema salsugineum]
Length=457

 Score =   231 bits (588),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 152/424 (36%), Positives = 235/424 (55%), Gaps = 25/424 (6%)
 Frame = -1

Query  1577  VTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             V+  + ++ P    ++     + LK +L++ L  +Y FAG IV NP + EPEILC+NRGV
Sbjct  45    VSVCFCYKKPRNIATNLVAPNETLKTALAETLVSYYAFAGEIVTNP-SGEPEILCNNRGV  103

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
               +EA A++ L+EL   + ++ +   KLVP  ++ G     + IQ+T+  CG + +  TF
Sbjct  104   DFLEAGADVELRELNLSDPDESI--AKLVP-IKKHG----VIAIQVTQLKCGSIVVGCTF  156

Query  1217  DHALGDASSFAKFLTTWSELA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             DH + DA S   FL +W+E++ ++ P S  P  RR LL PR P   ++S+D  ++     
Sbjct  157   DHRVADAYSMNMFLVSWAEMSRSDVPISYVPSFRRSLLNPRRPLIVDSSIDPMYMP----  212

Query  1040  DILNMRPPPTLLS--SIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYI  867
              + ++ PP       +I+  RL YI A ++ KLQ LAS    G   + +RTK+E+FSA++
Sbjct  213   -VTSLPPPQETFDPDTILASRLCYIKADALQKLQTLAS----GSKLTVKRTKLESFSAFL  267

Query  866   WKVMVNAVDKS---HNKCKMGWLVDGRTRI-PGIMSDYIGNVLSLTFGELSMDELKHGTI  699
             WK++ N   K        K+G +VDGR R+     + Y GNVLS+ FG   +D+L +  +
Sbjct  268   WKLVANHAAKDPVPSKNSKIGIVVDGRRRLMEQKHNTYFGNVLSIPFGGQKIDDLINKPL  327

Query  698   SKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPV  519
             S +   VH  + ++   EHFL+LIDW+E  RP   +S++       G A VVSSGR FPV
Sbjct  328   SWVTEEVHRFLESSVTKEHFLNLIDWVETRRPTPAVSRIYSNGSDDGPAFVVSSGRSFPV  387

Query  518   GELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECI  339
              +++FG+GSPV G+          GYV   PS+  DG W V   L    +  +E  +  +
Sbjct  388   TKVDFGWGSPVFGSYHFPWGG-SAGYVMPMPSSVNDGDWMVYLHLTKGQLKFIEEEASHV  446

Query  338   FQPI  327
               PI
Sbjct  447   LIPI  450



>gb|KDO60230.1| hypothetical protein CISIN_1g012180mg [Citrus sinensis]
Length=469

 Score =   231 bits (588),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 149/414 (36%), Positives = 226/414 (55%), Gaps = 29/414 (7%)
 Frame = -1

Query  1517  IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLN  1338
             +D LK ++++ L  +Y  AG +V N    EPE+LC+NRGV  VEA A + L++L  YN +
Sbjct  63    VDVLKKAMAEALVSYYALAGEVVYN-YDGEPELLCNNRGVDFVEAYAEVELRDLNLYNPD  121

Query  1337  KYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSEL  1158
             + +E GKL+P  ++ G     + +Q T   CGG+ +  T DH + DA S   FL +W+E+
Sbjct  122   ESIE-GKLLPKKKKNG----LLSVQATELKCGGIVVACTLDHRIADAYSTNMFLVSWAEI  176

Query  1157  ATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS--IMLKR  984
             A +KP S  P  RR +L PR P   + + D+ ++  S              ++   ++ R
Sbjct  177   AQSKPMSVLPSFRRSILNPRRPLCIDHAFDDMYLPISSLPPPPPPNNTPEEANGNNLISR  236

Query  983   LYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMV---NAVDKSHNK-CKM  816
             +YYI +  +++LQ LAS ++       +RTK+E+FSAY+WK++    N  D S  +  KM
Sbjct  237   IYYIKSEQLNELQLLASSDE------CKRTKLESFSAYLWKMVALSGNDNDGSGTRISKM  290

Query  815   GWLVDGRTRIPGI----------MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAI  666
             G +VDGRTR+             M  Y GNVLS+ FG   ++EL    +S +A  VH  +
Sbjct  291   GVVVDGRTRLSSSKGDHVNKSISMDSYFGNVLSVPFGGQKVNELIEKPLSWVAKRVHDFL  350

Query  665   STATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPV  486
               A   +HFL LIDW+E HRP   +SK+       G A VVSSG+RFPV +++FG+G PV
Sbjct  351   ENAVTKDHFLGLIDWVEAHRPDPAISKICATGSKDGPAFVVSSGQRFPVSKVDFGWGKPV  410

Query  485   LGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
              G+          GYV   PS   +  W V   L    +  +E+ +  +F+P+T
Sbjct  411   FGSYHFPWGS-DAGYVMPMPSPAHNSDWVVYMHLSEKQLDLIETQASNVFEPLT  463



>gb|AAC17079.1| Contains similarity to C2-HC type zinc finger protein C.e-MyT1 
gb|U67079 from C. elegans and to hypersensitivity-related 
gene 201 isolog T28M21.14 from A. thaliana BAC gb|AF002109 [Arabidopsis 
thaliana]
Length=572

 Score =   233 bits (594),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 154/425 (36%), Positives = 237/425 (56%), Gaps = 30/425 (7%)
 Frame = -1

Query  1577  VTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             V   + ++ P   H ++    + LK +L++ L  +Y FAG +V NP T EPEILC+NRGV
Sbjct  163   VHVCFCYKKP--LHFTNTVAYETLKTALAETLVSYYAFAGELVTNP-TGEPEILCNNRGV  219

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
               VEA A++ L+EL  Y+ ++ +   KLVP  ++ G     + IQ+T+  CG + +  TF
Sbjct  220   DFVEAGADVELRELNLYDPDESI--AKLVP-IKKHG----VIAIQVTQLKCGSIVVGCTF  272

Query  1217  DHALGDASSFAKFLTTWSELA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             DH + DA S   FL +W+E++ ++ P SC P  RR LL PR P   + S+D+ ++     
Sbjct  273   DHRVADAYSMNMFLLSWAEISRSDVPISCVPSFRRSLLNPRRPLVMDPSIDQIYMP----  328

Query  1040  DILNMRPPP---TLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAY  870
               +   PPP   T   +++  R+YYI A+++ +LQ LAS   +G     +RTK+E+FSA+
Sbjct  329   --VTSLPPPQETTNPENLLASRIYYIKANALQELQTLASSSKNG-----KRTKLESFSAF  381

Query  869   IWKVMVNAVDKSH---NKCKMGWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGT  702
             +WK++     K        K+G +VDGR R+    ++ Y GNVLS+ FG   +D+L    
Sbjct  382   LWKLVAEHAAKDPVPIKTSKLGIVVDGRRRLMEKENNTYFGNVLSVPFGGQRIDDLISKP  441

Query  701   ISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFP  522
             +S +   VH  +  +   EHFL+LIDW+E  RP   +S++       G A VVSSGR FP
Sbjct  442   LSWVTEEVHRFLKKSVTKEHFLNLIDWVETCRPTPAVSRIYSVGSDDGPAFVVSSGRSFP  501

Query  521   VGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSEC  342
             V +++FG+GSPV G+          GYV   PS+  D  W V   L    +  +E  +  
Sbjct  502   VNQVDFGWGSPVFGSYHFPWGG-SAGYVMPMPSSVDDRDWMVYLHLTKGQLRFIEEEASH  560

Query  341   IFQPI  327
             + +PI
Sbjct  561   VLKPI  565



>ref|XP_003545151.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Glycine 
max]
Length=467

 Score =   230 bits (587),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 176/473 (37%), Positives = 250/473 (53%), Gaps = 38/473 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSP-NQFHSSSPKIID  1512
             +F V    E +V    L  K   L LSNLDLL     V+  + ++ P  + +     ++ 
Sbjct  9     EFIVSVTKEEIV-VPELPMKEQWLPLSNLDLLIPPVDVSVFFCYKKPLPEKYYCFGTMVG  67

Query  1511  NLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             +LK +L+Q L  +YPFAG +V N    EPE+ C NRGV  VEA A++ L+ L  YN +  
Sbjct  68    SLKNALAQALVYYYPFAGEMVAN-TMGEPELFCSNRGVDFVEAVADVELQCLNLYNPDDT  126

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-  1155
             VE GKLVP  R++ G    + +Q T   CGGL +  TFDH + DA S   FL +W+E A 
Sbjct  127   VE-GKLVP--RKKHG---VLAVQATGLKCGGLVVACTFDHRIADAYSANMFLVSWAEAAR  180

Query  1154  TNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPT-------LLSS  999
              NKP  S  P  RR LL PR PP  +  L   +V  S        PPP+         S 
Sbjct  181   PNKPIISAQPCFRRSLLTPRRPPSIHPLLHHMYVPVS------ALPPPSDPNKKLVFESE  234

Query  998   IMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA---VDKSHN  828
              ++ R+YY+ + S++++Q LAS      GT +R TK+E+FSA++WK++  A   VD   N
Sbjct  235   PLISRIYYVTSESLNRMQALASSN----GTVKR-TKLESFSAFLWKMVAEATASVDGKKN  289

Query  827   -KCKMGWLVDGRTRI---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
                KMG +VDGR  +      M  Y GNVLS+ +G  ++DEL    +S +A  VH  +  
Sbjct  290   VAAKMGVVVDGRKMLCNDEKNMGSYFGNVLSIPYGGNAVDELVEKPLSWVAEKVHEFLKM  349

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGR-DGPGAAIVVSSGRRFPVGELEFGFGSPVL  483
                 +HFL L+DW+E HRP   LS++  G     G + VVSSG+RFP  +++FG+G PV 
Sbjct  350   GVTEDHFLGLVDWVEEHRPVPGLSRIYCGHGKEKGPSFVVSSGQRFPESKVDFGWGKPVF  409

Query  482   GTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
              +          GYV   P A G+G W V   L    +  +E  +  I +P +
Sbjct  410   ASYHFPWGG-DSGYVMPMPCANGNGDWLVYMHLLKAHLNFMEVRAPQILRPFS  461



>ref|XP_006488633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=471

 Score =   230 bits (587),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 149/414 (36%), Positives = 226/414 (55%), Gaps = 29/414 (7%)
 Frame = -1

Query  1517  IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLN  1338
             +D LK ++++ L  +Y  AG +V N    EPE+LC+NRGV  VEA A + L++L  YN +
Sbjct  63    VDVLKKAMAEALVSYYALAGEVVYN-YDGEPELLCNNRGVDFVEAYAEVELRDLNLYNPD  121

Query  1337  KYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSEL  1158
             + +E GKL+P  ++ G     + +Q T   CGG+ +  T DH + DA S   FL +W+E+
Sbjct  122   ESIE-GKLLPKKKKNG----LLSVQATELKCGGIVVACTLDHRIADAYSTNMFLVSWAEI  176

Query  1157  ATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS--IMLKR  984
             A +KP S  P  RR +L PR P   + + D+ ++  S              ++   ++ R
Sbjct  177   AQSKPMSVLPSFRRSILNPRRPLCIDHAFDDMYLPISSLPPPPPPNNTPEEANGNNLISR  236

Query  983   LYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMV---NAVDKSHNK-CKM  816
             +YYI +  +++LQ LAS ++       +RTK+E+FSAY+WK++    N  D S  +  KM
Sbjct  237   IYYIKSEQLNELQLLASSDE------CKRTKLESFSAYLWKMVALSGNDNDGSGTRISKM  290

Query  815   GWLVDGRTRIPGI----------MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAI  666
             G +VDGRTR+             M  Y GNVLS+ FG   ++EL    +S +A  VH  +
Sbjct  291   GVVVDGRTRLSSSKGDHVNKSISMDSYFGNVLSVPFGGQKVNELIEKPLSWVAKRVHDFL  350

Query  665   STATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPV  486
               A   +HFL LIDW+E HRP   +SK+       G A VVSSG+RFPV +++FG+G PV
Sbjct  351   ENAVTKDHFLGLIDWVEAHRPDPAISKICATGSKDGPAFVVSSGQRFPVSKVDFGWGKPV  410

Query  485   LGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
              G+          GYV   PS   +  W V   L    +  +E+ +  +F+P+T
Sbjct  411   FGSYHFPWGS-DAGYVMPMPSPAHNSDWVVYMHLSEKQLDLIETQASNVFEPLT  463



>gb|KHN11990.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=467

 Score =   230 bits (587),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 176/473 (37%), Positives = 250/473 (53%), Gaps = 38/473 (8%)
 Frame = -1

Query  1688  DFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSP-NQFHSSSPKIID  1512
             +F V    E +V    L  K   L LSNLDLL     V+  + ++ P  + +     ++ 
Sbjct  9     EFIVSVTKEEIV-VPELPMKEQWLPLSNLDLLIPPVDVSVFFCYKKPLPEKYYCFGTMVG  67

Query  1511  NLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
             +LK +L+Q L  +YPFAG +V N    EPE+ C NRGV  VEA A++ L+ L  YN +  
Sbjct  68    SLKNALAQALVYYYPFAGEMVAN-TMGEPELFCSNRGVDFVEAVADVELQCLNLYNPDDT  126

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-  1155
             VE GKLVP  R++ G    + +Q T   CGGL +  TFDH + DA S   FL +W+E A 
Sbjct  127   VE-GKLVP--RKKHG---VLAVQATGLKCGGLVVACTFDHRIADAYSANMFLVSWAEAAR  180

Query  1154  TNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPT-------LLSS  999
              NKP  S  P  RR LL PR PP  +  L   +V  S        PPP+         S 
Sbjct  181   PNKPIISAQPCFRRSLLTPRRPPSIHPLLHHMYVPVS------ALPPPSDPNKKLVFESE  234

Query  998   IMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA---VDKSHN  828
              ++ R+YY+ + S++++Q LAS      GT +R TK+E+FSA++WK++  A   VD   N
Sbjct  235   PLISRIYYVTSESLNRMQALASSN----GTVKR-TKLESFSAFLWKMVAEATASVDGKKN  289

Query  827   -KCKMGWLVDGRTRI---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
                KMG +VDGR  +      M  Y GNVLS+ +G  ++DEL    +S +A  VH  +  
Sbjct  290   VAAKMGVVVDGRKMLCNDEKNMGSYFGNVLSIPYGGNAVDELVEKPLSWVAEKVHEFLKM  349

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGR-DGPGAAIVVSSGRRFPVGELEFGFGSPVL  483
                 +HFL L+DW+E HRP   LS++  G     G + VVSSG+RFP  +++FG+G PV 
Sbjct  350   GVTEDHFLGLVDWVEEHRPVPGLSRIYCGHGKEKGPSFVVSSGQRFPESKVDFGWGKPVF  409

Query  482   GTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
              +          GYV   P A G+G W V   L    +  +E  +  I +P +
Sbjct  410   ASYHFPWGG-DSGYVMPMPCANGNGDWLVYMHLLKAHLNFMEVRAPQILRPFS  461



>ref|XP_010030883.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=488

 Score =   231 bits (588),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 155/439 (35%), Positives = 226/439 (51%), Gaps = 53/439 (12%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LKA+L Q L  +Y  AG +V N    EPE+LC+N GV  +EA A + L+ L  YN 
Sbjct  68    MVGILKAALGQALVSYYALAGEVVQN-SVCEPELLCNNSGVDFIEAFAEVELRHLNLYNP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVP  ++RG     + +Q T   CGG+ +  TFDH + DA S   FL  W++
Sbjct  127   DETIE-GKLVPT-KKRG----VLAVQATELKCGGIVVACTFDHRIADAYSANMFLVFWAD  180

Query  1160  LATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS-----  999
              A +  P S  P     LL PR P   N SLD  ++  S      + PPP          
Sbjct  181   KARSAAPTSLPPSFNHSLLNPRRPLCVNASLDSMYIPVSA-----LPPPPKQKQKADEAC  235

Query  998   ---------IMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA  846
                       ++ R+YY+ A+ + +LQ+ A           +R+K+E+FSA++WK++  +
Sbjct  236   ETTTSRDDDCVVSRMYYVTAAELSELQQRA------YSNGSKRSKLESFSAFLWKMVAES  289

Query  845   VDKSHNK-----CKMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGELSMDELKHG  705
                + N       +MG +VDGR R+        P  M+ Y GNVLS+ FGE    E+   
Sbjct  290   SSGASNDDDKRMSRMGIVVDGRCRLMSQHMHDEPTPMASYFGNVLSIPFGEKRTTEVMEK  349

Query  704   TISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLG------RDGPGAAIVV  543
              +S +A  VH  +  A   EHFLDLIDW+E HRP   ++++          +    A VV
Sbjct  350   PLSWVAEAVHEFVQRAATREHFLDLIDWVEEHRPVPAVARIYCKSGSAKEEEEGSTAFVV  409

Query  542   SSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAA  363
             SSG+RFPV E++FG+G P LG+          GYV   PS   +G W V   L    VA 
Sbjct  410   SSGQRFPVTEMDFGWGKPALGSYHFPWGG-EAGYVMPMPSPLSNGDWVVYLHLARSQVAF  468

Query  362   LESHSECIFQPITAHDLHL  306
             +ESH+  +F+P+T   L+L
Sbjct  469   IESHAPTVFRPLTPRYLNL  487



>ref|XP_003519535.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Glycine 
max]
Length=471

 Score =   230 bits (586),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 162/455 (36%), Positives = 242/455 (53%), Gaps = 32/455 (7%)
 Frame = -1

Query  1619  LTLSNLDLLSGRFPVTYLYFFRSP-NQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPN  1443
             L LSNLDLL     V+  + ++ P  + +     ++ +LK +L+Q L  +YPFAG +V N
Sbjct  31    LPLSNLDLLIPPMDVSVFFCYKKPLPEKYYCFGTMVGSLKNALAQALVYYYPFAGEMVAN  90

Query  1442  PKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQ  1263
                 EPE+ C NRG   VEA A + L+ L  YN +  V+ GK VP  R++ G    + +Q
Sbjct  91    -TMGEPELFCSNRGADFVEAVAEVELQCLNLYNPDDTVQ-GKFVP--RKKHG---LLAVQ  143

Query  1262  ITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPP--SCSPDHrrfllrprfpp  1089
              T   CG L +  TFDH + DA S   FL +W+E+A +  P  S  P   R L  PR PP
Sbjct  144   ATELKCGSLVVACTFDHRIADAYSANMFLVSWAEIAQSNKPIISIQPSFARSLFIPRNPP  203

Query  1088  RYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGT  909
              +++SL + +VS S     +  P P   S  ++ R+YY+   +++ +Q+LAS   +G+  
Sbjct  204   SFHSSLHDLYVSISALPRPS-DPKPGFQSEPLINRIYYVTGENLNLMQELAS--SNGV--  258

Query  908   SRRRTKIEAFSAYIWKVMVNAVDKSHNK-----CKMGWLVDGRTRI-------PGIMSDY  765
               +RTK+E+FSA++WK++  A             KMG +VDGR R+         IM  Y
Sbjct  259   --KRTKLESFSAFLWKMVAEAAAAKVKGKKNLVAKMGVVVDGRKRLSNGDKNKEAIMGSY  316

Query  764   IGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSK  585
              GNV+S+ +G   ++EL    +S +A  VH  +      EHFL L+DW+E HRP   LS+
Sbjct  317   FGNVVSIPYGGKPVEELMEKPLSWVAEKVHEFLEIGLTEEHFLGLVDWVEVHRPAPGLSR  376

Query  584   MVLGRDG-PGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDG  408
             +  G     G + VVSSG+RFP  +++FG+G PV  +          GYV   PS+ G+G
Sbjct  377   IYCGHGKEEGPSFVVSSGQRFPESKVDFGWGKPVFASYHFPWGG-DSGYVMPMPSSTGNG  435

Query  407   SWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
              W V   L    +  +E  +  IF P +  D H +
Sbjct  436   DWLVYMHLLEAHLNFMEVRAPQIFWPFS-RDYHFN  469



>gb|KCW56804.1| hypothetical protein EUGRSUZ_I02472, partial [Eucalyptus grandis]
Length=482

 Score =   228 bits (582),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 153/433 (35%), Positives = 223/433 (52%), Gaps = 53/433 (12%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LKA+L Q L  +Y  AG +V N    EPE+LC+N GV  +EA A + L+ L  YN 
Sbjct  68    MVGILKAALGQALVSYYALAGEVVQN-SVCEPELLCNNSGVDFIEAFAEVELRHLNLYNP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +E GKLVP  ++RG     + +Q T   CGG+ +  TFDH + DA S   FL  W++
Sbjct  127   DETIE-GKLVPT-KKRG----VLAVQATELKCGGIVVACTFDHRIADAYSANMFLVFWAD  180

Query  1160  LATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----  996
              A +  P S  P     LL PR P   N SLD  ++  S      + PPP          
Sbjct  181   KARSAAPTSLPPSFNHSLLNPRRPLCVNASLDSMYIPVSA-----LPPPPKQKQKADEAC  235

Query  995   ----------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA  846
                       ++ R+YY+ A+ + +LQ+ A           +R+K+E+FSA++WK++  +
Sbjct  236   ETTTSRDDDCVVSRMYYVTAAELSELQQRA------YSNGSKRSKLESFSAFLWKMVAES  289

Query  845   VDKSHNK-----CKMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGELSMDELKHG  705
                + N       +MG +VDGR R+        P  M+ Y GNVLS+ FGE    E+   
Sbjct  290   SSGASNDDDKRMSRMGIVVDGRCRLMSQHMHDEPTPMASYFGNVLSIPFGEKRTTEVMEK  349

Query  704   TISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLG------RDGPGAAIVV  543
              +S +A  VH  +  A   EHFLDLIDW+E HRP   ++++          +    A VV
Sbjct  350   PLSWVAEAVHEFVQRAATREHFLDLIDWVEEHRPVPAVARIYCKSGSAKEEEEGSTAFVV  409

Query  542   SSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAA  363
             SSG+RFPV E++FG+G P LG+          GYV   PS   +G W V   L    VA 
Sbjct  410   SSGQRFPVTEMDFGWGKPALGSYHFPWGG-EAGYVMPMPSPLSNGDWVVYLHLARSQVAF  468

Query  362   LESHSECIFQPIT  324
             +ESH+  +F+P+T
Sbjct  469   IESHAPTVFRPLT  481



>gb|KHM99656.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=473

 Score =   228 bits (581),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 153/422 (36%), Positives = 222/422 (53%), Gaps = 51/422 (12%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++ +LK +L+Q L  +Y FAG +VPN    EPE+LC+NRGV  VEA+A++ LK L FYN 
Sbjct  72    MVRSLKNALAQTLVSYYVFAGEVVPN-NMGEPEVLCNNRGVDFVEAEADVELKCLNFYNP  130

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  +E GK V   +++ G    + +Q T   CGG+ +  TFDH + DA S   FL +W++
Sbjct  131   DDTIE-GKFVT--KKKNG---VLAVQATSLKCGGIIVACTFDHRVADAYSTNMFLVSWAD  184

Query  1160  LATNKPPSCS------------PDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPP  1017
             +A    P+ +            P  RR LL PR P   + SL   +   S      + PP
Sbjct  185   MAQPTKPNNTLVVTVAPTASRHPCFRRSLLSPRRPGSIHPSLHHMYTPIS-----ELPPP  239

Query  1016  PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDK  837
             P+  S+ +L R+YY+ A  +H +Q  A+           RTK+E FSA++WK++  A  K
Sbjct  240   PSTASAALLSRIYYVTAEQLHLMQVFAA----------TRTKLECFSAFLWKMVARAASK  289

Query  836   SHNK----CKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKI  690
               N      KMG +VDGR R+         +M  Y GNVLS+ FG   ++EL    +  +
Sbjct  290   EKNGKRVVAKMGIVVDGRKRLGNGDKESEAMMESYFGNVLSIPFGGKPVEELVEEPLGFL  349

Query  689   ASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGEL  510
             A  VHA     T  EHFL LIDW+E HRP   ++K+       G A VVSSG+RFP  ++
Sbjct  350   AEAVHA-----TTEEHFLGLIDWVEAHRPVPGITKIYCNNADDGPAFVVSSGQRFPEDKV  404

Query  509   EFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQP  330
             +FG+G  V  +          GYV   PS   +G W V   L    +  +ES +  +F+P
Sbjct  405   DFGWGKVVFASYHFPWGG-ETGYVMPMPSPSRNGDWIVYMHLAKKQLEIIESEAAHVFKP  463

Query  329   IT  324
             +T
Sbjct  464   LT  465



>ref|XP_003530722.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=475

 Score =   227 bits (579),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 148/420 (35%), Positives = 222/420 (53%), Gaps = 43/420 (10%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++ +LK +L+Q L  +Y FAG +VPN    EPE+LC+NRGV  VEA A++ LK L FYN 
Sbjct  72    MLGSLKKALAQALISYYAFAGEVVPN-NVGEPEVLCNNRGVDFVEAVADVELKCLNFYNP  130

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  +E GK VP  +++ G    + +Q T   CGG+ L   FDH + DA S   FL +W+E
Sbjct  131   DDTIE-GKFVP--KKKNG---VLTVQATSLKCGGIVLACIFDHRIADAYSANMFLISWAE  184

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSL----DETFVSCSLDDI---LNMRPPPTLLS  1002
             +A                     P +  SL      + +  SL D+   ++   PP   +
Sbjct  185   IA----------QPTKPTTTTTTPCFRRSLLSPRRPSSIPRSLYDMYLPISKITPPQATT  234

Query  1001  SIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNK-  825
             + +L R+YY+ A  + K+Q L    ++    + +RTK E FSA++WK++  A  + + K 
Sbjct  235   APLLSRIYYVTAEQLEKMQSLVVMTNE---NNTKRTKFECFSAFLWKIVAQAASRGNKKG  291

Query  824   ----CKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHV  678
                  KMG +VDGR R+         +M  Y GNVLS+ FG   ++EL    +  +A  V
Sbjct  292   KKVIAKMGIVVDGRKRLCDGDKEKEALMGCYFGNVLSIPFGGKEVEELMEKPLGLVAEAV  351

Query  677   HAAISTATNAEHFLDLIDWIECHRPGLMLSKMVL--GRDGPGAAIVVSSGRRFPVGELEF  504
             H  ++ AT  EHFL LIDW+E HRP   ++K+    G    G + VVSSG+R   G+++F
Sbjct  352   HEFLAVATK-EHFLGLIDWVEAHRPEPGVAKIYCGGGSGDEGPSFVVSSGQRLMEGKMDF  410

Query  503   GFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             G+G  V G+          GYV   PS  G+G W V   L  + +  LES +  +F+PI+
Sbjct  411   GWGEVVFGSFHFPWGG-QAGYVMPMPSPLGNGDWVVYMHLAKEQLEVLESEASDVFRPIS  469



>ref|XP_010040766.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Eucalyptus grandis]
 gb|KCW44942.1| hypothetical protein EUGRSUZ_L01468 [Eucalyptus grandis]
Length=486

 Score =   228 bits (580),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 157/437 (36%), Positives = 231/437 (53%), Gaps = 51/437 (12%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LKA+L+Q L  +Y  AG +V N    EPE+LC+NRGV  +EA  ++ L+ L  YN 
Sbjct  68    VVGVLKAALTQALVSYYALAGEVVQN-SAGEPELLCNNRGVDFIEAFVDVELRHLNLYNP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  VE GKLVP  ++RG     + +Q T   CGG+ +   FDH + DA S   F+  W +
Sbjct  127   DDTVE-GKLVPT-KKRG----VLAVQATELKCGGIVVACMFDHRIADAYSVNMFMVFWVQ  180

Query  1160  LA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI----  996
              A T  P S  P     LL PR P  ++ SLD  ++  S      + PPP     +    
Sbjct  181   TARTAAPISLPPSFCHSLLNPRHPLCFDPSLDCMYIPVSA-----LYPPPNHKLQVDEQC  235

Query  995   ----------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA  846
                       +L  LYY+ A+ + +LQ+ A             TK+E+FSA++W+++  +
Sbjct  236   ETVTLRDNDRLLSHLYYVTAAKLSELQQSAC------SNGSNSTKLESFSAFLWRMVAES  289

Query  845   --VDKSHNKC--KMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGELSMDELKHGT  702
               VD   NK   +MG +VDGR R+        P  MS Y GNVLS+ FGE  + E+    
Sbjct  290   SVVDNDDNKTMSRMGIMVDGRCRLMSQGKDNKPTPMSSYFGNVLSVPFGEKRVREVVEKP  349

Query  701   ISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKM----VLGRDGPGA-AIVVSS  537
             +S +A  VH  +  A   EHFLDL+DW+E H+P   L+++    V+  +  G+ A+VVS 
Sbjct  350   LSWVADVVHEFVERAATKEHFLDLVDWVEEHQPVPALARIFCKPVIEEEEDGSTALVVSF  409

Query  536   GRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALE  357
             G+RFPV E++FG+G PVL +          GYV   PS   +G W V   L    VA ++
Sbjct  410   GQRFPVIEMDFGWGKPVLESYHFPWGS-KAGYVMPMPSPLSNGDWVVYLHLPRSEVAFIK  468

Query  356   SHSECIFQPITAHDLHL  306
             SH+  +F+P+  H L+L
Sbjct  469   SHAPTVFRPLIPHHLNL  485



>gb|EYU25783.1| hypothetical protein MIMGU_mgv1a006078mg [Erythranthe guttata]
Length=458

 Score =   224 bits (572),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 151/401 (38%), Positives = 221/401 (55%), Gaps = 24/401 (6%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             LK +LSQ L  F+P AG IV N +  EPEIL +NRGV    A A++ LK+++ Y  +  V
Sbjct  70    LKKALSQALVSFFPLAGEIVHN-RHGEPEILSNNRGVDFSYAYADVELKDVDLYRPDLSV  128

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
               GKLVP  +  G     + +Q+T   CGGL +  TFDH   DA S   FLT W+E+A +
Sbjct  129   -HGKLVPV-KMHG----VLSVQVTELKCGGLFVGCTFDHRAADAHSANMFLTAWAEIARS  182

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
             KP +  P  RR +  PR PP+ + SL++ +                 L+S    R+YYI 
Sbjct  183   KPITLLPSFRRSIFNPRRPPQQHKSLEKIYAPLLSMPPPPSADDTDQLTS----RIYYIK  238

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNK---CKMGWLVDG  798
             ++ I +LQ  +S   +      RR+KIE+FSA++WK +  A      +    K+G +VDG
Sbjct  239   SNEIDRLQSQSSHNGN------RRSKIESFSAFLWKAIAAAAVGGGERSKVVKLGIVVDG  292

Query  797   RTRIPG---IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLI  627
             R R+ G    +  Y GNVLS+ + E S+ ELK  +++++   VH  ++ A+ AEHFL LI
Sbjct  293   RARLSGETASLERYFGNVLSIPYVESSVGELKTASLNELVDVVHEFVAAASTAEHFLALI  352

Query  626   DWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGV  447
             DW+E  RP   + K+    +   AA+VVSSG+RF VGE++FG+G P  G+          
Sbjct  353   DWVELRRPNPAVVKVYCRDENNEAAVVVSSGQRFRVGEMDFGWGGPEFGSYHFPWGG-ET  411

Query  446   GYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             GYV   PSA G+G W V   L    +  +E+    +F+P +
Sbjct  412   GYVMPMPSACGNGDWIVYMHLMKKQLDFVEAREPHVFRPFS  452



>ref|XP_008228085.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Prunus 
mume]
Length=458

 Score =   223 bits (568),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 150/431 (35%), Positives = 229/431 (53%), Gaps = 40/431 (9%)
 Frame = -1

Query  1562  FFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEA  1383
             FF   N+   S   ++  L+ +++Q L  FY F+G ++ N    EPEI+C+NRGV   EA
Sbjct  45    FFCYKNEQRMSFWSMVGVLRKAMAQALVTFYAFSGEVMQN-SVGEPEIMCNNRGVDFFEA  103

Query  1382  QANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALG  1203
              A++ LK+L   NL+   +  KLVP  ++RG     + +Q T   CGG+ +  +FDH + 
Sbjct  104   FADVELKDL---NLDD-PDESKLVPK-KKRG----VLAVQATELKCGGMVVACSFDHRIA  154

Query  1202  DASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMR  1023
             DA S   FL +W+E+A +K  S  P  RR LL PR P   + SL++ +V       +   
Sbjct  155   DAYSTNMFLVSWAEMAQSKSLSLLPTFRRSLLNPRRPGHIDPSLNDMYVP------ITAL  208

Query  1022  PPPTLLSSI----MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVM  855
             PPP   + +    ++ R+YY+ A  +  LQ LA           +RTK+E+F A++WK++
Sbjct  209   PPPKNDTDVDQDHLISRIYYVTAEQLDNLQALAC------SNGFKRTKLESFCAFLWKMV  262

Query  854   VNAVDK---SHNKCKMGWLVDGRTRI----------PGIMSDYIGNVLSLTFGELSMDEL  714
               +  K   +   CKMG +VDGRTR+             M+ Y GNVLS+ FG    ++L
Sbjct  263   AKSDTKIGYAQKLCKMGIVVDGRTRLDKQGNYQSHQASHMATYFGNVLSVPFGGEKTEDL  322

Query  713   KHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSG  534
                +++ +A  VH  +  A   EHFL LIDW+E HRP   L+K+       G A VVSSG
Sbjct  323   VEKSLNWVAEEVHDFLKCAVTKEHFLGLIDWVEAHRPVPALAKIYSSGSEEGPAFVVSSG  382

Query  533   RRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALES  354
             +RFPV +++FG+G PV G+          GYV   PS    G W V   ++   +  +E 
Sbjct  383   QRFPVSKVDFGWGLPVFGSYHFPWGG-NAGYVMPMPSPARKGDWIVYMRIFKGQLELIEK  441

Query  353   HSECIFQPITA  321
              +  +F+ +T+
Sbjct  442   EAAHVFRRLTS  452



>ref|NP_197145.2| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AAT71960.1| At5g16410 [Arabidopsis thaliana]
 gb|AAU95445.1| At5g16410 [Arabidopsis thaliana]
 gb|AED92289.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=480

 Score =   222 bits (566),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 154/445 (35%), Positives = 237/445 (53%), Gaps = 33/445 (7%)
 Frame = -1

Query  1634  PKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGR  1455
             P+  ++ LSNLDLL     +   +F++ P         I D LK ++++ L  +Y  +G 
Sbjct  53    PENRVIPLSNLDLLIPPVDINVCFFYKKP-----LYGIIGDALKTAMAEALVSYYVLSGE  107

Query  1454  IVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFA  1275
             +  NP   E EILC N GV  VEA A++ L+EL  Y    Y    K VP  ++ G     
Sbjct  108   VSINPTNGENEILCSNGGVEFVEAAADVELRELNLYE--PYQSIAKFVP-MKKHG----V  160

Query  1274  VQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-TNKPPSCSPDHrrfllrpr  1098
               IQ+T   CG + +  TFDH + DA S   FL +W+E++ ++ P S  P  +R LL+PR
Sbjct  161   FAIQVTELKCGSVVVGCTFDHRIADAYSMNMFLVSWAEISRSDIPISYVPLLKRSLLKPR  220

Query  1097  fppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDG  918
              P   ++S+D+ ++  +    L +    T   +I+  R+YYI A  + K Q LA      
Sbjct  221   RPLIIDSSIDKLYMPIT---SLTVPQEITNQDNILTSRIYYIKADVLEKFQTLA------  271

Query  917   IGTSRRRTKIEAFSAYIWKVMV-NAVDKS---HNKCKMGWLVDGRTRIPGIMS-DYIGNV  753
               T+ +RTK+E+FSA++WK++  +A  +S       K+G +VDGR ++    + +Y GNV
Sbjct  272   --TNGKRTKLESFSAFLWKLLAKHAATESVLPTKTSKLGIVVDGRKKLMEQENCNYFGNV  329

Query  752   LSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLG  573
             LS+ FGE  +D+L H  +S +   VH  + +    +HFL+LIDW+E  RP  ++S++   
Sbjct  330   LSVPFGERRIDDLIHKPLSWVTDEVHKLLESTMTKDHFLNLIDWVETSRPIPVISRIYST  389

Query  572   RDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSA---RGDGSW  402
                 G A VVSSG+ FPV  ++FG+GSPV G+          GYV   PS     G G W
Sbjct  390   GSNDGPAFVVSSGKSFPVARIDFGWGSPVFGSY-HLPPGSRAGYVMTMPSPVENGGSGDW  448

Query  401   TVSAILWPDMVAALESHSECIFQPI  327
             TV   L    +  +E  +  +F P+
Sbjct  449   TVYLHLTKGQLRFIEQEASHVFNPV  473



>dbj|BAB09608.1| unnamed protein product [Arabidopsis thaliana]
Length=481

 Score =   222 bits (565),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 154/445 (35%), Positives = 237/445 (53%), Gaps = 33/445 (7%)
 Frame = -1

Query  1634  PKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGR  1455
             P+  ++ LSNLDLL     +   +F++ P         I D LK ++++ L  +Y  +G 
Sbjct  54    PENRVIPLSNLDLLIPPVDINVCFFYKKP-----LYGIIGDALKTAMAEALVSYYVLSGE  108

Query  1454  IVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFA  1275
             +  NP   E EILC N GV  VEA A++ L+EL  Y    Y    K VP  ++ G     
Sbjct  109   VSINPTNGENEILCSNGGVEFVEAAADVELRELNLYE--PYQSIAKFVP-MKKHG----V  161

Query  1274  VQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-TNKPPSCSPDHrrfllrpr  1098
               IQ+T   CG + +  TFDH + DA S   FL +W+E++ ++ P S  P  +R LL+PR
Sbjct  162   FAIQVTELKCGSVVVGCTFDHRIADAYSMNMFLVSWAEISRSDIPISYVPLLKRSLLKPR  221

Query  1097  fppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDG  918
              P   ++S+D+ ++  +    L +    T   +I+  R+YYI A  + K Q LA      
Sbjct  222   RPLIIDSSIDKLYMPIT---SLTVPQEITNQDNILTSRIYYIKADVLEKFQTLA------  272

Query  917   IGTSRRRTKIEAFSAYIWKVMV-NAVDKS---HNKCKMGWLVDGRTRIPGIMS-DYIGNV  753
               T+ +RTK+E+FSA++WK++  +A  +S       K+G +VDGR ++    + +Y GNV
Sbjct  273   --TNGKRTKLESFSAFLWKLLAKHAATESVLPTKTSKLGIVVDGRKKLMEQENCNYFGNV  330

Query  752   LSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLG  573
             LS+ FGE  +D+L H  +S +   VH  + +    +HFL+LIDW+E  RP  ++S++   
Sbjct  331   LSVPFGERRIDDLIHKPLSWVTDEVHKLLESTMTKDHFLNLIDWVETSRPIPVISRIYST  390

Query  572   RDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSA---RGDGSW  402
                 G A VVSSG+ FPV  ++FG+GSPV G+          GYV   PS     G G W
Sbjct  391   GSNDGPAFVVSSGKSFPVARIDFGWGSPVFGSY-HLPPGSRAGYVMTMPSPVENGGSGDW  449

Query  401   TVSAILWPDMVAALESHSECIFQPI  327
             TV   L    +  +E  +  +F P+
Sbjct  450   TVYLHLTKGQLRFIEQEASHVFNPV  474



>ref|XP_006424489.1| hypothetical protein CICLE_v10028364mg [Citrus clementina]
 gb|ESR37729.1| hypothetical protein CICLE_v10028364mg [Citrus clementina]
Length=469

 Score =   221 bits (562),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 146/414 (35%), Positives = 223/414 (54%), Gaps = 29/414 (7%)
 Frame = -1

Query  1517  IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLN  1338
             +D LK ++++ L  +Y  AG +V N    EPE+LC+NRGV  VEA A + L++L  YN +
Sbjct  63    VDVLKKAMAEALVSYYALAGEVVYN-YDGEPELLCNNRGVDFVEAYAEVELRDLNLYNPD  121

Query  1337  KYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSEL  1158
             + +E GKL+P  ++ G     + +Q T   CGG+ +  T DH + DA S   FL +W+ +
Sbjct  122   ESIE-GKLLPKKKKNG----LLSVQATELKCGGIVVACTLDHRIADAYSTNMFLVSWAGI  176

Query  1157  ATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS--IMLKR  984
             A +KP S  P  RR +L PR P   + + D+ ++  S              ++   ++ R
Sbjct  177   AQSKPMSVLPSFRRSILNPRRPLCIDHAFDDMYLPISSLPPPPPPNNTPEEANGNNLISR  236

Query  983   LYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMV---NAVDKSHNK-CKM  816
             +YYI +  +++LQ LAS ++       +RTK+E+FSAY+WK++    N  D S  +  KM
Sbjct  237   IYYIKSEQLNELQLLASSDE------CKRTKLESFSAYLWKMVALSGNDNDGSGTRISKM  290

Query  815   GWLVDGRTRIPGI----------MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAI  666
             G +VDGRTR+             M  Y GNVLS+ FG   ++EL    +S +A  VH  +
Sbjct  291   GVVVDGRTRLSSSKGDHVNKSISMDSYFGNVLSVPFGGQKVNELIEKPLSWVAKRVHDFL  350

Query  665   STATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPV  486
               A   +HFL LIDW+E  RP   +SK+       G A VVSSG+RFPV +++FG+G PV
Sbjct  351   ENAVTKDHFLGLIDWVEARRPDPAISKICATGSKDGPAFVVSSGQRFPVSKVDFGWGKPV  410

Query  485   LGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
              G+          GYV   PS   +  W V   L    +  +E+ +  +F+ +T
Sbjct  411   FGSYHFPWGS-DAGYVMPMPSPAHNSDWVVYMHLSEKQLDLIETQASNVFERLT  463



>ref|XP_004966759.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Setaria 
italica]
Length=476

 Score =   220 bits (560),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 153/462 (33%), Positives = 237/462 (51%), Gaps = 35/462 (8%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +L  SNLDL+ G F +  +  + +P    ++    +   +ASL   LSRF+PFAGR+V
Sbjct  26    PAMLAASNLDLILGSFHLYLIAVYPAPAAGFNAVAAAV---RASLPAFLSRFFPFAGRVV  82

Query  1448  PNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQ  1269
              N  T  PEI C+N G  +V A     L E++F N ++ +  G +   F Q      A+ 
Sbjct  83    TNASTGVPEIACNNAGAELVVANVGTSLAEMDFANADRSL--GIIQVPFEQ----GLALS  136

Query  1268  IQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfll-rprfp  1092
             +Q+ R+ CGG    +  DH L D     +    W+EL      S  P H R  L RPR P
Sbjct  137   LQLVRFACGGFAFVWGADHLLVDGHGLMELPNAWAELLRAGGLSWEPQHDRVSLFRPRSP  196

Query  1091  pRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIG  912
             PRY+ +LD  F   +   +     P  LL + +++R+Y +  + + +L+  AS  D    
Sbjct  197   PRYSPALDAEFTRYAPASL-----PNPLLVATLVRRMYVVSGADLDRLRAAASTAD----  247

Query  911   TSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI------PGIMSDYIGNVL  750
               RR T++EA SA+IWK++  AV  S   C++ WLVDGR  +         +  Y+GNV+
Sbjct  248   --RRATRLEALSAHIWKLLAAAVGGSDTHCRLAWLVDGRRHLDPSKYDKARLGRYLGNVV  305

Query  749   SLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECH----RPGLMLSKM  582
             +    E++++ +    I+ +A+   AAI  A  +E + +L+DW+E +    R G   ++ 
Sbjct  306   TYASREVAVESISSAPIADVATMAGAAIKKAFRSERYEELVDWMEANKGVFRDGGKWTEA  365

Query  581   V-LGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGS  405
             V +G   P  A+VVSS   F V E +FGFG P L        R+G   +    S   DGS
Sbjct  366   VGVGTGSP--ALVVSSFVPFRV-EGDFGFGRPRLVMPWVRPGRLGSAAMMVARSPEEDGS  422

Query  404   WTVSAILWPDMVAALESHSECIFQPITAHDLHLS*LQSCHSI  279
             W V+A +WP +  A+E+  E +F+P TA  L  S  +S  ++
Sbjct  423   WVVTARMWPQLADAVEADLEAVFRPATAARLGFSVPESVSAV  464



>ref|XP_006343402.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Solanum tuberosum]
Length=474

 Score =   219 bits (558),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 149/422 (35%), Positives = 232/422 (55%), Gaps = 32/422 (8%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             I+  LK SL++ L  +Y F+G IV N    EPE+LC+N  V  +EA  ++ LKE+ FYN 
Sbjct  67    IVKILKTSLAETLVSYYAFSGEIVEN-SAGEPELLCNNGSVSFIEAFGDVELKEINFYNP  125

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ + R K VP  +++ G    + IQ TR  CGG+ +  TFDH + DA S   FL + SE
Sbjct  126   DESIGR-KFVP--KKKHG---VLAIQATRLKCGGIIVGCTFDHRVADAYSANLFLVSLSE  179

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPP--PTLLS--SIM  993
             L   K  S  P  RR  L PR P  Y+ S+++ +V  S        PP  P +L+    +
Sbjct  180   LVQCKLLSQLPSFRRSSLFPRHPGYYDDSINDLYVPIS------TLPPTKPEILNPNDQV  233

Query  992   LKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS---HNKC  822
             + R+YY+    I  LQ L +  D       +R+K+E+FSA++WK +   ++K     +  
Sbjct  234   ISRIYYVTGDKIEHLQSLTNCHDQKSTKYSQRSKLESFSAFLWKTIACGINKETSGFSNF  293

Query  821   KMGWLVDGRTRI----------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHA  672
             + G +VDGRTR+             +  Y GN+LS+ FGE  ++ELK  +++ +A+ +H 
Sbjct  294   RFGLVVDGRTRLISNDVDVNNQDKSLKGYFGNILSIPFGEKKVEELKEKSLNWVANVIHE  353

Query  671   AISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGS  492
              +  A   EHFL +IDW+E HRP   ++K +   +G G+A+VVSS + FP  ++ FG+G 
Sbjct  354   FLDIAKTQEHFLGMIDWVEAHRPKPSIAK-IYAMNGDGSAVVVSSRKHFPAKKINFGWGQ  412

Query  491   PVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDL  312
             P   +     +    GYV   PS +G+G W V+  L    +  +E+    +F+PITA+ L
Sbjct  413   PAFWSYHFPWDG-KAGYVMPMPSPKGNGDWIVNMHLLKWQMELIEASPSHVFEPITANYL  471

Query  311   HL  306
             +L
Sbjct  472   NL  473



>gb|KDP35222.1| hypothetical protein JCGZ_09381 [Jatropha curcas]
Length=466

 Score =   218 bits (556),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 143/410 (35%), Positives = 220/410 (54%), Gaps = 30/410 (7%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +++Q L  +Y F G +V NP   E E+LC+NRGV   E  A+I LK+L+ YN 
Sbjct  62    MVSVLKKAMAQVLVSYYGFGGEVVSNP-LGESELLCNNRGVDFFEGFADIELKDLDLYNP  120

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  VE GKLVP  +     D  + IQ T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  121   DHSVE-GKLVPKKK-----DGVLAIQATELKCGGIVVGCTFDHRIADAYSTNMFLVSWAE  174

Query  1160  LATNKPPSCSPD-HrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS----I  996
              A +KP S  P   R  L   R     +TS+D+ +V  S      + P    L++     
Sbjct  175   TAQSKPISILPSFRRSLLNPRRPIRCIDTSMDDLYVPISS----FISPEEPELNNDDHDR  230

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSH-----  831
             ++ R+YY+ A  +  LQ +AS       +  + TK+E+FSA++W+++    +KS+     
Sbjct  231   IVSRIYYVKAEELTNLQYIASS------SGFKCTKLESFSAFLWQLIAKYANKSNPSNGK  284

Query  830   -NKCKMGWLVDGRTRIPGI-MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTA  657
                 K+G +VDGR+++    M  Y GNVLS+ +    +DEL +  +S +A  VH  +  A
Sbjct  285   VKMSKIGIIVDGRSKLNDTKMGRYFGNVLSIPYHSERIDELVNHNLSSMADIVHDFLKKA  344

Query  656   TNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGT  477
                EHFL LIDW+E +RP   ++K+       G A VVSSG+RFPV +++FG+G P+ G+
Sbjct  345   VTKEHFLGLIDWVEANRPVKCVAKVYANGKDDGPAFVVSSGQRFPVCKVDFGWGKPIFGS  404

Query  476   VCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                       GY+   PS   +G W +   L+   +  LE+ +   F+P 
Sbjct  405   YHFPWGG-NAGYIMPMPSPLENGDWILYMHLFRKQLEFLETEASNFFKPF  453



>ref|XP_004967783.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Setaria italica]
Length=476

 Score =   218 bits (555),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 150/482 (31%), Positives = 247/482 (51%), Gaps = 29/482 (6%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHS  1533
             MA+V+   D ++  ++  +VK    + KP++L+LSNLDLL+     +    +  P+    
Sbjct  1     MASVNGGGDLQLRVVSRRLVKASDSSIKPHVLSLSNLDLLNQSIQASTFCIYPKPSTGAG  60

Query  1532  SS-PKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKEL  1356
                  ++   ++ LS  L+ F+PFAGRI  +P +  PE+ C N+G  +V  +A + L  L
Sbjct  61    GGFDAVVAAFESGLSSFLNHFFPFAGRIATDPGSGLPELRCGNQGAELVVGEAGVALATL  120

Query  1355  EFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFL  1176
             ++  +   V R +L  A      +D  + +Q+  + CGG  + +   H L D  S +  +
Sbjct  121   DYGAVGAAVRRFQLPYA------EDVPLSVQVVSFACGGFTVAWCTHHVLLDGKSLSFLV  174

Query  1175  TTWSELATNK---PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLL  1005
               WSELA +         P+H R + RPR PP Y+ +LDE F        +N+       
Sbjct  175   NAWSELARSGETLAAGSRPNHDRSVFRPREPPSYSATLDEAFTPLDTKHQINV----LTA  230

Query  1004  SSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV-DKSHN  828
             +   ++RLYYIDAS I +L++ AS  D      +R T+++A SAY+WK +   V   +  
Sbjct  231   NQSFVERLYYIDASDIERLRRAASRNDG----YQRATRVQAVSAYLWKALAGVVAGTAEA  286

Query  827   KCKMGWLVDGRTRIP-----GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIS  663
             +C+MGW VDGR RI        M +Y+GN ++   GE S+ E+    +  +A+ V  AI+
Sbjct  287   RCRMGWRVDGRRRIADPERRAAMRNYVGNFITYAVGEASVAEVLRMPLPDVAAMVREAIA  346

Query  662   T-ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPV  486
               A   E   +L+DW+E H+    +   +LG   P  ++   S  R    + +FGFG   
Sbjct  347   APAPYEERLQELVDWVEEHKTRAYVETAILGVGSPILSVTTLSSFRT---DTDFGFGHAA  403

Query  485   LGTVCST-IERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLH  309
             +    +T   R+  GYV        +G+W V+A++WP++ AALE+    + +P+TA  L 
Sbjct  404   MAVPTATAAARLCSGYVQVFSRPGDEGTWFVNALVWPELAAALEADEPRVLRPVTAEYLG  463

Query  308   LS  303
             LS
Sbjct  464   LS  465



>gb|EAY73387.1| hypothetical protein OsI_01269 [Oryza sativa Indica Group]
Length=494

 Score =   218 bits (556),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 143/488 (29%), Positives = 246/488 (50%), Gaps = 31/488 (6%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHS  1533
             MA   +  + +V  ++  +V+    + + ++L +SNLDLL     V+ +  + +P     
Sbjct  1     MATCINGGELQVRVVSRRLVQASDESLRLHVLAVSNLDLLPQSIQVSMICIYPNPPTSAG  60

Query  1532  SSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELE  1353
                 ++    A L   L+ F+P AGRIV NP +  PEI C N+G  +V  +A++ L  L+
Sbjct  61    GFHDVVAAFAAGLPSLLNHFFPLAGRIVSNPCSGLPEIHCHNQGAELVVGEADVALASLD  120

Query  1352  FYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLT  1173
             +  + + +++  L+P        D A+ +Q+  + CGG  + +  +H + D S+ +  + 
Sbjct  121   YGRVGESIQK-ILLPY-----AGDVALSVQVVSFACGGFTVAWGTNHVVVDGSALSMLVG  174

Query  1172  TWSELATNK--PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSS  999
             +WSELA +        P+H R + RPR  P Y  SLDE F    LD     +        
Sbjct  175   SWSELARSGTLAAGARPNHDRSVFRPRATPSYGASLDEAFT--PLDGNGERQINVLTRDQ  232

Query  998   IMLKRLYYIDASSIHKLQKLAS-EEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKC  822
              +++RLYY++A+ I +LQ++AS    DG     R T+++A SAY+WK +   V +   +C
Sbjct  233   SLVRRLYYVEAADIARLQEMASLPAADG----ERATRVQAISAYLWKALAGVVRERDARC  288

Query  821   KMGWLVDGRTRIP-----GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTA  657
             +MGW VDGR R+          +Y+GNV++ T  E +++E++   ++++AS    AI+  
Sbjct  289   RMGWWVDGRRRLASPELRAATRNYVGNVVAYTVAEATVEEIQRKPLAEVASMARRAIAAP  348

Query  656   TNAEHFLDLIDWIECHR---PGLMLSKMV----LGRDGPGAAIVVSSGRRFPVGELEFGF  498
                EHF +L+DW+E H+   P     + V    +G   P  ++   +       +  +G 
Sbjct  349   AYDEHFQELVDWVEEHKAPAPEQEQQRYVEAATVGLGSPTVSVTAFAPSLAADTDFGYGH  408

Query  497   GSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHS----ECIFQP  330
              +  L    S+  R+  G+V       GDGS   S ++WP + AALE+        IF+P
Sbjct  409   AAMALPVSSSSGARLCSGFVRIIARPGGDGSCFASVLVWPRLAAALEAGDGERLGRIFKP  468

Query  329   ITAHDLHL  306
             +TA  L L
Sbjct  469   VTAEYLGL  476



>gb|ABG75942.1| coniferyl alcohol acyltransferase [Petunia x hybrida]
Length=454

 Score =   216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 244/473 (52%), Gaps = 35/473 (7%)
 Frame = -1

Query  1691  SDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIID  1512
             +DF V    + VV  V      + L +SNLDLL         + ++  ++ ++ +    +
Sbjct  4     TDFHVTVKKKEVVAAVLPMHHEHWLPMSNLDLLLPPLDFGVFFCYKR-SKINNDTKDDDE  62

Query  1511  NLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKY  1332
              +K +L++ L  FY  AG +V N    EPE+LC+NRGV    A A+I L  L+ Y+ +  
Sbjct  63    TIKKALAETLVSFYALAGEVVFN-SLGEPELLCNNRGVDFFHAYADIELNNLDLYHPDVS  121

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-  1155
             V   KL+P  ++ G     + +Q+T   CGG+ +  TFDH + DA S   FL  W+ +A 
Sbjct  122   VHE-KLIP-IKKHG----VLSVQVTGLKCGGIVVGCTFDHRVADAYSANMFLVAWAAIAR  175

Query  1154  -TNKPPSCSPDHrrfllrprfppRYNTS-LDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
               N   +  P  RR LL PR PP+++ S +D T+V  S         PP   + ++  R+
Sbjct  176   KDNNINTVIPSFRRSLLNPRRPPQFDDSFIDSTYVFLS--------SPPKQPNDVLTSRV  227

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVD  801
             YYI++  I+ LQ  A+          +R+K+E FSA++WK +         +CK+G +VD
Sbjct  228   YYINSQEINLLQSQATR------NGSKRSKLECFSAFLWKTIAEGGIDDSKRCKLGIVVD  281

Query  800   GRTRI----PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLD  633
             GR R+       M +Y GNVLS+ + E S+ +LK   + K+A  VH  +    N  HF  
Sbjct  282   GRQRLRHDSSTTMKNYFGNVLSVPYTEASVGQLKQTPLGKVADLVHTCLDNVANEHHFPS  341

Query  632   LIDWIECHRPGLMLSKMVLGRD-GPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIER  456
             LIDW+E HRP   + K+    +    AAIVVSSG RFP+ ++ FG+G P  G   S I  
Sbjct  342   LIDWVELHRPRQAIVKVYCKDECNDEAAIVVSSGLRFPLSQVNFGWGCPDFG---SYIFP  398

Query  455   IG--VGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
              G   GYV   PS   +G W V   L    +  +E+ +  IF P+TA  L L+
Sbjct  399   WGGQTGYVMPMPSPNKNGDWIVYMHLQKKHLDLVETRAPHIFHPLTACYLDLT  451



>ref|XP_010535222.1| PREDICTED: agmatine coumaroyltransferase-1-like [Tarenaya hassleriana]
Length=462

 Score =   216 bits (550),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 146/428 (34%), Positives = 226/428 (53%), Gaps = 18/428 (4%)
 Frame = -1

Query  1583  FPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNR  1404
             F V + Y   S N    S   ++  LK +L + L  ++ F+G +  +    + ++LC++ 
Sbjct  42    FCVFFCYDLGSNNGERRSFGSMVATLKEALEETLVHYHAFSGELTSD-SLGQLQLLCNDH  100

Query  1403  GVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTF  1224
             GV   +A A++ L+ L  +  +      +LVP   ++GG    + +Q T  +CG + ++ 
Sbjct  101   GVHFSQAYASVDLRHLNLHMYHLEESMYRLVPD--KQGG---VLSVQATELSCGSVIVSC  155

Query  1223  TFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSL  1044
               DH + DA S   FL +W+E A + PPS  P  RR LL PRFP + + SL+E +   S 
Sbjct  156   RVDHRVADAYSTNMFLVSWAESARSAPPSVFPSFRRSLLSPRFPLKLDPSLEELYFPLSS  215

Query  1043  DDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIW  864
                LN +PP +     ++ RL+Y+ A  + ++Q+LAS E  G     R TK+EA SA +W
Sbjct  216   VSPLN-QPPKSDSDDKIVSRLFYVKAQKVEEIQRLASSEKSG-----RVTKLEAMSAVLW  269

Query  863   KVMVNAVDKS--HNKCKMGWLVDGRTRIPG--IMSDYIGNVLSLTFGELSMDELKHGTIS  696
             K+       S    +  +G +VDGRTR+ G   +  Y+GNVL+  F     DEL    + 
Sbjct  270   KLAAKTEQMSGRRKRTMLGVVVDGRTRLAGDDELGSYVGNVLAFPFRGRDTDELVKRPLE  329

Query  695   KIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVG  516
              +A  VHA +      EHF+ LIDWIE H+P  M   +    DGP   +VVSSGRRFPV 
Sbjct  330   WVAREVHAVVKAGAEEEHFMGLIDWIEAHKPKPMTPGLYWVDDGP--IVVVSSGRRFPVE  387

Query  515   ELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIF  336
             E++FG+G PVLG+         + YV   PSA  +G W +  +L   +V  +   +  +F
Sbjct  388   EVDFGWGPPVLGSYYYRDWGSEMEYVMPMPSATVEGDWVIYTLLRKRVVDLIVEAAGDVF  447

Query  335   QPITAHDL  312
             QP+++  L
Sbjct  448   QPMSSKYL  455



>ref|XP_003553148.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Glycine max]
Length=472

 Score =   216 bits (549),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 142/430 (33%), Positives = 211/430 (49%), Gaps = 63/430 (15%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +L++ L  +Y FAG +VPN    EPE+LC+NRGV  VEA A++ LK L FYN 
Sbjct  69    MVGTLKKALARALISYYVFAGEVVPN-NMGEPEVLCNNRGVDFVEAVADVELKCLNFYNP  127

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  +E G+ VP  +++ G    + +Q T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  128   DDTIE-GRFVP--KKKNG---VLAVQATSLKCGGIIVACTFDHRVADAYSTNMFLVSWAE  181

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI-----  996
             +A    P+ +                          C    +L+ R P ++  S+     
Sbjct  182   MAQPTKPNNAVTAAAATAYRH--------------PCFRRSLLSPRRPGSIHPSLHHMYT  227

Query  995   ---------------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWK  861
                            +L R+YY+ A  +H++Q LA+           RTK+E FSA++WK
Sbjct  228   PISEFPPPPASAATALLSRIYYVKAEQLHRMQFLAA----------TRTKLECFSAFLWK  277

Query  860   VMVNAVDKSHNK----CKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDEL  714
             ++  A  K  N      KMG +VDGR R+         +M  Y GNVLS+ F    + EL
Sbjct  278   MVALAASKEENGKRVVAKMGIVVDGRKRLGNGDKESEAMMECYFGNVLSIPFDGKPVQEL  337

Query  713   KHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSG  534
                 +  +A  VH  +  A   EHFL LIDW+E HRP   ++K+       G A VVSSG
Sbjct  338   VEKPLGFVAEAVHEFLMAAATEEHFLGLIDWVEDHRPVPGVAKIYYSNTKEGPAFVVSSG  397

Query  533   RRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALES  354
             +RFP  +++FG+G  V  +          GYV   PS   +G W V   L    +  +ES
Sbjct  398   QRFPEDKVDFGWGKVVFASYHFPWAG-EAGYVMPMPSPLENGDWVVYMHLAKKQLEIIES  456

Query  353   HSECIFQPIT  324
              +  +F+P+T
Sbjct  457   EAAHVFKPLT  466



>ref|XP_002891015.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67274.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=432

 Score =   213 bits (543),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 149/406 (37%), Positives = 228/406 (56%), Gaps = 34/406 (8%)
 Frame = -1

Query  1523  KIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYN  1344
             ++ + LKASL++ L  +Y FAG +V N    EPEILC+NRGV  +EA A++ L+EL  ++
Sbjct  43    QLAETLKASLAEALVSYYAFAGELVKN-YVGEPEILCNNRGVDFLEALADVELRELNLHD  101

Query  1343  LNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWS  1164
              ++ +   KLVP  +++ G    + IQ+T+  C  + +  TFDH + DA S   FL +W+
Sbjct  102   PDESI--AKLVP--KKKHG---VLAIQVTQLKCESIVVGCTFDHQIADAFSMNMFLVSWA  154

Query  1163  ELA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFV---SCSLDDILNMRPPPTLLSSI  996
             E++ ++ P S  P  RR +L PR P   ++S+D+ ++   S  L       P      +I
Sbjct  155   EISRSDVPISSVPSFRRSMLNPRRPLIIDSSIDKMYMPATSLPLPQETTNDP-----DNI  209

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKM  816
             +  R+YYI  +++  LQ+LAS      G S+R TK+E+FSA++WK+          K K+
Sbjct  210   LTSRIYYIKGNALEDLQRLASSSSSKNGYSQR-TKLESFSAFLWKL----------KSKI  258

Query  815   GWLVDGRTRI-PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHF  639
             G +VDGR R+     S Y GNVLS+ FG  S+++L    +S +++ VH  +  A   +HF
Sbjct  259   GIVVDGRRRLMEKENSTYFGNVLSIPFGGHSINDLIDKPLSWLSNEVHKFLEEAVTKDHF  318

Query  638   LDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIE  459
             L+LIDW+E HRP   +S++       G A VVSSG  FPV +++FG+G PV G+     E
Sbjct  319   LNLIDWVEIHRPIPAVSRIYSTGANDGPAFVVSSG--FPVTKVDFGWGLPVFGSYHFPWE  376

Query  458   RIGVGYVNQRPSA--RGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                 GYV   PS    GDG W V   L    +  +E     + +PI
Sbjct  377   G-SAGYVMPMPSPVDDGDGDWVVYLYLTKGQLKFIEEEVAHVLKPI  421



>ref|XP_003617373.1| Taxadien-5-alpha-ol O-acetyltransferase [Medicago truncatula]
 gb|AET00332.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=473

 Score =   214 bits (546),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 153/447 (34%), Positives = 241/447 (54%), Gaps = 47/447 (11%)
 Frame = -1

Query  1580  PVTYLYFFRSPN---QFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCD  1410
             PV+   FF   N      +++  I+  LK SL++ L  +Y FAG +V N    EPE+LC+
Sbjct  40    PVSIGVFFCYKNPMITIGTTNNTIVGCLKNSLAEALVSYYVFAGEMVTN-SMGEPELLCN  98

Query  1409  NRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCL  1230
             NRGV  VEA A++ L+ L+ Y   + +E GKLVP  +++ G    + +Q T   CGGL +
Sbjct  99    NRGVDFVEAVADVELQSLDLYKPEETIE-GKLVP--KKKYG---VLAVQATWMKCGGLVV  152

Query  1229  TFTFDHALGDASSFAKFLTTWSELA---TNKP--PSCSPDHrrfllrprfppRYNTSLDE  1065
                FDH + DA S   FL +W+E+A    NK   P+  P  +R LL PR PP  + SL +
Sbjct  153   ACNFDHRIADAYSANMFLVSWAEIARSSNNKSLIPTTQPCFQRSLLTPRHPPSIHPSLYD  212

Query  1064  TFVSCSLDDILNMRPPPT------LLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSR  903
              ++  S     ++ PPP       + ++ ++ R+YY+ +  ++ +Q LA+  + G   S 
Sbjct  213   MYIPIS-----DLPPPPESKPELDIKTNPLISRMYYVTSEELNTMQLLANTNNSG---SV  264

Query  902   RRTKIEAFSAYIWKVMVNAVDKSHNK--CKMGWLVDGRTRIPG-------IMSDYIGNVL  750
             +R+K+E+FSA++WK++ +A   +      KMG +VDGR R+          MS Y GNVL
Sbjct  265   KRSKLESFSAFLWKMVASAASTNSENVVAKMGIVVDGRKRLSNGDKNKEEFMSSYFGNVL  324

Query  749   SLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGR  570
             S  +    ++EL   ++  +   VH  +  A   EHFL LIDW+E HRP   L+++  G 
Sbjct  325   STPYSCRLIEELVEKSLCWVTEQVHEFVEVADTEEHFLGLIDWVEEHRPVPGLARIYCGV  384

Query  569   DG--PGAAIVVSSGRRFPVGELEFGFGSPVLGTV---CSTIERIGVGYVNQRPSARGDGS  405
              G   G   VVSSG+RF   +++FG+G PV+G+    C        GYV   PS + +G 
Sbjct  385   TGGADGPTFVVSSGQRFSESKVDFGWGKPVVGSYHIPCGG----DAGYVMPMPSPKRNGD  440

Query  404   WTVSAILWPDMVAALESHSECIFQPIT  324
             W +   L  + +  + + +   F+PI+
Sbjct  441   WLLYMNLPKEYLHFMVAEAPHFFRPIS  467



>gb|KHN13176.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=469

 Score =   213 bits (543),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 145/431 (34%), Positives = 214/431 (50%), Gaps = 68/431 (16%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LK +L++ L  +Y FAG +VPN    EPE+LC+NRGV  VEA A++ LK L FYN 
Sbjct  69    MVGTLKKALARALISYYVFAGEVVPN-NMGEPEVLCNNRGVDFVEAVADVELKCLNFYNP  127

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  +E G+ VP  +++ G    + +Q T   CGG+ +  TFDH + DA S   FL +W+E
Sbjct  128   DDTIE-GRFVP--KKKNG---VLAVQATSLKCGGIIVACTFDHRVADAYSTNMFLVSWAE  181

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI-----  996
             +A    P+        ++       Y          C    +L+ R P ++  S+     
Sbjct  182   MAQPTKPN-------NVITAAAASGYRHP-------CFRRSLLSPRRPGSIHPSLHHMYT  227

Query  995   ---------------MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWK  861
                            +L R+YY+ A  +H++Q LA+           RTK+E FSA++WK
Sbjct  228   PISEFPPPPASAATALLSRIYYVKAEQLHRMQFLAA----------TRTKLECFSAFLWK  277

Query  860   VMVNAVDKSHNK----CKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDEL  714
             ++  A  K  N      KMG +VDGR R+         +M  Y GNVLS+ F    + EL
Sbjct  278   MVALAASKEENGKRVVAKMGIVVDGRKRLGNGDKESEAMMECYFGNVLSIPFDGKPVQEL  337

Query  713   KHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSG  534
                    +A  VH  +  AT  EHFL LIDW+E HRP   ++K+       G A VVSSG
Sbjct  338   VE---KPLAEAVHEFLMAATTEEHFLGLIDWVEDHRPVPGVAKIYYSNTKEGPAFVVSSG  394

Query  533   RRFPVGELEFGFGSPVLGTVCSTIERIG-VGYVNQRPSARGDGSWTVSAILWPDMVAALE  357
             +RFP  +++FG+G  V  +        G  GYV   PS   +G W V   L    +  +E
Sbjct  395   QRFPEDKVDFGWGKVVFASY--HFPWAGEAGYVMPMPSPLENGDWVVYMHLAKKQLEIIE  452

Query  356   SHSECIFQPIT  324
             S +  +F+P+T
Sbjct  453   SEAAHVFKPLT  463



>ref|XP_010248256.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like, partial 
[Nelumbo nucifera]
Length=355

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/339 (38%), Positives = 186/339 (55%), Gaps = 32/339 (9%)
 Frame = -1

Query  1265  QITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPD-Hrrfllrprfpp  1089
             Q T   CGGL +  TFDH + DA S   F  +W+E+A  KP S +P   R  L   +   
Sbjct  26    QATELKCGGLVVACTFDHRVADAYSANMFFVSWAEIAQAKPISITPSFRRSLLNPRKPAG  85

Query  1088  RYNTSLDETFVSCSLDDILNMRPPPTLLSSI------MLKRLYYIDASSIHKLQKLASEE  927
              Y+ SLDE ++  S      M PPP  ++ +      ++ R+YY+ A  I +LQ  A+  
Sbjct  86    CYDPSLDEMYIPIS------MLPPPPTVAELGVHDDHLISRIYYVTAQDIDRLQSQANSN  139

Query  926   DDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIP--------GIMS  771
                    ++R+KIE+FSA++WK++  + +    +CKMG +VDGR R+           M 
Sbjct  140   -----GYKKRSKIESFSAFLWKMVAKSSNDDAKRCKMGIVVDGRRRLSMDGEGKTTCSMD  194

Query  770   DYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLML  591
              Y GNVLS+ FG+ S+ ELK   ++ +A  VH  +  A   EHFL LIDW+E HRP   L
Sbjct  195   TYFGNVLSIPFGDESVSELKTRPLNWVAGVVHNYLKDAVTKEHFLGLIDWVEDHRPEPAL  254

Query  590   SKMVLGR---DGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSA  420
             +K+   R   DGP    VVSSG+RFPVG ++FG+GSP+ G+     +    GYV   PS+
Sbjct  255   AKIYCSRRNMDGP--TFVVSSGQRFPVGMVDFGWGSPIFGSYHFPWQG-EAGYVMPMPSS  311

Query  419   RGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
             RG+G W V   +    +  LE+ +  +F+P+T   L LS
Sbjct  312   RGNGDWIVYMHMPKGQLEFLEAEAADVFRPLTRGYLKLS  350



>gb|AFW55789.1| agmatine coumaroyltransferase [Zea mays]
Length=468

 Score =   213 bits (541),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 147/488 (30%), Positives = 248/488 (51%), Gaps = 41/488 (8%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHS  1533
             M AV SC D  +  ++  +VK    + +P+++T SNLDL       + +  +  P     
Sbjct  1     MPAVGSC-DVSIRVLSRRLVKASDPSLQPHVVTFSNLDLYPDNVQASIVCLY--PKLSTK  57

Query  1532  SSP-----KIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIR  1368
             S P      ++   +A L   L+ FYP AGRIV NP +  PE+ C N+G  +V  +  + 
Sbjct  58    SGPGGGFDAVVSTFEAVLPTLLNHFYPLAGRIVVNPSSGVPELHCHNQGAELVVGEVGVA  117

Query  1367  LKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSF  1188
             L  L+ Y L +   +  ++P       +D  + +Q+  + CGG  + +  ++ L D ++ 
Sbjct  118   LGSLD-YGLAEESLKKIMMPY-----PEDVTLSVQLLSFACGGFSVVWANNNLLNDGNAI  171

Query  1187  AKFLTTWSELATNKPP-----SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMR  1023
                +  WSELA          + S +H R + RPR PP Y+ +LD  F +      +N  
Sbjct  172   TMCVRMWSELARAGGSIATVGAVSVNHDRSMFRPRNPPAYSDALDAMFATYDDHRTVNA-  230

Query  1022  PPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVM---V  852
                   ++  ++RLYY++A+ I KL+ +A+     +   +R ++++A SAY+WKV+   V
Sbjct  231   ---LTAAASFVERLYYVEAADIAKLRDMAT-----VTELQRPSRVQAVSAYLWKVLAAVV  282

Query  851   NAVDKSHNKCKMGWLVDGRTRIPG-----IMSDYIGNVLSLTFGELSMDELKHGTISKIA  687
              A      +C MGW+VD R R+        M +Y GNV +   G  +++E++   ++++A
Sbjct  283   AACRVPEERCCMGWMVDARRRVKSPELIPAMRNYFGNVTAYALGGAAVEEIRRKPLAEVA  342

Query  686   SHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELE  507
             + V   I++    E+  +L+DW+E H+   ++ K VLG   P     V +   FP+ +  
Sbjct  343   AMVRETITSIDYDEYLQELVDWVEVHKTEHVMEKGVLGLGSPTLNQTVFAS--FPL-DTN  399

Query  506   FGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
             FGFG   L        R+  GY++      GDGSW +SA +WP M AALE  S+ +F+P+
Sbjct  400   FGFGDAALALPICDYGRLCSGYLSVGARPGGDGSWLLSAYIWPQMAAALE--SDGVFKPL  457

Query  326   TAHDLHLS  303
             TA  L L+
Sbjct  458   TAEYLGLT  465



>dbj|BAA92405.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase -like [Oryza 
sativa Japonica Group]
 dbj|BAA92409.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase -like [Oryza 
sativa Japonica Group]
 dbj|BAB03452.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase -like [Oryza 
sativa Japonica Group]
Length=460

 Score =   212 bits (540),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 150/489 (31%), Positives = 237/489 (48%), Gaps = 67/489 (14%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPN---Q  1542
             MA+  +  +  V  +   +VK    + +P++L +SNLDL+     V+    +  P+    
Sbjct  1     MASCINGGELHVRVVHRRLVKASDESIRPHVLAVSNLDLIPRTIQVSMFCIYPKPSTGGD  60

Query  1541  FHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLK  1362
             FH     ++    A L   L+ F+P AGRIV NP +  PEI C N+G  +V  +A++ L 
Sbjct  61    FH----DVVAAFAAGLPSLLNHFFPLAGRIVSNPCSGLPEIHCHNQGAELVVGEADVALA  116

Query  1361  ELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAK  1182
              L++  +   V  GK++  +      D A+ +Q+  + CGG  + +  +H + D S+ + 
Sbjct  117   SLDYGTVGASV--GKILLPY----AGDVALSVQVVSFACGGFTVAWGTNHVVVDGSALSM  170

Query  1181  FLTTWSELATNK--PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
              ++ WSELA +        P+H R + RPR PP Y  SLDE F    LD           
Sbjct  171   LVSAWSELARSGTLAAGARPNHDRSVFRPRSPPSYGASLDEAFTP--LDGARQ-------  221

Query  1007  LSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN  828
                          A+ I +L++ A           R T+++A SAY+WK +   V     
Sbjct  222   -------------AADIARLREQA-----------RATRVQAVSAYLWKALAAVVGSRDA  257

Query  827   KCKMGWLVDGRTRIP--------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHA  672
             +C+M W VDGR R+           M  Y+GNV +    E +M+E++   ++++AS    
Sbjct  258   RCRMVWWVDGRRRLTLSSSPELRAAMRSYVGNVTTFAVAEATMEEIQRKPLAEVASMARD  317

Query  671   AISTATNAEHFLDLIDWIECHRPGLM--LSKMVLGRDGPGAAIVVSSGRRFPVGELEFGF  498
             AI+     EHF +L+DW+E H+ G    +    +G   P  A+ V++   F V + +FG 
Sbjct  318   AIAAPAYGEHFQELVDWVEEHKAGKQRYIDTASVGLGSP--AVSVTAFASFEV-DTDFGH  374

Query  497   GSPVLGT-VCSTIERIGVGYVN--QRPSARGDGSWTVSAILWPDMVAALESHSEC--IFQ  333
             G   +     S+  R+  G+V    RP   GDGSW  SA+LWP + AALES      IF+
Sbjct  375   GHAAMALPTSSSSARLCTGFVQIAARPGG-GDGSWIASALLWPRLAAALESDERLGRIFK  433

Query  332   PITAHDLHL  306
             P+TA  L L
Sbjct  434   PVTAEYLGL  442



>ref|NP_001146980.1| LOC100280589 [Zea mays]
 gb|ACG24879.1| agmatine coumaroyltransferase [Zea mays]
Length=468

 Score =   212 bits (540),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 148/488 (30%), Positives = 248/488 (51%), Gaps = 41/488 (8%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHS  1533
             M AV S SD  +  ++  +VK    + +P+++T SNLDL       + +  +  P     
Sbjct  1     MPAVGS-SDVSIRVLSRRLVKASDPSLQPHVVTFSNLDLYPDNVQASIVCLY--PKLSTK  57

Query  1532  SSP-----KIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIR  1368
             S P      ++   +A L   L+ FYP AGRIV NP +  PE+ C N+G  +V  +  + 
Sbjct  58    SGPGGGFDAVVSTFEAVLPTLLNHFYPLAGRIVVNPSSGVPELHCHNQGAELVVGEVGVA  117

Query  1367  LKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSF  1188
             L  L+ Y L +   +  ++P       +D  + +Q+  + CGG  + +  ++ L D ++ 
Sbjct  118   LGSLD-YGLAEESLKKIMMPY-----PEDVTLSVQLLSFACGGFSVVWANNNLLNDGNAI  171

Query  1187  AKFLTTWSELATNKPP-----SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMR  1023
                +  WSELA          + S +H R + RPR PP Y+ +LD  F +      +N  
Sbjct  172   TMCVRMWSELARTGGSIATVGAVSVNHDRSMFRPRNPPAYSDALDAMFATYDDHRTVNA-  230

Query  1022  PPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVM---V  852
                   ++  ++RLYY++A+ I KL+ +A+     +   +R ++++A SAY+WKV+   V
Sbjct  231   ---LTAAASFVERLYYVEAADIAKLRDMAT-----VTELQRPSRVQAVSAYLWKVLAAVV  282

Query  851   NAVDKSHNKCKMGWLVDGRTRIPG-----IMSDYIGNVLSLTFGELSMDELKHGTISKIA  687
              A      +C MGW+VD R R+        M +Y GNV +   G  +++E++   ++++A
Sbjct  283   AACRVPEERCCMGWMVDARRRVKSPELIPAMRNYFGNVTAYALGGAAVEEIRRKPLAEVA  342

Query  686   SHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELE  507
             + V   I++    E+  DL+DW+E H+   ++ K VLG   P     V +   FP+ +  
Sbjct  343   AMVRDTITSIDYDEYLQDLVDWVEVHKTEHVMEKGVLGLGSPTLNQTVFAS--FPL-DTN  399

Query  506   FGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
             FGFG   L        R+  GY++      GDGSW +SA +WP M AALE  S+ +F+P+
Sbjct  400   FGFGDAALALPICDYGRLCSGYLSVGARPGGDGSWLLSAYIWPQMAAALE--SDGVFKPL  457

Query  326   TAHDLHLS  303
             TA  L L+
Sbjct  458   TAEYLGLT  465



>ref|NP_001130649.1| transferase isoform 1 [Zea mays]
 gb|ACF78955.1| unknown [Zea mays]
 gb|ACF79032.1| unknown [Zea mays]
 gb|AFW75531.1| transferase isoform 1 [Zea mays]
 gb|AFW75532.1| transferase isoform 2 [Zea mays]
Length=471

 Score =   209 bits (533),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 149/451 (33%), Positives = 241/451 (53%), Gaps = 35/451 (8%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +L  SNLDL+ G F +  +  + +P    +  P ++   + ++   LSRF+PFAGR+V
Sbjct  26    PAVLQASNLDLILGSFHIYLIAMYPAPA---AGFPAVVAAARDAMPAFLSRFFPFAGRVV  82

Query  1448  PNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQ  1269
              N  T  PEI CDN G  +V A+A +RL +++F + ++ +  G++   F+Q    D A+ 
Sbjct  83    ANADTGVPEIACDNTGAELVVARAGVRLADVDFADADRSL--GRIAVPFQQ----DLALS  136

Query  1268  IQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfll-rprfp  1092
             +Q+ R+ CGG  L++  +H L D        + W+EL      S  P H R  L RPR P
Sbjct  137   LQLVRFACGGFALSWGTNHLLVDGHGLTALPSAWAELLRTGGLSWEPHHERASLFRPRDP  196

Query  1091  pRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIG  912
             PRY+ SLD  F   +   +     P +LL++ +++R Y + A+ + +L+  AS       
Sbjct  197   PRYSASLDAEFTRYAPAGL-----PNSLLTATLVRRNYVVSAADVDRLRAAASTP-----  246

Query  911   TSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIPGIMSD------YIGNVL  750
              +RR T++EA SA++WK++  AV      C+M WLVDGR R+     D      Y+GNVL
Sbjct  247   -ARRATRLEALSAHVWKLLAAAVGGLDAHCRMAWLVDGRPRLDAARYDGATVRRYLGNVL  305

Query  749   SLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECH----RPGLMLSKM  582
             +    E +++ +    ++ +A+   AAI+     E + +L+DW+E H    R G   +++
Sbjct  306   TYASREAAVEAVSSSPLADVAAMAGAAIAEVFRWERYEELVDWMEVHKGVFREGGKWTEV  365

Query  581   V-LGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGS  405
             V  G   P  A+VVS+   F V E +FGFG P L        R+G   +    S R DGS
Sbjct  366   VGTGMGSP--ALVVSTFVPFRV-EGDFGFGRPRLVFPWVRPGRLGSAAMTVSRSPREDGS  422

Query  404   WTVSAILWPDMVAALESHSECIFQPITAHDL  312
             W ++A +WP +  A+++  + + +P TA  L
Sbjct  423   WLITARMWPRLADAVDADPDAVLKPATAARL  453



>emb|CDY38115.1| BnaC02g06580D [Brassica napus]
Length=333

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 132/339 (39%), Positives = 194/339 (57%), Gaps = 24/339 (7%)
 Frame = -1

Query  1517  IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLN  1338
             +D LK SL++ L  +Y  AG +V NP T EPEILC+N GV VVEA A++ L+EL  ++  
Sbjct  1     MDALKRSLAEALVSYYVLAGEVVANPITGEPEILCNNGGVEVVEAAADVELRELNLHD--  58

Query  1337  KYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSEL  1158
              Y    K VP  +  G       IQIT   CG L +  TFDH + DA S   FL +W+++
Sbjct  59    PYQSLAKFVP-MKVHG----VFAIQITELKCGSLVVGCTFDHRIADAYSMNMFLHSWAQI  113

Query  1157  A-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             + ++ P S  P   R LL PR P   ++S+D+ ++  +    L +    T   +I+  R+
Sbjct  114   SRSDVPTSYMPSFNRSLLNPRRPLVIDSSVDQMYMPVT---SLPLPQETTNPDNILTSRI  170

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVN----AVDKSHNKCKMG  813
             YYI A  + +LQ LA     G G   +RTK+E+FSA++WK++        D      K+G
Sbjct  171   YYIKADVVRELQTLA-----GNG---KRTKLESFSAFLWKLVAKHAATTTDSKLLNSKLG  222

Query  812   WLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFL  636
              +VDGR ++    ++ Y GNVLS+ FGE  +D+L H ++S +A  VH  + ++   +HFL
Sbjct  223   IVVDGRKKLTEQETNTYFGNVLSVPFGEQIIDDLTHKSLSWVADEVHKVLESSVTRDHFL  282

Query  635   DLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPV  519
             +LIDWIE  RP  +LS++       G A VVSSG+ FPV
Sbjct  283   NLIDWIETRRPVPVLSRIYGTGSEEGPAFVVSSGKSFPV  321



>gb|AFW75530.1| hypothetical protein ZEAMMB73_669200, partial [Zea mays]
Length=492

 Score =   209 bits (532),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 148/450 (33%), Positives = 240/450 (53%), Gaps = 33/450 (7%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +L  SNLDL+ G F +  +  + +P    +  P ++   + ++   LSRF+PFAGR+V
Sbjct  26    PAVLQASNLDLILGSFHIYLIAMYPAPA---AGFPAVVAAARDAMPAFLSRFFPFAGRVV  82

Query  1448  PNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQ  1269
              N  T  PEI CDN G  +V A+A +RL +++F + ++ +  G++   F+Q    D A+ 
Sbjct  83    ANADTGVPEIACDNTGAELVVARAGVRLADVDFADADRSL--GRIAVPFQQ----DLALS  136

Query  1268  IQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfll-rprfp  1092
             +Q+ R+ CGG  L++  +H L D        + W+EL      S  P H R  L RPR P
Sbjct  137   LQLVRFACGGFALSWGTNHLLVDGHGLTALPSAWAELLRTGGLSWEPHHERASLFRPRDP  196

Query  1091  pRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIG  912
             PRY+ SLD  F   +   +     P +LL++ +++R Y + A+ + +L+  AS       
Sbjct  197   PRYSASLDAEFTRYAPAGL-----PNSLLTATLVRRNYVVSAADVDRLRAAASTP-----  246

Query  911   TSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIPGIMSD------YIGNVL  750
              +RR T++EA SA++WK++  AV      C+M WLVDGR R+     D      Y+GNVL
Sbjct  247   -ARRATRLEALSAHVWKLLAAAVGGLDAHCRMAWLVDGRPRLDAARYDGATVRRYLGNVL  305

Query  749   SLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECH----RPGLMLSKM  582
             +    E +++ +    ++ +A+   AAI+     E + +L+DW+E H    R G   ++ 
Sbjct  306   TYASREAAVEAVSSSPLADVAAMAGAAIAEVFRWERYEELVDWMEVHKGVFREGGKWTE-  364

Query  581   VLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSW  402
             V+G      A+VVS+   F V E +FGFG P L        R+G   +    S R DGSW
Sbjct  365   VVGTGMGSPALVVSTFVPFRV-EGDFGFGRPRLVFPWVRPGRLGSAAMTVSRSPREDGSW  423

Query  401   TVSAILWPDMVAALESHSECIFQPITAHDL  312
              ++A +WP +  A+++  + + +P TA  L
Sbjct  424   LITARMWPRLADAVDADPDAVLKPATAARL  453



>gb|EAY99655.1| hypothetical protein OsI_21633 [Oryza sativa Indica Group]
Length=468

 Score =   206 bits (524),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 144/482 (30%), Positives = 237/482 (49%), Gaps = 43/482 (9%)
 Frame = -1

Query  1709  AAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRS---PNQF  1539
             AAV +  D  +  ++  +VK    T +P++ T+SNLDL    +  + +  + S       
Sbjct  5     AAVPAGEDLTIRVVSRRLVKASDATIQPHVATVSNLDLYFNNYQASMVCLYPSNLPAAGV  64

Query  1538  HSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKE  1359
               S   ++   +A L   L+ FYP AGRIV +P +  PE+ C N+G  +V  + +  L  
Sbjct  65    AGSFDAVVAAFEAGLPSLLNHFYPLAGRIVVDPVSRLPELHCHNQGAELVVGEVDAALGS  124

Query  1358  LEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKF  1179
             L+F  ++  + R  L+P       DD  + +Q+ R+ CGG  + +  +H   D    +  
Sbjct  125   LDFAGMDGSLRR-ILLPY-----PDDVMLSVQLLRFACGGFSVVWGNNHLPNDGHGISMV  178

Query  1178  LTTWSELATNK--PPSCSPDHrrfllrprfppRYNTSLDETFVS----CSLDDILNMRPP  1017
             +  WSELA           +H R + RPR PP Y  ++  TF +      L ++L  +  
Sbjct  179   VRMWSELARTGRIGDGVVVNHDRSVFRPRSPPSYGAAVRATFAAYHDESRLVNVLTTQ--  236

Query  1016  PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDK  837
                     ++RLYYI+A  + +L+ +AS         RR ++++A SA++WK +   V  
Sbjct  237   -----DSFVERLYYIEAGDVARLRDMAST------GQRRASRVQAVSAFLWKALAGVVAA  285

Query  836   S---HNKCKMGWLVDGRTRI--PGI---MSDYIGNVLSLTFGELSMDELKHGTISKIASH  681
             S     +C+MGW VD R R+  P +   M  + GN+ +   GE +++E+    ++++A+ 
Sbjct  286   SRVPEERCRMGWWVDARRRVASPALVPAMHSFFGNMTAYALGEAAVEEILERPLAEVAAM  345

Query  680   VHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFG  501
                AI++     +  +L+DW+E H+   M+    LG   P     V +   FP+ + +FG
Sbjct  346   AREAIASIDYDAYVQELVDWVEEHKAEKMMEVSALGLGSPTVNQTVFAS--FPL-DTDFG  402

Query  500   FGSPVLGTVCSTIERIGVG--YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
             FG   L        R+  G   V  RP   GDGSW VSA +WP + AALES    IF+P+
Sbjct  403   FGEATLAMPVWENGRVSSGTLAVGARPG--GDGSWLVSAYIWPRLAAALESDDHRIFKPL  460

Query  326   TA  321
             TA
Sbjct  461   TA  462



>gb|EEE54281.1| hypothetical protein OsJ_01188 [Oryza sativa Japonica Group]
Length=450

 Score =   205 bits (521),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 147/489 (30%), Positives = 232/489 (47%), Gaps = 77/489 (16%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPN---Q  1542
             MA+  +  +  V  +   +VK    + +P++L +SNLDL+     V+    +  P+    
Sbjct  1     MASCINGGELHVRVVHRRLVKASDESIRPHVLAVSNLDLIPRTIQVSMFCIYPKPSTGGD  60

Query  1541  FHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLK  1362
             FH     ++    A L   L+ F+P AGRIV NP +  PEI C N+G  +V  +A++ L 
Sbjct  61    FH----DVVAAFAAGLPSLLNHFFPLAGRIVSNPCSGLPEIHCHNQGAELVVGEADVALA  116

Query  1361  ELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAK  1182
              L++  +   V  GK++  +      D A+ +Q+  + CGG  + +  +H + D S+ + 
Sbjct  117   SLDYGTVGASV--GKILLPY----AGDVALSVQVVSFACGGFTVAWGTNHVVVDGSALSM  170

Query  1181  FLTTWSELATNK--PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
              ++ WSELA +        P+H R + RPR PP Y  SLDE F                 
Sbjct  171   LVSAWSELARSGTLAAGARPNHDRSVFRPRSPPSYGASLDEAFTP---------------  215

Query  1007  LSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN  828
                        +D +     Q LA             T+++A SAY+WK +   V     
Sbjct  216   -----------LDGAR----QALA-------------TRVQAVSAYLWKALAAVVGSRDA  247

Query  827   KCKMGWLVDGRTRIP--------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHA  672
             +C+M W VDGR R+           M  Y+GNV +    E +M+E++   ++++AS    
Sbjct  248   RCRMVWWVDGRRRLTLSSSPELRAAMRSYVGNVTTFAVAEATMEEIQRKPLAEVASMARD  307

Query  671   AISTATNAEHFLDLIDWIECHRPGLM--LSKMVLGRDGPGAAIVVSSGRRFPVGELEFGF  498
             AI+     EHF +L+DW+E H+ G    +    +G   P  A+ V++   F V + +FG 
Sbjct  308   AIAAPAYGEHFQELVDWVEEHKAGKQRYIDTASVGLGSP--AVSVTAFASFEV-DTDFGH  364

Query  497   GSPVLGT-VCSTIERIGVGYVN--QRPSARGDGSWTVSAILWPDMVAALESHSEC--IFQ  333
             G   +     S+  R+  G+V    RP   GDGSW  SA+LWP + AALES      IF+
Sbjct  365   GHAAMALPTSSSSARLCTGFVQIAARPGG-GDGSWIASALLWPRLAAALESDERLGRIFK  423

Query  332   PITAHDLHL  306
             P+TA  L L
Sbjct  424   PVTAEYLGL  432



>ref|XP_006343401.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Solanum tuberosum]
Length=382

 Score =   203 bits (516),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 144/388 (37%), Positives = 213/388 (55%), Gaps = 34/388 (9%)
 Frame = -1

Query  1415  CDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGL  1236
             C   GV  +EA  ++ LKE+ FYN ++ +E GK VP  +++ G    + IQ+T+  CGG+
Sbjct  10    CTYSGVSFIEAFGDVELKEINFYNPDESIE-GKFVP--KKKHG---VLAIQVTQLKCGGI  63

Query  1235  CLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFV  1056
              L  TFDH + DA S   FL +WSELA +KP S  P  RR  L PR P  Y+ S+D+ +V
Sbjct  64    ILGCTFDHRVADAYSANLFLVSWSELAQSKPLSQLPSFRRSSLFPRHPGYYDDSIDDLYV  123

Query  1055  SCSL-----DDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTK  891
               S       +ILN  P   ++S     R+YY+    I  LQ LA+  D   G   +R+K
Sbjct  124   PISTLPPTKSEILN--PNDQVIS-----RIYYVTGDKIEHLQSLANCHDQK-GIKSQRSK  175

Query  890   IEAFSAYIWKVMVNAVDKS---HNKCKMGWLVDGRTRIPGIMSD----------YIGNVL  750
             +E+FSA++WK +   ++K     N  + G +V+GRTR+     D          Y GNVL
Sbjct  176   LESFSAFLWKSIACGINKETSGFNNFRFGIVVNGRTRLISNNVDVNNQDKSLKGYFGNVL  235

Query  749   SLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGR  570
             S+ FGE  ++ELK  ++  +A+ VH  +  A   EHFL LIDW+E HRP   ++K +   
Sbjct  236   SIPFGEKKVEELKEKSLHWVANVVHEFLDIAKTQEHFLGLIDWVEAHRPEPSIAK-IYAM  294

Query  569   DGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSA  390
             +G G A+VVSSG+ FP  ++ FG+G P   +         VGYV    S +G+G W V  
Sbjct  295   NGDGPAVVVSSGQHFPAKKINFGWGLPAFWSYHFPWAG-KVGYVMPMSSPKGNGDWIVYM  353

Query  389   ILWPDMVAALESHSECIFQPITAHDLHL  306
              L    +  +E+    +F+ +TA+ L+L
Sbjct  354   HLLKWQMELIEASPSQVFELVTANYLNL  381



>ref|XP_003561102.1| PREDICTED: rosmarinate synthase-like [Brachypodium distachyon]
Length=475

 Score =   205 bits (522),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 150/459 (33%), Positives = 230/459 (50%), Gaps = 43/459 (9%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +L +SNLDL+ G F V ++  + +P    +  P +    +A+L   LSRF+PFAGRIV
Sbjct  27    PAVLPVSNLDLIFGSFHVFFISVYPAPT---AGFPAVAAAARAALPAFLSRFFPFAGRIV  83

Query  1448  PNPKTDEPEILCDNRG--VLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFA  1275
             PN  T  PEI C N G  +++  A A  RL +++F++ ++ +  G++   F QRG    A
Sbjct  84    PNASTGIPEIHCSNAGAELVIARAGAGTRLADVDFFDADRSL--GRIQVPF-QRG---LA  137

Query  1274  VQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE-LATNKPPSCSP-DHrrfllrp  1101
             + +Q+  + CGG  LT+  DH L D          W+E L T + P   P  H       
Sbjct  138   LSLQLVGFACGGFALTWGSDHLLLDGRGLTALPNAWTELLRTGELPWPDPLSHLARASLF  197

Query  1100  rfpp--RYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEE  927
                   +Y  S+D  FV       L    P  LL + +++R Y +  +++ +L+  AS  
Sbjct  198   LPRSPCQYPLSMDAEFVRYDAPGSL----PNPLLVATLVRRNYVVSNAAVDRLRAAAS--  251

Query  926   DDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT-----RIPGIMSDYI  762
                 G+SR    +EA SA++WK++  AV  S   C+M WLVDGR      + PG  + Y+
Sbjct  252   ----GSSR----LEALSAHVWKLLATAVGTSDTHCRMAWLVDGRRVLDMGKYPGAATAYL  303

Query  761   GNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHR------PG  600
             GNVL+    E +++ +    +  +A+   AAI  A   E +  L+DW+E H+       G
Sbjct  304   GNVLTYASREAAVETISASPLGDVAAMAAAAIGEALRQERYEALVDWMEEHKGAFREEGG  363

Query  599   LMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSA  420
                  + LG   P  A+VVS+   F V E +FGFG P +        R+G   +    S 
Sbjct  364   KWTEAVGLGTGSP--ALVVSAFVPFRV-EGDFGFGKPRMVMPWIRPGRLGSAAMTLIRSP  420

Query  419   RGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
              GDGSW V+A LWP +   ++   E +F+P TA  L  +
Sbjct  421   TGDGSWLVTARLWPRLAEVVDKDPEAVFRPATAERLGFA  459



>ref|XP_009609794.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nicotiana tomentosiformis]
Length=362

 Score =   201 bits (512),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 188/332 (57%), Gaps = 15/332 (5%)
 Frame = -1

Query  1274  VQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprf  1095
             V +Q+T+  CGGL +   FDH + DA S   FL +WSELA +KP +  P  R+  L PR 
Sbjct  36    VSLQVTQLKCGGLVVGCAFDHRVADAYSANLFLVSWSELAQSKPLTQLPSFRKSFLFPRH  95

Query  1094  ppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGI  915
             P  Y+ S+D  +V   +  I  ++P     +   + R+YY+    I+ LQ LA+   D  
Sbjct  96    PGYYDDSIDGLYVP--IPTIPLIKPETLNPNDQAISRIYYVTGEKINHLQSLANR--DQK  151

Query  914   GTSRRRTKIEAFSAYIWKVMVNAVDKSHN--KCKMGWLVDGRTRIPG-------IMSDYI  762
              T  +R+K+E+FSA++WK +   + ++ N    + G +VDGRTR+         ++  Y 
Sbjct  152   STKFQRSKLESFSAFLWKTIACGIKETSNSKNFRFGIIVDGRTRLSNGDDNQEKLLKGYF  211

Query  761   GNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKM  582
             GNVLS+ FG   ++ELK  ++S +A+ +H  I  A   EHFL LIDW+E HRP   ++K 
Sbjct  212   GNVLSIPFGNKKIEELKEKSLSWVANAIHEIIEKAVTREHFLGLIDWVEAHRPEPAVTK-  270

Query  581   VLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSW  402
             +   D  G A+VVSSG++FP  E++FG+G PV  +          GYV   PS +G+G W
Sbjct  271   IYATDDDGPAVVVSSGQQFPAREIDFGWGEPVFWSYHFPWAGKS-GYVMPMPSPKGNGDW  329

Query  401   TVSAILWPDMVAALESHSECIFQPITAHDLHL  306
              +   L    +  +E+ +  +F+P+TA+ L+L
Sbjct  330   IIYMHLMKWQLELIETSASHVFKPVTANYLNL  361



>ref|XP_006655791.1| PREDICTED: agmatine coumaroyltransferase-2-like [Oryza brachyantha]
Length=468

 Score =   204 bits (519),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 138/462 (30%), Positives = 236/462 (51%), Gaps = 37/462 (8%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +L +SNLDL+ G FP+  +  + +P     +   ++  ++A+    LSRF+PFAGR+V
Sbjct  26    PAVLAVSNLDLILGPFPMYLVSVYAAPPGGVGA---VLSAVRAAFRSYLSRFFPFAGRVV  82

Query  1448  PNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQ  1269
              +P T+ PEI+C+N G  +V A A + L  ++F + ++    G +   F         + 
Sbjct  83    RDPVTNIPEIVCNNAGAELVVADAAVPLAAVDFRDPDRST--GLMHVPFEA----SLPLS  136

Query  1268  IQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCS--PDHrrfllrprf  1095
             +Q+ R+ CGG  L     H L D  ++   L   +E+        S  P   R + RPR 
Sbjct  137   LQLVRFACGGFSLAVGTSHLLVDGRAYILLLNALAEMLREGSLCLSREPLLDRSIFRPRS  196

Query  1094  ppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGI  915
             PPR++ SLD  F   +   ++N      L+++ + +R+Y I+A+ +  LQK AS      
Sbjct  197   PPRFSPSLDAEFARFTPATMIN-----PLMAAAIQRRMYRIEAADLEGLQKAAS------  245

Query  914   GTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI------PGIMSDYIGNV  753
                RR ++  A  A++WK++  AV  S   C+M W+VDGR  +       G +  Y+GNV
Sbjct  246   AGGRRASRFVALCAHVWKLLARAVGDSDPNCRMAWIVDGRKALEPSVGGEGALDRYMGNV  305

Query  752   LSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRP-----GLMLS  588
             ++ T  E+S++E+    +  +A+ V  +I+     + F +L+DW+E ++      G    
Sbjct  306   ITYTSREVSVEEVLRMPLHGVAAMVRESITPVMTKDRFQELVDWMETNKAAFKDGGKWTE  365

Query  587   KMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDG  408
              + LG   P  A+V+S    FP+ + + GFG P L        R+G   +   P+  GDG
Sbjct  366   SVNLGLGSP--ALVISGLLPFPI-DGDLGFGKPRLVMPWVRHGRLGSASMTAVPTPAGDG  422

Query  407   SWTVSAI-LWPDMVAALESHSECIFQPITAHDLHLS*LQSCH  285
             SW +S   +WP ++  +ES  +C+ +P+TA  L  +   + H
Sbjct  423   SWFISGTRMWPRLLEVVESAPDCLLKPVTAASLGFASAAAAH  464



>gb|EAY73389.1| hypothetical protein OsI_01271 [Oryza sativa Indica Group]
Length=456

 Score =   202 bits (515),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 150/489 (31%), Positives = 237/489 (48%), Gaps = 71/489 (15%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPN---Q  1542
             MA+  +  +  V  +   +VK    + +P++L +SNLDL+     V+    +  P+    
Sbjct  1     MASCINGGELHVRVVHRRLVKASDESIRPHVLAVSNLDLIPRTIQVSMFCIYPKPSTGGD  60

Query  1541  FHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLK  1362
             FH     ++    A L   L+ F+P AGRIV NP +  PEI C N+G  +V  +A++ L 
Sbjct  61    FH----DVVAAFAAGLPSLLNHFFPLAGRIVSNPCSGLPEIHCHNQGAELVVGEADVALA  116

Query  1361  ELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAK  1182
              L++                   GG    V+++       G  + +  +H + D S+ + 
Sbjct  117   SLDY-------------------GG---VVRLR-------GFTVAWGTNHVVVDGSALSM  147

Query  1181  FLTTWSELATNK--PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
              ++ WSELA +        P+H R + RPR PP Y  SLDE F        +N+    T 
Sbjct  148   LVSAWSELARSGTLAAGARPNHDRSVFRPRSPPSYGASLDEAFTPLDGARQVNVL---TS  204

Query  1007  LSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN  828
               S +  RLYYI+A+ I +L++ A           R T+++A SAY+WK +   V     
Sbjct  205   DESFVGVRLYYIEAADIARLREQA-----------RATRVQAVSAYLWKALAAVVGSRDA  253

Query  827   KCKMGWLVDGRTRIP--------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHA  672
             +C+M W VDGR R+           M  Y+GNV +    E +++E++   ++++AS    
Sbjct  254   RCRMVWWVDGRRRLTLSSSPELRAAMRSYVGNVTTFAVAEATVEEIQRKPLAEVASMARD  313

Query  671   AISTATNAEHFLDLIDWIECHRPGLM--LSKMVLGRDGPGAAIVVSSGRRFPVGELEFGF  498
             AI+     EHF +L+DW+E H+ G    +    +G   P  A+ V++   F V + +FG 
Sbjct  314   AIAAPAYGEHFQELVDWVEEHKAGKQRYIDTASVGLGSP--AVSVTAFASFEV-DTDFGH  370

Query  497   GSPVLGT-VCSTIERIGVGYVN--QRPSARGDGSWTVSAILWPDMVAALESHSEC--IFQ  333
             G   +     S+  R+  G+V    RP   GDGSW  SA+LWP + AALES      IF+
Sbjct  371   GHAAMALPTSSSSARLCTGFVQIAARPGG-GDGSWIASALLWPRLAAALESDERLGRIFK  429

Query  332   PITAHDLHL  306
             P+TA  L L
Sbjct  430   PVTAEYLGL  438



>gb|KCW44660.1| hypothetical protein EUGRSUZ_L01809, partial [Eucalyptus grandis]
Length=440

 Score =   202 bits (514),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 141/404 (35%), Positives = 204/404 (50%), Gaps = 57/404 (14%)
 Frame = -1

Query  1562  FFRSPNQFHSSSPKI-----IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             FF   N   ++S K+     +  LKA+L + L  +Y  AG ++ N    EPE+LC+NRGV
Sbjct  49    FFCYTNPTTTASQKLEYGSMVGILKAALGKALVSYYALAGEVIQN-SVGEPELLCNNRGV  107

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
                EA A + L+ L  YN ++ +E GKLVP  ++RG     + +Q T   CGG+ +  TF
Sbjct  108   DFTEAFAEVELRHLNLYNPDETIE-GKLVPT-KKRG----VLAVQATELKCGGIVVACTF  161

Query  1217  DHALGDASSFAKFLTTWSELATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             DH + DA S   FL  W++ A +  P S  P   R LL PR P   N SLD  ++  S  
Sbjct  162   DHRIADAYSANMFLVFWADKARSAAPISLPPSFNRSLLNPRRPLCVNASLDSMYLPVSA-  220

Query  1040  DILNMRPPPTLLSS--------------IMLKRLYYIDASSIHKLQKLASEEDDGIGTSR  903
                 + PPP                    ++ R+YY+ A+ + KLQ+ A           
Sbjct  221   ----LPPPPKQKQKADEACETTTSRDDDCVVSRMYYVTAAELSKLQQRA------YSNGS  270

Query  902   RRTKIEAFSAYIWKVMVNAVDKSHNK-----CKMGWLVDGRTRI--------PGIMSDYI  762
             +R+K+E+FSA++WK++  +   + N       +MG +VDGR R+        P  M+ Y 
Sbjct  271   KRSKLESFSAFLWKMVAESSSGASNDDDKRMSRMGIVVDGRCRLMSQRMDDEPTPMASYF  330

Query  761   GNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKM  582
             GNVLS  FGE    E+    +S +A  VH  +  A   EHFLDLIDW+E HR    ++++
Sbjct  331   GNVLSKPFGEKRTTEVMEKPLSWVAEAVHEFVQRAATREHFLDLIDWVEEHRSVPAVARI  390

Query  581   VLGRDGP------GAAIVVSSGRRFPVGELEFGFGSPVLGTVCS  468
                            A VVSSG+RFPV E++FG+G P  G   S
Sbjct  391   YCKSGSAEEEEEGSTAFVVSSGQRFPVTEMDFGWGKPRWGPTTS  434



>ref|XP_002447065.1| hypothetical protein SORBIDRAFT_06g027990 [Sorghum bicolor]
 gb|EES11393.1| hypothetical protein SORBIDRAFT_06g027990 [Sorghum bicolor]
Length=466

 Score =   202 bits (515),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 160/473 (34%), Positives = 234/473 (49%), Gaps = 46/473 (10%)
 Frame = -1

Query  1676  DFITESVVKTVG--LTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLK  1503
             D +T + V TV   L  + + L LSNLDL+     V+ ++F   P             LK
Sbjct  20    DEVTITAVSTVAPALPVQEHRLPLSNLDLILPPIDVS-VFFCYVPAAGGRGHHHPAAVLK  78

Query  1502  ASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQAN-IRLKELEFYNLNKYVE  1326
             A+L++ L  +YP AG +V N    EPE+LC  RGV V EA A+   L++L     ++ VE
Sbjct  79    AALAKTLVAYYPLAGEVVAN-AAGEPELLCSGRGVDVAEATADGTALQDLRLSLPDESVE  137

Query  1325  RGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK  1146
                LVP  +++ G    + +Q+T++ CGG  +  TFDH + DA SF  FL  W+  A   
Sbjct  138   --PLVP--KKKAG---VMSVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAARGG  190

Query  1145  PPSCSPDHrrfllrprfppRYNTS-----LDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
                 +P   R  L PR P   +T+      D  FV  S          P L  +    R+
Sbjct  191   SAPPAPSFHRSFLAPREPAPLSTAGGNNLADRLFVPVSRA--------PALPDTAAANRI  242

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSH-----NKCKM  816
             Y + A  +  LQ  A            RTK+EAF+A++W++   A   S        C M
Sbjct  243   YCVSADDVAALQASAGSG---------RTKLEAFTAHLWQLYARAAAASRRQQRCQSCCM  293

Query  815   GWLVDGRTRI--PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEH  642
             G +VDGR+R+   G M  Y GNVL++ +G +  D L+   +  +A  VH  ++ A   EH
Sbjct  294   GVVVDGRSRLRRDGAMEAYFGNVLTIPYGVMGTDALRGMALGDVAGDVHRWVAEAATGEH  353

Query  641   FLDLIDWIECHRPGLMLSKMVLGRDGPGA---AIVVSSGRRFPVGELEFGFGSPVLGTVC  471
             F +L+DW+E  RP   +++  LGR   G    A VVSSG R P+GE++FG+G P   +  
Sbjct  354   FRELVDWVEEQRPEPTVARAYLGRGYGGEDAMACVVSSGMRLPIGEVDFGWGRPAFASYH  413

Query  470   STIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDL  312
                   G GYV   PSARGDG W V     P++V  +E+    +F+ +   D+
Sbjct  414   FPWPG-GAGYVMPMPSARGDGDWVVYVHAAPEVVGVMEAEP-TMFRALEGSDI  464



>ref|XP_010041079.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like, partial 
[Eucalyptus grandis]
Length=447

 Score =   202 bits (513),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 142/405 (35%), Positives = 206/405 (51%), Gaps = 59/405 (15%)
 Frame = -1

Query  1562  FFRSPNQFHSSSPKI-----IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGV  1398
             FF   N   ++S K+     +  LKA+L + L  +Y  AG ++ N    EPE+LC+NRGV
Sbjct  49    FFCYTNPTTTASQKLEYGSMVGILKAALGKALVSYYALAGEVIQN-SVGEPELLCNNRGV  107

Query  1397  LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTF  1218
                EA A + L+ L  YN ++ +E GKLVP  ++RG     + +Q T   CGG+ +  TF
Sbjct  108   DFTEAFAEVELRHLNLYNPDETIE-GKLVPT-KKRG----VLAVQATELKCGGIVVACTF  161

Query  1217  DHALGDASSFAKFLTTWSELATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLD  1041
             DH + DA S   FL  W++ A +  P S  P   R LL PR P   N SLD  ++  S  
Sbjct  162   DHRIADAYSANMFLVFWADKARSAAPISLPPSFNRSLLNPRRPLCVNASLDSMYLPVSA-  220

Query  1040  DILNMRPPPTLLSS--------------IMLKRLYYIDASSIHKLQKLASEEDDGIGTSR  903
                 + PPP                    ++ R+YY+ A+ + KLQ+ A           
Sbjct  221   ----LPPPPKQKQKADEACETTTSRDDDCVVSRMYYVTAAELSKLQQRA------YSNGS  270

Query  902   RRTKIEAFSAYIWKVMVNAVDKSHNK-----CKMGWLVDGRTRI--------PGIMSDYI  762
             +R+K+E+FSA++WK++  +   + N       +MG +VDGR R+        P  M+ Y 
Sbjct  271   KRSKLESFSAFLWKMVAESSSGASNDDDKRMSRMGIVVDGRCRLMSQRMDDEPTPMASYF  330

Query  761   GNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKM  582
             GNVLS  FGE    E+    +S +A  VH  +  A   EHFLDLIDW+E HR    +++ 
Sbjct  331   GNVLSKPFGEKRTTEVMEKPLSWVAEAVHEFVQRAATREHFLDLIDWVEEHRSVPAVAR-  389

Query  581   VLGRDGPG-------AAIVVSSGRRFPVGELEFGFGSPVLGTVCS  468
             +  + G          A VVSSG+RFPV E++FG+G P  G   S
Sbjct  390   IYCKSGSAEEEEEGSTAFVVSSGQRFPVTEMDFGWGKPRWGPTTS  434



>ref|NP_001042650.2| Os01g0261600 [Oryza sativa Japonica Group]
 dbj|BAF04564.2| Os01g0261600 [Oryza sativa Japonica Group]
Length=454

 Score =   202 bits (513),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 147/489 (30%), Positives = 230/489 (47%), Gaps = 73/489 (15%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPN---Q  1542
             MA+  +  +  V  +   +VK    + +P++L +SNLDL+     V+    +  P+    
Sbjct  1     MASCINGGELHVRVVHRRLVKASDESIRPHVLAVSNLDLIPRTIQVSMFCIYPKPSTGGD  60

Query  1541  FHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLK  1362
             FH     ++    A L   L+ F+P AGRIV NP +  PEI C N+G  +V  +A++ L 
Sbjct  61    FH----DVVAAFAAGLPSLLNHFFPLAGRIVSNPCSGLPEIHCHNQGAELVVGEADVALA  116

Query  1361  ELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAK  1182
              L++  +   V  GK++  +      D A+ +Q+  + CGG  + +  +H + D S+ + 
Sbjct  117   SLDYGTVGASV--GKILLPY----AGDVALSVQVVSFACGGFTVAWGTNHVVVDGSALSM  170

Query  1181  FLTTWSELATNK--PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
              ++ WSELA +        P+H R + RPR PP Y  SLDE F    LD           
Sbjct  171   LVSAWSELARSGTLAAGARPNHDRSVFRPRSPPSYGASLDEAFTP--LD-----------  217

Query  1007  LSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN  828
                               ++  L S+E              A SAY+WK +   V     
Sbjct  218   ---------------GARQVNVLTSDESS-----------PAVSAYLWKALAAVVGSRDA  251

Query  827   KCKMGWLVDGRTRIP--------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHA  672
             +C+M W VDGR R+           M  Y+GNV +    E +M+E++   ++++AS    
Sbjct  252   RCRMVWWVDGRRRLTLSSSPELRAAMRSYVGNVTTFAVAEATMEEIQRKPLAEVASMARD  311

Query  671   AISTATNAEHFLDLIDWIECHRPGLM--LSKMVLGRDGPGAAIVVSSGRRFPVGELEFGF  498
             AI+     EHF +L+DW+E H+ G    +    +G   P  A+ V++   F V + +FG 
Sbjct  312   AIAAPAYGEHFQELVDWVEEHKAGKQRYIDTASVGLGSP--AVSVTAFASFEV-DTDFGH  368

Query  497   GSPVLG-TVCSTIERIGVGYVN--QRPSARGDGSWTVSAILWPDMVAALESHSEC--IFQ  333
             G   +     S+  R+  G+V    RP   GDGSW  SA+LWP + AALES      IF+
Sbjct  369   GHAAMALPTSSSSARLCTGFVQIAARPGG-GDGSWIASALLWPRLAAALESDERLGRIFK  427

Query  332   PITAHDLHL  306
             P+TA  L L
Sbjct  428   PVTAEYLGL  436



>ref|XP_004964835.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Setaria 
italica]
Length=561

 Score =   204 bits (519),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 158/451 (35%), Positives = 237/451 (53%), Gaps = 35/451 (8%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +L  SNLDL+ G F   + Y         +  P +     A+L   LSRF+PFAGR+V
Sbjct  116   PAVLPASNLDLILGSF---HTYLVAVYPAPAAGFPAVAAAASAALPAFLSRFFPFAGRVV  172

Query  1448  PNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQ  1269
              N  T  PEI CDN G  +V A+A  RL +++F + ++ + R   VP FRQ      A+ 
Sbjct  173   TNASTGVPEIACDNAGAELVVAEAAARLADVDFADADRSLAR-VAVP-FRQ----GLALS  226

Query  1268  IQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfll-rprfp  1092
             +Q+ R+ CGG  L++  DH L D          W+EL      S  P H R  L RPR P
Sbjct  227   LQLVRFACGGFALSWGTDHLLADGHGLTMLPNAWAELLRTGGLSWEPHHERASLFRPRSP  286

Query  1091  pRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIG  912
             PR++ SLD  F   +   + N     TLL++ +++R Y + A+ + +L+  AS       
Sbjct  287   PRFSPSLDAEFTRYAPAGLPN-----TLLTAALVRRNYVVSAADVARLRTAASTP-----  336

Query  911   TSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI------PGIMSDYIGNVL  750
              +RR T++EA SA++WK++  AV  S   C+M WLVDGR R+       G +  Y+GNVL
Sbjct  337   -ARRATRLEALSAHVWKLLAAAVGGSDTHCRMAWLVDGRPRLDPARYDAGTVRRYLGNVL  395

Query  749   SLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECH----RPGLMLSKM  582
             +    E +++ +   T++ +A+   AAI+    +E F +L+DW+E      R G   ++ 
Sbjct  396   TYASREAAVEAVSSATLADVAAMAGAAIAEVFRSERFEELVDWMEARKGVFREGGKWTEA  455

Query  581   V-LGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGS  405
             V +G   P  A+VVS+   F V E +FGFG P L        R+G   +    S R DGS
Sbjct  456   VGVGTGSP--ALVVSAFVPFRV-EGDFGFGRPRLVMPWVRPGRLGSAAMTVARSPREDGS  512

Query  404   WTVSAILWPDMVAALESHSECIFQPITAHDL  312
             W ++A LWP +  A+++  E + +P TA  L
Sbjct  513   WVITARLWPRLADAVDADPEAVLKPATAARL  543



>ref|XP_004978226.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=456

 Score =   201 bits (511),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 160/469 (34%), Positives = 230/469 (49%), Gaps = 75/469 (16%)
 Frame = -1

Query  1670  ITESVVKTVG--LTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKAS  1497
             +T + V TV   L  + + L LSNLDL+     V   + +  P    SS    +  LKA+
Sbjct  20    VTITAVTTVAPALPVQEHRLALSNLDLILPPIDVGVFFCYADPGG--SSGAATV--LKAA  75

Query  1496  LSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQAN--IRLKELEFYNLNKYVER  1323
             L++ L  +YP AG +V N    EPE+LC  RGV V EA A     +++L     ++ VE 
Sbjct  76    LAKTLVAYYPLAGEVVAN-AAGEPELLCSGRGVDVAEASAGDGTDMRDLRLGLPDESVE-  133

Query  1322  GKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTW--------  1167
              +LVP  +++ G    + +Q+T++ CGG+ +  TFDH + DA SF  FL  W        
Sbjct  134   -QLVP--KKKAG---VMAVQVTKFGCGGIVVGCTFDHRVCDAYSFNMFLVAWAAAARGGP  187

Query  1166  ---------SELATNKP-PSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPP  1017
                      S LA  +P P C+                 T  D  FV  SL         
Sbjct  188   APPAPSFRRSFLAPRQPAPPCT----------------GTLADRLFVPVSLA--------  223

Query  1016  PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDK  837
             P L  +    R+Y + A+ +  LQ  A            RTK+EAF+A++W +   A  +
Sbjct  224   PALPDTAAANRIYRVSAADVAALQAAAGPG---------RTKLEAFTAHLWGLHARAASR  274

Query  836   SH-NKCKMGWLVDGRTRI---PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAA  669
                  C MG +VDGRTR+    G M  Y GNVLS+ +G +    L+   ++ +A  VH  
Sbjct  275   RRIGSCCMGVVVDGRTRLRGGDGAMGTYFGNVLSIPYGVMGAGALRGAALADVAGDVHRW  334

Query  668   ISTATNAEHFLDLIDWIECHRPGLMLSKMVLGR--DGPGA-AIVVSSGRRFPVGELEFGF  498
             ++ A   EHF +L+DW+E  RP   +++  LGR   G GA A VVSSG R P+GE++FG+
Sbjct  335   VAEAATGEHFRELVDWVEARRPEPTVARAYLGRGEGGEGATACVVSSGMRLPIGEVDFGW  394

Query  497   GSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESH  351
             G P   +        G GYV   PSARGDG W V   + P++V A+E  
Sbjct  395   GRPAFASYHFPWPG-GAGYVMPMPSARGDGDWVVYVHVAPEVVEAMEEE  442



>dbj|BAJ86050.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   201 bits (510),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 147/452 (33%), Positives = 227/452 (50%), Gaps = 36/452 (8%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +  +SNLDL+ G FP+  +  +  P +       ++  ++A+L   LSRF+PFAGR+V
Sbjct  26    PAVQAVSNLDLVLGPFPIHLVSIYPPPPRGLG---PVLAAVRAALPAYLSRFFPFAGRVV  82

Query  1448  PNPKTDEPEILCDNRGV-LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAV  1272
              +P T+ PE+ CDN G  LVV   A + L  ++F  +++ +  G +   F       FA+
Sbjct  83    RDPDTNVPEVACDNAGAELVVADAAGVPLAAVDFARVDRSL--GMIQIPFDPA----FAL  136

Query  1271  QIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPD---Hrrfllrp  1101
              +Q+ R+ CGG  LT   +H L D  +F   L   +E+        S      R  LL P
Sbjct  137   SLQVVRFACGGFALTVATNHLLADGRAFVLLLNCLAEMVRGGGGGLSRGPLLDRSSLLAP  196

Query  1100  rfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDD  921
             R PP Y  SLD  F   +   ++N      LL++ M +RLY IDA+ +  LQ  AS    
Sbjct  197   RSPPVYGPSLDAEFARFTPATMIN-----PLLAAAMERRLYRIDAADLVALQNAASS---  248

Query  920   GIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI---PGIMSDYIGNVL  750
                  RR ++  A  A++WK++  AV  S   C+M W+VDGR  +    G +  Y+GNV+
Sbjct  249   ---AGRRTSRFVALCAHVWKLLARAVGDSDPNCQMAWIVDGRKCVEPSEGALDMYMGNVV  305

Query  749   SLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRP-----GLMLSK  585
             + T  E  + EL    +  +A+   AA+++ T  + F +L+DW+E ++      G     
Sbjct  306   TYTSREAPVAELLRAPLQDVAAAARAAMASVTTRDRFQELVDWVEANKTAYKDGGKWTEA  365

Query  584   MVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGS  405
             + LG   P  A+V+S    F + + + GFG P L        R+G   V   P   GDGS
Sbjct  366   VNLGLGSP--ALVISGLLPFAI-DGDLGFGKPRLVLPWLRHGRLGSASVTVVPCPGGDGS  422

Query  404   WTVSAI-LWPDMVAALESHSECIFQPITAHDL  312
             W V    LWP +V  +E+  E + +P+TA  L
Sbjct  423   WFVGGTRLWPRLVEVVENVPESLLKPVTAASL  454



>gb|ACF85647.1| unknown [Zea mays]
 gb|AFW55788.1| agmatine coumaroyltransferase [Zea mays]
Length=462

 Score =   201 bits (510),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 147/483 (30%), Positives = 246/483 (51%), Gaps = 37/483 (8%)
 Frame = -1

Query  1715  TMAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFH  1536
             TMAA D  S   +  ++  +VK    + +P++++LSNLDL      +  L  +  PN   
Sbjct  4     TMAANDPTS---IRVVSRRLVKASDASIQPHVMSLSNLDLYVCDSQLGTLCVY--PNAGG  58

Query  1535  SSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKEL  1356
               S +I    ++ L   L+  YPFAGR+V NP +  PE+ C N+G  +V  +  + L  L
Sbjct  59    GFSARIPSLFESLLPSLLNYLYPFAGRLVTNPSSGLPELHCHNQGAELVVGEVGVALGSL  118

Query  1355  EFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFL  1176
              +      V+  K+V  F +    D  + +Q+  + CGG  + +  +H +GD    A  +
Sbjct  119   NYGATKDSVK--KMVLPFPR----DVLLSVQLLSFACGGFSVMWWINHLVGDGHVGATIV  172

Query  1175  TTWSELATNKPPSCSP--DHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLS  1002
              TWS+LA       +P  ++ R + RPR PP Y+ S+  TF +         R P  L +
Sbjct  173   RTWSQLARTGDIGGAPPLNYDRSVFRPRSPPSYSDSVAATFTTFD-----EQRLPNALTA  227

Query  1001  SI-MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD----K  837
                 + R+YY++AS I  L+  A+       T++R T++EA SAY+WK + + V      
Sbjct  228   EASFVDRVYYVEASDIAALRDTAAAAT----TAQRPTRVEALSAYLWKALADVVAACPRS  283

Query  836   SHNKCKMGWLVDGRTRIPG-----IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHA  672
             +  +C+MGW V  R R+       +M  Y+GNV +   G+   +E+    ++++A+ V  
Sbjct  284   NKERCRMGWWVSARRRVTAPKLVALMPGYLGNVTTYALGDAPAEEIVRKPLAEVAAMVRD  343

Query  671   AISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGS  492
             AI++    E+  +++DW+E H+   ++   V+G   P   +  S    FP+ + +FGFG 
Sbjct  344   AITSVDYDEYLQEMVDWVEVHKTEGLMEAAVIGVGAP--TLNQSVMTTFPL-DTDFGFGQ  400

Query  491   PVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDL  312
               L T  S   R+   +++      GDGSW V+A +WP + AALE  S+ IF+ +TA  L
Sbjct  401   ATLATTVSDYGRLCSAFLSVGARPGGDGSWLVTAYIWPQLAAALE--SDGIFKLLTAEYL  458

Query  311   HLS  303
              L+
Sbjct  459   GLA  461



>ref|XP_002436488.1| hypothetical protein SORBIDRAFT_10g003560 [Sorghum bicolor]
 gb|EER87855.1| hypothetical protein SORBIDRAFT_10g003560 [Sorghum bicolor]
Length=459

 Score =   200 bits (508),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 145/434 (33%), Positives = 229/434 (53%), Gaps = 29/434 (7%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +LT+SNLDL+ G FP+  +  + +P    +    ++  ++A+L   LS  +PFAGR+V
Sbjct  26    PSVLTVSNLDLVLGPFPIFLVSIYAAPA---AGPDTVLAAVRATLPSYLSHLFPFAGRVV  82

Query  1448  PNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQ  1269
              +P+T  PE+ C+N G  +V A A + L  ++F  +++ +  G +   F        A+ 
Sbjct  83    LDPETKIPEVACNNAGAELVVADAAVPLAAVDFSEVDQSL--GLIQIPFDT----SLALS  136

Query  1268  IQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfpp  1089
             +Q+ R+ CGG  LT    H L D  +F   LT  +E+  +   S  P   R L +PR PP
Sbjct  137   VQLVRFACGGFALTLATSHLLADGRAFTLLLTALAEMIRDGGLSREPLLDRSLFKPRSPP  196

Query  1088  RYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGT  909
             RY+ SLD  F   + + ++N      LL++ + +RLY IDA+ +  LQ  AS    G   
Sbjct  197   RYSASLDAEFARFTPETMIN-----PLLTAAIRRRLYRIDAADLAALQAAASSPGGG---  248

Query  908   SRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIP---GIMSDYIGNVLSLTF  738
              RR ++  A  A++WK++  AV  ++  C+M W+VDGR ++    G +  YIGNV++ T 
Sbjct  249   GRRASRFVALCAHVWKLLARAVGDANPSCRMAWIVDGRKQVEPWDGALDRYIGNVVTYTA  308

Query  737   GELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIE----CHRPGLMLSKMV-LG  573
              E S+ EL    + ++A+ V AAI+    A  F +L DW+E      R G   ++ V LG
Sbjct  309   REASVAELLRAPLPEVAAMVRAAIAGVMTAARFQELADWMEERKAAFREGGKWTEAVNLG  368

Query  572   RDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVS  393
                P  A+++S    F + + + GFG P L        R+G   V   PS  GDGSW   
Sbjct  369   LGSP--ALIISGLLPFAI-DGDLGFGKPSLVMPWIRHGRLGSASVTVVPSPSGDGSWFFG  425

Query  392   AI-LWPDMVAALES  354
             A  +WP ++  +ES
Sbjct  426   ATRMWPRLMEVVES  439



>gb|EEE54278.1| hypothetical protein OsJ_01184 [Oryza sativa Japonica Group]
Length=450

 Score =   199 bits (506),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 144/489 (29%), Positives = 227/489 (46%), Gaps = 77/489 (16%)
 Frame = -1

Query  1712  MAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPN---Q  1542
             MA+  +  +  V  +   +VK    + +P++L +SNLDL+     V+    +  P+    
Sbjct  1     MASCINGGELHVRVVHRRLVKASDESIRPHVLAVSNLDLIPRTIQVSMFCIYPKPSTGGD  60

Query  1541  FHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLK  1362
             FH     ++    A L   L+ F+P AGRIV NP +  PEI C N+G  +V  +A++ L 
Sbjct  61    FH----DVVAAFAAGLPSLLNHFFPLAGRIVSNPCSGLPEIHCHNQGAELVVGEADVALA  116

Query  1361  ELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAK  1182
              L++  +   V  GK++  +      D A+ +Q+  + CGG  + +  +H + D S+ + 
Sbjct  117   SLDYGTVGASV--GKILLPY----AGDVALSVQVVSFACGGFTVAWGTNHVVVDGSALSM  170

Query  1181  FLTTWSELATNK--PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
              ++ WSELA +        P+H R + RPR PP Y  SLDE F                 
Sbjct  171   LVSAWSELARSGTLAAGARPNHDRSVFRPRSPPSYGASLDEAFTPL--------------  216

Query  1007  LSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN  828
                                         DG     R T+++A SAY+WK +   V     
Sbjct  217   ----------------------------DG-ARQARATRVQAVSAYLWKALAAVVGSRDA  247

Query  827   KCKMGWLVDGRTRIP--------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHA  672
             +C+M W VDGR R+           M  Y+G V +    + +M+E++   + ++AS    
Sbjct  248   RCRMVWWVDGRRRLTLSSSPELRAAMRSYVGKVTTFAVPKATMEEIQRKPLPEVASMARD  307

Query  671   AISTATNAEHFLDLIDWIECHRPGLM--LSKMVLGRDGPGAAIVVSSGRRFPVGELEFGF  498
             AI+     EHF +L+DW+E H+ G    +    +G   P  A+ V++   F V + +FG 
Sbjct  308   AIAAPAYGEHFQELVDWVEEHKAGKQRYIDTASVGLGSP--AVSVTAFASFEV-DTDFGH  364

Query  497   GSPVLG-TVCSTIERIGVGYVN--QRPSARGDGSWTVSAILWPDMVAALESHSEC--IFQ  333
             G   +     S+  R+  G+V    RP   GDGSW  SA+LWP + AALES      IF+
Sbjct  365   GHAAMALPTSSSSARLCTGFVQIAARPGG-GDGSWIASALLWPRLAAALESDERLGRIFK  423

Query  332   PITAHDLHL  306
             P+TA  L L
Sbjct  424   PVTAEYLGL  432



>ref|NP_001146851.1| agmatine coumaroyltransferase [Zea mays]
 gb|ACG23946.1| agmatine coumaroyltransferase [Zea mays]
Length=462

 Score =   199 bits (507),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 147/483 (30%), Positives = 245/483 (51%), Gaps = 37/483 (8%)
 Frame = -1

Query  1715  TMAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFH  1536
             TMAA D  S   +  ++  +VK    + +P++++LSNLDL      +  L  +  PN   
Sbjct  4     TMAANDPTS---IRVVSRRLVKASDASIQPHVMSLSNLDLYVCDSQLGTLCVY--PNAGG  58

Query  1535  SSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKEL  1356
               S +I    ++ L   L+  YPFAGR+V NP +  PE+ C N+G  +V  +  + L  L
Sbjct  59    GFSARIPSLFESLLPSLLNYLYPFAGRLVTNPSSGLPELHCHNQGAELVVGEVGVALGSL  118

Query  1355  EFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFL  1176
               Y   K   +  ++P  R     D  + +Q+  + CGG  + +  +H +GD    A  +
Sbjct  119   N-YGATKDSFKKMVLPFPR-----DVLLSVQLLSFACGGFSVMWWINHLVGDGHVGATIV  172

Query  1175  TTWSELATNKPPSCSP--DHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLS  1002
              TWS+LA       +P  ++ R + RPR PP Y+ S+  TF +         R P  L +
Sbjct  173   RTWSQLARTGDIGGAPPLNYDRSVFRPRSPPSYSDSVAATFTTFD-----EKRLPNALTA  227

Query  1001  SI-MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV----DK  837
                 + R+YY++AS I  L+  A+       T++R T++EA SAY+WK + + V      
Sbjct  228   EASFVDRVYYVEASDIAALRDTAAAAT----TAQRPTRVEALSAYLWKALADVVAACPRS  283

Query  836   SHNKCKMGWLVDGRTRIPG-----IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHA  672
             +  +C+MGW V  R R+       +M  Y+GNV +   G+   +E+    ++++A+ V  
Sbjct  284   NKERCRMGWWVSARRRVTAPKLVALMPGYLGNVTTYALGDAPAEEIVRKPLAEVAAMVRD  343

Query  671   AISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGS  492
             AI++    E+  +++DW+E H+   ++   V+G   P   +  S    FP+ + +FGFG 
Sbjct  344   AITSVDYDEYLQEMVDWVEVHKTEGLMEAAVIGVGAP--TLNQSVMTTFPL-DTDFGFGQ  400

Query  491   PVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDL  312
               L T  S   R+   +++      GDGSW V+A +WP + AALE  S+ IF+ +TA  L
Sbjct  401   ATLATTVSDYGRLCSAFLSVGARPGGDGSWLVTAYIWPQLAAALE--SDGIFKLLTAEYL  458

Query  311   HLS  303
              L+
Sbjct  459   GLA  461



>gb|ACG29622.1| transferase [Zea mays]
Length=471

 Score =   199 bits (507),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 148/450 (33%), Positives = 241/450 (54%), Gaps = 33/450 (7%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +L  SNLDL+ G F +  +  + +P    +  P ++   +A++   LSRF+PFAGR+V
Sbjct  26    PAVLQASNLDLILGSFHIYLIAMYPAPA---AGFPAVVAAARAAMPAFLSRFFPFAGRVV  82

Query  1448  PNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQ  1269
              N  T  PEI CDN G  +V A+A +RL +++F + ++ +  G++   F+Q    D A+ 
Sbjct  83    ANADTGVPEIACDNTGAELVVARAGVRLADVDFADADRSL--GRIAVPFQQ----DLALS  136

Query  1268  IQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfll-rprfp  1092
             +Q+ R+ CGG  L++  +H L D        + W+EL      S  P H R  L RPR P
Sbjct  137   LQLVRFACGGFALSWGTNHLLVDGHGLTALPSAWAELLRTGGLSWEPHHERASLFRPRDP  196

Query  1091  pRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIG  912
             PRY+ SLD  F   +   +     P +LL++ +++R Y + A+ + +L+  AS       
Sbjct  197   PRYSASLDAEFTRYAPAGL-----PNSLLTATLVRRNYVVSAADVDRLRAAASTP-----  246

Query  911   TSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIPGIMSD------YIGNVL  750
              +RR T++EA SA++WK++  AV      C+M WLVDGR R+     D      Y+GNVL
Sbjct  247   -ARRATRLEALSAHVWKLLAAAVGGLDAHCRMAWLVDGRPRLDAARYDGATVRRYLGNVL  305

Query  749   SLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECH----RPGLMLSKM  582
             +    E +++ +    ++ +A+   AAI+    +E + +L+DW+E H    R G   ++ 
Sbjct  306   TYASREAAVEAVSSSPLADVAAMAGAAIAEVFRSERYEELVDWMEVHKGVFREGGKWTE-  364

Query  581   VLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSW  402
             V+G      A+VVS+   F V E +FGFG P L        R+G   +    S R DGSW
Sbjct  365   VVGTGMGSPALVVSTFVPFRV-EGDFGFGRPRLVFPWVRPGRLGSAAMTVSRSPREDGSW  423

Query  401   TVSAILWPDMVAALESHSECIFQPITAHDL  312
              ++A +WP +  A+++  + + +P T   L
Sbjct  424   LITARMWPRLADAVDADPDAVLKPATTARL  453



>ref|NP_001183762.1| hypothetical protein [Zea mays]
 gb|ACR38244.1| unknown [Zea mays]
 gb|AFW85838.1| hypothetical protein ZEAMMB73_947943 [Zea mays]
Length=459

 Score =   199 bits (506),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 145/434 (33%), Positives = 229/434 (53%), Gaps = 29/434 (7%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +LT+SNLDL+ G FP+  +  + +P     +   ++D ++ +L   LSR +PFAGR+V
Sbjct  26    PSVLTVSNLDLVLGPFPIFLISIYAAPAAGLDA---VLDIVRVTLPSYLSRLFPFAGRVV  82

Query  1448  PNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQ  1269
              +P+T  PE+ C+N G  +V A A + L  ++F  +++ +  G +   F  R     A+ 
Sbjct  83    IDPETKIPEVACNNAGAELVVADAAVPLAAVDFSEVDQSL--GLIQIPFDAR----LALS  136

Query  1268  IQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfpp  1089
             +Q+ R+ CGG  LT    H L D  +F   LT  +E+  +   S  P   R L +PR PP
Sbjct  137   VQLVRFACGGYALTLGTSHLLADGRAFTLLLTALAEMVRDGGLSREPLLDRSLFKPRSPP  196

Query  1088  RYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGT  909
             RY+ SLD  F   + + ++N      LL++ + +R+Y IDA+ +  LQ  AS    G   
Sbjct  197   RYSASLDAEFARFTPETMIN-----PLLAAAIRRRMYRIDAADLAALQAAASPSAGG---  248

Query  908   SRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIP---GIMSDYIGNVLSLTF  738
              RR ++  A  A++WK++  AV  +   C+M W+VDGR ++    G +  YIGNV++ T 
Sbjct  249   GRRASRFVALCAHVWKLLARAVGDASPSCRMAWIVDGRKQVEPSDGALDRYIGNVVTYTA  308

Query  737   GELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIE----CHRPGLMLSKMV-LG  573
              E S+ EL    + ++A  V AAI+  T A  F +L+DW+E      R G   ++ V LG
Sbjct  309   REASVAELLRAPLPEVAGMVRAAIAGVTTAARFQELVDWMEERKAAFRDGGKWTETVNLG  368

Query  572   RDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVS  393
                P  A+++S    F + + + GFG P L        R+G   V   P   GDGSW   
Sbjct  369   LGSP--ALIMSGLLPFAI-DGDLGFGKPSLVLPWVRHGRLGSASVTVVPCPSGDGSWFFG  425

Query  392   AI-LWPDMVAALES  354
                +WP ++  +ES
Sbjct  426   GTRMWPRLMEVVES  439



>emb|CDM83195.1| unnamed protein product [Triticum aestivum]
Length=470

 Score =   198 bits (504),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 147/476 (31%), Positives = 234/476 (49%), Gaps = 34/476 (7%)
 Frame = -1

Query  1682  RVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLK  1503
             RV  + +S+VK     P   +L +SNLDLL    P+  +  +R+P+        ++   +
Sbjct  8     RVRIVRKSIVKPSVARPG-VVLAVSNLDLLYQTMPIAMICAYRTPSDGLGFQ-DVVAAFE  65

Query  1502  ASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVER  1323
             A L   L  F+  AGRIV NP +  PE+ CDN+G  +V  +  + L  L++ +L   + R
Sbjct  66    AKLPYLLDHFFLLAGRIVANPHSGLPEVHCDNQGAELVVGEVGVALGSLDYGSLEASLAR  125

Query  1322  GKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA---T  1152
                VP     G    A+ +Q+  + CGG  + +  +H L D  +    +  WS+LA   T
Sbjct  126   LG-VPVQYDAG---VALSVQLVSFACGGFAVAWGTNHVLLDGCTLCMIVDVWSQLARSGT  181

Query  1151  NK-PPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYY  975
              K   + +P+H R + RPR  P Y   L E F+    + ++N         S ++ R YY
Sbjct  182   EKIAAAAAPNHDRSIFRPRAAPSYG-GLGEVFIPLESERLVN----ALTAGSSLVVRTYY  236

Query  974   IDASSIHKLQKLAS-EEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDG  798
             ++   +  L+  AS  E+ G   SR    +EA  AY+WKV+   V  S ++C+MGW V+G
Sbjct  237   VEQRDLDMLRVQASASEERGASASR----VEAACAYLWKVLAGVVGSSDDRCRMGWWVNG  292

Query  797   R---TRIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLI  627
             R    +    M  Y+GNV S    E S+D +K   + ++AS V  +I     +EHF +L+
Sbjct  293   RPCLAKKEAAMRSYVGNVTSFAVAEASVDAIKRRPLPEVASMVRQSIRATATSEHFQELV  352

Query  626   DWIECHR---PGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGT-VCSTIE  459
             DW+E  +   PG  +    +G   P   + V+S   F + + +FGFG   +         
Sbjct  353   DWVEERKGKGPGKYVETATVGLGSP--VLSVTSMVSFGL-DTDFGFGQAAIAMPTWVDSG  409

Query  458   RIGVGYVNQRPS----ARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
             R+  G+V    S      G GSW  +  +WP + AAL+S +  IF+P+TA  L L+
Sbjct  410   RLCCGFVTIMASPGTGGHGGGSWIFTMSIWPRLAAALDSDAHRIFKPLTAEYLGLA  465



>gb|KCW74067.1| hypothetical protein EUGRSUZ_E02701 [Eucalyptus grandis]
Length=438

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 147/414 (36%), Positives = 206/414 (50%), Gaps = 53/414 (13%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  LKA+L+Q L  +Y  AG +V N    EPE+LC+N  V  +EA A++ L+ L  YN 
Sbjct  68    MVGVLKAALAQALVSYYALAGEVVQN-SASEPELLCNNWEVDFIEAFADVELRHLNLYNP  126

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             +  VE GKLVP  ++RG    AVQ       CGG+ +  TFDH + +A S   F+  W E
Sbjct  127   DDTVE-GKLVPT-KKRGV--LAVQ-------CGGIVVACTFDHRIVEAYSVNMFMVFWVE  175

Query  1160  LATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKR  984
              A +  P S  P  RR LL  R    ++ SLD  ++      +  + PPP          
Sbjct  176   TARSAAPISLPPSFRRSLLNLRHRLCFDPSLDRMYIP-----VFALYPPPK---------  221

Query  983   LYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA---VDKSHNKCKMG  813
                      HKLQ   S          +RTK+E+FSA++W+++  +   VD   NK  M 
Sbjct  222   ---------HKLQSACS-------NGSKRTKLESFSAFLWRMVAESSSVVDNDDNKT-MS  264

Query  812   WLVDGRTRIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLD  633
              +  G    P  MS Y GNVLS+ F E    E+    +S +   VH  +  A   EHF+D
Sbjct  265   MMGIGEDDKPTPMSSYFGNVLSVPFREKRPREVVEKPLSWVVDVVHKFVERAATKEHFVD  324

Query  632   LIDWIECHRPGLMLSKMVLGRDGP-----GAAIVVSSGRRFPVGELEFGFGSPVLGTVCS  468
              IDW+E HRP L L ++    D          +VVSSG+RFPV E++FG+G  VLG+   
Sbjct  325   PIDWVEEHRPVLALERIFCKPDSEEEEEGSMVLVVSSGQRFPVTEMDFGWGKLVLGSYHF  384

Query  467   TIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
                     YV   P+   +G W V   L    VA +ESH+  IF+ +T H L+L
Sbjct  385   PWGG-KAEYVMPMPNPLSNGDWVVYLHLPRSQVAFIESHASTIFKLLTPHHLNL  437



>ref|NP_001174603.1| Os06g0150550 [Oryza sativa Japonica Group]
 dbj|BAD69312.1| putative hydroxycinnamoyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD69048.1| putative hydroxycinnamoyl transferase [Oryza sativa Japonica 
Group]
 gb|EAZ35846.1| hypothetical protein OsJ_20143 [Oryza sativa Japonica Group]
 dbj|BAG88657.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93331.1| Os06g0150550 [Oryza sativa Japonica Group]
Length=474

 Score =   197 bits (502),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 148/489 (30%), Positives = 242/489 (49%), Gaps = 38/489 (8%)
 Frame = -1

Query  1697  SCSDFRVDFITESVVKTVGLTPK-PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK  1521
             S   F ++  +  +V+     P  P +L +SNLDL+ G FP+  +  +  P         
Sbjct  2     SLRRFDLEIASRELVRASRPPPGFPPVLAVSNLDLILGPFPIYLVSVYAPPP---GGVAA  58

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  ++A+L   LS F+PFAGR+V +P T+ PE+ C+N G  +V A A + L  ++F  +
Sbjct  59    VVSAVRAALPAYLSHFFPFAGRVVRDPATNIPEVACNNAGAELVVADAAVPLAAVDFAQV  118

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +  G +  AF         + +Q+ R+ CGG  LT   +H L D  +F   L    E
Sbjct  119   DRSI--GLMRVAFDA----SLPLSLQLVRFACGGFSLTVATNHLLADGRAFIVLLNALGE  172

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             +      +  P   R LL PR PPR++ SLDE F   +   ++N      L+++ + +RL
Sbjct  173   MVREGRLTSEPLLDRSLLMPRSPPRFSPSLDEEFSRFTPATMIN-----PLMAAAIQRRL  227

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVD  801
             Y I+A+ + +L++ AS         RR T+  A  A++WK++  AV  S   C+M W++D
Sbjct  228   YRIEAADLERLREEASAGGG---GGRRATRFVALCAHVWKLLARAVGDSDTHCRMAWIID  284

Query  800   GRTRIP---------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNA  648
             GR R+          G +  Y+GNV++ T  E S++E+    +  +A  V AAI+ A   
Sbjct  285   GRKRLEPPSVGGGEGGALDRYMGNVVTYTSREASVEEVLGAPLHAVAGMVRAAITAAMTR  344

Query  647   EHFLDLIDWIECHRP------GLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPV  486
             + F  L+DW+E  +       G     + LG   P  A+V+S    F + + + GFG P 
Sbjct  345   DRFQQLVDWMETKKAAAFKDGGKWTEAVNLGLGSP--AMVISGLLPFAI-DGDMGFGKPR  401

Query  485   LGTVCSTIERIGVGYVNQRPSARGDGSWTVSAI-LWPDMVAALESHS-ECIFQPITAHDL  312
             L        R+G       PS  GDGSW  +   LWP ++  +E+   +C+ +P TA  L
Sbjct  402   LVMPWLQHGRLGSASATVVPSPAGDGSWFFAGTRLWPRLLEVVEAAGPDCLLKPATAASL  461

Query  311   HLS*LQSCH  285
              L+     H
Sbjct  462   GLAYPAGAH  470



>ref|NP_001150771.1| transferase [Zea mays]
 gb|ACG40329.1| transferase [Zea mays]
 gb|AFW59399.1| transferase [Zea mays]
Length=448

 Score =   196 bits (499),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 135/413 (33%), Positives = 213/413 (52%), Gaps = 51/413 (12%)
 Frame = -1

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVE-AQANIRLKELEFYNLNKY  1332
             LK +L++ L  +YP AG +V N    EPE+LC  RGV   E A A + L+E+    +++ 
Sbjct  61    LKEALAKTLVAYYPLAGEVVAN-GDGEPELLCSGRGVDFTETAAAGVELREVRLGAVDEG  119

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-  1155
             VE  KLVP   ++ G   AV++  +++TCGG  +  TFDH + DA SF  FL  W+  A 
Sbjct  120   VE--KLVPV--KKTGVTMAVKL--SKFTCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAAR  173

Query  1154  -TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLY  978
              ++ PP   P              +  SL       +  D  + R P T     ++ RL+
Sbjct  174   GSSAPPPPDP-------------CFRRSL------VAPRDTPHRRAPST---DALINRLF  211

Query  977   ----------YIDASSIHKLQKLASEEDDGIGTSRR--RTKIEAFSAYIWKVMVNAVDKS  834
                          A S++++ ++A+E+   +  S    RTK+EAF+A +W++   A    
Sbjct  212   SPRSAAPPPPPAAAGSVNRIYRIAAEDIAALKASAGPGRTKMEAFTALLWQLCARAASPR  271

Query  833   HNKCKMGWLVDGRTRI--PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIST  660
              ++C MG +VDGRTR+   G M  Y GNVL++ +G +  ++L+   ++ +A  VH  ++ 
Sbjct  272   QSQCCMGVVVDGRTRMFPDGAMKAYFGNVLTIPYGVIGSEDLRCMALADVADDVHRWVAE  331

Query  659   ATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAI--VVSSGRRFPVGELEFGFGSPV  486
             A   +HF  L+DW+E  RP    ++  LG  G   A+  +VSSG  FPVG+ +FG G P 
Sbjct  332   AATGDHFRGLVDWVEALRPKPAAARAYLGGTGGNEAMACIVSSGMSFPVGKADFGTGLPA  391

Query  485   LGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
               +        G GYV   PSARG+G W V   + P++   +E  +  +FQ +
Sbjct  392   FASYHFPWP-AGAGYVMPMPSARGNGDWVVYVHVAPEVAKVMEEST--VFQAL  441



>gb|EAY99714.1| hypothetical protein OsI_21696 [Oryza sativa Indica Group]
Length=474

 Score =   197 bits (500),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 148/489 (30%), Positives = 242/489 (49%), Gaps = 38/489 (8%)
 Frame = -1

Query  1697  SCSDFRVDFITESVVKTVGLTPK-PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK  1521
             S   F ++  +  +V+     P  P +L +SNLDL+ G FP+  +  +  P         
Sbjct  2     SLRRFDLEIASRELVRASRPPPGFPPVLAVSNLDLILGPFPIYLVSVYAPPP---GGVAA  58

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             ++  ++A+L   LS F+PFAGR+V +P T+ PE+ C+N G  +V A A + L  ++F  +
Sbjct  59    VVSAVRAALPAYLSHFFPFAGRLVRDPATNIPEVACNNAGAELVVADAAVPLAAVDFAQV  118

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +  G +  AF         + +Q+ R+ CGG  LT   +H L D  +F   L    E
Sbjct  119   DRSI--GLMRVAFDA----SLPLSLQLVRFACGGFSLTVATNHLLADGRAFIVLLNALGE  172

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             +      +  P   R LL PR PPR++ SLDE F   +   ++N      L+++ + +RL
Sbjct  173   MVREGRLTSEPLLDRSLLMPRSPPRFSPSLDEEFSRFTPATMIN-----PLMAAAIQRRL  227

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVD  801
             Y I+A+ + +L++ AS         RR T+  A  A++WK++  AV  S   C+M W++D
Sbjct  228   YRIEAADLERLREEASAGGG---GGRRATRFVALCAHVWKLLARAVGDSDTHCRMAWIID  284

Query  800   GRTRIP---------GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNA  648
             GR R+          G +  Y+GNV++ T  E S++E+    +  +A  V AAI+ A   
Sbjct  285   GRKRLEPPSVGGGEGGALDRYMGNVVTYTSREASVEEVLGAPLHAVAGMVRAAITAAMTR  344

Query  647   EHFLDLIDWIECHRP------GLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPV  486
             + F  L+DW+E  +       G     + LG   P  A+V+S    F + + + GFG P 
Sbjct  345   DRFQQLVDWMETKKAAAFKDGGKWTEAVNLGLGSP--AMVISGLLPFAI-DGDMGFGKPR  401

Query  485   LGTVCSTIERIGVGYVNQRPSARGDGSWTVSAI-LWPDMVAALESHS-ECIFQPITAHDL  312
             L        R+G       PS  GDGSW  +   LWP ++  +E+   +C+ +P TA  L
Sbjct  402   LVMPWLQHGRLGSASATVVPSQAGDGSWFFAGTRLWPRLLEVVEAAGPDCLLKPATAASL  461

Query  311   HLS*LQSCH  285
              L+     H
Sbjct  462   GLAYPAGAH  470



>gb|KDP25023.1| hypothetical protein JCGZ_22558 [Jatropha curcas]
Length=425

 Score =   195 bits (496),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 205/413 (50%), Gaps = 70/413 (17%)
 Frame = -1

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEIL-----------CDNRGVLVVEAQAN  1374
             ++ +LK +L+Q L  +Y FAG +V N    EPEIL             NRGV   EA A+
Sbjct  63    MVGSLKKALAQVLVSYYAFAGEVVAN-SAGEPEILHYKKNGILRPTNRNRGVDFYEAFAD  121

Query  1373  IRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDAS  1194
             I L+ L  YN ++ +E  KLVP    +  D+ A    I+                     
Sbjct  122   IELQHLNLYNPDQSIE-AKLVP----KKEDEMAQSKAISDSVV----------------P  160

Query  1193  SFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP  1014
             SF +       L   + P+C                 + SLD+ +V  S      ++PP 
Sbjct  161   SFRR------SLLNPRRPAC----------------IHPSLDDMYVPIS-----KLQPPK  193

Query  1013  TLLSSI--MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD  840
                S    ++ R+YY+ A S++KLQ LAS     IG   +RTK+E+FSA +W+++  +  
Sbjct  194   DSDSDDDHLISRIYYVKADSLNKLQSLASS----IGC--QRTKLESFSALLWQLVAKSAQ  247

Query  839   KSHNKC-KMGWLVDGRTRIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAIS  663
                 K  KMG +VDGRTR+   M  Y GNVLS+ +G+  +DEL    +S +A+ VH  + 
Sbjct  248   NGMAKVSKMGIVVDGRTRLGDTMDSYFGNVLSIPYGKKKIDELIANPLSWVANEVHDFLE  307

Query  662   TATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVL  483
             +A   EHFL LIDW+E HRP   L+K+       G A VVSSG+RFPV +++FG+G+P  
Sbjct  308   SAATKEHFLGLIDWVEAHRPEPALAKIYGSGSDDGPAFVVSSGQRFPVSKVDFGWGAPFF  367

Query  482   GTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPIT  324
             G+          GYV   PS   +G W V   L    +  +E+ S  +FQP+T
Sbjct  368   GSYHFPWGG-NAGYVMPMPSPLCNGDWIVYMHLLKTQIHLIEAESSNLFQPLT  419



>emb|CDX79279.1| BnaC06g20240D [Brassica napus]
Length=340

 Score =   193 bits (490),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 127/354 (36%), Positives = 193/354 (55%), Gaps = 24/354 (7%)
 Frame = -1

Query  1343  LNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWS  1164
             +N Y    KLVP  ++ G     + IQ+T+  CG + +  TFDH + DA S   FL +W+
Sbjct  3     INLYFRIAKLVP-IKKHG----VIAIQVTQMKCGSIVVGCTFDHRVADAYSMNMFLVSWA  57

Query  1163  ELA-TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLS---SI  996
             E++ ++ P SC P  RR LL PR P   ++++D+ ++  +        PPP  ++   SI
Sbjct  58    EISRSDVPISCVPSFRRSLLNPRRPLVMDSAIDQMYIPVT------SLPPPQEITNPDSI  111

Query  995   MLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS---HNK  825
             +  RLYYI A ++ KLQ LA     G     +RTK+E+FSA++WK++     +       
Sbjct  112   LASRLYYIKADALGKLQTLAR----GSKMEVKRTKLESFSAFLWKLVAKHAARDPVLSKN  167

Query  824   CKMGWLVDGRTRIPGIMSD-YIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNA  648
              K+G +VDGR R+    ++ Y GNVLS+ FG   +D+L +  +S +   VH  + TA   
Sbjct  168   SKLGIVVDGRRRLMEQENNTYFGNVLSIPFGGQQIDDLINKPLSWVTEEVHRFLETAVTK  227

Query  647   EHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCS  468
             EHFL+LIDW+E  RP   +S++       G A VVSSGR FPV +++FG+GSPV G+   
Sbjct  228   EHFLNLIDWVETRRPTPTVSRIYSTGSEDGPAFVVSSGRSFPVSQVDFGWGSPVFGSYHF  287

Query  467   TIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
                    GYV   PS+  DG W V   L    +  +E  +  + +PI  + L +
Sbjct  288   PWGG-NAGYVMPMPSSVEDGDWMVYLHLTKGQLKFIEEEASQVLKPIDNNYLKI  340



>ref|XP_002437844.1| hypothetical protein SORBIDRAFT_10g003600 [Sorghum bicolor]
 gb|EER89211.1| hypothetical protein SORBIDRAFT_10g003600 [Sorghum bicolor]
Length=826

 Score =   201 bits (512),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 153/455 (34%), Positives = 237/455 (52%), Gaps = 37/455 (8%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +L  SNLDL+ G F +  +  + +P    +  P ++   +A+L   LSRF+PFAGRIV
Sbjct  373   PAVLQPSNLDLILGSFHIYLIAVYPAPA---AGFPAVVAATRAALPAFLSRFFPFAGRIV  429

Query  1448  PNPKTDEPEILCDNRGV-LVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAV  1272
              N  T  PEI CDN G  LVV   A +RL +++F + ++ +  G++   F+Q      A+
Sbjct  430   ANADTGAPEIACDNAGAELVVAHAAGVRLADVDFADADRSL--GRIAVPFQQ----GLAL  483

Query  1271  QIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSEL--ATNKPPSCSPDHrrfll-rp  1101
              +Q+ R+ CGG  L++  DH L D          WSEL     +  S  P H R  L RP
Sbjct  484   SLQLVRFACGGFALSWATDHLLVDGHGLTALPNAWSELLRTGGRLLSWEPHHERASLFRP  543

Query  1100  rfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDD  921
             R PPRY+ SLD  F   +   +     P +LL++ +++R Y + A+ + +L+  AS    
Sbjct  544   RDPPRYSPSLDAEFTRYAPASL-----PSSLLTATLVRRNYVVSAADVDRLRAAAST---  595

Query  920   GIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIPGIMSD------YIG  759
                 +RR T++EA SA++WK++  AV     +C+M WLVDGR R+ G   D      Y+G
Sbjct  596   ---RARRATRLEALSAHVWKLLAAAVGGLDARCRMAWLVDGRRRLDGARYDAGTVRRYLG  652

Query  758   NVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECH------RPGL  597
             NVL+    E+ ++ +    ++ +A+    AI+    +E + +L+DW+E        R G 
Sbjct  653   NVLTYASREVDVEAVSSSPLADVAAMAGEAIAEVFRSERYEELVDWMEARKGVFRDREGG  712

Query  596   MLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSAR  417
                  V+G      A+VVSS   F V E +FGFG P L        R+G   +    S  
Sbjct  713   GKWTEVVGTGTGSPALVVSSFVPFHV-EGDFGFGRPRLVIPWIRPGRLGSAAMTVARSPV  771

Query  416   GDGSWTVSAILWPDMVAALESHSECIFQPITAHDL  312
              DGSW ++A LWP +  A+++  + + +P TA  L
Sbjct  772   EDGSWLITARLWPRLADAVDADPDAVLKPATAARL  806



>dbj|BAJ96756.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   196 bits (499),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 143/449 (32%), Positives = 232/449 (52%), Gaps = 32/449 (7%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +  +SNLDL+ G FP+  +  +  P     +   ++  ++A+L   LSRF+PFAGRIV
Sbjct  44    PAVHAVSNLDLVLGPFPLYLICVYAPPPCGLGT---VLSAVRAALPGYLSRFFPFAGRIV  100

Query  1448  PNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQ  1269
              +P T+ PE+ C+N G  +V A A + L  ++F ++ + +  G +   F       FA+ 
Sbjct  101   RDPGTNIPEVACNNAGAELVVADAAVPLAAVDFASIERSL--GLIQVPFDA----GFALS  154

Query  1268  IQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-TNKPPSCSPDHrrfllrprfp  1092
             +Q+ R+TCGG  L    +H L D  +    L + +E+  T    S  P   + L RPR P
Sbjct  155   VQMVRFTCGGFSLAVGTNHLLADGRALVVLLNSLTEMVRTGGRLSREPLFDQSLFRPRSP  214

Query  1091  pRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIG  912
             PR++ SLD  F   +   ++N      LL++ + +RLY I+A+ +  LQ  A+       
Sbjct  215   PRHSPSLDAEFSRFTPGTMIN-----PLLAAAIQRRLYRIEAADLTALQTAAATV-----  264

Query  911   TSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI---PGIMSDYIGNVLSLT  741
             + R  ++  A  A++WK++  AV +S   C+M W+VDGR  +    G +  Y+GNV++ T
Sbjct  265   SGRHPSRFVALCAHVWKLLARAVGESAPSCRMAWIVDGRRCVEPSAGALDMYMGNVVTYT  324

Query  740   FGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRP-----GLMLSKMVL  576
               E S+ +L+   +  +A+ V AAI+T    + F DL+DW E ++      G    ++ L
Sbjct  325   SHEESVSDLRRMLLHDVAATVRAAITTVMTKDRFQDLVDWAEENKAAYKDGGKWTEEVNL  384

Query  575   GRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTV  396
             G   P  A+V+S    F + + + GFG P L        R+G   +   P    DGSW V
Sbjct  385   GLGSP--ALVISGFVPFAI-DGDMGFGKPRLVLPWLRHGRLGSAAMILVPCPSRDGSWFV  441

Query  395   SAI-LWPDMVAALESHSECIFQPITAHDL  312
                 LWP +V  +E+  E +  P+TA  L
Sbjct  442   EGTRLWPRLVEVVENVPESLLTPVTARSL  470



>gb|EMT19167.1| Anthranilate N-benzoyltransferase protein 3 [Aegilops tauschii]
Length=456

 Score =   195 bits (496),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 131/422 (31%), Positives = 200/422 (47%), Gaps = 60/422 (14%)
 Frame = -1

Query  1511  NLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQAN-IRLKELEFYNLNK  1335
              LKA+L++ L  +YP AG +V N    EPE+LC  RGV   EA A+ + L+EL     ++
Sbjct  66    TLKAALAKVLVAYYPLAGEVVAN-AAGEPELLCSGRGVDFAEAAADGVELRELRLGLPDE  124

Query  1334  YVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA  1155
              VER  LVP  +++ G    + +Q+T++ CGG  +  TFDH + DA SF  FL  W+  A
Sbjct  125   SVER--LVP--KKKSG---VMSVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAA  177

Query  1154  TNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYY  975
                     P                 S + +F++ S        PPP+  +  +  RL+ 
Sbjct  178   RGTSIPLPP-----------------SFNRSFLAPS-------SPPPSCTAGTLADRLFV  213

Query  974   IDASS----------------IHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV  843
               +                   H      +      G  R  TK+EAF+A++W++   A 
Sbjct  214   PVSLVPPPPATAAPPTAFNRIYHVAAADVAALQASAGPGR--TKLEAFTAHLWQLYSRAA  271

Query  842   DKSHNKCKMGWLVDGRTRI--PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAA  669
                 + C MG +VDGR R+   G M  Y GNVL++ +G     +L+   ++ +A  VH  
Sbjct  272   TPRQDSCCMGVVVDGRGRLRPDGAMRPYFGNVLTIPYGAFGAADLRDMALADVADDVHRW  331

Query  668   ISTATNAEHFLDLIDWIECHRPGLMLSKMVL------GRDGPGAAIVVSSGRRFPVGELE  507
             ++ A   EHF  L+DW+E  RP   +++  +      G +G  A+ VVSSG R P GE++
Sbjct  332   VAEAATGEHFQGLVDWVEAQRPEPTVARAYIGGGDDDGSEGETASCVVSSGLRLPFGEVD  391

Query  506   FGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
             FG+G P   +        G GYV   PSARG G W V     P++V  +E        P+
Sbjct  392   FGWGRPAFASYHFPWPG-GAGYVMPMPSARGGGDWVVYVHAAPEVVKVMEQEPTVFRAPV  450

Query  326   TA  321
             ++
Sbjct  451   SS  452



>gb|EMT19980.1| hypothetical protein F775_15344 [Aegilops tauschii]
Length=473

 Score =   195 bits (496),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 136/483 (28%), Positives = 227/483 (47%), Gaps = 48/483 (10%)
 Frame = -1

Query  1703  VDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSP--NQFHSS  1530
             V+   D  +  ++  +V     + K ++L +SN+DLL G FPV+ +  +  P    FH  
Sbjct  5     VNQGHDLNIRVMSRRLVSASDSSIKEHVLGVSNIDLLHGAFPVSLVCIYPRPPAGGFHFH  64

Query  1529  SPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEF  1350
             +  ++   ++ L   L+ ++  AGRIV NP+T  PEILC+N+G  ++   A++ L  L+F
Sbjct  65    A--VVAAFESGLPSLLNHYFVHAGRIVANPRTGLPEILCNNQGAELIVGVADVALAGLDF  122

Query  1349  YNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTT  1170
              + +  V +  L P      G D  + +Q+  + CGG  + +  +H LGD  +    +  
Sbjct  123   SSRDLSVRKIPL-PY-----GGDVPLSVQLVSFACGGFSVAWGHNHLLGDGHALLGLVC-  175

Query  1169  WSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIML  990
                 A  K     P     +           S+   F+      ++    P   + +IM 
Sbjct  176   ----ADPKKRKLGPKTVDCVNLGYAM----NSVGYRFL------VVKFEVPDIKVGTIMK  221

Query  989   KR--LYY------IDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS  834
                  +Y       D  SI + Q +AS + DG    RR T+++A SAY+WK +   V  +
Sbjct  222   SEDATFYGDIFPMKDVQSISR-QDMASHDGDG----RRATRVQAVSAYMWKTLAAVVGAA  276

Query  833   HNKCKMGWLVDGRTRIPG------IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHA  672
                C+MGW VDGR R+          + Y+GN      GE  ++E++   + ++AS V  
Sbjct  277   DTHCRMGWWVDGRRRLTAPEHRALATTSYVGNASIFVLGEDGVEEIQRKPLPEVASMVRE  336

Query  671   AISTATNAEHFLDLIDWIECHRPGLM-LSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFG  495
              I      + F +++DW+E H+ G   +    +G   P   + V++   FP+ + + GFG
Sbjct  337   LIDAPGYGDRFQEVVDWVEQHKSGATYMDASNIGLGCP--TVAVTAMTSFPM-DTDLGFG  393

Query  494   SPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHD  315
                +    +    +  G+V    + RGDG+W VSA +WP + AALES    IF PITA  
Sbjct  394   HAAMAMTTTRGRGLCSGFVQMAATPRGDGAWIVSASVWPKLAAALESDELRIFVPITAKH  453

Query  314   LHL  306
             L L
Sbjct  454   LGL  456



>gb|ABA95047.1| Transferase family protein, expressed [Oryza sativa Japonica 
Group]
Length=442

 Score =   194 bits (493),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 136/480 (28%), Positives = 226/480 (47%), Gaps = 65/480 (14%)
 Frame = -1

Query  1709  AAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSP---NQF  1539
             AAV +  D  +  ++  +VK    T +P++ T+SNLDL    +  + +  + S       
Sbjct  5     AAVPAGEDLTIRVVSRRLVKASDATIQPHVATVSNLDLYFNNYQASMVCLYPSNLPVAGV  64

Query  1538  HSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKE  1359
               S   ++   +A L   L+ FYP AGRIV +P +  PE+ C N+G  +V  + +  L  
Sbjct  65    AGSFDAVVAAFEAGLPSLLNHFYPLAGRIVVDPVSRLPELHCHNQGAELVVGEVDAALGS  124

Query  1358  LEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKF  1179
             L+F  ++  + R  L+P       DD  + +Q+ R+ CGG  + +  +H   D       
Sbjct  125   LDFAGMDGSLRR-ILLPY-----PDDVMLSVQLLRFACGGFSVVWGNNHLPNDGHGI---  175

Query  1178  LTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVS----CSLDDILNMRPPPT  1011
                 S +    PPS                 Y  ++  TF +      L ++L  +    
Sbjct  176   ----SMVVRMCPPS-----------------YGAAVRATFAAYHDESRLVNVLTTQ----  210

Query  1010  LLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS-  834
                   ++RLYYI+A  + +L+ +AS         RR ++++A SA++WK +   V  S 
Sbjct  211   ---DSFVERLYYIEAGDVARLRDMAST------GQRRASRVQAVSAFLWKALAGVVAASR  261

Query  833   --HNKCKMGWLVDGRTRI--PGI---MSDYIGNVLSLTFGELSMDELKHGTISKIASHVH  675
                 +C+MGW VD R R+  P +   M  + GN+ +   GE +++E+    ++++A+   
Sbjct  262   VPEERCRMGWWVDARRRVASPALVPAMHSFFGNMTAYALGEAAVEEILERPLAEVAAMAR  321

Query  674   AAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFG  495
              AI++     +  +L+DW+E H+   M+    LG   P     V +   FP+ + +FGFG
Sbjct  322   EAIASIAYDAYVQELVDWVEEHKAEKMMEVSALGLGSPTVNQTVFAS--FPL-DTDFGFG  378

Query  494   SPVLGTVCSTIERIGVG--YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITA  321
                L        R+  G   V  RP   GDGSW VSA +WP + AALES    IF+P+TA
Sbjct  379   EATLAMPVWENGRVSSGTLAVGARPG--GDGSWLVSAYIWPRLAAALESDDHRIFKPLTA  436



>dbj|BAK03783.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   193 bits (491),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 152/460 (33%), Positives = 243/460 (53%), Gaps = 35/460 (8%)
 Frame = -1

Query  1628  PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIV  1449
             P +L +SNLDL+ G F   +++F        +  P +    +A+L   LSRFYPFAGR+V
Sbjct  29    PAVLPVSNLDLILGSF---HVFFIAVYPAPAAGFPAVAAAARAALPAFLSRFYPFAGRVV  85

Query  1448  PNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQ  1269
              N  T  PE++C N G  +V A+A+  L +++F + +  +  G++   F +RG    A+ 
Sbjct  86    TNASTGVPEVVCGNAGAELVVARADAELADVDFADADASL--GRIQVPF-ERG---LALS  139

Query  1268  IQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDH-rrfllrprfp  1092
             +Q+ R+ CGG  L +  DH L D          W+E+      S  P H R  L RPR P
Sbjct  140   LQLVRFACGGFSLAWGTDHLLVDGHGLTTLPNAWAEMLVGGGLSWEPHHDRASLFRPRSP  199

Query  1091  pRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIG  912
             PRY+ SLD  FV     ++ N      LL++ +++R Y +DA+ + +L+  AS      G
Sbjct  200   PRYSPSLDAEFVRYDPANLPN-----ALLAAALVRRNYVVDAADVDRLRAAAS------G  248

Query  911   TSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIPGI------MSDYIGNVL  750
               RR T++EA SA++WK++  AV  S  +C+M WLVDGR R+         +++Y+GNV+
Sbjct  249   PERRATRLEALSAHVWKLLAAAVGGSDTRCRMAWLVDGRRRLDPAKYNKTHVNNYLGNVV  308

Query  749   SLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHR-----PGLMLSK  585
             +    E ++D ++   ++ +A+   A I+     E + +L+DW+E  +      G     
Sbjct  309   TYASREAAVDTVRTAPLADVATMAAAPIAEVFRQERYEELVDWMEARKGVFAEGGKWTEA  368

Query  584   MVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGS  405
             + LG   P  A+VVS+   F V E +FGFG P L        R+G   +    S  GDGS
Sbjct  369   VGLGTGSP--ALVVSAFVPFRV-EGDFGFGRPRLVMPWVRPGRLGSAAMTVIRSPAGDGS  425

Query  404   WTVSAILWPDMVAALESHSECIFQPITAHDLHLS*LQSCH  285
             W V+A +WP +  A+++  + +F+P TA  L  +  + C 
Sbjct  426   WLVTARMWPRLADAVDADRDAVFKPATAEWLGFAAPRCCE  465



>ref|XP_008668908.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Zea 
mays]
Length=460

 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 152/472 (32%), Positives = 225/472 (48%), Gaps = 65/472 (14%)
 Frame = -1

Query  1682  RVDFITESVVKTVG--LTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             RV  +T + V TV   L  + + L LSNLDL+     V   + + +      S   +   
Sbjct  6     RVSTVTVAAVSTVAPALPMQEHRLPLSNLDLILPPIDVGVFFCYDADPAGGRSHQPVAAV  65

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQAN-IRLKELEFYNLNKY  1332
             LKA+L++ L  +YP AG +V N    EPE+LC  RGV V EA A+   L++L     ++ 
Sbjct  66    LKAALAKTLVAYYPLAGEVVAN-AAGEPELLCSGRGVDVAEAAADGTVLRDLRLGLPDES  124

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWS----  1164
             VE   LVP  +++ G    + +Q+T++ CGG  +  TFDH + DA SF  FL  W+    
Sbjct  125   VE--PLVP--KKKAG---VMSVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAAS  177

Query  1163  ------------ELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRP  1020
                              + P+ +P                +  D  FV  S         
Sbjct  178   GSSAPPAPCFHRSFLAPREPAAAP-----------LRTAGSLADRLFVPVSRA-------  219

Query  1019  PPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD  840
              P L  +    R+Y + A+ +  LQ  A     G G    RTK+EAF+A++W +   A  
Sbjct  220   -PALPDTATANRIYRVSAADVAALQASA-----GAG----RTKLEAFTAHLWGLHAKAAA  269

Query  839   KSHNK----CKMGWLVDGRTRI--PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHV  678
              S  +    C MG +VDGR+R+   G M  Y GNVL++ +G +    L    ++ +A  V
Sbjct  270   ASRRQQPRSCCMGVVVDGRSRLRRDGAMGAYFGNVLTIPYGVMGTGALGEMALADVAGDV  329

Query  677   HAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGA---AIVVSSGRRFPVGELE  507
             H  ++ A   EHF +L+DW+E  RP   +++  LGR   G    A VVSSG R P+GE++
Sbjct  330   HRWVAEAATGEHFRELVDWVEAQRPEPTVARAYLGRGHGGEDAMACVVSSGMRLPLGEVD  389

Query  506   FGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESH  351
             FG+G P   +        G GYV   PSARGDG W V      ++V  +E+ 
Sbjct  390   FGWGRPAFASYQFPWPG-GAGYVMPMPSARGDGDWVVYVHAALEVVEVMEAE  440



>ref|XP_004962590.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Setaria italica]
Length=456

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 139/484 (29%), Positives = 226/484 (47%), Gaps = 41/484 (8%)
 Frame = -1

Query  1721  IPTMAAVDSCSDFRVDFITESVVKTVGLTPKPYILTLSNLDLL--SGRFPVTYLYFFRSP  1548
             +   AA  S     +  +T  +VK    +  P+   +SN+DL   +G+F    LY    P
Sbjct  1     MAAAAAESSVHQLPIRIVTRRLVKASDPSISPHAAAVSNIDLYNSTGQFSFVCLYPGELP  60

Query  1547  NQFHSSS-PKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANI  1371
             N+  +SS   ++    A L   L+ FYP  GRI  +P +  PE+ C N+G  +V  + + 
Sbjct  61    NKGATSSFDDVVAAFAAGLPSLLNHFYPLCGRIAADPSSGLPELHCYNQGADLVVGEVDA  120

Query  1370  RLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASS  1191
              L  L+F          KL   F     DD A+ +Q+  + CG   + +  +H   D  +
Sbjct  121   TLGSLDFGEAESL---KKLTLPFP----DDVALSVQLLSFACGRFAVVWGINHLHADVFA  173

Query  1190  FAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCS----LDDILNMR  1023
              A+ ++ WSEL+ +   +     R    RPR  P Y   + E   +      L ++L   
Sbjct  174   AAQLISNWSELSRSGTIAMPSHDRSAFFRPRDRPSYGARVGELLTTFDGEHRLVNVLTAH  233

Query  1022  PPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV  843
                       ++RLYY++A  +  L++ A       G SR     EA SAY+WK +   V
Sbjct  234   -------DSFVERLYYVEAVDLDALREAA-------GASR----AEALSAYLWKALAGIV  275

Query  842   DKSH---NKCKMGWLVDGRTRIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHA  672
               S     +C+MGW VD R R+   M  Y GN  + T G+ +++E++   ++ +A+ V  
Sbjct  276   AASRVPDERCRMGWWVDARHRLAAAMPSYFGNATAYTAGDAAVEEVRRKPLADVAAMVRE  335

Query  671   AISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGS  492
             A++     E+  ++ DW+E H+  + +   +LG   P   +  +     P+ + +FGFG 
Sbjct  336   AVTAVDYDEYVQEISDWVEEHKEEMFVESAILGLGAP--TLSQTEFASSPI-DTDFGFGQ  392

Query  491   PVLGTVCSTIERIGVGY--VNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAH  318
               +        R+  G   +  RP A GDGSW VSA +WP + AALES  + I +P+TA 
Sbjct  393   AAIAMPVFHYSRMSSGLMAIGARP-AGGDGSWFVSACVWPRLAAALESDEQHILKPLTAD  451

Query  317   DLHL  306
              L L
Sbjct  452   YLGL  455



>tpg|DAA36101.1| TPA: hypothetical protein ZEAMMB73_105025 [Zea mays]
Length=541

 Score =   192 bits (488),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 152/472 (32%), Positives = 225/472 (48%), Gaps = 65/472 (14%)
 Frame = -1

Query  1682  RVDFITESVVKTVG--LTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             RV  +T + V TV   L  + + L LSNLDL+     V   + + +      S   +   
Sbjct  6     RVSTVTVAAVSTVAPALPMQEHRLPLSNLDLILPPIDVGVFFCYDADPAGGRSHQPVAAV  65

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQAN-IRLKELEFYNLNKY  1332
             LKA+L++ L  +YP AG +V N    EPE+LC  RGV V EA A+   L++L     ++ 
Sbjct  66    LKAALAKTLVAYYPLAGEVVAN-AAGEPELLCSGRGVDVAEAAADGTVLRDLRLGLPDES  124

Query  1331  VERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWS----  1164
             VE   LVP  +++ G    + +Q+T++ CGG  +  TFDH + DA SF  FL  W+    
Sbjct  125   VE--PLVP--KKKAG---VMSVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAAS  177

Query  1163  ------------ELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRP  1020
                              + P+ +P                +  D  FV  S         
Sbjct  178   GSSAPPAPCFHRSFLAPREPAAAP-----------LRTAGSLADRLFVPVSR--------  218

Query  1019  PPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD  840
              P L  +    R+Y + A+ +  LQ  A     G G    RTK+EAF+A++W +   A  
Sbjct  219   APALPDTATANRIYRVSAADVAALQASA-----GAG----RTKLEAFTAHLWGLHAKAAA  269

Query  839   KSHNK----CKMGWLVDGRTRI--PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHV  678
              S  +    C MG +VDGR+R+   G M  Y GNVL++ +G +    L    ++ +A  V
Sbjct  270   ASRRQQPRSCCMGVVVDGRSRLRRDGAMGAYFGNVLTIPYGVMGTGALGEMALADVAGDV  329

Query  677   HAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGA---AIVVSSGRRFPVGELE  507
             H  ++ A   EHF +L+DW+E  RP   +++  LGR   G    A VVSSG R P+GE++
Sbjct  330   HRWVAEAATGEHFRELVDWVEAQRPEPTVARAYLGRGHGGEDAMACVVSSGMRLPLGEVD  389

Query  506   FGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESH  351
             FG+G P   +        G GYV   PSARGDG W V      ++V  +E+ 
Sbjct  390   FGWGRPAFASYQFPWPG-GAGYVMPMPSARGDGDWVVYVHAALEVVEVMEAE  440



>ref|NP_001056826.2| Os06g0151100 [Oryza sativa Japonica Group]
 dbj|BAD69322.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Oryza 
sativa Japonica Group]
 dbj|BAD69058.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Oryza 
sativa Japonica Group]
 dbj|BAF18740.2| Os06g0151100 [Oryza sativa Japonica Group]
Length=478

 Score =   191 bits (484),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 149/475 (31%), Positives = 246/475 (52%), Gaps = 37/475 (8%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPK-PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V+    ++V+     P  P +L +SNLDL+ G F V+ +  + +P +  ++    +  
Sbjct  11    FGVEVTARTLVRASDPPPGFPAVLPVSNLDLILGSFNVSLIVVYPAPARGFAAVAAAVRA  70

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
                +    LSRF+PFAGR+V +  T  PE+ CDN G  +V A A + L +++F + ++ +
Sbjct  71    ALPAF---LSRFFPFAGRVVADAATGIPEVACDNAGAELVLADAGVALADVDFADADRSL  127

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
               G +   + Q      A+ +Q+ R+ CGG  +++  +H L D        T W+E+   
Sbjct  128   --GTIQLPYEQ----GIALSLQLVRFKCGGFSMSWGTNHLLVDGHGLTALPTAWAEMLRT  181

Query  1148  KPPSCSPDHrrfll-rprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYI  972
                S  P H R  L RPR PPR+  SLD  F   +   ++N      LL++ +++R Y +
Sbjct  182   GGLSWEPHHDRRSLFRPRSPPRHGASLDAEFTRYAPGSLVN-----PLLAAALVRRNYVV  236

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT  792
              A  + +L+  AS        SRR T++EA SA++WK++  A   S  +C++ WLVDGR 
Sbjct  237   GADDLDRLRAAAST------ASRRATRLEALSAHVWKLLAAATHGSDARCRLAWLVDGRR  290

Query  791   RI------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDL  630
             R+      P ++S Y+GNV++    E  ++ +    ++ +A+   AAI      E + +L
Sbjct  291   RLDPAKYDPTLVSSYLGNVVTYASRESPVEAITSSPLADVAAMAGAAIGEVFRQERYEEL  350

Query  629   IDWIECHRP-----GLMLSKMV-LGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCS  468
             +DW+E  +      G   ++ V +G   P  A+VVS+   F V + +FGFGSP L     
Sbjct  351   VDWMELRKAAAFKNGEKWTETVGIGTGSP--AVVVSAFVPFRV-DGDFGFGSPALVMPWV  407

Query  467   TIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
                R+G   +    S R DGSW VSA LWP +  A+E+  + + +P TA  L L+
Sbjct  408   RPGRLGSAAMTVARSPREDGSWVVSARLWPRLADAIEADPDAVLKPATAARLGLA  462



>gb|EEC80023.1| hypothetical protein OsI_21698 [Oryza sativa Indica Group]
Length=479

 Score =   191 bits (484),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 149/475 (31%), Positives = 246/475 (52%), Gaps = 37/475 (8%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPK-PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V+    ++V+     P  P +L +SNLDL+ G F V+ +  + +P +  ++    +  
Sbjct  12    FGVEVTARTLVRASDPPPGFPAVLPVSNLDLILGSFNVSLIVVYPAPARGFAAVAAAVRA  71

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
                +    LSRF+PFAGR+V +  T  PE+ CDN G  +V A A + L +++F + ++ +
Sbjct  72    ALPAF---LSRFFPFAGRVVADAATGIPEVACDNAGAELVLADAGVALADVDFADADRSL  128

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
               G +   + Q      A+ +Q+ R+ CGG  +++  +H L D        T W+E+   
Sbjct  129   --GTIQLPYEQ----GIALSLQLVRFKCGGFSMSWGTNHLLVDGHGLTALPTAWAEMLRT  182

Query  1148  KPPSCSPDHrrfll-rprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYI  972
                S  P H R  L RPR PPR+  SLD  F   +   ++N      LL++ +++R Y +
Sbjct  183   GGLSWEPHHDRRSLFRPRSPPRHGASLDAEFTRYAPGSLVN-----PLLAAALVRRNYVV  237

Query  971   DASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRT  792
              A  + +L+  AS        SRR T++EA SA++WK++  A   S  +C++ WLVDGR 
Sbjct  238   GADDLDRLRAAAST------ASRRATRLEALSAHVWKLLAAATHGSDARCRLAWLVDGRR  291

Query  791   RI------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDL  630
             R+      P ++S Y+GNV++    E  ++ +    ++ +A+   AAI      E + +L
Sbjct  292   RLDPAKYDPTLVSSYLGNVVTYASRESPVEAITSSPLADVAAMAGAAIGEVFRQERYEEL  351

Query  629   IDWIECHRP-----GLMLSKMV-LGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCS  468
             +DW+E  +      G   ++ V +G   P  A+VVS+   F V + +FGFGSP L     
Sbjct  352   VDWMELRKAAAFKNGEKWTETVGIGTGSP--AVVVSAFVPFRV-DGDFGFGSPALVMPWV  408

Query  467   TIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
                R+G   +    S R DGSW VSA LWP +  A+E+  + + +P TA  L L+
Sbjct  409   RPGRLGSAAMTVARSPREDGSWVVSARLWPRLADAIEADPDAVLKPATAARLGLA  463



>gb|KHG25192.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=330

 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 124/322 (39%), Positives = 183/322 (57%), Gaps = 33/322 (10%)
 Frame = -1

Query  1223  TFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSL  1044
              FDH + DA +   FL +W+E+A +KP S  P  RR LL PR P R + SLDE +V    
Sbjct  26    AFDHRVADAYTANMFLVSWAEIAQSKPVSMVPSFRRSLLNPRRPGRADPSLDEMYVP---  82

Query  1043  DDILNMRPP-----PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAF  879
               I ++ PP     PT     ++ R+YY+ +  I++LQ LAS + D      +R+K+E+F
Sbjct  83    --IPSLPPPEENHEPT---DHLISRIYYVSSDQINELQSLASSDGD------KRSKLESF  131

Query  878   SAYIWK-VMVNAVDKSHNK-CKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELS  726
             SA++WK V   A  K  N+  KMG +VDGR+R+          M+ + GNVLS+ +G   
Sbjct  132   SAFLWKQVAAFAASKDRNRISKMGIVVDGRSRLGEGDEDKATAMAYHFGNVLSVPYGSQP  191

Query  725   MDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKM--VLGRDGPGAA  552
             + EL    + ++A  VH  +  ATN EHFL LIDW+E HRP   ++++  V+  DGP  A
Sbjct  192   IGELIEQPLCRVAKQVHEFLKPATNKEHFLGLIDWVEAHRPEPAMTRVYNVVKDDGP--A  249

Query  551   IVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDM  372
             +VVSSG RFPV +++FG+G P  G+       +  GYV   PS   DG W V  +L    
Sbjct  250   VVVSSGLRFPVSKMDFGWGCPAFGSYHFPWGGL-CGYVMPMPSPVRDGDWVVYMLLLKGQ  308

Query  371   VAALESHSECIFQPITAHDLHL  306
             +  +E  +  +F+P+T+  L+L
Sbjct  309   LEQIEKEAALVFRPLTSDYLNL  330



>dbj|BAJ95580.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   188 bits (477),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 138/479 (29%), Positives = 231/479 (48%), Gaps = 45/479 (9%)
 Frame = -1

Query  1679  VDFITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKA  1500
             +  ++  VVK      +PY+L +SNLDL+      +    +R P     S+  +     A
Sbjct  3     IQVVSRHVVKASPCV-EPYVLAVSNLDLIHRSTQSSVACIYRKPASGDFSA--VTAAFHA  59

Query  1499  SLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERG  1320
              L   L+ F+P AGRIV N  +  PE+ C N+G  +V   A + L  L++   ++ + R 
Sbjct  60    ELPAFLNYFFPLAGRIVTNTSSGHPEVQCCNQGAELVIGHAGVDLGSLDWSRSDESLNRI  119

Query  1319  KLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHAL-GDASSFAKFLTTWSELATNKP  1143
             KL  A       D A+ +Q+  +TCGG  + +  +  + GD  + +  +  WSE      
Sbjct  120   KLAHA------ADVALSVQLVSFTCGGFAVVWATNSLIAGDGEAASMLVRMWSEFLCVGT  173

Query  1142  PSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI-MLKRLYYIDA  966
              +     R   LRPR PP Y+ S+D  F     +  +N     TL +   +++RLYY+  
Sbjct  174   IAVPNHDRSLFLRPRDPPSYDASMDGMFTPWHHEHEVN-----TLTAQENLVERLYYVHG  228

Query  965   SSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKV---MVNAVDKSHNKCKMGWLVDGR  795
               I +L+++AS         +R ++++A SAYIWKV   +V A  +   +C+MGW VDGR
Sbjct  229   RDIERLRQMASR------GGQRSSRVQALSAYIWKVVAGVVAASTRQEKRCRMGWWVDGR  282

Query  794   TRIPG-IMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWI  618
              R+    + +Y+GN  +    E ++D +    ++ +++ V  AI++    E +  ++DW+
Sbjct  283   QRLRAPALRNYVGNATTYVVEEAAVDTILQAPLADVSATVREAITSVDYEERYKQVVDWL  342

Query  617   ECHRPG---------LMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGT---V  474
             E H P            +    +G   P  + +V +      G+ +FGFG   L     V
Sbjct  343   EKHNPAPPPQGGRRRRFVEAATVGLGSPTVSQMVWASF---AGDTDFGFGEAALAMPMPV  399

Query  473   CSTIERIGVGY--VNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
              ++  ++  GY  V  RPS   +  W + A +WP + AALES  + IF P+TA  L  S
Sbjct  400   SASTMKLCSGYLCVVSRPS--DEAPWIIRACIWPRLAAALESDEQRIFNPLTAEFLGFS  456



>ref|XP_004964836.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=459

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 148/477 (31%), Positives = 241/477 (51%), Gaps = 39/477 (8%)
 Frame = -1

Query  1697  SCSDFRVDFITESVVKTVGLTPK-PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPK  1521
             +C    ++  + ++V+     P  P +L +SNLDL+ G FP+  +  + +P     +   
Sbjct  3     ACRPLHLEIASRTLVRASRPPPGFPAVLAVSNLDLVLGPFPIFLISVYSAPTAGLDA---  59

Query  1520  IIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNL  1341
             +++ ++ +    LS F+PFAGRIV +P+T  P++ C+N G  +V A A++ L  ++F  +
Sbjct  60    VLNAVRGAFPTYLSSFFPFAGRIVRDPETKIPDVQCNNAGAELVVADADVPLAAVDFREV  119

Query  1340  NKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSE  1161
             ++ +  G +   F         + +Q+ R+ CGG  LT    H L D  +F   L+  +E
Sbjct  120   DRSL--GLIQIPFDA----SIPMSLQLVRFACGGFALTIGTTHLLADGRAFTVLLSALAE  173

Query  1160  LATNKPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRL  981
             +  +   S  P   R L +PR PP Y+ SLD  F   +   ++N      +L++ M +RL
Sbjct  174   MVRDGGLSREPLFDRSLFKPRSPPWYSASLDAEFARFTPQTMIN-----PVLTAAMKRRL  228

Query  980   YYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVD  801
             Y I+A+ +  LQ  AS      G  RR ++  A  A++WK++  AV  +   C+M W+VD
Sbjct  229   YRIEAADLAALQAAASPP----GGRRRASRFVALCAHVWKLLARAVGDADPSCRMAWIVD  284

Query  800   GRTRIP---GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDL  630
             GR ++    G +  YIGNV++ T  E S+ EL    +  +A+ V AAI+    A  F +L
Sbjct  285   GRKQVEPSDGALDRYIGNVVTYTSREASVAELMRAPLHDVAAAVRAAIAGVMTAARFQEL  344

Query  629   IDWIECHRP-----GLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCST  465
              DW+E  +      G    ++ LG   P  A+V+S    FP+ + + GFG P L      
Sbjct  345   ADWMEERKAAFRDGGKWTEEVNLGLGSP--ALVMSGLLPFPI-DGDLGFGKPRLVVPWVR  401

Query  464   IERIGVGYVNQRPSARGDGSWTVSAI-LWPDMVAALESHSECIFQPI--TAHDLHLS  303
               R+G   V   PS  GDGSW V A  +WP +   +E      F P+   A DL L+
Sbjct  402   HGRLGSAAVTVVPSPSGDGSWFVGATRMWPRLWEVVE------FDPLLKPAADLGLA  452



>emb|CDP14267.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   185 bits (470),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 150/471 (32%), Positives = 221/471 (47%), Gaps = 85/471 (18%)
 Frame = -1

Query  1670  ITESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRS-------PNQFHSSSP--KI  1518
             +  S V    L  + + L +SNLDLL     V   + ++        P +  ++SP   +
Sbjct  10    VKRSEVVAAALPVQEHWLPMSNLDLLLLALDVGVFFCYKKNNDTTSIPEKNLTTSPTENM  69

Query  1517  IDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLN  1338
             +  +K +L+Q L  FYPFAG +V N +  EPE+LC+NRGV  ++A A+I LK+L+ Y+ +
Sbjct  70    VATIKKALAQALVSFYPFAGEVVQN-RLGEPELLCNNRGVDFLDAFADIELKDLDLYHPD  128

Query  1337  KYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSEL  1158
               +  GK VP F+ +G     + IQ+T   CGGL +  TFDH + DA S   F T W E+
Sbjct  129   TSI-HGKFVP-FKNQG----VLSIQVTELKCGGLVIGCTFDHRVADAHSANMFFTAWVEI  182

Query  1157  ATNKPPSCS--PDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSI---M  993
             A  K  +    P  RR LL PR P  Y+  +D+ +V      +L+  PPP  L +    +
Sbjct  183   AQAKGTATHTVPCLRRSLLNPRRPTTYDAEIDDLYV------LLSSLPPPKELKASDDRL  236

Query  992   LKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMG  813
             L R+YYI+   I +LQ +AS          RRTK+E+FSA++WK +              
Sbjct  237   LSRIYYIEGKEIGQLQSMAS------SNGCRRTKLESFSAFLWKTIAEG-----------  279

Query  812   WLVDGRTRIPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLD  633
                                                   S +A  +HA I  A   +HFL 
Sbjct  280   --------------------------------------SWVADMIHACIEGANKEDHFLG  301

Query  632   LIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERI  453
             LIDW+E HRP    + +         AIV+SS  RFPV ++ FG+  P  G+        
Sbjct  302   LIDWVEEHRPQPAAAAVYFKNSEDEEAIVISSRLRFPVAQMNFGWEMPDFGSY--HFHWG  359

Query  452   G-VGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
             G  GYV   PS   +G W V   L    +  +ES S  +F+P+    L ++
Sbjct  360   GQTGYVMPMPSVSREGDWIVYMNLLKKHLDIVESKSGHVFRPLNPAYLKMN  410



>ref|XP_004976754.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=444

 Score =   184 bits (466),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 135/386 (35%), Positives = 200/386 (52%), Gaps = 30/386 (8%)
 Frame = -1

Query  1484  LSRFYPFAGRIVPNPKTDEPEILCDNRGV-LVVEAQANIRLKELEFYNLNKYVERGKLVP  1308
             L  +YP AG +V N    EPE+LC  RGV   V   A + L+E+    +++ VE  KLVP
Sbjct  67    LVAYYPLAGEVVAN-ADGEPELLCSGRGVDFTVATAAGVDLREIRLGAVDESVE--KLVP  123

Query  1307  AFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSP  1128
               ++ GG    V +++T++ CGG  +  TFDH + DA SF  FL  W+  A   P   +P
Sbjct  124   -VKKAGG---VVAVKVTKFRCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAARGGPAPPAP  179

Query  1127  DHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIM---LKRLYYIDASSI  957
               RR L  PR PP    S +       +D + + R        +    + R+Y I A+ +
Sbjct  180   SFRRSLAAPRDPPPRAPSTEAL-----IDRLFSPRSAALPPPPVAASSVNRIYRIAAADV  234

Query  956   HKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRI--P  783
               L+  A     G G    RTK+EAF+A++W++   A  +  ++C MG +VDGRTR+   
Sbjct  235   AVLKAAA-----GPG----RTKMEAFTAHLWRLCSRAASRRQSQCCMGVVVDGRTRMFPD  285

Query  782   GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRP  603
             G M  Y GNVL++ +G +  +EL+   ++ +A  VH  +  A   +HF  L+DW+E  RP
Sbjct  286   GAMKAYFGNVLTIPYGVIGSEELRRMALADVADDVHRWVVEAATGDHFRGLVDWVEALRP  345

Query  602   GLMLSKMVLGRDGPGAAI--VVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQR  429
                 ++  LG  G   A+  +VSSG  FPVG+ +FG G P   +        G GYV   
Sbjct  346   KPAAARAYLGGTGGSEAMACIVSSGMSFPVGKADFGTGLPAFASYHFPWP-AGAGYVMPM  404

Query  428   PSARGDGSWTVSAILWPDMVAALESH  351
             PSARGDG W V   + P++   +E  
Sbjct  405   PSARGDGDWVVYVHVAPELAKVMEEE  430



>ref|XP_004964837.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=458

 Score =   184 bits (467),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 143/454 (31%), Positives = 233/454 (51%), Gaps = 31/454 (7%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPK-PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F +   + ++V+     P  P +L +SNLDL+ G FP+  +  + +P     +   ++  
Sbjct  6     FHLSIASRTLVRASRPQPGFPAVLAVSNLDLILGPFPIFLVSVYPAPAAGLDA---VLAA  62

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
             ++ +    LS F+PFAGRIV +P+T  PE+ C+N G  +V A A + L +++F  +++ +
Sbjct  63    VRGAFPAYLSSFFPFAGRIVRDPETKIPEVQCNNAGAELVVADAAVPLADVDFTEVDRSL  122

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
               G +   F         + +Q+ R+ CGG  LT    H L D  +F   L+  +E+  +
Sbjct  123   --GLIQIPFDA----SIPMSLQLVRFACGGFALTVGTTHLLADGRAFTILLSALAEMVRD  176

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
                S  P   R L +PR PP Y+ SLD  F   + + ++N      +L++ + +RLY I+
Sbjct  177   GGLSREPLFDRSLFKPRSPPWYSASLDAEFARFTPETMIN-----PVLTAAIRRRLYRIE  231

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTR  789
             A+ +  LQ  AS      G  RR ++  A  A++WK++  AV  +   C+M W+VDGR +
Sbjct  232   AADLAALQAAASPP----GGGRRASRFVALCAHVWKLVARAVGDADPSCRMAWIVDGRKQ  287

Query  788   IP---GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWI  618
             +    G +  YIGNV++ T  E S+ EL    +  +A+ V AAI+    A  F +L DW+
Sbjct  288   VEPSDGALDRYIGNVVTYTSREASVAELMRAPLHDVAAAVRAAIAGVMTAARFQELADWM  347

Query  617   ECHRP-----GLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERI  453
             E  +      G    ++ LG   P  A+V+S    FP+ + + GFG P L        R+
Sbjct  348   EERKAAFRDGGKWTEEVNLGLGSP--ALVISGLLPFPI-DGDLGFGKPRLVMPWLRHGRL  404

Query  452   GVGYVNQRPSARGDGSWTVSAI-LWPDMVAALES  354
             G   V   PS  GDGSW  +A  +WP +V  +ES
Sbjct  405   GSANVTVVPSPSGDGSWFFAATRMWPRLVEVVES  438



>ref|NP_001053822.1| Os04g0609500 [Oryza sativa Japonica Group]
 emb|CAE03556.1| OSJNBa0085I10.1 [Oryza sativa Japonica Group]
 emb|CAE03657.2| OSJNBa0060N03.22 [Oryza sativa Japonica Group]
 emb|CAH67749.1| H0702G05.8 [Oryza sativa Indica Group]
 dbj|BAF15736.1| Os04g0609500 [Oryza sativa Japonica Group]
 gb|EAY95486.1| hypothetical protein OsI_17331 [Oryza sativa Indica Group]
Length=457

 Score =   181 bits (458),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 134/387 (35%), Positives = 197/387 (51%), Gaps = 29/387 (7%)
 Frame = -1

Query  1475  FYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQ  1296
             FYP AG +V N    EPE+LC  RGV   E+ A   ++ L    +++ VE  KLVPA + 
Sbjct  74    FYPLAGEVVAN-GDGEPELLCSGRGVDFTESVAGEEMRGLRIGMVDERVE--KLVPAKKA  130

Query  1295  RGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-------TNKPPS  1137
                    + +Q+T++ CGG  +  TFDH + DA SF  FL  W+  A       T  PP 
Sbjct  131   AS----VMAVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAARDGHGGGTAPPPP  186

Query  1136  CSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSI  957
               P  RR ++ PR PP   +   +  +      + +  PPP   ++  + R+Y + A+  
Sbjct  187   TIPSFRRSIVAPRDPPPPRSPSTDALIDRLFAPLGSAPPPPDDAAAAAVNRIYRVAAADA  246

Query  956   HKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKV-MVNAVDKSHNKCKMGWLVDGRTRI--  786
               LQ  A     G G    RTK+EAF+A++W++    A  +    C MG +VDGR R+  
Sbjct  247   ASLQDSA-----GPG----RTKLEAFTAHLWQLNARAAAAERERPCCMGVVVDGRGRMFP  297

Query  785   PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHR  606
              G M  Y GNVL++ +G +   EL+   ++ +A  VH  ++ A   +HF  L+DW+E  R
Sbjct  298   DGAMRAYFGNVLTIPYGVMGSGELRAAALADVAGDVHRWVAEAATGDHFRGLVDWVEARR  357

Query  605   PGLMLSKMVL--GRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQ  432
             P    ++  L     G  AA +VSSG  FPVGE +FG G+P   +        G GYV  
Sbjct  358   PKPAAARAYLGGTGGGDAAACIVSSGMGFPVGEADFGTGAPAFASYHFPWP-AGAGYVMP  416

Query  431   RPSARGDGSWTVSAILWPDMVAALESH  351
              PSARGDG W V   + P++  A++  
Sbjct  417   MPSARGDGDWVVYVHVSPELAVAMDEE  443



>ref|XP_002447068.1| hypothetical protein SORBIDRAFT_06g028020 [Sorghum bicolor]
 gb|EES11396.1| hypothetical protein SORBIDRAFT_06g028020 [Sorghum bicolor]
Length=457

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 128/409 (31%), Positives = 198/409 (48%), Gaps = 50/409 (12%)
 Frame = -1

Query  1484  LSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVE--AQANIRLKELEFYNLNKYVERGKLV  1311
             L  +YP AG +V N    EPE+LC  RGV   E  A   + L+E+    +++ VE  KLV
Sbjct  69    LVAYYPLAGEVVAN-GDGEPELLCSGRGVDFTETTAAGGVELREIRLGAVDEGVE--KLV  125

Query  1310  PAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCS  1131
             PA +          +++T++ CGG  +  TFDH + DA SF  FL  W+  A        
Sbjct  126   PAKKAAS----VTAVKVTKFRCGGAVVGCTFDHRVCDAYSFNMFLVAWAATARGS-----  176

Query  1130  PDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLY---------  978
                      P   P +  SL         DD  + R P T     ++ RL+         
Sbjct  177   ------SAPPPPAPSFRRSL-----VAPRDDPTHERAPST---DALIDRLFSPRSAAPPP  222

Query  977   -----YIDASSIHKLQKLASEEDDGIGTSRR--RTKIEAFSAYIWKVMVNAVDK-SHNKC  822
                       S++++ ++A+ +   +  S    RTK+EAF+A++WK+   A      ++C
Sbjct  223   PPPAAAAGRRSVNRIYRIAAADIAALKASAGPGRTKLEAFTAHLWKLCSRAASSPRQSQC  282

Query  821   KMGWLVDGRTRIP--GIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNA  648
              MG +VDGRTR+   G M  Y GNVL++ +G +  ++L+   ++ +A  VH  ++ A   
Sbjct  283   CMGVVVDGRTRMSPGGAMKAYFGNVLTIPYGVIGSEDLRRMALADVAGDVHRWVAEAATG  342

Query  647   EHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAI--VVSSGRRFPVGELEFGFGSPVLGTV  474
             +HF  L+DW+E  RP    ++  LG  G   A+  +VSSG  FPV +++FG G P   + 
Sbjct  343   DHFRGLVDWVEALRPKPAAARAYLGGTGGNEAMACIVSSGMTFPVRKVDFGTGLPAFASY  402

Query  473   CSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                    G GYV   PSARGDG W V   + P++   +E     +FQ +
Sbjct  403   HFPWP-AGAGYVMPMPSARGDGDWVVYVHVAPEVAKVMEEEESTVFQAL  450



>gb|EAZ35847.1| hypothetical protein OsJ_20144 [Oryza sativa Japonica Group]
Length=443

 Score =   179 bits (454),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 135/474 (28%), Positives = 222/474 (47%), Gaps = 70/474 (15%)
 Frame = -1

Query  1685  FRVDFITESVVKTVGLTPK-PYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDN  1509
             F V+    ++V+     P  P +L +SNLDL+ G F V+ +  + +P +  ++    +  
Sbjct  11    FGVEVTARTLVRASDPPPGFPAVLPVSNLDLILGSFNVSLIVVYPAPARGFAAVAAAVRA  70

Query  1508  LKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYV  1329
                +    LSRF+PFAGR+V +  T  PE+ CDN G  +V A A + L +++F + ++ +
Sbjct  71    ALPAF---LSRFFPFAGRVVADAATGIPEVACDNAGAELVLADAGVALADVDFADADRSL  127

Query  1328  ERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATN  1149
               G +   + Q      A+ +Q+ R+ CGG  +++  +H L D        T W+E+   
Sbjct  128   --GTIQLPYEQ----GIALSLQLVRFKCGGFSMSWGTNHLLVDGHGLTALPTAWAEMLRT  181

Query  1148  KPPSCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYID  969
                S  P H R                          +   R PP   +S+        D
Sbjct  182   GGLSWEPHHDRR------------------------SLFRPRSPPRHGASL--------D  209

Query  968   ASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTR  789
             A                   SRR T++EA SA++WK++  A   S  +C++ WLVDGR R
Sbjct  210   AEFTRT-------------ASRRATRLEALSAHVWKLLAAATHGSDARCRLAWLVDGRRR  256

Query  788   I------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLI  627
             +      P ++S Y+GNV++    E  ++ +    ++ +A+   AAI      E + +L+
Sbjct  257   LDPAKYDPTLVSSYLGNVVTYASRESPVEAITSSPLADVAAMAGAAIGEVFRQERYEELV  316

Query  626   DWIECHRP-----GLMLSKMV-LGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCST  465
             DW+E  +      G   ++ V +G   P  A+VVS+   F V + +FGFGSP L      
Sbjct  317   DWMELRKAAAFKNGEKWTETVGIGTGSP--AVVVSAFVPFRV-DGDFGFGSPALVMPWVR  373

Query  464   IERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
               R+G   +    S R DGSW VSA LWP +  A+E+  + + +P TA  L L+
Sbjct  374   PGRLGSAAMTVARSPREDGSWVVSARLWPRLADAIEADPDAVLKPATAARLGLA  427



>gb|EMT02774.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=449

 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 135/386 (35%), Positives = 195/386 (51%), Gaps = 32/386 (8%)
 Frame = -1

Query  1484  LSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQA-NIRLKELEFYNLNKYVERGKLVP  1308
             L  ++P AG +V N    EPE+LC+ RGV   EA A +  L+EL    +++ V+  KLVP
Sbjct  70    LVAYHPLAGEVVAN-GDGEPELLCNCRGVDFTEASAGDTELRELRLGIVDEGVD--KLVP  126

Query  1307  AFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNK--PPSC  1134
             +  ++ G    + +Q+T++ CGG  +  TFDH + DA SF  FL  W+  A     PP+ 
Sbjct  127   S--KKAG---VISLQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAARGGSVPPAP  181

Query  1133  SPDHrrfllrprfppRYNTS--LDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASS  960
             +        R   P  Y T+  +D  F   S             +++  + R+Y I A+ 
Sbjct  182   TFRRSLVSPRDPSPRTYATNALIDRLFSPLSSAPPPPP----ATVAATAVNRIYRIAAAD  237

Query  959   IHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIP-  783
             +  LQ  A     G G    RTK+EAF+A++W++   +       C MG +VDGR R+  
Sbjct  238   VAALQATA-----GPG----RTKLEAFTAHLWQLCSMSASAHQRLCCMGMVVDGRARMSP  288

Query  782   -GIMSDYIGNVLSLTFGELSMDELKHG-TISKIASHVHAAISTATNAEHFLDLIDWIECH  609
              G M  Y GNVL++T+G  S D+L+   T++ +A  VH  +  A   EHF  LIDW+E  
Sbjct  289   DGAMKAYFGNVLTITYGVNSSDDLRRRMTLADVADDVHQWVREAATDEHFRGLIDWVEAL  348

Query  608   RPGLMLSKMVLGRDG--PGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVN  435
             RP    ++  LG  G     A +VSSG  FPV E+ FG G P   +        G  YV 
Sbjct  349   RPNPAAARAYLGGTGGTKATACIVSSGMSFPVREINFGTGLPAFASYHFPWP-AGAAYVM  407

Query  434   QRPSARGDGSWTVSAILWPDMVAALE  357
               PSARGDG W V     P++V  +E
Sbjct  408   PMPSARGDGEWVVYVHAAPELVEVME  433



>ref|XP_003581633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=467

 Score =   177 bits (449),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 151/466 (32%), Positives = 221/466 (47%), Gaps = 76/466 (16%)
 Frame = -1

Query  1619  LTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNP  1440
             L +SNLDLL     V+    +  P             LK +L++ L  +YP AG +V + 
Sbjct  35    LAVSNLDLLLPPLEVSVFLCYAQPA-------PTAAALKEALAKVLVPYYPLAGEVVASA  87

Query  1439  KTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQI  1260
                EPE+LC  RGV   EA     LKEL    +++ V+R  LVPA +  G     V +Q+
Sbjct  88    H-GEPELLCSGRGVDFTEAVGGSELKELRLGLVDEGVQR--LVPAKKLAG----VVSVQV  140

Query  1259  TRYTCGGLCLTFTFDHALGDASSFAKFLTTW-------------------SELATNKPPS  1137
             T++ CGG+ +  TFDH + DA SF  FL  W                   S LA   P  
Sbjct  141   TKFRCGGIVVGCTFDHRVCDAYSFNLFLVAWAAAARGGGGPTPPAPTFRRSLLAPRDP--  198

Query  1136  CSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSI  957
              SP               +  +D  F    L  +   + PP+  +++   R+Y I A+ I
Sbjct  199   -SP----------RTNSTDALIDRLF--SPLSSVPPQQAPPSKATAV--NRIYRISAADI  243

Query  956   HKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNA-----VDKSHNKCKMGWLVDGRT  792
               LQ  A     G G    RTK+E+F+A++W++   +      +++   C MG +VDGR+
Sbjct  244   SALQAAA-----GPG----RTKLESFTAHLWQLCSKSSAAAQAEQAQKLCCMGMVVDGRS  294

Query  791   RIP--------GIMSDYIGNVLSLTFGELSMDELKHG-TISKIASHVHAAISTATNAEHF  639
             R+           M  Y GNVL++ +G +S D+L+   T++++A  VH  +  A  A+HF
Sbjct  295   RMSCSDEYNGDEAMKRYFGNVLTIPYGVISADDLRRRMTLAEVARDVHRWVREAATADHF  354

Query  638   LDLIDWIECHRPGLMLSKMVLGRDG--PGAAIVVSSGRRFPVGELEFGFGSPVLGTVCST  465
               L+DW+E  RP    ++  LG  G     A +VSSG  FPVG L+FG G P   +    
Sbjct  355   RGLVDWVEALRPRPAAARAYLGGTGGADATACIVSSGMGFPVGRLDFGTGRPAFASYHFP  414

Query  464   IERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
                 G GYV   PSARGDG W V     P++V  LE     +F+ +
Sbjct  415   WP-AGAGYVMPMPSARGDGDWVVYVHAAPELVRVLEEEEHTVFRAL  459



>ref|XP_003575891.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Brachypodium distachyon]
Length=467

 Score =   176 bits (446),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 136/457 (30%), Positives = 225/457 (49%), Gaps = 45/457 (10%)
 Frame = -1

Query  1631  KPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRI  1452
             KP +  +SNLDL       +    +  P +    +  ++   +A     L+ FYP  GRI
Sbjct  20    KPRVDAVSNLDLDPNSIQGSVTCVYPKPAKGGDFN-GVVAAFEAHFPTLLNHFYPLTGRI  78

Query  1451  VPNPKTDE-PEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFA  1275
             V +P +   PE+ C N+G  ++ A A + L  L++ +  + ++R +L  A      ++  
Sbjct  79    VFDPSSPMIPELHCHNQGAELIVADAGVPLCSLDWGSSEESLKRIQLPYA------EEIP  132

Query  1274  VQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCS---PDHrrfllr  1104
             + +Q+  +TCGG  + ++ ++ +GD +     +  WSEL  +   S +   P+H R L R
Sbjct  133   LSVQLISFTCGGFAVVWSGNNLMGDGNMGMNLVKMWSELVRSGGTSFTGQAPNHDRSLFR  192

Query  1103  prfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEED  924
             PR PP Y  S++  F S S   ++N            ++RLYYI+AS I +L+ +AS   
Sbjct  193   PRDPPSYRASIEGLFTSSSEGGMVNA----LTAEQSFIERLYYIEASDIARLRHMASTA-  247

Query  923   DGIGTSRRRTKIEAFSAYIWKVMVNAVD------KSHNKCKMGWLVDGR----TRIPGIM  774
                      ++ +A SAY+WKV    V       +S  +C+M W VDGR      +   +
Sbjct  248   ---------SRAQAVSAYLWKVFAAVVGSSKLLAESDKRCRMLWWVDGRRVLAPELRSKL  298

Query  773   SDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLM  594
              +Y GNV++    E  ++ +    + ++A  V   I++  + EH   L+DWIE H+P   
Sbjct  299   GNYAGNVVAYAVREADVETILEKPLPELAMMVRETIAS-IDGEHIQGLVDWIEVHKPHKF  357

Query  593   LSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERI--GVGYVNQRPSA  420
             +   ++G   P     + S   FP  + +FGFG   L     +  R+  GV  + QRP  
Sbjct  358   IETPIVGLGSPTLGQTMWSS--FPT-DTDFGFGHASLALPVDSRGRLCAGVLCIGQRP--  412

Query  419   RGD-GSWTVSAILWPDMVAALESHSECIFQPITAHDL  312
              GD GSW +SA +WP + AALE+  E IF+P+T   L
Sbjct  413   -GDSGSWVLSAYIWPRLAAALEADKERIFKPLTPEYL  448



>ref|XP_006851033.1| hypothetical protein AMTR_s00025p00227780, partial [Amborella 
trichopoda]
 gb|ERN12614.1| hypothetical protein AMTR_s00025p00227780, partial [Amborella 
trichopoda]
Length=311

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 162/322 (50%), Gaps = 16/322 (5%)
 Frame = -1

Query  1262  ITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSPDHrrfllrprfppRY  1083
             +T+  CG + +  TFDH + DA S   FL +W++ A + PPS  P   R LL PR    Y
Sbjct  1     LTKLKCGSIVVACTFDHRVADAYSANMFLISWAQTAQSNPPSMLPSFERSLLSPRRQGSY  60

Query  1082  NTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSR  903
               S D  F+  S       +P  TL +     R+YYI A  IH LQ  AS         +
Sbjct  61    TVSHDCMFMEESF------QPISTLSNDRRCSRIYYIKAKDIHLLQARASS------NGQ  108

Query  902   RRTKIEAFSAYIWKVMV---NAVDKSHNKCKMGWLVDGRTRIPGIMSDYIGNVLSLTFGE  732
              RTK+E+F+  +W+++         S+ KC +G +VDGR+R+   MS Y GNVL+  F E
Sbjct  109   HRTKLESFATLLWQILAAKPKLAGNSNKKCGLGIMVDGRSRLGPGMSGYFGNVLASPFME  168

Query  731   LSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAA  552
                 EL+    +++A  VH  +   TN + F  L+DW+E H P  ML  +    +    A
Sbjct  169   AEASELRAMPFNQVAGLVHEFLIGVTNNDFFKGLVDWVEMHWPKPMLPAVYFKNEAEVPA  228

Query  551   IVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDM  372
             +++SSG RFPV +++F +G PV  ++         GYV    SA GDG W V   L    
Sbjct  229   VLLSSGLRFPVSDVDFSWGGPVFASIHFPWGGTS-GYVMPVMSALGDGDWVVFMHLPEGQ  287

Query  371   VAALESHSECIFQPITAHDLHL  306
             +  +E+    +  P+TA  L L
Sbjct  288   MEVVEAELGEVLHPMTASYLKL  309



>ref|XP_003581632.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=467

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/395 (34%), Positives = 195/395 (49%), Gaps = 32/395 (8%)
 Frame = -1

Query  1475  FYPFAGRIVPNPKTDEPEILCDNRGVLVVEA-QANIRLKELEFYNLNKYVERGKLVPAFR  1299
             +YP AG +V      EPE+LC  RGV   EA  A   L+++     ++  +  KLVPA +
Sbjct  85    YYPLAGEVVAT-AAGEPELLCSGRGVDFTEATAAGAELRQVRLSMPDESAD--KLVPA-K  140

Query  1298  QRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCSP---  1128
             + G     + +Q T++ CGG  +   FDH + DA SF  FL  W+  A     S SP   
Sbjct  141   KSG----VMSVQFTKFKCGGAVVGCVFDHRVCDAYSFNMFLVAWANAARGGSSSVSPAPS  196

Query  1127  -DHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHK  951
              D      R       +T  D  FV  S     +    P   +     R+Y++ A+ +  
Sbjct  197   FDRSFLAPRNGISSSVDTLADRLFVPVSRVPPPSTSAAPAAATE-AFNRIYHVSAADVAA  255

Query  950   LQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHNK--CK--MGWLVDGRTRI-  786
             LQ  A     G G    RTK+EAF+A++W++   A D S  +  C+  MG +VDGR+R+ 
Sbjct  256   LQAAA-----GPG----RTKLEAFTAHLWQLYAMAADTSDRRPSCRVSMGVVVDGRSRLR  306

Query  785   -PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECH  609
               G M  Y GNVL++ +G L   +L+   ++ +A+ VH  +S A + E F  L++W+E H
Sbjct  307   PDGAMGAYFGNVLTIPYGILGAGDLRGMALADVAADVHGWVSEAASGERFRGLVEWVEAH  366

Query  608   RPGLMLSKMVLGRDGPGAAI-VVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQ  432
             RP   +++  LG     + + VVSSG R PVGE++FG G P   +        G GYV  
Sbjct  367   RPEPTVARAYLGAGESDSMVCVVSSGMRLPVGEVDFGTGRPAFASYHFPWPG-GAGYVMP  425

Query  431   RPSAR-GDGSWTVSAILWPDMVAALESHSECIFQP  330
              PSAR G G W V     P++V A+E        P
Sbjct  426   MPSARAGSGDWVVYVHAAPELVRAMEQEPTVFRAP  460



>dbj|BAJ87867.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   172 bits (437),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 120/401 (30%), Positives = 201/401 (50%), Gaps = 32/401 (8%)
 Frame = -1

Query  1466  FAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGG  1287
              AGRI  NP +  PE+ C N+G  ++   A + L  L++    + ++R +L  A      
Sbjct  1     MAGRIAVNPSSGMPELHCFNQGTELIVGDAGVELWTLDWGLSEESLKRIQLPYA------  54

Query  1286  DDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPS-CSPDHrrfl  1110
              +  + +Q+  +TCGG  + +  ++ +GD +     +  WSEL  +   S   P H R L
Sbjct  55    AEVPLSVQLVSFTCGGFAVVWATNNLIGDGNVGIMLVRMWSELVRSGTISEGGPSHDRSL  114

Query  1109  lrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASE  930
               PR PP+Y+ SLD  F     +  +N         +  ++RLYY++   I  L++ AS 
Sbjct  115   FSPREPPQYDPSLDGMFTQWDHEHEVNA----LTAEASFIERLYYVEERDIAMLREAAST  170

Query  929   EDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKS------HNKCKMGWLVDGRTRI--PGIM  774
             E       ++ T+++A SAY+WKV+   VD S        +C+M W VDGR R+  P + 
Sbjct  171   E------GQQATRVQAVSAYLWKVLAGIVDASKLLPEAEKRCRMLWWVDGRKRVSSPELR  224

Query  773   S---DYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRP  603
             S   +Y GNV S    + ++  +    + ++AS V  AI++    E + D++DW+E H+P
Sbjct  225   SALRNYAGNVTSYVLADEAVGTVLSKPLVEVASMVREAITSVNYDELYQDMVDWLEVHKP  284

Query  602   GLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGT-VCSTIERIGVGYVNQRP  426
                +    +G   P   I  +    FP  + +FGFG   L   V + + R+  G++    
Sbjct  285   QKFIETSFIGLGSP--TITQTVWTTFP-NDTDFGFGHAALAMPVDANLGRLCTGFLCVSA  341

Query  425   SARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHLS  303
                  G+W +SA +WP + AALES  + +F+P+TA  L L+
Sbjct  342   KPGNPGTWIISAFIWPRLAAALESDQQRVFKPLTAEYLGLT  382



>ref|XP_008778761.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like, 
partial [Phoenix dactylifera]
Length=270

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/258 (38%), Positives = 142/258 (55%), Gaps = 19/258 (7%)
 Frame = -1

Query  1085  YNTSLDETFVSCSLDDILNMRPPP-TLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGT  909
             Y++S D     C+L   ++ RPPP +      + R+ Y+ A  I ++Q  +  +      
Sbjct  21    YDSSPDRL---CAL---VSSRPPPLSPDQEAAVSRICYVAADDIARIQAASGGQ------  68

Query  908   SRRRTKIEAFSAYIWKVMVNAVDKSHNKCKMGWLVDGRTRIP--GIMSDYIGNVLSLTFG  735
                RTK EAF+AY+W+V+          C+MG +VDGRTR+   G M+ Y GNV+S+ +G
Sbjct  69    ---RTKFEAFTAYLWRVLARGARPEDKVCRMGAVVDGRTRLARGGEMAGYFGNVVSIPYG  125

Query  734   ELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGA  555
              L ++ELK   +++ A+ VH  +  AT  EHF  L+DW+E  RP   ++++ LG +  G 
Sbjct  126   ILGVEELKDMDLAETAAAVHGMLRQATTEEHFRGLVDWVEARRPEPAVARIYLGEEDGGV  185

Query  554   AIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPD  375
               VVSSGR FPVGE+EFG+G  V G+          GYV   PSAR +G W V   L   
Sbjct  186   GCVVSSGRAFPVGEVEFGWGRAVFGSYHFPWGS-SAGYVMPMPSARRNGDWVVYMHLLKR  244

Query  374   MVAALESHSECIFQPITA  321
              V  LE     +F+P+TA
Sbjct  245   FVDVLEVEEPPVFRPLTA  262



>gb|KCW74058.1| hypothetical protein EUGRSUZ_E02684 [Eucalyptus grandis]
Length=315

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 118/326 (36%), Positives = 168/326 (52%), Gaps = 47/326 (14%)
 Frame = -1

Query  1181  FLTTWSELATNKPP-SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPP---  1014
             F+  W+E A +  P S  P  RR LL PR P  ++ SLD  ++  S        PPP   
Sbjct  2     FMVFWAETARSAAPISLPPSFRRSLLNPRHPLCFDPSLDRMYIPVS------ALPPPLKH  55

Query  1013  -----------TLLSS-IMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAY  870
                        TL     +L RLYY+  + + +LQ+ A           +RTK+E+FSA+
Sbjct  56    KLQVDEQCETMTLRDDDHLLSRLYYVTNAKLSELQQSA------CSNGSKRTKLESFSAF  109

Query  869   IWKVMVNA---VDKSHNKC--KMGWLVDGRTRI--------PGIMSDYIGNVLSLTFGEL  729
             +W+++  +    D   NK   +MG +VDGR R+        P  MS Y GNVLS+ FGE 
Sbjct  110   LWRMVAESSLVADNDDNKTMSRMGIVVDGRCRLMSQGKDDKPTPMSSYFGNVLSVPFGEK  169

Query  728   SMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMV-----LGRDG  564
                E+    +S +A  VH  + +A   EHFLDLIDW+E HRP   L+++         + 
Sbjct  170   RAREVVEKPLSWVADVVHEFVESAAKKEHFLDLIDWVEGHRPVPALARIFCKPGSEEEEE  229

Query  563   PGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAIL  384
                A+VVSSG+RFPV E++FG+G P+LG+          GYV   PS   +G W V   L
Sbjct  230   GSTALVVSSGQRFPVTEMDFGWGKPMLGSYHFPWGG-KAGYVMPMPSPLSNGDWVVYLHL  288

Query  383   WPDMVAALESHSECIFQPITAHDLHL  306
                 VA +ESH+  +F+P+T H L+L
Sbjct  289   SRSQVAFIESHAPTVFRPLTPHHLNL  314



>gb|KFK22997.1| hypothetical protein AALP_AAs66525U000100 [Arabis alpina]
Length=256

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 143/259 (55%), Gaps = 18/259 (7%)
 Frame = -1

Query  1082  NTSLDETFVSCSLDDILNMRPPP---TLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIG  912
             ++S+DE +V  +        PPP   T   +I++ R+YYI A ++ +LQ LAS    G  
Sbjct  2     DSSIDEMYVPVT------SLPPPQETTNPDNILVSRIYYIKADALEELQALAS----GSE  51

Query  911   TSRRRTKIEAFSAYIWKVMVNAVDKS---HNKCKMGWLVDGRTRIPGIMSD-YIGNVLSL  744
                +RTKIE+FSA +WK++     K        K+G +VDGR R     ++ Y GNVLS+
Sbjct  52    IKDKRTKIESFSALLWKLVAKHAAKDPFPSKNSKLGIVVDGRRRFMEQQTNTYFGNVLSI  111

Query  743   TFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDG  564
              FG   +++L +  +S + + VH  + ++   +HFL+LIDW+E HRP   LS++      
Sbjct  112   PFGGQRINDLINKPLSWVTTEVHKFLESSVTKDHFLNLIDWVEAHRPTPALSRIYCTGAD  171

Query  563   PGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAIL  384
              G AIVVSSGR FPV  ++FG+GSPV G+          GYV   PS+  DG W V   L
Sbjct  172   DGPAIVVSSGRSFPVTRVDFGWGSPVFGSYHFPWGG-SAGYVMPMPSSVDDGDWMVYLHL  230

Query  383   WPDMVAALESHSECIFQPI  327
                 +  +E  +  +F+PI
Sbjct  231   TKGQLKFIEEEASHVFKPI  249



>ref|NP_001053821.1| Os04g0609300 [Oryza sativa Japonica Group]
 emb|CAE03656.2| OSJNBa0060N03.21 [Oryza sativa Japonica Group]
 emb|CAH67748.1| H0702G05.7 [Oryza sativa Indica Group]
 dbj|BAF15735.1| Os04g0609300 [Oryza sativa Japonica Group]
 gb|EAY95485.1| hypothetical protein OsI_17330 [Oryza sativa Indica Group]
Length=466

 Score =   161 bits (408),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 145/459 (32%), Positives = 223/459 (49%), Gaps = 31/459 (7%)
 Frame = -1

Query  1670  ITESVVKTVGLTPKPYILTLSNLDLLSGRFPV-TYLYFFRSPNQFHSSSPKIIDNLKASL  1494
             +T +      L  + + L LSNLDL+     V  +  +          +      LKA+L
Sbjct  17    VTSASTVAPALPVQEHRLPLSNLDLILPPMDVGVFFCYGAGEGSGGGGALLPAATLKAAL  76

Query  1493  SQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQA-NIRLKELEFYNLNKYVERGK  1317
             ++ L  +YP AG +V N +  E E+LC  RGV   EA A +  L++L    +++  E  K
Sbjct  77    AKVLVAYYPLAGEVVANTR-GEGELLCSGRGVDFAEATAGDAVLRQLRLAVVDESAE--K  133

Query  1316  LVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPS  1137
             LVP  +++ G    + +Q+T++ CGG  +  TFDH + DA SF  FL  W+  A     +
Sbjct  134   LVP--KKKAG---VMCVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAARGSSAA  188

Query  1136  CSP--DHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDAS  963
              +P  D          PP  +   D  FV  S   +          ++  + R++ + A+
Sbjct  189   PAPSFDRSFLAPTSPAPPCPDALSDRLFVPVSC--VPAPPSSAPEAAAAAVNRIFRVAAA  246

Query  962   SIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAV---DKSHNKCKMGWLVDGRT  792
              +  LQ  A     G G    RTK+EAF+A++W++   A     +    C MG +VDGRT
Sbjct  247   DVAALQAAA-----GPG----RTKLEAFTAHLWQLHARAAASPPRHRRSCCMGVVVDGRT  297

Query  791   RI--PGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLDLIDWI  618
             R+   G M  Y GNVL++ +G +S  +L    ++ +A  VH  ++ A   +HF  L+DW+
Sbjct  298   RLRRDGAMGAYFGNVLTIPYGAMSSGDLSAMPLADVAGDVHRWVAEAATRDHFRGLVDWV  357

Query  617   ECHRPGLMLSKMVL--GRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVCSTIERIGVG  444
             E  RP   +++  L        AA VVSSG R PVGE++FG G P   +        G G
Sbjct  358   EQLRPEPSVARAYLGGDGGAEAAACVVSSGMRMPVGEVDFGRGRPAFASYHFPWPG-GAG  416

Query  443   YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
             YV   PSARGDG W V      ++V A+E     +F+ +
Sbjct  417   YVMPMPSARGDGDWVVYVHAAAEVVKAMEEEETTVFRAL  455



>ref|NP_001059280.2| Os07g0244600 [Oryza sativa Japonica Group]
 dbj|BAF21194.2| Os07g0244600 [Oryza sativa Japonica Group]
Length=445

 Score =   159 bits (402),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 129/427 (30%), Positives = 197/427 (46%), Gaps = 70/427 (16%)
 Frame = -1

Query  1550  PNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANI  1371
             PN        ++   +A L   L+ FYP AGRIV +P T  PE+ C N+G  +V  + ++
Sbjct  76    PNAGDGDFDAVVATFEAVLPSLLNHFYPLAGRIVVDPATGLPELHCHNQGAELVVGEVDV  135

Query  1370  RLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASS  1191
              L  L +                             + R+ CG   + +   + L D   
Sbjct  136   ALGSLNY----------------------------ALLRFACGSFSVVWGNYNLLHDGQV  167

Query  1190  FAKFLTTWSELA-TNKPPSCSP-DHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPP  1017
                 +  WSELA T +     P +H R + RPR PP Y  ++D  F +   DD   +   
Sbjct  168   STMIVRMWSELARTGRISDGLPINHDRSVFRPRSPPSYGAAIDAMFTA--YDDGGRLVNA  225

Query  1016  PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDK  837
              T   S  ++RLYYI+A  I +L+  AS   +     +R ++++A SAY+WK +   V  
Sbjct  226   LTAHDSF-VERLYYIEAGDIARLRDAASAGAE----QQRASRVQAVSAYLWKALAGVVAA  280

Query  836   S---HNKCKMGWLVDGRTRI--PGI---MSDYIGNVLSLTFGELSMDELKHGTISKIASH  681
             S     +C MGW VD R R+  P +   M  Y GNV S   G+ ++ E+    ++++A+ 
Sbjct  281   SCVPEERCCMGWWVDARRRVASPALVPAMCGYCGNVTSYALGDAAVGEVLERPLAEVAAM  340

Query  680   VHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFG  501
             V  +I++    E+  +L+DW+  H+      K V                 FP+ + +FG
Sbjct  341   VRESIASIDYDEYLQELVDWVVGHK----TEKTVFAS--------------FPL-DTDFG  381

Query  500   FGSPVLGTVCSTIERIGVG--YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
             FG   L        ++G G   V  RP   GDGSW VSA +WP M AALE  S+ +F+P+
Sbjct  382   FGQAALAMPIWDHGKMGCGTLAVGVRPG--GDGSWLVSAYIWPRMAAALE--SDGVFKPL  437

Query  326   TAHDLHL  306
             TA  L L
Sbjct  438   TAAYLGL  444



>ref|XP_003562118.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Brachypodium 
distachyon]
Length=487

 Score =   158 bits (400),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 121/468 (26%), Positives = 215/468 (46%), Gaps = 29/468 (6%)
 Frame = -1

Query  1667  TESVVKTVGLTPKPYILTLSNLDLLSGRFPVTYLYFFRSP-NQFHSSSPKIIDNLKASLS  1491
             +  +VK    + +P++  +S+LDL++     +    +R P N        ++   +A L 
Sbjct  20    SRRLVKASDTSIQPHVAAVSHLDLITNCAQASVRCVYRKPTNGDLGCFSAVVAAFEAHLP  79

Query  1490  QCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLV  1311
               L+ F+  AGRIV +  T  PE+ C N+G  +V   A++ L  +++    + + R ++ 
Sbjct  80    SLLNHFFSLAGRIVIDRATGVPELHCFNQGAELVVGHADLELCGMDWGLPEESLGRIQVP  139

Query  1310  PAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELATNKPPSCS  1131
              A      +D  + +Q+  + CGG  + +  +  +GD +     +  +SEL+     S  
Sbjct  140   YA------EDLPLSVQLLSFACGGFAVVWATNTLIGDGNVGVMLVRMFSELSRTGTLSWG  193

Query  1130  -PDHrrfllrprfpp-RYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSI  957
              P H R +      P  Y T +   F     +  +N            + RLYY++A  I
Sbjct  194   GPTHDRSVFSKPRDPPSYGTKVASMFTPWDHEHQVN----ALTAEESFVGRLYYVEAQDI  249

Query  956   HKLQKLASEEDDGIGTSRRR-TKIEAFSAYIWKVMVNAVDKS------HNKCKMGWLVDG  798
              +L+  A  +       +R  T+++A SAY+WKV+   V  S        +C++ W VDG
Sbjct  250   ARLRADADADAGAGTGRQRAATRVQAMSAYLWKVLARIVATSKLLSEDEKRCRLLWWVDG  309

Query  797   RTR-----IPGIMSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLD  633
             R R     +   + +Y GNV S    + + D +    +S +A  V  AI+     E +  
Sbjct  310   RRRFSAPELRARLQNYAGNVTSYVVADAAADRVLGEPMSGVAGMVRDAIAEVDYDEMYQQ  369

Query  632   LIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGTVC-STIER  456
             ++DW+E H+PG  +    +G   P  A  + S  +    + +FGFG   L     S++ R
Sbjct  370   MVDWMEVHKPGRFVETSTVGLGSPTLAQTMWSSFK---DDTDFGFGKAALAMPAESSLGR  426

Query  455   IGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDL  312
             + +  ++        G+W VSA +WP + AALES  + IF+P+ A  L
Sbjct  427   LCMAMLSISAKPGDPGTWLVSACIWPRLAAALESDPQRIFKPLNAEYL  474



>gb|EMS59417.1| Anthranilate N-benzoyltransferase protein 3 [Triticum urartu]
Length=355

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 170/348 (49%), Gaps = 30/348 (9%)
 Frame = -1

Query  1367  LKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASSF  1188
             L+EL    +++ V+  KLVP+ +  G     + +Q+T++ CGG  +  TFDH + DA SF
Sbjct  15    LRELRLVIVDEGVD--KLVPS-KMAG----VISVQVTKFKCGGAVVGCTFDHRVCDAYSF  67

Query  1187  AKFLTTWSELATNK--PPSCSPDHrrfllrprfppRYNTS--LDETFVSCSLDDILNMRP  1020
               FL  W+  +     PP+ +        R   P  Y T+  +D  F   S         
Sbjct  68    NMFLVAWAATSRGGSVPPAPTFRRSLVSPRDPSPRTYATNALIDRLFSPLSSASPPPP--  125

Query  1019  PPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVD  840
                 +++  + R+Y I A+ +  LQ  A     G G    RTK+EAF+A++W++   +  
Sbjct  126   --ATVAATAVNRIYRIAAADVAALQVTA-----GPG----RTKLEAFTAHLWQLCSMSGS  174

Query  839   KSHNKCKMGWLVDGRTRIP--GIMSDYIGNVLSLTFGELSMDELKHG-TISKIASHVHAA  669
                  C MG +VDGR R+   G M  Y GNVL++T+G  S+D+L+    ++ +A  VH  
Sbjct  175   AHQRLCCMGMVVDGRARMSPDGAMKAYFGNVLTITYGVNSIDDLRRRMALADVADDVHRW  234

Query  668   ISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDG--PGAAIVVSSGRRFPVGELEFGFG  495
             +  A   EHF  LIDW+E  RP    ++  LG  G     A +VSSG  FPV E+ FG G
Sbjct  235   VREAATDEHFRGLIDWVEALRPKPAAARAYLGGTGGTKATACIVSSGMGFPVREINFGTG  294

Query  494   SPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESH  351
              P   +        G  YV   PSAR DG W V     P++V  +E  
Sbjct  295   LPAFASYHFPWP-AGAAYVMPMPSARDDGEWVVYVHAAPELVKVMEEE  341



>ref|XP_003575487.2| PREDICTED: anthranilate N-benzoyltransferase protein 3-like [Brachypodium 
distachyon]
Length=410

 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 140/414 (34%), Positives = 205/414 (50%), Gaps = 40/414 (10%)
 Frame = -1

Query  1475  FYPFAGRIVPNPKTDEPEIL-CDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFR  1299
              +P AGRIV +P +  PE L C N+G  +V A A + L+ L++   N+ V R  LVP   
Sbjct  1     MFPMAGRIVRDPVSGLPEELRCGNQGAELVLADAGVALRALDWSLANESV-RKILVPF--  57

Query  1298  QRGGDDFAVQIQITRYTCG-GLCLTFTFDHALGDASSFAKFLTTWSELA-TNKPPSCSPD  1125
                 D+  + +Q+  +TCG G  + + F H LGD S     + TW EL  T       P 
Sbjct  58    ---PDEVPLSLQLVSFTCGLGFAVVWGFHHLLGDGSFGGMLMKTWCELVMTGSISGGGPS  114

Query  1124  Hrrfll-rprfppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKL  948
             H R +  RPR PP Y+ S   TF     +  +N         +  ++R YY++   + +L
Sbjct  115   HDRAVFFRPRDPPSYSASFAATFTPWDHEHQVNG----LTAEASFVQRHYYVEGRDVARL  170

Query  947   QKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDK------SHNKCKMGWLVDGRTRI  786
             +  AS  + G G  RR T+ EA SAY+WKV+   V           +C+M WLVDGR R+
Sbjct  171   RDTASTTEPG-GRRRRATRAEAVSAYLWKVLAGVVASLTRLADDEKRCRMAWLVDGRRRL  229

Query  785   ------PGI---MSDYIGNVLSLTFGELSMDELKHGTISKIASHVHAAISTATNAEHFLD  633
                   P +   +  Y GNV +   G+ ++  +    ++++A+ V  AI+         +
Sbjct  230   TLTSSTPELRRALRSYAGNVTTHAVGDAAVAAVLSRPLAEVAAMVRDAITAPDYDALCQE  289

Query  632   LIDWIECH-RPGLMLSKMV-LGRDGPGAAIVVSSGRRFPVGELEFGFGSPVLGT-VCSTI  462
              +DW+E H R GL  +  V LG   P  A+ V S       E +FGFG  VLG  V +  
Sbjct  290   TVDWVEAHKRTGLSYAHTVALGLGSPTLAMTVVSSEHN--SETDFGFGPAVLGMPVDARD  347

Query  461   ERIGVG--YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPITAHDLHL  306
              R+     YV  RP+   DGSW V+A +WP + AALE+    +F+PITA  L L
Sbjct  348   GRLCTAHMYVTTRPA---DGSWIVNAYVWPRLAAALEADEGRVFRPITAEYLGL  398



>gb|EEE66874.1| hypothetical protein OsJ_23688 [Oryza sativa Japonica Group]
Length=394

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 127/427 (30%), Positives = 192/427 (45%), Gaps = 81/427 (19%)
 Frame = -1

Query  1550  PNQFHSSSPKIIDNLKASLSQCLSRFYPFAGRIVPNPKTDEPEILCDNRGVLVVEAQANI  1371
             PN        ++   +A L   L+ FYP AGRIV +P T  PE+ C N+G  +V  +   
Sbjct  36    PNAGDGDFDAVVATFEAVLPSLLNHFYPLAGRIVVDPATGLPELHCHNQGAELVVGE---  92

Query  1370  RLKELEFYNLNKYVERGKLVPAFRQRGGDDFAVQIQITRYTCGGLCLTFTFDHALGDASS  1191
                                                 + R+ CG   + +   + L D   
Sbjct  93    ------------------------------------LLRFACGSFSVVWGNYNLLHDGQV  116

Query  1190  FAKFLTTWSELA-TNKPPSCSP-DHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPP  1017
                 +  WSELA T +     P +H R + RPR PP Y  ++D  F +   DD   +   
Sbjct  117   STMIVRMWSELARTGRISDGLPINHDRSVFRPRSPPSYGAAIDAMFTA--YDDGGRLVNA  174

Query  1016  PTLLSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDK  837
              T   S  ++RLYYI+A  I +L+  AS   +     +R ++++A SAY+WK +   V  
Sbjct  175   LTAHDSF-VERLYYIEAGDIARLRDAASAGAE----QQRASRVQAVSAYLWKALAGVVAA  229

Query  836   S---HNKCKMGWLVDGRTRI--PGI---MSDYIGNVLSLTFGELSMDELKHGTISKIASH  681
             S     +C MGW VD R R+  P +   M  Y GNV S   G+ ++ E+    ++++A+ 
Sbjct  230   SCVPEERCCMGWWVDARRRVASPALVPAMCGYCGNVTSYALGDAAVGEVLERPLAEVAAM  289

Query  680   VHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDGPGAAIVVSSGRRFPVGELEFG  501
             V  +I++    E+  +L+DW+  H+      K V                 FP+ + +FG
Sbjct  290   VRESIASIDYDEYLQELVDWVVGHK----TEKTVFAS--------------FPL-DTDFG  330

Query  500   FGSPVLGTVCSTIERIGVG--YVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
             FG   L        ++G G   V  RP   GDGSW VSA +WP M AALE  S+ +F+P+
Sbjct  331   FGQAALAMPIWDHGKMGCGTLAVGVRPG--GDGSWLVSAYIWPRMAAALE--SDGVFKPL  386

Query  326   TAHDLHL  306
             TA  L L
Sbjct  387   TAAYLGL  393



>gb|ACU24086.1| unknown [Glycine max]
Length=302

 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 107/308 (35%), Positives = 162/308 (53%), Gaps = 24/308 (8%)
 Frame = -1

Query  1181  FLTTWSELATNKPP--SCSPDHrrfllrprfppRYNTSLDETFVSCSLDDILNMRPPPTL  1008
             FL +W+E+A +  P  S  P   R L  PR PP +++SL + +VS S     +  P P  
Sbjct  2     FLVSWAEIAQSNKPIISIQPSFARSLFIPRNPPSFHSSLHDLYVSISALPRPS-DPKPGF  60

Query  1007  LSSIMLKRLYYIDASSIHKLQKLASEEDDGIGTSRRRTKIEAFSAYIWKVMVNAVDKSHN  828
              S  ++ R+YY+   +++ +Q+LAS   +G+    +RTK+E+FSA++WKV+  A      
Sbjct  61    QSEPLINRIYYVTGENLNLMQELAS--SNGV----KRTKLESFSAFLWKVVAEAAAAKVK  114

Query  827   K-----CKMGWLVDGRTRI-------PGIMSDYIGNVLSLTFGELSMDELKHGTISKIAS  684
                    KMG +VDGR R+         IM  Y GNV+S+ +G   ++EL    +S +A 
Sbjct  115   GKKNLVAKMGVVVDGRKRLSNGDKNKEAIMGSYFGNVVSIPYGGKPVEELMEKPLSWVAE  174

Query  683   HVHAAISTATNAEHFLDLIDWIECHRPGLMLSKMVLGRDG-PGAAIVVSSGRRFPVGELE  507
              VH  +      EHFL L+DW+E HRP   LS++  G     G + VVSSG+RFP  +++
Sbjct  175   KVHEFLEIGLTEEHFLGLVDWVEVHRPAPGLSRIYCGHGKEEGPSFVVSSGQRFPESKVD  234

Query  506   FGFGSPVLGTVCSTIERIGVGYVNQRPSARGDGSWTVSAILWPDMVAALESHSECIFQPI  327
             FG+G PV  +          GYV   PS+ G+G W V   L    +  +E  +  IF P 
Sbjct  235   FGWGKPVFASYHFPWGG-DSGYVMPMPSSTGNGDWLVYMHLLEAHLNFMEVRAPQIFWPF  293

Query  326   TAHDLHLS  303
             +  D H +
Sbjct  294   S-RDYHFN  300



>emb|CDY38112.1| BnaC02g06610D [Brassica napus]
Length=376

 Score =   149 bits (375),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 176/319 (55%), Gaps = 33/319 (10%)
 Frame = -1

Query  1634  PKPYILTLSNLDLLSGRFPVTYLYFFRSPNQFHSSSPKIIDNLKASLSQCLSRFYPFAGR  1455
             P+  I+++SNLDLL     +   +F++ P  +++++    D LK SL++ L  +Y  AG 
Sbjct  60    PENMIISVSNLDLLLPPVDINVCFFYKKP-LYNTTN----DVLKTSLAEALVSYYVLAGE  114

Query  1454  IVPNPKTDEPEILCDNRGVLVVEAQANIRLKELEFYNLNKYVERGKLVPAFRQRGGDDFA  1275
             +V NP T E EILC+N GV VVEA A++ L+EL  +  + Y    K VP  +  G     
Sbjct  115   VVANPITGESEILCNNGGVEVVEAAADVELRELNLH--DPYQSIAKFVP-MKVHG----V  167

Query  1274  VQIQITRYTCGGLCLTFTFDHALGDASSFAKFLTTWSELA-TNKPPSCSPDHrrfllrpr  1098
               IQIT   CG L +  TFDH + DA S   FL +W++++ ++ P S  P   R LL PR
Sbjct  168   FAIQITELKCGSLVVGCTFDHRIADAYSMNMFLHSWAQISRSDVPTSYMPSFNRSLLNPR  227

Query  1097  fppRYNTSLDETFVSCSLDDILNMRPPPTLLSSIMLKRLYYIDASSIHKLQKLASEEDDG  918
              P   ++S+D+ ++  +    L +    T   +I+  R+YYI A  + +LQ LA     G
Sbjct  228   RPLVIDSSVDQMYMPVT---SLPLPQETTNPDNILTSRIYYIKADVVRELQTLA-----G  279

Query  917   IGTSRRRTKIEAFSAYIWKVMVN----AVDKSHNKCKMGWLVDGRTRIPGIMSD-YIGNV  753
              G   +RTK+E+FSA++WK++        D      K+G +VDGR ++    ++ Y GNV
Sbjct  280   NG---KRTKLESFSAFLWKLVAKHAATTTDSKLLNSKLGIVVDGRKKLTEQETNTYFGNV  336

Query  752   LSLTF----GELSMDELKH  708
             LS+ F    G  S+ +L++
Sbjct  337   LSVPFDSPSGPGSIKDLRY  355



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5313667069557