BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c352_g1_i1 len=676 path=[692:0-383 40:384-675]

Length=676
                                                                      Score     E

ref|XP_009623059.1|  PREDICTED: uncharacterized protein LOC104114340    197   4e-60   
ref|XP_009763860.1|  PREDICTED: uncharacterized protein LOC104215703    197   9e-60   
emb|CDO99878.1|  unnamed protein product                                192   3e-58   
ref|XP_004249990.1|  PREDICTED: calponin homology domain-containi...    191   2e-57   
ref|XP_006361442.1|  PREDICTED: RAB6-interacting golgin-like            184   1e-54   
ref|XP_008375580.1|  PREDICTED: RAB6-interacting golgin-like            176   1e-51   
ref|XP_011102137.1|  PREDICTED: uncharacterized protein LOC105180173    174   4e-51   
gb|EYU38078.1|  hypothetical protein MIMGU_mgv1a015496mg                173   9e-51   
ref|XP_011076908.1|  PREDICTED: uncharacterized protein LOC105161043    174   1e-50   
ref|XP_002523043.1|  conserved hypothetical protein                     171   6e-50   Ricinus communis
ref|XP_009335996.1|  PREDICTED: uncharacterized protein LOC103928...    171   1e-49   
ref|XP_009337000.1|  PREDICTED: uncharacterized protein LOC103929...    171   1e-49   
ref|XP_008231979.1|  PREDICTED: RAB6-interacting golgin-like            169   4e-49   
gb|KDP45007.1|  hypothetical protein JCGZ_01507                         169   5e-49   
ref|XP_004289568.1|  PREDICTED: uncharacterized protein LOC101299716    167   3e-48   
ref|XP_007221368.1|  hypothetical protein PRUPE_ppa012660mg             166   6e-48   
ref|XP_009335995.1|  PREDICTED: uncharacterized protein LOC103928...    166   7e-48   
ref|XP_009336999.1|  PREDICTED: uncharacterized protein LOC103929...    166   7e-48   
ref|XP_004496189.1|  PREDICTED: RAB6-interacting golgin-like            166   2e-47   
ref|XP_011024251.1|  PREDICTED: uncharacterized protein LOC105125486    161   6e-46   
ref|NP_001241267.1|  uncharacterized protein LOC100794044               160   1e-45   
ref|XP_007010286.1|  Family of Uncharacterized protein function i...    160   2e-45   
ref|XP_010658727.1|  PREDICTED: uncharacterized protein LOC100262498    160   3e-45   
ref|XP_006436659.1|  hypothetical protein CICLE_v10032972mg             159   4e-45   
ref|XP_007143818.1|  hypothetical protein PHAVU_007G104200g             159   4e-45   
ref|XP_002315451.2|  hypothetical protein POPTR_0010s24210g             158   8e-45   Populus trichocarpa [western balsam poplar]
gb|KEH43435.1|  transcriptional activator                               157   2e-44   
gb|KHN00913.1|  hypothetical protein glysoja_000581                     157   2e-44   
ref|XP_003556274.1|  PREDICTED: RAB6-interacting golgin-like            157   3e-44   
emb|CAN75481.1|  hypothetical protein VITISV_034536                     160   3e-43   Vitis vinifera
gb|KDO46936.1|  hypothetical protein CISIN_1g045900mg                   153   5e-43   
ref|XP_008446775.1|  PREDICTED: RAB6-interacting golgin-like            153   1e-42   
ref|XP_002529082.1|  conserved hypothetical protein                     150   2e-41   Ricinus communis
ref|XP_004150485.1|  PREDICTED: uncharacterized protein LOC101217540    149   2e-41   
gb|KDP34701.1|  hypothetical protein JCGZ_10906                         149   2e-41   
ref|XP_010243883.1|  PREDICTED: uncharacterized protein PF11_0207...    149   5e-41   
ref|XP_004303018.1|  PREDICTED: uncharacterized protein LOC101302467    149   7e-41   
ref|XP_010089400.1|  hypothetical protein L484_013791                   148   1e-40   
ref|XP_010032096.1|  PREDICTED: uncharacterized protein LOC104421728    148   1e-40   
ref|XP_008461743.1|  PREDICTED: RAB6-interacting golgin                 146   5e-40   
gb|KHG17202.1|  RAB6-interacting golgin                                 146   6e-40   
ref|XP_007162864.1|  hypothetical protein PHAVU_001G187400g             146   6e-40   
ref|NP_001241375.1|  uncharacterized protein LOC100796368               146   8e-40   
ref|XP_007132400.1|  hypothetical protein PHAVU_011G091600g             145   8e-40   
gb|KHN21121.1|  hypothetical protein glysoja_006600                     146   8e-40   
ref|NP_001238549.1|  uncharacterized protein LOC100499699               145   9e-40   
ref|XP_007027643.1|  Family of Uncharacterized protein function i...    145   9e-40   
ref|XP_002267642.1|  PREDICTED: syncoilin                               145   1e-39   Vitis vinifera
ref|NP_190858.1|  uncharacterized protein                               145   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137876.1|  PREDICTED: uncharacterized protein LOC101210...    145   1e-39   
ref|XP_006603672.1|  PREDICTED: uncharacterized protein LOC100527...    144   2e-39   
ref|XP_009115987.1|  PREDICTED: uncharacterized protein LOC103841220    144   3e-39   
ref|XP_007202665.1|  hypothetical protein PRUPE_ppa012398mg             144   3e-39   
ref|XP_004139478.1|  PREDICTED: uncharacterized protein LOC101203874    144   3e-39   
gb|EPS70589.1|  hypothetical protein M569_04170                         144   3e-39   
ref|XP_008442808.1|  PREDICTED: RAB6-interacting golgin                 144   3e-39   
gb|KDP42698.1|  hypothetical protein JCGZ_23638                         144   3e-39   
ref|XP_006403757.1|  hypothetical protein EUTSA_v10010763mg             144   4e-39   
ref|XP_009352988.1|  PREDICTED: uncharacterized protein LOC103944289    144   4e-39   
gb|AFK35409.1|  unknown                                                 144   6e-39   
ref|XP_010464658.1|  PREDICTED: ankyrin repeat domain-containing ...    144   6e-39   
ref|XP_010110159.1|  hypothetical protein L484_016779                   143   8e-39   
ref|XP_010504039.1|  PREDICTED: uncharacterized protein LOC104781143    143   9e-39   
ref|NP_001238045.1|  uncharacterized protein LOC100499923               142   1e-38   
emb|CDP06964.1|  unnamed protein product                                142   2e-38   
gb|KFK34536.1|  hypothetical protein AALP_AA5G158900                    142   2e-38   
ref|XP_007015921.1|  Family of Uncharacterized protein function (...    142   2e-38   
gb|AFK44042.1|  unknown                                                 141   3e-38   
gb|AAM61492.1|  unknown                                                 141   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011090009.1|  PREDICTED: uncharacterized protein PF11_0207...    141   4e-38   
ref|XP_010515771.1|  PREDICTED: uncharacterized protein LOC104791...    140   4e-38   
ref|XP_004487521.1|  PREDICTED: RAB6-interacting golgin-like            141   5e-38   
ref|XP_010093204.1|  hypothetical protein L484_008986                   141   6e-38   
ref|XP_002876173.1|  hypothetical protein ARALYDRAFT_485662             140   6e-38   
ref|NP_001237324.1|  uncharacterized protein LOC100527015               140   7e-38   
ref|XP_010479518.1|  PREDICTED: ankyrin repeat domain-containing ...    141   7e-38   
ref|XP_004249454.1|  PREDICTED: uncharacterized protein LOC101262159    140   8e-38   
ref|XP_010552833.1|  PREDICTED: uncharacterized protein LOC104823107    140   8e-38   
ref|XP_010426924.1|  PREDICTED: putative uncharacterized protein ...    140   8e-38   
ref|XP_006403750.1|  hypothetical protein EUTSA_v10010775mg             140   9e-38   
ref|XP_010045250.1|  PREDICTED: uncharacterized protein LOC104434009    140   1e-37   
ref|XP_006339121.1|  PREDICTED: RAB6-interacting golgin-like            140   1e-37   
emb|CDY13331.1|  BnaC06g14260D                                          139   2e-37   
ref|XP_010426919.1|  PREDICTED: uncharacterized protein LOC104711848    139   2e-37   
ref|XP_006291948.1|  hypothetical protein CARUB_v10018137mg             139   2e-37   
ref|XP_010553338.1|  PREDICTED: uncharacterized protein LOC104823...    140   3e-37   
ref|XP_006409782.1|  hypothetical protein EUTSA_v10017323mg             139   3e-37   
ref|XP_006291927.1|  hypothetical protein CARUB_v10018112mg             139   3e-37   
ref|XP_009125242.1|  PREDICTED: inner centromere protein-like iso...    138   4e-37   
ref|XP_010036719.1|  PREDICTED: ankyrin repeat domain-containing ...    139   5e-37   
emb|CDY00898.1|  BnaC05g43020D                                          139   5e-37   
ref|XP_009365354.1|  PREDICTED: ankyrin repeat domain-containing ...    138   6e-37   
gb|EYU36092.1|  hypothetical protein MIMGU_mgv1a015310mg                137   8e-37   
ref|XP_010510736.1|  PREDICTED: uncharacterized protein LOC104786950    138   8e-37   
ref|XP_006295096.1|  hypothetical protein CARUB_v10024170mg             138   9e-37   
ref|XP_010912242.1|  PREDICTED: PERQ amino acid-rich with GYF dom...    137   1e-36   
ref|XP_006851564.1|  hypothetical protein AMTR_s00040p00190890          137   1e-36   
ref|XP_010504044.1|  PREDICTED: histone-lysine N-methyltransferas...    140   1e-36   
ref|XP_009140819.1|  PREDICTED: uncharacterized protein LOC103864798    137   1e-36   
ref|XP_010417923.1|  PREDICTED: uncharacterized protein LOC104703587    137   2e-36   
ref|XP_010516863.1|  PREDICTED: uncharacterized protein LOC104792...    137   2e-36   
ref|XP_006295030.1|  hypothetical protein CARUB_v10024099mg             137   2e-36   
emb|CDY13335.1|  BnaC06g14220D                                          137   2e-36   
gb|KFK34539.1|  hypothetical protein AALP_AA5G159300                    137   2e-36   
ref|NP_850688.1|  uncharacterized protein                               137   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783982.1|  PREDICTED: uncharacterized protein PF11_0207...    136   3e-36   
ref|XP_010505188.1|  PREDICTED: uncharacterized protein LOC104782...    137   3e-36   
ref|NP_001031494.1|  uncharacterized protein                            137   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850265.1|  uncharacterized protein                               137   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125238.1|  PREDICTED: uncharacterized protein LOC103850269    135   5e-36   
ref|XP_010515770.1|  PREDICTED: uncharacterized protein LOC104791...    135   6e-36   
ref|XP_009133083.1|  PREDICTED: uncharacterized protein LOC103857...    135   6e-36   
ref|XP_006410818.1|  hypothetical protein EUTSA_v10017290mg             135   7e-36   
gb|KHG12092.1|  RAB6-interacting golgin                                 135   8e-36   
ref|XP_010426923.1|  PREDICTED: uncharacterized protein LOC104711...    135   9e-36   
ref|XP_007206014.1|  hypothetical protein PRUPE_ppa012383mg             135   1e-35   
ref|XP_010509474.1|  PREDICTED: uncharacterized protein LOC104785...    135   1e-35   
ref|XP_009393830.1|  PREDICTED: uncharacterized protein LOC103979414    134   1e-35   
ref|XP_006403751.1|  hypothetical protein EUTSA_v10010775mg             134   1e-35   
gb|KFK25207.1|  hypothetical protein AALP_AA8G081100                    135   1e-35   
ref|XP_008807487.1|  PREDICTED: histone-lysine N-methyltransferas...    135   1e-35   
ref|XP_010049773.1|  PREDICTED: uncharacterized protein LOC104438347    135   1e-35   
ref|XP_002880971.1|  hypothetical protein ARALYDRAFT_481739             135   1e-35   
ref|XP_006471397.1|  PREDICTED: RAB6-interacting golgin-like            134   2e-35   
gb|KHG17413.1|  RAB6-interacting golgin                                 136   2e-35   
ref|NP_180342.1|  uncharacterized protein                               134   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291949.1|  hypothetical protein CARUB_v10018137mg             134   2e-35   
ref|XP_010553337.1|  PREDICTED: uncharacterized protein LOC104823...    134   3e-35   
ref|XP_009103619.1|  PREDICTED: uncharacterized protein LOC103829683    134   3e-35   
gb|KDO51356.1|  hypothetical protein CISIN_1g030894mg                   133   5e-35   
ref|XP_009364862.1|  PREDICTED: centlein                                133   5e-35   
ref|XP_010558988.1|  PREDICTED: uncharacterized protein LOC104827...    133   5e-35   
emb|CDX78131.1|  BnaA09g33260D                                          142   5e-35   
ref|XP_009125240.1|  PREDICTED: uncharacterized protein LOC103850...    133   6e-35   
ref|XP_008360373.1|  PREDICTED: RAB6-interacting golgin                 133   6e-35   
ref|XP_002876174.1|  hypothetical protein ARALYDRAFT_323836             132   6e-35   
ref|XP_004291548.1|  PREDICTED: uncharacterized protein LOC101315115    133   7e-35   
emb|CDX71428.1|  BnaC04g16630D                                          133   7e-35   
emb|CDX73596.1|  BnaC08g24070D                                          142   8e-35   
emb|CDY04510.1|  BnaA07g13360D                                          132   9e-35   
ref|XP_007143819.1|  hypothetical protein PHAVU_007G104200g             131   1e-34   
gb|KFK36526.1|  hypothetical protein AALP_AA4G135800                    132   1e-34   
ref|XP_010504043.1|  PREDICTED: uncharacterized protein LOC104781...    134   2e-34   
ref|XP_010940357.1|  PREDICTED: DNA repair protein RAD50-like           132   2e-34   
ref|XP_006295031.1|  hypothetical protein CARUB_v10024099mg             132   2e-34   
gb|KFK34540.1|  hypothetical protein AALP_AA5G159300                    132   2e-34   
ref|XP_010516862.1|  PREDICTED: uncharacterized protein LOC104792...    132   3e-34   
emb|CDX67549.1|  BnaA07g15890D                                          131   3e-34   
ref|NP_566974.1|  uncharacterized protein                               131   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb|EYU19794.1|  hypothetical protein MIMGU_mgv1a015500mg                130   3e-34   
ref|XP_010683857.1|  PREDICTED: uncharacterized protein LOC104898467    131   3e-34   
ref|XP_009141591.1|  PREDICTED: uncharacterized protein LOC103865...    131   4e-34   
ref|XP_010505187.1|  PREDICTED: uncharacterized protein LOC104782...    131   4e-34   
ref|XP_002879610.1|  hypothetical protein ARALYDRAFT_482617             131   4e-34   
ref|NP_565846.1|  uncharacterized protein                               131   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115991.1|  PREDICTED: uncharacterized protein LOC103841...    130   6e-34   
gb|AAM64459.1|  unknown                                                 131   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133082.1|  PREDICTED: uncharacterized protein LOC103857...    130   9e-34   
ref|XP_006410819.1|  hypothetical protein EUTSA_v10017290mg             130   9e-34   
ref|XP_010509472.1|  PREDICTED: uncharacterized protein LOC104785...    130   1e-33   
emb|CDY43720.1|  BnaAnng07350D                                          129   3e-33   
ref|XP_006384649.1|  hypothetical protein POPTR_0004s19810g             128   5e-33   
ref|XP_009413401.1|  PREDICTED: harmonin-like isoform X1                128   5e-33   
emb|CBI30259.3|  unnamed protein product                                127   6e-33   
ref|XP_006295106.1|  hypothetical protein CARUB_v10024181mg             127   7e-33   
ref|XP_010558987.1|  PREDICTED: uncharacterized protein LOC104827...    127   8e-33   
ref|XP_006652248.1|  PREDICTED: RAB6-interacting golgin-like            127   1e-32   
gb|KFK36527.1|  hypothetical protein AALP_AA4G135800                    127   2e-32   
ref|XP_002283313.1|  PREDICTED: uncharacterized protein LOC100256294    126   2e-32   Vitis vinifera
emb|CDX77133.1|  BnaC04g39280D                                          134   2e-32   
ref|XP_010521677.1|  PREDICTED: histone-lysine N-methyltransferas...    127   2e-32   
ref|XP_010242636.1|  PREDICTED: RAB6-interacting golgin-like            126   2e-32   
ref|XP_009133084.1|  PREDICTED: uncharacterized protein LOC103857624    126   3e-32   
emb|CDX73594.1|  BnaC08g24090D                                          126   3e-32   
ref|XP_002879606.1|  hypothetical protein ARALYDRAFT_482609             125   3e-32   
ref|XP_006381309.1|  hypothetical protein POPTR_0006s11650g             126   3e-32   
ref|NP_001031492.1|  uncharacterized protein                            125   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141590.1|  PREDICTED: uncharacterized protein LOC103865...    126   5e-32   
emb|CDY43719.1|  BnaAnng07340D                                          126   5e-32   
ref|XP_011044659.1|  PREDICTED: uncharacterized protein LOC105139...    125   5e-32   
emb|CDX78133.1|  BnaA09g33280D                                          125   6e-32   
ref|XP_009115990.1|  PREDICTED: uncharacterized protein LOC103841...    125   7e-32   
ref|XP_006296389.1|  hypothetical protein CARUB_v10025562mg             124   8e-32   
ref|XP_006430278.1|  hypothetical protein CICLE_v10012928mg             125   8e-32   
ref|XP_010509479.1|  PREDICTED: uncharacterized protein LOC104785891    124   1e-31   
ref|XP_010505172.1|  PREDICTED: uncharacterized protein LOC104782054    124   1e-31   
gb|AGT16904.1|  hypothetical protein SHCRBa_082_J13_F_170               124   1e-31   
ref|XP_002447770.1|  hypothetical protein SORBIDRAFT_06g015330          124   1e-31   Sorghum bicolor [broomcorn]
ref|NP_001144188.1|  uncharacterized protein LOC100277048               124   1e-31   Zea mays [maize]
emb|CAE04893.2|  OSJNBa0042I15.15                                       124   1e-31   Oryza sativa [red rice]
ref|XP_004975534.1|  PREDICTED: RAB6-interacting golgin-like            124   1e-31   
ref|XP_009413402.1|  PREDICTED: uncharacterized protein LOC103994...    124   1e-31   
ref|XP_011005398.1|  PREDICTED: uncharacterized protein LOC105111662    124   2e-31   
ref|NP_001052720.1|  Os04g0408600                                       124   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008462544.1|  PREDICTED: septin-11-like                          123   3e-31   
gb|KFK36346.1|  hypothetical protein AALP_AA4G110600                    122   4e-31   
ref|XP_003625765.1|  hypothetical protein MTR_7g104020                  122   5e-31   
ref|XP_009122685.1|  PREDICTED: myosin-9                                122   1e-30   
gb|AEI28610.1|  hypothetical protein                                    122   1e-30   
gb|ABG75754.1|  salt response protein                                   122   1e-30   
ref|NP_187609.2|  uncharacterized protein                               121   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007010287.1|  Family of Uncharacterized protein function i...    120   2e-30   
ref|XP_004494149.1|  PREDICTED: RAB6-interacting golgin-like isof...    121   2e-30   
ref|XP_006398823.1|  hypothetical protein EUTSA_v10014828mg             121   3e-30   
ref|XP_004143305.1|  PREDICTED: uncharacterized protein LOC101209289    120   3e-30   
ref|XP_006381310.1|  hypothetical protein POPTR_0006s11650g             120   5e-30   
ref|XP_011044649.1|  PREDICTED: uncharacterized protein LOC105139...    120   5e-30   
emb|CDX84559.1|  BnaA03g16710D                                          120   5e-30   
emb|CDY57618.1|  BnaCnng32210D                                          120   5e-30   
ref|XP_006407618.1|  hypothetical protein EUTSA_v10021627mg             120   5e-30   
ref|XP_003579676.1|  PREDICTED: uncharacterized protein LOC100830167    120   6e-30   
ref|XP_002882648.1|  hypothetical protein ARALYDRAFT_478325             120   7e-30   
emb|CDY60156.1|  BnaAnng16520D                                          120   8e-30   
gb|ABK95581.1|  unknown                                                 119   8e-30   Populus trichocarpa [western balsam poplar]
emb|CDY66899.1|  BnaC03g73270D                                          119   1e-29   
emb|CDP15376.1|  unnamed protein product                                118   1e-29   
ref|XP_006298664.1|  hypothetical protein CARUB_v10014755mg             119   1e-29   
ref|XP_010486580.1|  PREDICTED: uncharacterized protein LOC104764...    117   2e-29   
ref|XP_003625766.1|  hypothetical protein MTR_7g104020                  119   2e-29   
ref|XP_009146879.1|  PREDICTED: syncoilin                               118   3e-29   
ref|XP_007162862.1|  hypothetical protein PHAVU_001G187400g             117   4e-29   
gb|KFK35874.1|  hypothetical protein AALP_AA4G048100                    118   4e-29   
ref|XP_011094404.1|  PREDICTED: structural maintenance of chromos...    117   5e-29   
ref|XP_009135033.1|  PREDICTED: syncoilin-like                          117   7e-29   
ref|XP_004494148.1|  PREDICTED: RAB6-interacting golgin-like isof...    117   8e-29   
ref|XP_010552993.1|  PREDICTED: ankyrin repeat domain-containing ...    117   8e-29   
ref|XP_010558206.1|  PREDICTED: syncoilin-like                          116   2e-28   
emb|CDX74002.1|  BnaA03g30450D                                          116   3e-28   
ref|XP_004167776.1|  PREDICTED: uncharacterized LOC101217540            114   3e-28   
gb|AFK38778.1|  unknown                                                 115   3e-28   
emb|CDY70153.1|  BnaC05g50700D                                          115   4e-28   
ref|XP_004251024.1|  PREDICTED: uncharacterized protein LOC101249789    115   6e-28   
ref|XP_002313658.2|  hypothetical protein POPTR_0009s14970g             114   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006349090.1|  PREDICTED: RAB6-interacting golgin-like            114   1e-27   
ref|XP_002536212.1|  conserved hypothetical protein                     113   1e-27   Ricinus communis
ref|XP_009795227.1|  PREDICTED: uncharacterized protein LOC104241951    113   2e-27   
ref|XP_009390019.1|  PREDICTED: RAB6-interacting golgin-like            113   3e-27   
gb|EYU35141.1|  hypothetical protein MIMGU_mgv1a014901mg                113   3e-27   
ref|XP_004246559.1|  PREDICTED: uncharacterized protein LOC101267639    112   6e-27   
ref|XP_009590693.1|  PREDICTED: uncharacterized protein LOC104087837    112   8e-27   
ref|XP_011088854.1|  PREDICTED: uncharacterized protein LOC105169987    111   9e-27   
gb|KCW89236.1|  hypothetical protein EUGRSUZ_A01535                     112   9e-27   
ref|XP_009798512.1|  PREDICTED: uncharacterized protein LOC104244734    111   9e-27   
gb|EPS60393.1|  hypothetical protein M569_14410                         111   1e-26   
ref|XP_009804289.1|  PREDICTED: uncharacterized protein LOC104249548    110   5e-26   
ref|XP_009624494.1|  PREDICTED: uncharacterized protein LOC104115534    109   5e-26   
ref|XP_009628857.1|  PREDICTED: uncharacterized protein LOC104119140    109   6e-26   
ref|XP_006424311.1|  hypothetical protein CICLE_v10029402mg             109   8e-26   
ref|XP_006341155.1|  PREDICTED: uncharacterized protein PF11_0207...    107   3e-25   
gb|AAS79606.1|  hypothetical protein                                    107   6e-25   Ipomoea trifida
ref|XP_010686071.1|  PREDICTED: uncharacterized protein LOC104900357    107   8e-25   
emb|CDY32440.1|  BnaA09g51560D                                          105   1e-24   
emb|CDY17934.1|  BnaC04g02850D                                          105   1e-24   
ref|NP_568126.1|  uncharacterized protein                               105   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008385432.1|  PREDICTED: RAB6-interacting golgin-like            105   4e-24   
gb|EAY86109.1|  hypothetical protein OsI_07479                          104   5e-24   Oryza sativa Indica Group [Indian rice]
gb|AFW71658.1|  hypothetical protein ZEAMMB73_937831                    102   2e-23   
ref|NP_001144843.1|  uncharacterized protein LOC100277929               102   3e-23   Zea mays [maize]
ref|XP_002871051.1|  hypothetical protein ARALYDRAFT_487145             102   5e-23   
ref|XP_006403752.1|  hypothetical protein EUTSA_v10010775mg             100   5e-23   
ref|XP_004173772.1|  PREDICTED: uncharacterized protein LOC101227866    100   6e-23   
ref|XP_006647329.1|  PREDICTED: RAB6-interacting golgin-like            101   8e-23   
ref|XP_010423680.1|  PREDICTED: putative U-box domain-containing ...    100   1e-22   
gb|KFK24830.1|  hypothetical protein AALP_AA8G030600                    100   2e-22   
ref|NP_001047008.1|  Os02g0528100                                     99.8    3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952628.1|  PREDICTED: RAB6-interacting golgin-like            100   3e-22   
emb|CAB82931.1|  putative protein                                     99.8    3e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EMS63555.1|  hypothetical protein TRIUR3_32840                     99.4    4e-22   
ref|XP_006288776.1|  hypothetical protein CARUB_v10002097mg           99.8    4e-22   
ref|XP_003575057.1|  PREDICTED: uncharacterized protein LOC100841661  99.0    6e-22   
ref|XP_007027644.1|  Family of Uncharacterized protein function i...  97.8    8e-22   
gb|KDO61051.1|  hypothetical protein CISIN_1g029490mg                 97.8    3e-21   
ref|XP_008367315.1|  PREDICTED: RAB6-interacting golgin-like          94.4    5e-21   
ref|NP_001118452.1|  uncharacterized protein                          92.4    5e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY27436.1|  BnaC03g64760D                                        92.0    5e-20   
gb|AAF04425.1|AC010927_18  unknown protein                            93.6    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008353832.1|  PREDICTED: uncharacterized protein LOC103417421  90.1    1e-19   
ref|XP_002453925.1|  hypothetical protein SORBIDRAFT_04g021530        92.8    1e-19   Sorghum bicolor [broomcorn]
ref|XP_010486581.1|  PREDICTED: uncharacterized protein LOC104764...  88.6    8e-19   
ref|NP_001154555.1|  uncharacterized protein                          87.8    9e-19   
ref|XP_010486579.1|  PREDICTED: uncharacterized protein LOC104764...  87.8    2e-18   
ref|XP_009114070.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  90.1    2e-18   
ref|XP_008344361.1|  PREDICTED: uncharacterized protein LOC103407192  86.7    3e-18   
emb|CAN66217.1|  hypothetical protein VITISV_041166                   88.6    5e-18   
emb|CDY71050.1|  BnaAnng35900D                                        89.7    7e-18   
ref|XP_001763371.1|  predicted protein                                86.7    9e-18   
ref|XP_009365349.1|  PREDICTED: uncharacterized protein LOC103955201  85.1    5e-17   
ref|XP_009365347.1|  PREDICTED: uncharacterized protein LOC103955197  84.7    7e-17   
gb|KDO61052.1|  hypothetical protein CISIN_1g029490mg                 84.3    1e-16   
emb|CDY69999.1|  BnaAnng32280D                                        87.8    1e-16   
ref|XP_009133806.1|  PREDICTED: uncharacterized protein LOC103858240  82.4    1e-16   
dbj|BAO05270.1|  salt response protein                                82.0    2e-16   
dbj|BAO05269.1|  salt response protein                                82.0    2e-16   
gb|KDO61053.1|  hypothetical protein CISIN_1g029490mg                 82.8    6e-16   
dbj|BAO05506.1|  salt response protein                                80.5    9e-16   
dbj|BAO05505.1|  salt response protein                                80.5    1e-15   
ref|XP_007162863.1|  hypothetical protein PHAVU_001G187400g           78.2    1e-14   
ref|XP_009365350.1|  PREDICTED: uncharacterized protein LOC103955...  76.6    2e-14   
dbj|BAG95875.1|  unnamed protein product                              78.2    2e-14   
dbj|BAO04168.1|  salt response protein                                76.3    3e-14   
ref|XP_009365352.1|  PREDICTED: uncharacterized protein LOC103955203  75.5    3e-14   
ref|XP_004164075.1|  PREDICTED: uncharacterized LOC101209289          75.9    5e-14   
ref|XP_009365351.1|  PREDICTED: uncharacterized protein LOC103955...  74.3    9e-14   
ref|NP_001190218.1|  uncharacterized protein                          74.3    3e-13   
emb|CDX79678.1|  BnaC03g20140D                                        67.4    7e-11   
ref|XP_010412898.1|  PREDICTED: uncharacterized protein LOC104699266  65.9    1e-10   
ref|XP_008360560.1|  PREDICTED: uncharacterized protein LOC103424251  66.2    2e-10   
ref|XP_008353138.1|  PREDICTED: uncharacterized protein LOC103416688  63.9    4e-10   
gb|EAY94008.1|  hypothetical protein OsI_15785                        53.1    7e-06   
ref|XP_005839302.1|  hypothetical protein GUITHDRAFT_134014           53.1    3e-05   



>ref|XP_009623059.1| PREDICTED: uncharacterized protein LOC104114340 [Nicotiana tomentosiformis]
Length=160

 Score =   197 bits (502),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 135/158 (85%), Gaps = 3/158 (2%)
 Frame = +3

Query  18   MMMSITSVGSGGRLSMeene---eeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRA  188
            MM ++ SVGS GR S   ++   ++E+T++A+ SFQAREEEIE++KMEVK KVESQL+RA
Sbjct  1    MMSNLPSVGSSGRTSTTADDNDEDQEMTKVALASFQAREEEIERKKMEVKGKVESQLSRA  60

Query  189  EQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaF  368
            E++T+ L  +WEELEVLTDPMRKEV MVRKKID VNRE+KSL Q CQKKEKEY+E LE F
Sbjct  61   EEETRRLVRVWEELEVLTDPMRKEVAMVRKKIDVVNREIKSLGQTCQKKEKEYREVLEVF  120

Query  369  QEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDP  482
             EKNNEKTQLTSTL+ELV ESEKFR+GKLEELSK+++P
Sbjct  121  NEKNNEKTQLTSTLVELVKESEKFRMGKLEELSKVLNP  158



>ref|XP_009763860.1| PREDICTED: uncharacterized protein LOC104215703 [Nicotiana sylvestris]
Length=160

 Score =   197 bits (500),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 135/158 (85%), Gaps = 3/158 (2%)
 Frame = +3

Query  18   MMMSITSVGSGGRLSMeene---eeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRA  188
            MM ++ SVGS GR S   ++   ++E+T++A+ SFQAREEEIE++KMEVK KVE+QL+RA
Sbjct  1    MMSTLQSVGSSGRTSTTADDNDEDQEMTKVALASFQAREEEIERKKMEVKGKVETQLSRA  60

Query  189  EQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaF  368
            E++T+ L  +WEELEVLTDPMRKEV MVRKKID VNRE+KSL Q CQKKEKEY+E LE F
Sbjct  61   EEETRRLVRVWEELEVLTDPMRKEVAMVRKKIDVVNREIKSLGQTCQKKEKEYREVLEVF  120

Query  369  QEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDP  482
             EKNNEKTQLTSTL+ELV ESEKFR+GKLEELSK+++P
Sbjct  121  NEKNNEKTQLTSTLVELVKESEKFRMGKLEELSKVLNP  158



>emb|CDO99878.1| unnamed protein product [Coffea canephora]
Length=156

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M +I S+GS GR SM+++++EE+ +MAI SFQAREEEIE++KME+K +VESQLNRAE++T
Sbjct  1    MKNIASIGSSGRSSMDDHDDEEMAKMAIASFQAREEEIERKKMEMKERVESQLNRAEEET  60

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LA IWEELEVLTDPM+KEV   RK+ID VNRELKSL QACQKKEKE+KE L+ FQEK+
Sbjct  61   RRLAQIWEELEVLTDPMKKEVAAARKRIDLVNRELKSLGQACQKKEKEHKEVLDIFQEKS  120

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIV  476
            NEK QLT+TL+ELVNESEK R+ KLEELSK V
Sbjct  121  NEKAQLTTTLMELVNESEKLRMRKLEELSKFV  152



>ref|XP_004249990.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472 
[Solanum lycopersicum]
Length=165

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 134/163 (82%), Gaps = 8/163 (5%)
 Frame = +3

Query  18   MMMSITSVGSGGRLSMeenee--------eeITRMAITSFQAREEEIEKRKMEVKIKVES  173
            MM S+ SVGS GR S  ++          +E+T++A+ SFQAREE+IE++KMEVK KVES
Sbjct  1    MMSSLQSVGSSGRTSTSDDNNNNNINDEDQEMTKLALASFQAREEQIERKKMEVKGKVES  60

Query  174  QLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeyke  353
            QL RAE++T+ L  +WEELEVLTDPMRKEV MVRKKID +NRE+KSL Q+CQKKEKEY+E
Sbjct  61   QLTRAEEETRRLVRVWEELEVLTDPMRKEVAMVRKKIDLINREIKSLGQSCQKKEKEYRE  120

Query  354  aleaFQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDP  482
             LEAF EKNNEKTQLTSTL+ELV +SEK R+GKLEELSK+++P
Sbjct  121  VLEAFNEKNNEKTQLTSTLVELVKKSEKLRMGKLEELSKVLNP  163



>ref|XP_006361442.1| PREDICTED: RAB6-interacting golgin-like [Solanum tuberosum]
Length=164

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +T++A+ SFQAREE+IE++KMEVK KVESQL RAE++T+ L  +WEELEVLTDPMRKEV 
Sbjct  31   MTKLALASFQAREEQIERKKMEVKGKVESQLTRAEEETRRLVRVWEELEVLTDPMRKEVA  90

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            MVRKKID +NRE+KSL Q+CQKKEKEY+E LEAF EKNNEKTQLTSTL+ELV ESEK R+
Sbjct  91   MVRKKIDVINREIKSLGQSCQKKEKEYREVLEAFNEKNNEKTQLTSTLVELVKESEKLRM  150

Query  447  GKLEELSKIVDP  482
            GKLEELSK+++P
Sbjct  151  GKLEELSKVLNP  162



>ref|XP_008375580.1| PREDICTED: RAB6-interacting golgin-like [Malus domestica]
 ref|XP_008356852.1| PREDICTED: RAB6-interacting golgin-like [Malus domestica]
Length=162

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  15   KMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            K + S +  GS GRLS EEN++EEI+R+AI+++QAREEEIE++KMEVK KVE+QL RAE+
Sbjct  5    KSLGSNSFAGSSGRLSTEENDDEEISRLAISAYQAREEEIERKKMEVKEKVEAQLGRAEE  64

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
            +T+ LA IWEELEVL DPMRKE+  VRKKID  NRELK L  +CQKKEKEYKEALE+F E
Sbjct  65   ETRRLAQIWEELEVLGDPMRKELANVRKKIDMANRELKPLGLSCQKKEKEYKEALESFNE  124

Query  375  KNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPT  485
            KN EK QL STL+EL+ ESEK R+ KLEELSK ++PT
Sbjct  125  KNKEKAQLVSTLMELLTESEKLRMQKLEELSKNIEPT  161



>ref|XP_011102137.1| PREDICTED: uncharacterized protein LOC105180173 [Sesamum indicum]
Length=154

 Score =   174 bits (441),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = +3

Query  24   MSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTK  203
            MS+ S  +G R S++++ E E ++ AI  +QAREEEIE+RKMEV+ +VESQL RAE++T+
Sbjct  1    MSLAS--NGSRSSVDDSNECEASKTAIALYQAREEEIERRKMEVRERVESQLTRAEEETR  58

Query  204  HLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNN  383
             LAH+WEELEVL+DPMRKEV  VRK+ID  NR+LKSL Q C KKEKEYKEA+EAFQEKNN
Sbjct  59   RLAHVWEELEVLSDPMRKEVAAVRKRIDLANRDLKSLAQICHKKEKEYKEAMEAFQEKNN  118

Query  384  EKTQLTSTLIELVNESEKFRLGKLEELSKIVDPT  485
            EK+QLT TL+ELVN+SEK R+ KLEEL+ IV+  
Sbjct  119  EKSQLTCTLVELVNQSEKLRMRKLEELTNIVNSN  152



>gb|EYU38078.1| hypothetical protein MIMGU_mgv1a015496mg [Erythranthe guttata]
Length=156

 Score =   173 bits (439),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            MMS+TS+GS GR S ++ EE E ++ AI ++Q REEEIE+RKMEVK +VESQL RAE++T
Sbjct  1    MMSLTSMGSNGRPSTDDKEEHEASKTAIATYQEREEEIERRKMEVKERVESQLTRAEEET  60

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LA +WEELEVLTDPMRKEV  VRK+ID  NR+LKS+ Q CQKKEKEYKEA+EAFQEKN
Sbjct  61   RRLAQVWEELEVLTDPMRKEVATVRKRIDLANRDLKSIGQICQKKEKEYKEAMEAFQEKN  120

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
            NEK+QLT+ LIELVN+SEKFR+ KLEELSKIV+
Sbjct  121  NEKSQLTTALIELVNQSEKFRMRKLEELSKIVN  153



>ref|XP_011076908.1| PREDICTED: uncharacterized protein LOC105161043 [Sesamum indicum]
Length=176

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  33   TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
             S+GS GRLS ++ +++E ++MAI S+QAREEEIE+RKMEV+ +VESQL+RAE++ K L 
Sbjct  22   ASIGSSGRLSADDEDDDEASKMAIASYQAREEEIERRKMEVRERVESQLSRAEEEAKRLT  81

Query  213  HIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKT  392
             +WEELEV TDPMRK+V  VRK++D  NR+LKSL Q CQKKEKEYKEA+EAFQEK+ EK 
Sbjct  82   QVWEELEVFTDPMRKDVSSVRKRLDMANRDLKSLQQICQKKEKEYKEAMEAFQEKSKEKA  141

Query  393  QLTSTLIELVNESEKFRLGKLEELSKIVD  479
            QLT+ L+ELVN+SE FR+ KLEELSKIV+
Sbjct  142  QLTTALMELVNQSENFRMKKLEELSKIVN  170



>ref|XP_002523043.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39347.1| conserved hypothetical protein [Ricinus communis]
Length=153

 Score =   171 bits (434),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M ++ S+GSGG+LSMEENEE+EI+R  I+SFQAREEEIE++KMEV+ KVE QL RAE++T
Sbjct  1    MRNMGSMGSGGKLSMEENEEDEISRFDISSFQAREEEIERKKMEVREKVELQLGRAEEET  60

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            K L  IWEELE L DP RKEV MVRKKID  NRELK L Q+CQKKEKEYKEALEA+ EKN
Sbjct  61   KRLTQIWEELESLADPTRKEVAMVRKKIDVANRELKPLGQSCQKKEKEYKEALEAYNEKN  120

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIV  476
             EK QL +TL+EL+ ESE+ R+ KLEELSK +
Sbjct  121  KEKAQLVTTLMELLTESERLRMKKLEELSKNI  152



>ref|XP_009335996.1| PREDICTED: uncharacterized protein LOC103928644 isoform X2 [Pyrus 
x bretschneideri]
Length=159

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  15   KMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            K + S +   S GRLS EEN++EEI+R+AI+++QAREEEIE++KMEVK KVE+QL RAE+
Sbjct  2    KSLGSNSFASSSGRLSTEENDDEEISRLAISAYQAREEEIERKKMEVKEKVEAQLGRAEE  61

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
            +T+ L  IWEELEVL DPMRKE+  VRKKID  NRELK L  +CQKKEKEYKEALE+F E
Sbjct  62   ETRRLTQIWEELEVLGDPMRKELANVRKKIDMANRELKPLGLSCQKKEKEYKEALESFNE  121

Query  375  KNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPT  485
            KN EK QL STL+EL+ ESEK R+ KLEELSK ++PT
Sbjct  122  KNKEKAQLVSTLMELLTESEKLRMQKLEELSKNIEPT  158



>ref|XP_009337000.1| PREDICTED: uncharacterized protein LOC103929519 isoform X2 [Pyrus 
x bretschneideri]
Length=162

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  15   KMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            K + S +   S GRLS EEN++EEI+R+AI+++QAREEEIE++KMEVK KVE+QL RAE+
Sbjct  5    KSLGSNSFASSSGRLSTEENDDEEISRLAISAYQAREEEIERKKMEVKEKVEAQLGRAEE  64

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
            +T+ L  IWEELEVL DPMRKE+  VRKKID  NRELK L  +CQKKEKEYKEALE+F E
Sbjct  65   ETRRLTQIWEELEVLGDPMRKELANVRKKIDMANRELKPLGLSCQKKEKEYKEALESFNE  124

Query  375  KNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPT  485
            KN EK QL STL+EL+ ESEK R+ KLEELSK ++PT
Sbjct  125  KNKEKAQLVSTLMELLTESEKLRMQKLEELSKNIEPT  161



>ref|XP_008231979.1| PREDICTED: RAB6-interacting golgin-like [Prunus mume]
Length=159

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M S+ S+ S GRLS EENE+EE++R+AI++++AREEEIE++KMEVK KVE QL RAE++T
Sbjct  4    MKSLGSISSSGRLSTEENEDEEVSRLAISAWEAREEEIERKKMEVKEKVELQLGRAEEET  63

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LA IWEELEV+ DPMRKE+  VRKKID VNRELK L  + QKKEKEYKEALE+F EKN
Sbjct  64   RRLAQIWEELEVMGDPMRKELANVRKKIDMVNRELKPLGLSYQKKEKEYKEALESFNEKN  123

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
             EK QL +TL+E++ ESE+ R+ KLEELSK ++PTH
Sbjct  124  KEKAQLVTTLMEMLTESERLRMQKLEELSKNIEPTH  159



>gb|KDP45007.1| hypothetical protein JCGZ_01507 [Jatropha curcas]
Length=159

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 126/156 (81%), Gaps = 3/156 (2%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeee---ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAE  191
            M ++ S+GS GRLSM+EN   E    +R AI++FQAREEEIE++KMEV+ KVE QL RAE
Sbjct  1    MRNMGSMGSSGRLSMDENSNNEEEEASRFAISTFQAREEEIERKKMEVREKVELQLGRAE  60

Query  192  QQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQ  371
            ++T+ L  IWEELEV+ DPMRKEV MVRKKID  NRELK L Q+CQKKEKEYKEALEAF 
Sbjct  61   EETRRLTQIWEELEVMCDPMRKEVAMVRKKIDLANRELKPLGQSCQKKEKEYKEALEAFN  120

Query  372  EKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
            EKN EKTQL +TL+EL+ ESE+ R+ KLEELSK V+
Sbjct  121  EKNKEKTQLVTTLMELLTESERMRMKKLEELSKNVE  156



>ref|XP_004289568.1| PREDICTED: uncharacterized protein LOC101299716 [Fragaria vesca 
subsp. vesca]
Length=156

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M S+   GS GRLSMEENE+EE +R+AI++FQAREEEIE++KMEVK +VE QL RAE++T
Sbjct  1    MKSLGGNGSSGRLSMEENEDEETSRLAISTFQAREEEIERKKMEVKERVELQLGRAEEET  60

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LA IWEELE L+DP RKE+  VRKKID VNRELK L   CQKKEKEYKEALE+F EKN
Sbjct  61   RRLAQIWEELEALSDPNRKELANVRKKIDMVNRELKPLGLGCQKKEKEYKEALESFNEKN  120

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
             EK QL +T++EL+ ESE+ R+ KLEELSK ++ +H
Sbjct  121  KEKAQLVTTMMELLTESERLRMQKLEELSKNIELSH  156



>ref|XP_007221368.1| hypothetical protein PRUPE_ppa012660mg [Prunus persica]
 gb|EMJ22567.1| hypothetical protein PRUPE_ppa012660mg [Prunus persica]
Length=159

 Score =   166 bits (421),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M S+ S+ + GRLS EENE+EE++R+AI++++AREEEIE++KMEVK KVE QL RAE++T
Sbjct  4    MKSLGSISNNGRLSTEENEDEEVSRLAISAWEAREEEIERKKMEVKEKVELQLGRAEEET  63

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LA IWEELEV+ DP+RKE+  VRKKID VNRELK L  + QKKEKEYKEALE+F EKN
Sbjct  64   RRLAQIWEELEVMGDPLRKELANVRKKIDMVNRELKPLGLSYQKKEKEYKEALESFNEKN  123

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
             EK QL +TL+E++ ESE+ R+ KLEELSK ++PTH
Sbjct  124  KEKAQLVTTLMEMLTESERLRMQKLEELSKNIEPTH  159



>ref|XP_009335995.1| PREDICTED: uncharacterized protein LOC103928644 isoform X1 [Pyrus 
x bretschneideri]
Length=160

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 128/158 (81%), Gaps = 1/158 (1%)
 Frame = +3

Query  15   KMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            K + S +   S GRLS EEN++EEI+R+AI+++QAREEEIE++KMEVK KVE+QL RAE+
Sbjct  2    KSLGSNSFASSSGRLSTEENDDEEISRLAISAYQAREEEIERKKMEVKEKVEAQLGRAEE  61

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
            +T+ L  IWEELEVL DPMRKE+  VRKKID  NRELK L  +CQKKEKEYKEALE+F E
Sbjct  62   ETRRLTQIWEELEVLGDPMRKELANVRKKIDMANRELKPLGLSCQKKEKEYKEALESFNE  121

Query  375  KNNEKTQLTSTLIE-LVNESEKFRLGKLEELSKIVDPT  485
            KN EK QL STL+E L+ ESEK R+ KLEELSK ++PT
Sbjct  122  KNKEKAQLVSTLMEQLLTESEKLRMQKLEELSKNIEPT  159



>ref|XP_009336999.1| PREDICTED: uncharacterized protein LOC103929519 isoform X1 [Pyrus 
x bretschneideri]
Length=163

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 128/158 (81%), Gaps = 1/158 (1%)
 Frame = +3

Query  15   KMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            K + S +   S GRLS EEN++EEI+R+AI+++QAREEEIE++KMEVK KVE+QL RAE+
Sbjct  5    KSLGSNSFASSSGRLSTEENDDEEISRLAISAYQAREEEIERKKMEVKEKVEAQLGRAEE  64

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
            +T+ L  IWEELEVL DPMRKE+  VRKKID  NRELK L  +CQKKEKEYKEALE+F E
Sbjct  65   ETRRLTQIWEELEVLGDPMRKELANVRKKIDMANRELKPLGLSCQKKEKEYKEALESFNE  124

Query  375  KNNEKTQLTSTLIE-LVNESEKFRLGKLEELSKIVDPT  485
            KN EK QL STL+E L+ ESEK R+ KLEELSK ++PT
Sbjct  125  KNKEKAQLVSTLMEQLLTESEKLRMQKLEELSKNIEPT  162



>ref|XP_004496189.1| PREDICTED: RAB6-interacting golgin-like [Cicer arietinum]
Length=172

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M ++ S+GS GRLS EE E+E+++++AI+++QA+EEEIE++KMEVK +VE QL RAE++T
Sbjct  14   MKNLGSIGSSGRLSAEECEDEDVSKLAISAYQAKEEEIERKKMEVKERVELQLGRAEEET  73

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LAHIWEELEVL DPMRKEV M+RKKID  N++LK L Q  QKKEKEYKEALE F EKN
Sbjct  74   RRLAHIWEELEVLDDPMRKEVAMIRKKIDLANKDLKQLGQNYQKKEKEYKEALETFNEKN  133

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             EKT L +TL EL+ ESE+ R+ KLEEL K V+
Sbjct  134  KEKTHLVATLAELLTESERLRMKKLEELCKTVE  166



>ref|XP_011024251.1| PREDICTED: uncharacterized protein LOC105125486 [Populus euphratica]
Length=158

 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 125/150 (83%), Gaps = 1/150 (1%)
 Frame = +3

Query  33   TSVGSGGRLSMee-neeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHL  209
            +++GSGGRLS +E NEEEEI R+ I+ FQAREEEIE++KMEV+ KVE  L RAE++T+ L
Sbjct  6    SNIGSGGRLSTDEINEEEEIPRLDISKFQAREEEIERKKMEVREKVELHLGRAEEETRRL  65

Query  210  AHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEK  389
             HIWEELEVL DP+RK+V + RKKID  N+ELK L Q+CQKKEKEYKEALEAF EKN EK
Sbjct  66   THIWEELEVLADPLRKDVAIARKKIDMANKELKPLGQSCQKKEKEYKEALEAFNEKNREK  125

Query  390  TQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             QL +TL+EL+ ESEK R+ KLEEL+KI++
Sbjct  126  AQLVATLMELLAESEKQRMKKLEELNKIME  155



>ref|NP_001241267.1| uncharacterized protein LOC100794044 [Glycine max]
 gb|ACU24394.1| unknown [Glycine max]
 gb|KHN37841.1| hypothetical protein glysoja_016965 [Glycine soja]
Length=172

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M ++ S+GS GRLS EE E+EEI+++AI++FQ++EEEIE++K EV+ KVE QL RAE++T
Sbjct  14   MKNLGSIGSSGRLSAEEYEDEEISKLAISTFQSKEEEIERKKTEVREKVELQLGRAEEET  73

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LAHIWEELEVL DPMRKEV MVRKKID  N++LK L    QKKEKEYKEALEAF EKN
Sbjct  74   RRLAHIWEELEVLDDPMRKEVAMVRKKIDLANKDLKPLGLNFQKKEKEYKEALEAFNEKN  133

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             EK  L +TL+E++ ESE+ R+ KLEEL KI++
Sbjct  134  KEKAHLVATLVEMLTESERLRMKKLEELCKIIE  166



>ref|XP_007010286.1| Family of Uncharacterized protein function isoform 1 [Theobroma 
cacao]
 gb|EOY19096.1| Family of Uncharacterized protein function isoform 1 [Theobroma 
cacao]
Length=160

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            I+R+AI++FQAREEEIE++KMEVK KVE QL RAE++T+ L+ IWEELEVL+DP+RKEV 
Sbjct  27   ISRLAISTFQAREEEIERKKMEVKEKVEIQLGRAEEETRRLSMIWEELEVLSDPLRKEVA  86

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            MVRKKID  NRELK L Q+CQKKEKEYKEALEAF EKN EK QL +TL+E++ ESE+ R+
Sbjct  87   MVRKKIDMANRELKPLGQSCQKKEKEYKEALEAFNEKNKEKAQLVTTLMEMLTESERLRM  146

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  147  KKLEELSKNIE  157



>ref|XP_010658727.1| PREDICTED: uncharacterized protein LOC100262498 [Vitis vinifera]
 emb|CBI40236.3| unnamed protein product [Vitis vinifera]
Length=193

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = +3

Query  15   KMMMSITSVGSGGRLS---MeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNR  185
            +M  +  ++ S GRL+   M E+EEE++TR AI++ Q+REEEIE++KMEV+ KVE QL+R
Sbjct  33   QMQKTKNNLSSSGRLATMMMMEDEEEDVTRSAISTLQSREEEIERKKMEVRQKVELQLSR  92

Query  186  AEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealea  365
            AE++T+ LA IWEELEVL DP+RKEV +VRKKID  NR++K L Q+CQKKEKEYKEALEA
Sbjct  93   AEEETRRLAQIWEELEVLADPLRKEVAVVRKKIDMANRDIKPLGQSCQKKEKEYKEALEA  152

Query  366  FQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPT  485
            F EKN EK QL +TL+EL++ESEK R+ KLE+LSK VD T
Sbjct  153  FNEKNREKAQLVTTLMELLSESEKLRMKKLEDLSKHVDST  192



>ref|XP_006436659.1| hypothetical protein CICLE_v10032972mg [Citrus clementina]
 ref|XP_006492193.1| PREDICTED: RAB6-interacting golgin-like [Citrus sinensis]
 gb|ESR49899.1| hypothetical protein CICLE_v10032972mg [Citrus clementina]
Length=155

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = +3

Query  33   TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
            +S GSG  LS +E E+EE+ RMAI +FQAREEEIE++KMEVK +VE QL RAE++++ LA
Sbjct  6    SSNGSG--LSTDEIEDEEMARMAIATFQAREEEIERKKMEVKERVELQLGRAEEESRRLA  63

Query  213  HIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKT  392
             IWEELEVLTDPMRKEV +VRKKID  NRELK L Q+ QKKE+EYKEALEAF EK+ EK 
Sbjct  64   QIWEELEVLTDPMRKEVAVVRKKIDMANRELKPLGQSIQKKEREYKEALEAFNEKSKEKA  123

Query  393  QLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
            QL + L+EL+ ESE+ R+ KLEELSK ++P  
Sbjct  124  QLVTALMELLTESERVRMKKLEELSKNIEPIQ  155



>ref|XP_007143818.1| hypothetical protein PHAVU_007G104200g [Phaseolus vulgaris]
 gb|ESW15812.1| hypothetical protein PHAVU_007G104200g [Phaseolus vulgaris]
Length=172

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = +3

Query  3    GMSQKMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLN  182
            G   + M ++ S+GS GRLS EE E+EEI+++AI++FQ++EEEIE++KMEV+ KVE QL 
Sbjct  8    GEEMQKMKNLGSIGSSGRLSAEEYEDEEISKLAISTFQSKEEEIERKKMEVREKVELQLG  67

Query  183  RAEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykeale  362
            RAE++T+ LAHIWEELEVL DP+RKEV MVRKKID  NR+LK L    QKKEKE KEALE
Sbjct  68   RAEEETRRLAHIWEELEVLDDPLRKEVAMVRKKIDLANRDLKPLGLNYQKKEKECKEALE  127

Query  363  aFQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
            A  EKN EK  L +TL+E++ ESE+ R+ KL+EL KI++
Sbjct  128  ALNEKNKEKAHLVATLVEMLTESERMRMKKLDELCKIIE  166



>ref|XP_002315451.2| hypothetical protein POPTR_0010s24210g [Populus trichocarpa]
 gb|EEF01622.2| hypothetical protein POPTR_0010s24210g [Populus trichocarpa]
Length=158

 Score =   158 bits (400),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = +3

Query  33   TSVGSGGRLS-MeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHL  209
            +++GS GRLS  E NEEEEI R+ I+ FQAREEEIE++KMEV+ KVE QL RAE++T+ L
Sbjct  6    SNIGSSGRLSTEEINEEEEIPRLDISKFQAREEEIERKKMEVREKVELQLGRAEEETRRL  65

Query  210  AHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEK  389
             HIWEELEVL DP+RK+V + RKKID  N+ELK L Q+CQKKEKEYKEALEAF EKN EK
Sbjct  66   THIWEELEVLADPLRKDVAIARKKIDMANKELKPLGQSCQKKEKEYKEALEAFNEKNREK  125

Query  390  TQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             QL +TL+EL+ ESEK R+ KLEEL+KI++
Sbjct  126  AQLVATLMELLTESEKQRMKKLEELNKIME  155



>gb|KEH43435.1| transcriptional activator [Medicago truncatula]
Length=162

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M ++ S+GS GR S EE E+E+++++AI++ QA+EEEIE+RKMEVK +VE QL RAE++T
Sbjct  4    MKNLGSIGSSGRFSTEECEDEDVSKLAISTLQAKEEEIERRKMEVKERVELQLGRAEEET  63

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LAHIWEELEV+ DPMRKEV MVRKKID  N+++K L Q  QKKEKEYKEALEAF EKN
Sbjct  64   RRLAHIWEELEVMEDPMRKEVAMVRKKIDLANKDVKQLGQNYQKKEKEYKEALEAFNEKN  123

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             EK  L +TL E++ ESE+ R+ KLEEL K ++
Sbjct  124  KEKNHLVATLTEMLAESERIRMKKLEELCKTIE  156



>gb|KHN00913.1| hypothetical protein glysoja_000581 [Glycine soja]
Length=159

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M  + ++GS GRLS EE E+EEI+++ I++FQ++EEEIE++KMEV+ KVE QL RAE++T
Sbjct  1    MQKMKNLGSSGRLSAEEYEDEEISKLTISTFQSKEEEIERKKMEVREKVEFQLGRAEEET  60

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LAHIWEELEVL DPMRKEV MVRKKID  N++LK L    QKKEKEYKEALEAF EKN
Sbjct  61   RRLAHIWEELEVLDDPMRKEVAMVRKKIDLANKDLKPLGLNFQKKEKEYKEALEAFNEKN  120

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             EK  L +TL+E++ ESE+ R+ KLEEL K ++
Sbjct  121  KEKAHLVATLVEMLTESERLRMKKLEELCKTIE  153



>ref|XP_003556274.1| PREDICTED: RAB6-interacting golgin-like [Glycine max]
Length=169

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M  + ++GS GRLS EE E+EEI+++ I++FQ++EEEIE++KMEV+ KVE QL RAE++T
Sbjct  11   MQKMKNLGSSGRLSAEEYEDEEISKLTISTFQSKEEEIERKKMEVREKVEFQLGRAEEET  70

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LAHIWEELEVL DPMRKEV MVRKKID  N++LK L    QKKEKEYKEALEAF EKN
Sbjct  71   RRLAHIWEELEVLDDPMRKEVAMVRKKIDLANKDLKPLGLNFQKKEKEYKEALEAFNEKN  130

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             EK  L +TL+E++ ESE+ R+ KLEEL K ++
Sbjct  131  KEKAHLVATLVEMLTESERLRMKKLEELCKTIE  163



>emb|CAN75481.1| hypothetical protein VITISV_034536 [Vitis vinifera]
Length=366

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = +3

Query  15   KMMMSITSVGSGGRLS---MeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNR  185
            KM  +  ++ S GRL+   M E+EEE++TR AI++ Q+REEEIE++KMEV+ KVE QL+R
Sbjct  206  KMQKTKNNLSSSGRLATMMMMEDEEEDVTRSAISTLQSREEEIERKKMEVRQKVELQLSR  265

Query  186  AEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealea  365
            AE++T+ LA IWEELEVL DP+RKEV +VRKKID  NR++K L Q+CQKKEKEYKEALEA
Sbjct  266  AEEETRRLAQIWEELEVLADPLRKEVAVVRKKIDMANRDIKPLGQSCQKKEKEYKEALEA  325

Query  366  FQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPT  485
            F EKN EK QL +TL+EL++ESEK R+ KLE+LSK VD T
Sbjct  326  FNEKNREKAQLVTTLMELLSESEKLRMKKLEDLSKHVDST  365



>gb|KDO46936.1| hypothetical protein CISIN_1g045900mg [Citrus sinensis]
Length=155

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 121/149 (81%), Gaps = 2/149 (1%)
 Frame = +3

Query  33   TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
            +S GSG  LS +E E+EE+ RMAI +FQAREEEIE++K EVK +VE QL RAE++++ LA
Sbjct  6    SSNGSG--LSTDEIEDEEMARMAIATFQAREEEIERKKTEVKERVELQLGRAEEESRRLA  63

Query  213  HIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKT  392
             IWEELEVLTDPMRKEV +VRKKID  NRELK L Q+ QKKE+EYKEALEAF EK+ EK 
Sbjct  64   QIWEELEVLTDPMRKEVAVVRKKIDMANRELKPLGQSIQKKEREYKEALEAFNEKSKEKA  123

Query  393  QLTSTLIELVNESEKFRLGKLEELSKIVD  479
            QL + L+EL+ ESE+ R+ KLEELSK ++
Sbjct  124  QLVTALMELLTESERVRMKKLEELSKSIE  152



>ref|XP_008446775.1| PREDICTED: RAB6-interacting golgin-like [Cucumis melo]
Length=161

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 121/153 (79%), Gaps = 4/153 (3%)
 Frame = +3

Query  42   GSGGRL----SMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHL  209
            G+G R+    S + NE+E ++++ +++ QAREEEIE++KMEVK KVE QL RAE++ K L
Sbjct  9    GNGDRVLLEGSNDRNEDETVSKLTVSTLQAREEEIERKKMEVKEKVEFQLTRAEEEAKRL  68

Query  210  AHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEK  389
            A IWEELEV+ DPM KEVG VRK+IDTV RELKSL Q CQKKEKEYKE  + F EK+NEK
Sbjct  69   AQIWEELEVMGDPMGKEVGNVRKRIDTVKRELKSLGQICQKKEKEYKEVQDIFNEKSNEK  128

Query  390  TQLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
             QL +TL+EL+ +SEK+R+ KLEEL+K ++ T+
Sbjct  129  AQLLATLMELLGQSEKWRMKKLEELNKNIESTN  161



>ref|XP_002529082.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33326.1| conserved hypothetical protein [Ricinus communis]
Length=173

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE++KMEVK +V++QL RAE+ TK LA I EELE L+DPMRKEV 
Sbjct  40   MSRSALAMFRAKEEEIERKKMEVKDRVQAQLGRAEEATKRLAEIREELETLSDPMRKEVS  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            MVRKKIDTVNRELK L   CQ+KE+EY+EALEAF EKN EK+QL S L+ELV ESE+ RL
Sbjct  100  MVRKKIDTVNRELKPLGLTCQRKEREYREALEAFNEKNKEKSQLVSKLMELVGESERLRL  159

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  160  KKLEELSKNIE  170



>ref|XP_004150485.1| PREDICTED: uncharacterized protein LOC101217540 [Cucumis sativus]
 gb|KGN52204.1| hypothetical protein Csa_5G615265 [Cucumis sativus]
Length=161

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++++ +++ QAREEEIE++KMEVK KVE QL RAE++ K LA IWEELEV+ DPM KEVG
Sbjct  28   VSKLTVSTLQAREEEIERKKMEVKEKVELQLTRAEEEAKRLAQIWEELEVMGDPMGKEVG  87

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRK+IDTV RELKSL Q CQKKEKEYKE  + F EK+NEK QL +TL+EL+ +SEK+R+
Sbjct  88   NVRKRIDTVKRELKSLGQICQKKEKEYKEVQDIFNEKSNEKAQLLATLMELLGQSEKWRM  147

Query  447  GKLEELSKIVDPTH  488
             KLEEL+K ++  +
Sbjct  148  KKLEELNKNIESMN  161



>gb|KDP34701.1| hypothetical protein JCGZ_10906 [Jatropha curcas]
Length=172

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+  F+A+EEEIE++KMEV+ +V++QL R E++TK LA I EELE LTDP+RKEV 
Sbjct  39   MTRSALAMFRAKEEEIERKKMEVRDRVQAQLGRVEEETKRLAEIREELEALTDPVRKEVS  98

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKIDTVNRELK L Q CQKKE+EYKEALEAF EKN EK QL S L+ELV+ESEK RL
Sbjct  99   VVRKKIDTVNRELKPLGQNCQKKEREYKEALEAFNEKNKEKAQLVSKLMELVSESEKQRL  158

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  159  KKLEELSKTIE  169



>ref|XP_010243883.1| PREDICTED: uncharacterized protein PF11_0207-like [Nelumbo nucifera]
Length=172

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+T+F+A+EEEIE++KMEV+ KV++QL R E++TK LA I EELE L DP RKEV 
Sbjct  39   MSRSALTTFRAKEEEIERKKMEVREKVQAQLGRVEEETKRLAEIREELEALADPTRKEVA  98

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VNRELK L Q+CQKKEKEYKEAL+AF EKN EK QL + L+ELV+ESE+ R+
Sbjct  99   LVRKKIDAVNRELKPLGQSCQKKEKEYKEALDAFNEKNKEKAQLITKLMELVSESERLRM  158

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  159  KKLEELSKHID  169



>ref|XP_004303018.1| PREDICTED: uncharacterized protein LOC101302467 [Fragaria vesca 
subsp. vesca]
Length=186

 Score =   149 bits (376),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = +3

Query  33   TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
             S GS    S    E+EE++R A+++F+A+EEEIE++KMEV+ KV++QL R E++TK LA
Sbjct  35   NSAGSLSFNSNLSKEDEEMSRSALSTFRAKEEEIERKKMEVREKVQAQLGRVEEETKRLA  94

Query  213  HIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKT  392
             I EELE L+DPMRKEV  VRKKIDTVN+ELK L Q+CQKKE+EYKEALEAF EKN EK 
Sbjct  95   TIREELEGLSDPMRKEVSAVRKKIDTVNKELKPLGQSCQKKEREYKEALEAFNEKNREKV  154

Query  393  QLTSTLIELVNESEKFRLGKLEELSKIVD  479
            QL + L+ELV ESEK R+ KLEELSK VD
Sbjct  155  QLITKLMELVGESEKMRMKKLEELSKNVD  183



>ref|XP_010089400.1| hypothetical protein L484_013791 [Morus notabilis]
 gb|EXB37753.1| hypothetical protein L484_013791 [Morus notabilis]
Length=171

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIE+++MEV+ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  38   MSRSALSTFRAKEEEIERKRMEVRERVQAQLGRVEEETKRLAMIREELEALADPMRKEVA  97

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VN+ELK L   CQKKEKEYKEALEAF EKN EK QL + L+ELV+ESEK RL
Sbjct  98   LVRKKIDAVNKELKPLGHTCQKKEKEYKEALEAFNEKNKEKVQLITKLMELVSESEKLRL  157

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  158  KKLEELSKNIDSIH  171



>ref|XP_010032096.1| PREDICTED: uncharacterized protein LOC104421728 [Eucalyptus grandis]
 gb|KCW51486.1| hypothetical protein EUGRSUZ_J01003 [Eucalyptus grandis]
Length=165

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 121/159 (76%), Gaps = 3/159 (2%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneee---eITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAE  191
            M +  SV  GG+ S +E++ +   +I+R+AI++ QAREEEI ++KMEVK +VE QL RAE
Sbjct  7    MKNHGSVNGGGKPSTDEDQVKEDGDISRLAISTLQAREEEIARKKMEVKERVELQLGRAE  66

Query  192  QQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQ  371
            + T+ LA IWEELE L DP+RKEV  VRKKID V RELK L Q+C +KEKEYKEA+EAF 
Sbjct  67   EATRRLAQIWEELEELADPLRKEVATVRKKIDVVIRELKPLGQSCHRKEKEYKEAMEAFN  126

Query  372  EKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
            EK+ EK QL +TL+EL++ESE+ R+ KLEELSK  +  H
Sbjct  127  EKSKEKAQLMATLMELLSESEQLRMKKLEELSKNAESVH  165



>ref|XP_008461743.1| PREDICTED: RAB6-interacting golgin [Cucumis melo]
Length=175

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  24   MSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTK  203
            M  ++V +G    ++E++EEEI+R A+  F+A+EEEIE++KME++ KVE++L RAE+ TK
Sbjct  21   MISSNVNNGIGSPLKEDQEEEISRSALALFRAKEEEIERKKMEMREKVEARLGRAEEATK  80

Query  204  HLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNN  383
             LA I EELE +TDPMRKEV  +RKKID VN+ELK L   CQKKE+EYKE L+ F EKN 
Sbjct  81   RLAEIREELEGMTDPMRKEVSFIRKKIDLVNKELKPLGLTCQKKEREYKEVLDLFNEKNR  140

Query  384  EKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
            EK+QL S L+ELVNESEK R+ KLEELSK +D  H
Sbjct  141  EKSQLVSKLMELVNESEKLRMRKLEELSKNIDILH  175



>gb|KHG17202.1| RAB6-interacting golgin [Gossypium arboreum]
Length=168

 Score =   146 bits (368),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  24   MSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTK  203
            +++ + GS    S    E+EEI++ A+++F+A+EEEIE++KMEV+ KV+ QL R E++TK
Sbjct  14   LTVQNSGSLSFSSHLSKEDEEISKSALSTFRAKEEEIERKKMEVREKVQLQLGRVEEETK  73

Query  204  HLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNN  383
             LA I EELE L DPMRKEV +VRKKID VN+ELK L   CQKKE+EYKEALEAF EKN 
Sbjct  74   RLATIREELEALADPMRKEVAVVRKKIDAVNKELKPLGHTCQKKEREYKEALEAFNEKNK  133

Query  384  EKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
            EK QL + L+ELV+ESE+ R+ KLEELSK +D  H
Sbjct  134  EKVQLITKLMELVSESERLRMKKLEELSKNIDSLH  168



>ref|XP_007162864.1| hypothetical protein PHAVU_001G187400g [Phaseolus vulgaris]
 gb|ESW34858.1| hypothetical protein PHAVU_001G187400g [Phaseolus vulgaris]
Length=167

 Score =   146 bits (368),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIE++KMEV+ KV+ QL R E++TK LA I EELE L DPMRKEV 
Sbjct  34   MSRSALSTFRAKEEEIERKKMEVREKVQLQLGRVEEETKRLATIREELEALADPMRKEVA  93

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRK+ID+VN+ELK L  ACQKKEKEYK+ALE+F EKN EK QL + L+ELV+ESE+ R+
Sbjct  94   LVRKRIDSVNKELKPLGHACQKKEKEYKDALESFNEKNREKVQLITKLMELVSESERLRM  153

Query  447  GKLEELSKIVD  479
             KLEELSK VD
Sbjct  154  KKLEELSKNVD  164



>ref|NP_001241375.1| uncharacterized protein LOC100796368 [Glycine max]
 gb|ACU23258.1| unknown [Glycine max]
 gb|KHN38658.1| hypothetical protein glysoja_008207 [Glycine soja]
Length=175

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE+RKMEV+ KV + L R E++TK LA I EELE LTDP+RKEV 
Sbjct  42   MSRSALAMFRAKEEEIERRKMEVRDKVHAYLGRVEEETKRLAEIREELEGLTDPLRKEVA  101

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L Q CQ+KE+EYKEALE F EKN EK QL + L+ELV ESEK R+
Sbjct  102  IVRKKIDSVNKELKPLGQTCQRKEREYKEALEVFNEKNKEKAQLVTKLMELVTESEKLRM  161

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  162  KKLEELSKNLDTLH  175



>ref|XP_007132400.1| hypothetical protein PHAVU_011G091600g [Phaseolus vulgaris]
 gb|ESW04394.1| hypothetical protein PHAVU_011G091600g [Phaseolus vulgaris]
Length=174

 Score =   145 bits (367),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE++KMEV+ KV + L R E++TK LA I EELE LTDP+RKEV 
Sbjct  41   MSRSALAMFRAKEEEIERKKMEVRDKVHAYLGRVEEETKRLAEIREELEGLTDPLRKEVA  100

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            MVRKKID+VN+ELK L Q CQ+KE+EYKEAL+AF EKN EK QL + L+ELV ESEK R+
Sbjct  101  MVRKKIDSVNKELKPLGQTCQRKEREYKEALDAFNEKNKEKAQLVTKLMELVTESEKLRM  160

Query  447  GKLEELSKIVD  479
             KLEELSK VD
Sbjct  161  KKLEELSKNVD  171



>gb|KHN21121.1| hypothetical protein glysoja_006600 [Glycine soja]
Length=176

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE+RK+EV+ KV + L R E++TK LA I EELE LTDP+RKEV 
Sbjct  43   MSRSALAMFRAKEEEIERRKVEVRDKVHAYLGRVEEETKRLAEIREELEGLTDPLRKEVA  102

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L Q CQ+KE+EYKEAL+AF EKN EK QL + L+ELV ESEK R+
Sbjct  103  IVRKKIDSVNKELKPLGQTCQRKEREYKEALDAFNEKNKEKAQLVTKLMELVTESEKLRM  162

Query  447  GKLEELSKIVDPTH  488
             KLEELSK VD  H
Sbjct  163  KKLEELSKNVDTLH  176



>ref|NP_001238549.1| uncharacterized protein LOC100499699 [Glycine max]
 gb|ACU13292.1| unknown [Glycine max]
Length=176

 Score =   145 bits (367),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE+RK+EV+ KV + L R E++TK LA I EELE LTDP+RKEV 
Sbjct  43   MSRSALAMFRAKEEEIERRKVEVRDKVHAYLGRVEEETKRLAEIREELEGLTDPLRKEVA  102

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L Q CQ++E+EYKEAL+AF EKN EK QL + L+ELV ESEK R+
Sbjct  103  IVRKKIDSVNKELKPLGQTCQRREREYKEALDAFNEKNKEKAQLVTKLMELVTESEKLRM  162

Query  447  GKLEELSKIVDPTH  488
             KLEELSK VD  H
Sbjct  163  KKLEELSKNVDTLH  176



>ref|XP_007027643.1| Family of Uncharacterized protein function isoform 1 [Theobroma 
cacao]
 gb|EOY08145.1| Family of Uncharacterized protein function isoform 1 [Theobroma 
cacao]
Length=171

 Score =   145 bits (367),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            I++ A+++F+A+EEEIE++KMEV+ KV+ QL R E++TK LA I EELE L DPMRK+V 
Sbjct  38   ISKSALSTFRAKEEEIERKKMEVREKVQLQLGRVEEETKRLAFIREELEALADPMRKDVA  97

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VN+ELK L   CQKKE+EYKEALEAF EKN EK QL + L+ELV+ESE+ R+
Sbjct  98   LVRKKIDAVNKELKPLGHTCQKKEREYKEALEAFNEKNKEKVQLITKLMELVSESERLRM  157

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  158  KKLEELSKNIDSIH  171



>ref|XP_002267642.1| PREDICTED: syncoilin [Vitis vinifera]
 emb|CBI17071.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIE++KMEV+ +V++QL R E++TK LA I EELE L+DPMRKEV 
Sbjct  39   MSRSALSAFRAKEEEIERKKMEVRERVQAQLGRVEEETKRLAEIREELEALSDPMRKEVA  98

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            ++RK+ID VNREL+ L Q CQKKEKEYKEALEAF EKN EK QL + L+ELV+ESE+ R+
Sbjct  99   IIRKRIDAVNRELRPLGQGCQKKEKEYKEALEAFNEKNKEKAQLVTKLMELVSESERLRM  158

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  159  KKLEELSKNIE  169



>ref|NP_190858.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB86894.1| putative protein [Arabidopsis thaliana]
 dbj|BAF01404.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79007.1| uncharacterized protein AT3G52900 [Arabidopsis thaliana]
Length=164

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  27   SITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKH  206
            +++ V + G+L ME+NEEEEI ++A+T FQAREEEIE++KM VK KV+ +L  AE+ T+ 
Sbjct  11   AVSGVNTNGKLPMEDNEEEEIWKVAVTRFQAREEEIERKKMTVKEKVQQRLGFAEEATRC  70

Query  207  LAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNE  386
            L    EELE++ DPMRKEVGMVRKKID  NR++KSL Q+CQKKEKEYK+ LEAF EKN E
Sbjct  71   LTQTLEELEIMGDPMRKEVGMVRKKIDMANRDIKSLAQSCQKKEKEYKDTLEAFNEKNKE  130

Query  387  KTQLTSTLIELVNESEKFRLGKLEELSKIV  476
            K  L S L+EL+ ESE+ R+ KLEE++K V
Sbjct  131  KAHLVSMLMELLAESERLRIKKLEEINKTV  160



>ref|XP_004137876.1| PREDICTED: uncharacterized protein LOC101210169 isoform 1 [Cucumis 
sativus]
 ref|XP_004137877.1| PREDICTED: uncharacterized protein LOC101210169 isoform 2 [Cucumis 
sativus]
 ref|XP_004165499.1| PREDICTED: uncharacterized protein LOC101227916 [Cucumis sativus]
 gb|KGN59071.1| hypothetical protein Csa_3G751460 [Cucumis sativus]
Length=167

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            I+R A+++F+A+EEEIE++KMEV+ KV++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  34   ISRSALSTFRAKEEEIERKKMEVREKVQAQLGRVEEETKRLACIREELEALADPMRKEVA  93

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID VN+ELK L   CQKKEKEYKEALEAF +KN EK QL + L+ELV+ESE+ RL
Sbjct  94   QVRKKIDAVNKELKPLGHTCQKKEKEYKEALEAFNDKNKEKVQLITKLMELVSESERLRL  153

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  154  KKLEELSKNID  164



>ref|XP_006603672.1| PREDICTED: uncharacterized protein LOC100527015 isoform X1 [Glycine 
max]
 gb|ACU19051.1| unknown [Glycine max]
 gb|KHN02249.1| hypothetical protein glysoja_002273 [Glycine soja]
Length=164

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +3

Query  9    SQKMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRA  188
            +Q   + + + GS    S    E+EEI+R A+++F+A+EEEIE++KMEV+ KV+ QL R 
Sbjct  5    NQNNQLVVQNSGSLSFSSHLSKEDEEISRSALSTFRAKEEEIERKKMEVREKVQLQLGRV  64

Query  189  EQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaF  368
            E++TK LA I EELE L DPMRKEV +VRK+ID+VN+ELK L   CQKKEKEYK+ALEAF
Sbjct  65   EEETKRLATIREELEALADPMRKEVALVRKRIDSVNKELKPLGHTCQKKEKEYKDALEAF  124

Query  369  QEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             EKN EK QL + L+ELV+ESE+ R+ KLEELSK +D
Sbjct  125  NEKNREKVQLITKLMELVSESERLRMKKLEELSKNID  161



>ref|XP_009115987.1| PREDICTED: uncharacterized protein LOC103841220 [Brassica rapa]
Length=161

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    MSQKMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNR  185
            MS K   +  +V + G+L MEENEEEEI ++A++ FQAREEEIE++KM VK KV+ +L  
Sbjct  1    MSIKNSGAAPAVNTNGKLPMEENEEEEIWKVAVSRFQAREEEIERKKMTVKEKVQQRLGF  60

Query  186  AEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealea  365
            AE+ T+ L    EELE++ DPMRKEVGMVRKKID  NR++KSL Q+CQKKEKEYKE LEA
Sbjct  61   AEEATRCLTQTLEELEIMGDPMRKEVGMVRKKIDMANRDIKSLAQSCQKKEKEYKETLEA  120

Query  366  FQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIV  476
            F EKN EKT L S L+EL+ ESE+ R+ KLEE++K V
Sbjct  121  FNEKNKEKTHLVSMLMELLAESERVRMKKLEEINKTV  157



>ref|XP_007202665.1| hypothetical protein PRUPE_ppa012398mg [Prunus persica]
 ref|XP_008241282.1| PREDICTED: RAB6-interacting golgin-like [Prunus mume]
 gb|EMJ03864.1| hypothetical protein PRUPE_ppa012398mg [Prunus persica]
Length=171

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = +3

Query  33   TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
             S GS    S    E+EE++R A+++F+A+EEEIE++KMEV+ KV++QL R E++TK LA
Sbjct  20   NSAGSLSFNSNLSKEDEEMSRSALSTFRAKEEEIERKKMEVREKVQAQLGRVEEETKRLA  79

Query  213  HIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKT  392
             I EELE L DPMRKEV  VRKKID++N+ELK L   CQKKEKEY++ALEAF EKN EK 
Sbjct  80   TIREELEGLADPMRKEVSQVRKKIDSINKELKPLGHTCQKKEKEYRDALEAFNEKNREKV  139

Query  393  QLTSTLIELVNESEKFRLGKLEELSKIVD  479
            QL + L+ELV+ESEK R+ KLEELSK VD
Sbjct  140  QLITKLMELVSESEKLRMKKLEELSKNVD  168



>ref|XP_004139478.1| PREDICTED: uncharacterized protein LOC101203874 [Cucumis sativus]
 gb|KGN64906.1| hypothetical protein Csa_1G153510 [Cucumis sativus]
Length=176

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            I+R A+  F+A+EEEIE++KME++ KVE++L RAE+ TK LA I EELE +TDPMRKEV 
Sbjct  43   ISRSALALFRAKEEEIERKKMEMREKVEARLGRAEEATKRLAEIREELEGMTDPMRKEVS  102

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             +RKKID VN+ELK L   CQKKE+EYKE L+ F EKN EK+QL S L+ELVNESEK R+
Sbjct  103  FIRKKIDLVNKELKPLGLTCQKKEREYKEVLDLFNEKNKEKSQLVSKLMELVNESEKLRM  162

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  163  KKLEELSKNID  173



>gb|EPS70589.1| hypothetical protein M569_04170, partial [Genlisea aurea]
Length=152

 Score =   144 bits (362),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  36   SVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAH  215
            S+GS GR   +++       +AI S+QA+EEEIEK K+EV+ KVES++ RAE++ K L  
Sbjct  2    SIGSSGRFPDDDDGSNNDDALAIMSYQAKEEEIEKMKLEVRKKVESRITRAEEEAKRLTQ  61

Query  216  IWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQ  395
            +WEELE  TDP RKE+ +VRK++D   +ELK+L+Q C KKEKEY+EA+EA+QE++ EK Q
Sbjct  62   VWEELEGFTDPTRKELSLVRKRLDVAAKELKTLSQICHKKEKEYREAMEAYQERSKEKAQ  121

Query  396  LTSTLIELVNESEKFRLGKLEELSKIV  476
            LT+ L+EL+N+SEK+R+ KLE+ +K++
Sbjct  122  LTAALVELMNQSEKYRMRKLEDFTKLL  148



>ref|XP_008442808.1| PREDICTED: RAB6-interacting golgin [Cucumis melo]
Length=167

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            I+R A+++F+A+EEEIE++KMEV+ KV++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  34   ISRSALSTFRAKEEEIERKKMEVREKVQAQLGRVEEETKRLACIREELEALADPMRKEVA  93

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRK+ID VN+ELK L   CQKKEKEYKEALEAF +KN EK QL + L+ELV+ESE+ RL
Sbjct  94   QVRKRIDAVNKELKPLGHTCQKKEKEYKEALEAFNDKNKEKVQLITKLMELVSESERLRL  153

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  154  KKLEELSKNID  164



>gb|KDP42698.1| hypothetical protein JCGZ_23638 [Jatropha curcas]
Length=164

 Score =   144 bits (362),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = +3

Query  12   QKMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAE  191
            Q+  + + + GS    S    E+EE++R A+++F+A+EEEIE++KMEV+ KV+ QL R E
Sbjct  6    QQNQLMVQNSGSLSFSSQMSKEDEEMSRSALSTFRAKEEEIERKKMEVREKVQLQLGRVE  65

Query  192  QQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQ  371
            ++TK LA I EELE + DPMRKEV  VRKKIDTVN+ELK L    QKKEKEYKEALEAF 
Sbjct  66   EETKRLAMIREELEAMADPMRKEVAFVRKKIDTVNKELKPLGHTVQKKEKEYKEALEAFN  125

Query  372  EKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
            EKN EK QL + L+ELV+ESE+ RL KLEELSK +D  H
Sbjct  126  EKNKEKVQLITKLMELVSESERLRLKKLEELSKNIDSIH  164



>ref|XP_006403757.1| hypothetical protein EUTSA_v10010763mg [Eutrema salsugineum]
 gb|ESQ45210.1| hypothetical protein EUTSA_v10010763mg [Eutrema salsugineum]
Length=176

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  27   SITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKH  206
            + ++V + G+L MEENEEEEI ++A++ FQAREEEIE++KM VK KV+ +L  AE+ T+ 
Sbjct  23   TASAVNANGKLPMEENEEEEIWKVAVSRFQAREEEIERKKMTVKEKVQQRLGFAEEATRC  82

Query  207  LAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNE  386
            L    EELE++ DPMRKEVG+VRKKID  NR++KSL Q+CQKKEKEYKE LEAF EKN E
Sbjct  83   LTQTLEELEIMGDPMRKEVGIVRKKIDMANRDIKSLAQSCQKKEKEYKETLEAFNEKNKE  142

Query  387  KTQLTSTLIELVNESEKFRLGKLEELSKIV  476
            KT L S L+EL+ ESE+ RL KLEE++K V
Sbjct  143  KTHLVSMLMELLAESERLRLKKLEEINKTV  172



>ref|XP_009352988.1| PREDICTED: uncharacterized protein LOC103944289 [Pyrus x bretschneideri]
Length=173

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = +3

Query  33   TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
             S GS    S    E+EE++R A+++F+A+EEEIE++KMEV+ KV++QL R E++TK LA
Sbjct  22   NSAGSLSFNSNMSKEDEEMSRSALSTFRAKEEEIERKKMEVREKVQAQLGRVEEETKRLA  81

Query  213  HIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKT  392
             I EELE L DPMRKEV  VRKKID++N+ELK L   CQKKEKEY++ALEAF EKN EK 
Sbjct  82   TIREELEGLADPMRKEVSQVRKKIDSINKELKPLGHTCQKKEKEYRDALEAFNEKNREKV  141

Query  393  QLTSTLIELVNESEKFRLGKLEELSKIVD  479
            QL + L+ELV ESEK R+ KLEELSK VD
Sbjct  142  QLITKLMELVTESEKLRMKKLEELSKNVD  170



>gb|AFK35409.1| unknown [Lotus japonicus]
Length=177

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE+RKMEV+ KV + L R E + K LA I EELE  TDPMRKEVG
Sbjct  44   MSRSALAMFRAKEEEIERRKMEVRDKVHAHLGRVETEAKRLAEIREELEGFTDPMRKEVG  103

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VN+ELK L Q CQKKE+EY EALEAF +KN EK QL + L+ELV ESE+ R+
Sbjct  104  IVRKKIDMVNKELKPLGQTCQKKEREYHEALEAFNDKNREKAQLVTKLVELVTESERLRM  163

Query  447  GKLEELSKIVDPTH  488
             KL+ELSK +D  H
Sbjct  164  KKLDELSKNIDTLH  177



>ref|XP_010464658.1| PREDICTED: ankyrin repeat domain-containing protein 30A-like 
[Camelina sativa]
Length=179

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEKRKME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  46   MSRTALSAFRAKEEEIEKRKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  105

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEALEAF +KN EK QL + L+ELV ESEK R+
Sbjct  106  LVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNDKNREKVQLITKLMELVGESEKMRM  165

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  166  KKLEELSKNIDSIH  179



>ref|XP_010110159.1| hypothetical protein L484_016779 [Morus notabilis]
 gb|EXC25397.1| hypothetical protein L484_016779 [Morus notabilis]
Length=171

 Score =   143 bits (360),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 15/171 (9%)
 Frame = +3

Query  21   MMSITSVG--SGGRLSMeenee--------eeITRMAITSFQAREEEIEKRKMEVKIKVE  170
            M +  SVG  S GRLS ++  +        +E++R+AI+SFQAREEEIE+ KMEVK KVE
Sbjct  1    MKNFGSVGNTSSGRLSTDQEYQINQEDHDNQEVSRLAISSFQAREEEIERIKMEVKEKVE  60

Query  171  SQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeyk  350
             QL RAE++T+ LA IWEELE + DP+RKEV  VRK++D  NRELK L Q+C KKEKEYK
Sbjct  61   LQLGRAEEETRRLAQIWEELEEMADPLRKEVANVRKRVDMANRELKPLGQSCMKKEKEYK  120

Query  351  ealeaFQEKNNEKTQLTSTLIE-----LVNESEKFRLGKLEELSKIVDPTH  488
            EALE F EK+ EK QL +TL+E     L+ ESE+ R+ KLE LSK ++  H
Sbjct  121  EALELFNEKSKEKAQLVTTLMESSYYQLMTESERMRMQKLEGLSKHIEKPH  171



>ref|XP_010504039.1| PREDICTED: uncharacterized protein LOC104781143 [Camelina sativa]
 ref|XP_010515767.1| PREDICTED: uncharacterized protein LOC104791548 [Camelina sativa]
Length=164

 Score =   143 bits (360),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  27   SITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKH  206
            + ++V + G+L MEENE+EEI ++A++ FQAREEEIE++KM VK KV+ +L  AE+ T+ 
Sbjct  11   AASAVNTNGKLPMEENEDEEIWKVAVSRFQAREEEIERKKMTVKEKVQQRLGFAEEATRC  70

Query  207  LAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNE  386
            L    EELE++ DPMRKEVGMVRKKID  NR++KSL Q+CQKKEKEYKE LEAF EKN E
Sbjct  71   LTQTLEELEIMGDPMRKEVGMVRKKIDLANRDIKSLAQSCQKKEKEYKETLEAFNEKNKE  130

Query  387  KTQLTSTLIELVNESEKFRLGKLEELSKIV  476
            K  L S L+EL+ ESE+ R+ KLEE++K V
Sbjct  131  KAHLVSMLMELLAESERLRIKKLEEINKTV  160



>ref|NP_001238045.1| uncharacterized protein LOC100499923 [Glycine max]
 gb|ACU14201.1| unknown [Glycine max]
 gb|KHN18740.1| hypothetical protein glysoja_021491 [Glycine soja]
Length=164

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = +3

Query  9    SQKMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRA  188
            +Q   + + + GS    S    E+EE++R A+++F+A+EEEIE++KMEV+ KV+ QL R 
Sbjct  5    NQNNQLVVQNSGSLSFSSHLSKEDEEMSRSALSTFRAKEEEIERKKMEVREKVQLQLGRV  64

Query  189  EQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaF  368
            E++TK LA I EELE L DPMRKEV +VRK+ID+VN+ELK L   CQKKEKEYK+ALEAF
Sbjct  65   EEETKRLATIREELEALADPMRKEVALVRKRIDSVNKELKPLGHTCQKKEKEYKDALEAF  124

Query  369  QEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             EKN EK QL + L+ELV ESE+ R+ KLEELSK +D
Sbjct  125  NEKNREKVQLITKLMELVGESERLRMKKLEELSKNID  161



>emb|CDP06964.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +T+ A+++F+A+EEEIE++K EV+ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  41   MTKSALSAFRAKEEEIERKKAEVRERVQAQLGRVEEETKKLAEIREELEALADPMRKEVA  100

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            ++RKK+D +NRELK L Q CQ+KEKEYKE L+AF EK+ EKTQL S L+ELV+ESEK R+
Sbjct  101  LIRKKVDLLNRELKPLGQTCQRKEKEYKECLDAFNEKSREKTQLVSKLMELVSESEKLRM  160

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  161  KKLEELSKSIN  171



>gb|KFK34536.1| hypothetical protein AALP_AA5G158900 [Arabis alpina]
Length=163

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  33   TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
            ++  + G+L MEENEEEEI ++A++ FQAREEEIE++KM VK KV+ +L  AE+ T+ L 
Sbjct  12   SAANTNGKLPMEENEEEEIWKVAVSRFQAREEEIERKKMNVKEKVQQRLGFAEEATRCLT  71

Query  213  HIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKT  392
               EELE++ DPMRKEVGMVRKKID  NR++KSL Q+CQKKEKEYK+ LEAF EKN EK 
Sbjct  72   QTLEELEIMGDPMRKEVGMVRKKIDMANRDIKSLAQSCQKKEKEYKDTLEAFNEKNKEKA  131

Query  393  QLTSTLIELVNESEKFRLGKLEELSKIV  476
             L S L+EL+ ESE+ R+ KLEE++K V
Sbjct  132  NLVSVLMELLAESERLRMKKLEEINKTV  159



>ref|XP_007015921.1| Family of Uncharacterized protein function (DUF662) [Theobroma 
cacao]
 gb|EOY33540.1| Family of Uncharacterized protein function (DUF662) [Theobroma 
cacao]
Length=172

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = +3

Query  9    SQKMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRA  188
            SQ   +  + + SG    +++++EEE+ + A+ SF+A+EEEIE++KMEV+ KV++ + R 
Sbjct  13   SQMQRVKNSGINSGNGSPIKDDKEEEMAKSALASFRAKEEEIERKKMEVRDKVQAYMGRV  72

Query  189  EQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaF  368
            E+ T+ LA I EEL+ L DPMRKEV  VRKKIDTVNRELK L Q+CQKKE+EYKEALEAF
Sbjct  73   EEATRRLADIREELDSLIDPMRKEVANVRKKIDTVNRELKPLGQSCQKKEREYKEALEAF  132

Query  369  QEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             +KN EK QL S L+ELV+ESEK R+ KL+ELSK ++
Sbjct  133  NDKNKEKAQLVSKLMELVSESEKLRMTKLDELSKNIE  169



>gb|AFK44042.1| unknown [Lotus japonicus]
Length=166

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = +3

Query  3    GMSQKMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLN  182
            G  Q   + + + GS    S    E+EE++R A+++F+A+EEEIE++KMEV+ KV+ QL 
Sbjct  5    GEQQNNQLVVQNSGSLSFSSQMSKEDEEMSRSALSNFKAKEEEIERKKMEVREKVQLQLG  64

Query  183  RAEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykeale  362
            R E++TK LA I EELE L DPMRKEV +VRK+ID+VN+ELK L   CQKKEKEYK+ALE
Sbjct  65   RVEEETKRLATIREELESLADPMRKEVTIVRKRIDSVNKELKPLGHTCQKKEKEYKDALE  124

Query  363  aFQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
            AF EKN EK QL + L+ELV+ESE+ R+ KLEELSK +D
Sbjct  125  AFNEKNREKVQLITRLMELVSESERLRMKKLEELSKNID  163



>gb|AAM61492.1| unknown [Arabidopsis thaliana]
Length=164

 Score =   141 bits (355),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +3

Query  27   SITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKH  206
            +++ V + G+L ME+NEEEEI ++A+T FQAREEEIE++KM VK KV+ +L  AE+ T+ 
Sbjct  11   AVSGVNTNGKLPMEDNEEEEIWKVAVTRFQAREEEIERKKMTVKEKVQQRLGFAEEATRC  70

Query  207  LAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNE  386
            L    EELE++ DPM KEVGMVRKKID  NR++KSL Q+CQKKEKEYK+ LEAF EKN E
Sbjct  71   LTQTLEELEIMGDPMIKEVGMVRKKIDMANRDIKSLAQSCQKKEKEYKDTLEAFNEKNKE  130

Query  387  KTQLTSTLIELVNESEKFRLGKLEELSKIV  476
            K  L S L+EL+ ESE+ R+ KLEE++K V
Sbjct  131  KAHLVSMLMELLAESERLRIKKLEEINKTV  160



>ref|XP_011090009.1| PREDICTED: uncharacterized protein PF11_0207-like [Sesamum indicum]
Length=175

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 116/150 (77%), Gaps = 3/150 (2%)
 Frame = +3

Query  30   ITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHL  209
            I  VGS     M E+++EE+TR A+ +F+A+EEEIEKRK EV+ KV++QL R E++T+ L
Sbjct  26   INHVGSP---LMNEDKDEEMTRSALAAFRAKEEEIEKRKAEVREKVQAQLGRVEEETRRL  82

Query  210  AHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEK  389
            A I EELE L DPMRKEV +VRK+ID +NR+LK L  +CQKKEKEYKEALEAF EKN EK
Sbjct  83   AEIREELETLHDPMRKEVAIVRKRIDLINRDLKPLGLSCQKKEKEYKEALEAFNEKNREK  142

Query  390  TQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             QL + L+ELV ESEK RL KLEEL K +D
Sbjct  143  GQLVAKLVELVTESEKQRLKKLEELCKNID  172



>ref|XP_010515771.1| PREDICTED: uncharacterized protein LOC104791551 isoform X2 [Camelina 
sativa]
Length=149

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R EQ+T+ LA+I EELE + DPMRKEV 
Sbjct  17   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEQETRRLANIREELESMADPMRKEVN  76

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK RL
Sbjct  77   WVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRL  136

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  137  KKLEELSKSID  147



>ref|XP_004487521.1| PREDICTED: RAB6-interacting golgin-like [Cicer arietinum]
Length=173

 Score =   141 bits (355),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            I+R  +  F+A+EEEIE+RK+EV+ KV + L R E +TK LA I EE+E  TDPMRK+V 
Sbjct  40   ISRSVLAMFKAKEEEIERRKLEVRDKVHAHLGRVENETKRLAEIREEIEGFTDPMRKDVA  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            MVRKKID VN+ELK L Q CQKKE+EY EALEAF EKN EK QL + L++LV ESE+ R+
Sbjct  100  MVRKKIDMVNKELKPLGQTCQKKEREYNEALEAFNEKNKEKAQLVTKLVQLVAESERMRM  159

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  160  KKLEELSKNIDTLH  173



>ref|XP_010093204.1| hypothetical protein L484_008986 [Morus notabilis]
 gb|EXB53702.1| hypothetical protein L484_008986 [Morus notabilis]
Length=168

 Score =   141 bits (355),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  39   VGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHI  218
            + S G  + + ++EEE++R A+  F+A+EEEIE++K EV+ KV++Q+ + EQ TK LA I
Sbjct  19   ISSNGSPTKDIDKEEELSRSALAMFRAKEEEIERKKTEVREKVQAQIGKVEQATKRLADI  78

Query  219  WEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQL  398
             EELE LTDPMRK++ M+RKKID +N+ELK L Q+CQKKE+EY+EA+EA+ EKN EKTQL
Sbjct  79   REELEALTDPMRKDISMIRKKIDLINKELKPLGQSCQKKEREYREAVEAYNEKNREKTQL  138

Query  399  TSTLIELVNESEKFRLGKLEELSKIVDPTH  488
             + L+E+VNESE+ RL KLE+L   +   H
Sbjct  139  VAKLLEMVNESERLRLKKLEDLGNNITIIH  168



>ref|XP_002876173.1| hypothetical protein ARALYDRAFT_485662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52432.1| hypothetical protein ARALYDRAFT_485662 [Arabidopsis lyrata subsp. 
lyrata]
Length=164

 Score =   140 bits (354),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  24   MSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTK  203
            ++ + V   G+L MEENEEEEI ++A++ FQAREEEIE++KM VK KV+ +L  AE+ T+
Sbjct  10   VAASGVNINGKLPMEENEEEEIWKVAVSRFQAREEEIERKKMTVKEKVQQRLGFAEEATR  69

Query  204  HLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNN  383
             L    EELE++ DPMRKEVGMVRKKID  NR++KSL Q+CQKKEKEYKE LEAF EKN 
Sbjct  70   CLTQTLEELEIMGDPMRKEVGMVRKKIDMANRDIKSLAQSCQKKEKEYKETLEAFNEKNK  129

Query  384  EKTQLTSTLIELVNESEKFRLGKLEELSKIV  476
            EK  L S L+EL+ ESE+ R+ KLEE++K V
Sbjct  130  EKAHLVSMLMELLAESERLRIKKLEEINKTV  160



>ref|NP_001237324.1| uncharacterized protein LOC100527015 [Glycine max]
 gb|ACU16051.1| unknown [Glycine max]
Length=167

 Score =   140 bits (354),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 121/160 (76%), Gaps = 3/160 (2%)
 Frame = +3

Query  9    SQKMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRA  188
            +Q   + + + GS    S    E+EEI+R A+++F+A+EEEIE++KMEV+ KV+ QL R 
Sbjct  5    NQNNQLVVQNSGSLSFSSHLSKEDEEISRSALSTFRAKEEEIERKKMEVREKVQLQLGRV  64

Query  189  EQQTKHLAHI---WEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykeal  359
            E++TK LA I   ++ELE L DPMRKEV +VRK+ID+VN+ELK L   CQKKEKEYK+AL
Sbjct  65   EEETKRLATIREEYQELEALADPMRKEVALVRKRIDSVNKELKPLGHTCQKKEKEYKDAL  124

Query  360  eaFQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
            EAF EKN EK QL + L+ELV+ESE+ R+ KLEELSK +D
Sbjct  125  EAFNEKNREKVQLITKLMELVSESERLRMKKLEELSKNID  164



>ref|XP_010479518.1| PREDICTED: ankyrin repeat domain-containing protein 30A-like 
[Camelina sativa]
Length=179

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEKRK E++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  46   MSRTALSAFRAKEEEIEKRKTEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  105

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEALEAF +KN EK QL + L+ELV ESEK R+
Sbjct  106  LVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNDKNREKVQLITKLMELVGESEKMRM  165

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  166  KKLEELSKNIDSIH  179



>ref|XP_004249454.1| PREDICTED: uncharacterized protein LOC101262159 [Solanum lycopersicum]
Length=170

 Score =   140 bits (354),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEKRKMEVK +V++QL R E++T+ LA I EELE L DPM+K+V 
Sbjct  37   MSRSALSTFKAKEEEIEKRKMEVKERVQAQLGRVEEETRRLAIIREELEALADPMKKDVQ  96

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRK+ID VN+ELK L Q CQKKEKEYKEALEAF EK+ EK QL S L+ELV ESEK RL
Sbjct  97   TVRKRIDAVNKELKPLGQTCQKKEKEYKEALEAFNEKHKEKVQLISRLMELVGESEKMRL  156

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  157  KKLEELSKSIE  167



>ref|XP_010552833.1| PREDICTED: uncharacterized protein LOC104823107 [Tarenaya hassleriana]
Length=163

 Score =   140 bits (353),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = +3

Query  27   SITSVGSGGRLSMeeneeee-ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTK  203
            + ++V + G++ ++E+ +EE I R A++ FQAREEEIE++KM VK KVE +L  AE+ T+
Sbjct  9    TASAVATNGKIPIDESTDEEEIWRAAMSKFQAREEEIERKKMAVKEKVEQRLGLAEEATR  68

Query  204  HLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNN  383
             LA   EELE++ DPMRKEVG +RKKIDT NRE+KSL Q CQKKEKEYKE +EAF EKN 
Sbjct  69   CLAQTLEELEIMGDPMRKEVGAIRKKIDTANREIKSLAQNCQKKEKEYKETVEAFNEKNK  128

Query  384  EKTQLTSTLIELVNESEKFRLGKLEELSKIV  476
            EK  L S L+EL+ ESE+ R+ KLEE++K V
Sbjct  129  EKAHLISVLMELLTESERLRMKKLEEINKTV  159



>ref|XP_010426924.1| PREDICTED: putative uncharacterized protein DDB_G0287113 isoform 
X2 [Camelina sativa]
Length=170

 Score =   140 bits (354),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R EQ+T+ LA+I EELE + DPMRKEV 
Sbjct  38   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEQETRRLANIREELESMADPMRKEVN  97

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK RL
Sbjct  98   WVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRL  157

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  158  KKLEELSKSID  168



>ref|XP_006403750.1| hypothetical protein EUTSA_v10010775mg [Eutrema salsugineum]
 gb|ESQ45203.1| hypothetical protein EUTSA_v10010775mg [Eutrema salsugineum]
Length=161

 Score =   140 bits (352),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LAHI EELE + DPMRKEV 
Sbjct  29   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLAHIREELETMADPMRKEVS  88

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK RL
Sbjct  89   WVRKKIDSVNKELKPLGATVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRL  148

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  149  KKLEELSKSIE  159



>ref|XP_010045250.1| PREDICTED: uncharacterized protein LOC104434009 [Eucalyptus grandis]
 gb|KCW87407.1| hypothetical protein EUGRSUZ_B03885 [Eucalyptus grandis]
Length=174

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+ +F+++EEEIE+RK EVK KV++QL R E+ +K LA I +ELE LTDPMRKEVG
Sbjct  41   VSRSALAAFRSKEEEIERRKTEVKEKVQNQLGRVEEASKRLAEILDELEALTDPMRKEVG  100

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VNRELK L   CQKKE+EY+E LEAF EK+ EK QL + L ELV+ESE+ R+
Sbjct  101  IVRKKIDIVNRELKPLGLGCQKKEREYREVLEAFNEKSKEKAQLVAKLTELVSESERSRM  160

Query  447  GKLEELSKIVD  479
             KLEELSK V+
Sbjct  161  KKLEELSKNVE  171



>ref|XP_006339121.1| PREDICTED: RAB6-interacting golgin-like [Solanum tuberosum]
Length=170

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEKRKMEV+ +V++QL R E++T+ LA I EELE L DPM+K+V 
Sbjct  37   MSRSALSTFKAKEEEIEKRKMEVRERVQAQLGRVEEETRRLAIIREELETLADPMKKDVS  96

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRK+ID VN+ELK L Q CQKKEKEYKEALEAF EK+ EK QL S L+ELV ESEK RL
Sbjct  97   TVRKRIDVVNKELKPLGQTCQKKEKEYKEALEAFNEKHKEKVQLISRLMELVGESEKMRL  156

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  157  KKLEELSKSIE  167



>emb|CDY13331.1| BnaC06g14260D [Brassica napus]
Length=162

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LA+I EELE + DPMRKEV 
Sbjct  30   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLANIREELETMADPMRKEVS  89

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK RL
Sbjct  90   LVRKKIDSVNKELKPLGATVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRL  149

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  150  KKLEELSKSIE  160



>ref|XP_010426919.1| PREDICTED: uncharacterized protein LOC104711848 [Camelina sativa]
Length=165

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  42   GSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIW  221
             + G+L MEENE+EEI ++A++ FQAREEEIE++KM VK KV+ +L  AE+ T+ L    
Sbjct  17   NTNGKLPMEENEDEEIWKVAVSRFQAREEEIERKKMTVKEKVQQRLGFAEEATRCLTQTL  76

Query  222  EELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLT  401
            EELE++ DPMRKEVGMVRKKID  NR++KSL Q+CQKKEKEYKE LEAF EKN EK  L 
Sbjct  77   EELEIMGDPMRKEVGMVRKKIDLANRDIKSLAQSCQKKEKEYKETLEAFNEKNKEKAHLV  136

Query  402  STLIELVNESEKFRLGKLEELSKIV  476
            S L+EL+ ESE+ R+ KLEE++K V
Sbjct  137  SMLMELLAESERLRIKKLEEINKTV  161



>ref|XP_006291948.1| hypothetical protein CARUB_v10018137mg [Capsella rubella]
 gb|EOA24846.1| hypothetical protein CARUB_v10018137mg [Capsella rubella]
Length=165

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LA+I EELE + DPMRKEV 
Sbjct  33   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLANIREELESMADPMRKEVN  92

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID+VN+ELK L    QKKE+EYKEAL++F EKN EK QL + L+ELV ESEK RL
Sbjct  93   WVRKKIDSVNKELKPLGSTVQKKEREYKEALDSFNEKNREKVQLITKLMELVGESEKLRL  152

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  153  KKLEELSKSID  163



>ref|XP_010553338.1| PREDICTED: uncharacterized protein LOC104823463 isoform X2 [Tarenaya 
hassleriana]
Length=185

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +3

Query  24   MSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTK  203
            M + + GS    S    E+EE+ R A+++F+A+E+EIEK+KMEV+ +V++QL R E++T+
Sbjct  32   MVLHTSGSLSFSSQMSREDEEMARSALSAFRAKEDEIEKKKMEVRERVQAQLGRVEEETR  91

Query  204  HLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNN  383
             LA I EELE L DPMRKEV MVRKKIDTVN+ELK L    QKKE+EYKE+L++F EKN 
Sbjct  92   RLALIREELESLADPMRKEVSMVRKKIDTVNKELKPLGATVQKKEREYKESLDSFNEKNR  151

Query  384  EKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
            EK QL + L+ELV ESEK RL KLEELSK ++
Sbjct  152  EKVQLITKLMELVGESEKLRLKKLEELSKSIE  183



>ref|XP_006409782.1| hypothetical protein EUTSA_v10017323mg [Eutrema salsugineum]
 gb|ESQ51235.1| hypothetical protein EUTSA_v10017323mg [Eutrema salsugineum]
Length=169

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+E+EIE+RKMEVK +V+++L  AE+ T+ LA I EELE LTDPMRKE+ 
Sbjct  35   LSRSALALFKAKEDEIERRKMEVKDRVKTKLGLAEEATRRLAEIREELEALTDPMRKEIS  94

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             +RK++D +NRELK L Q+CQ+KEKE+KEALEA+ EKN EK    S L+ELV ESEK R+
Sbjct  95   ALRKRVDAINRELKPLGQSCQRKEKEFKEALEAYNEKNKEKAMFVSKLVELVTESEKLRM  154

Query  447  GKLEELSKIVDPTHR  491
             KLEELSK +D + R
Sbjct  155  SKLEELSKSIDISLR  169



>ref|XP_006291927.1| hypothetical protein CARUB_v10018112mg, partial [Capsella rubella]
 gb|EOA24825.1| hypothetical protein CARUB_v10018112mg, partial [Capsella rubella]
Length=176

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +3

Query  45   SGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWE  224
            + G+L MEENE+EEI ++A++ FQAREEEIEK+K+ VK KV+ +L  AE+ T+ L    E
Sbjct  29   TNGKLPMEENEDEEIWKVAVSRFQAREEEIEKKKLSVKEKVQQRLGFAEEATRCLTQTLE  88

Query  225  ELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTS  404
            ELE++ DPMRKEVGMVRKKID  NR++KSL Q+CQKKEKEYKE LEAF EKN EK  L S
Sbjct  89   ELEIMGDPMRKEVGMVRKKIDLANRDIKSLAQSCQKKEKEYKETLEAFNEKNKEKAHLVS  148

Query  405  TLIELVNESEKFRLGKLEELSKIV  476
             L+EL+ ESE+ R+ KLEE++K V
Sbjct  149  MLMELLAESERLRIKKLEEINKTV  172



>ref|XP_009125242.1| PREDICTED: inner centromere protein-like isoform X2 [Brassica 
rapa]
Length=158

 Score =   138 bits (348),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LA+I EELE + DPMRKEV 
Sbjct  26   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLANIREELENMADPMRKEVS  85

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK RL
Sbjct  86   LVRKKIDSVNKELKPLGATVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRL  145

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  146  KKLEELSKSIE  156



>ref|XP_010036719.1| PREDICTED: ankyrin repeat domain-containing protein 30A-like 
[Eucalyptus grandis]
 gb|KCW48351.1| hypothetical protein EUGRSUZ_K02066 [Eucalyptus grandis]
Length=178

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIE++KMEV+ +V + L R E++TK LA I EELE L DPMRK+V 
Sbjct  45   MSRSALSTFRAKEEEIERKKMEVRERVLNHLGRVEEETKRLATIREELEALADPMRKDVS  104

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKIDTVN+ELK+L  +CQKKE+EYKEALEAF +KN EK QL + L+ELV+ESEK R+
Sbjct  105  LVRKKIDTVNKELKTLGHSCQKKEREYKEALEAFNDKNKEKVQLITKLMELVSESEKLRM  164

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  165  KKLEELSKNIE  175



>emb|CDY00898.1| BnaC05g43020D [Brassica napus]
Length=178

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++ +A+EEEIEK KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  45   MSRTALSAIRAKEEEIEKNKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  104

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  105  LVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITKLMELVGESEKVRM  164

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  165  KKLEELSKNIDSIH  178



>ref|XP_009365354.1| PREDICTED: ankyrin repeat domain-containing protein 30A-like 
[Pyrus x bretschneideri]
Length=173

 Score =   138 bits (348),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIE++KMEV+ KV++QL R E++TK LA I EELE L+DPMRK+V 
Sbjct  40   MSRSALSTFRAKEEEIERKKMEVREKVQAQLGRVEEETKRLATIREELEGLSDPMRKDVS  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID +N+ELK L   CQKKEKEY++ALEAF EKN EK QL + L+ELV+ESEK R+
Sbjct  100  QVRKKIDAINKELKPLGHTCQKKEKEYRDALEAFNEKNREKVQLITKLMELVSESEKTRM  159

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  160  KKLEELSKNIE  170



>gb|EYU36092.1| hypothetical protein MIMGU_mgv1a015310mg [Erythranthe guttata]
Length=161

 Score =   137 bits (346),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +T+M + +F+A+EE+IEK+K EV+ KV SQL R E++TK L+ I EELE + DPMRKEV 
Sbjct  28   MTKMTLAAFRAKEEDIEKKKAEVREKVHSQLGRVEEETKRLSEIREELEAMNDPMRKEVA  87

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID +NR+LK L  +C KKEKEYKEALE+F EKN EK QL S L+ELV ESEK RL
Sbjct  88   IVRKKIDLLNRDLKPLGLSCHKKEKEYKEALESFNEKNKEKGQLISKLVELVTESEKLRL  147

Query  447  GKLEELSKIVD  479
             KLEEL K +D
Sbjct  148  KKLEELCKNID  158



>ref|XP_010510736.1| PREDICTED: uncharacterized protein LOC104786950 [Camelina sativa]
Length=174

 Score =   138 bits (347),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 120/159 (75%), Gaps = 5/159 (3%)
 Frame = +3

Query  30   ITSVGSGGRLS-----MeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            I  + S G +S     M +++EEE+++ A   F+A+E+EIE+RKMEVK +V+++L  AE+
Sbjct  16   IQRIKSSGNMSINGSPMIDDKEEELSQSAFALFKAKEDEIERRKMEVKDRVQTKLGLAEE  75

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
             T+ LA I EELE LTDPMRKE+  +RK++DT+NRELK L Q+CQ+KE+E+KEALEA+ E
Sbjct  76   ATRKLAEIREELEALTDPMRKEISAIRKRVDTINRELKPLGQSCQRKEREFKEALEAYNE  135

Query  375  KNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTHR  491
            KN EK+   S L+ELV ESEK R+ KLEELSK ++ + R
Sbjct  136  KNKEKSTFVSKLVELVTESEKLRMTKLEELSKSIEVSLR  174



>ref|XP_006295096.1| hypothetical protein CARUB_v10024170mg [Capsella rubella]
 gb|EOA27994.1| hypothetical protein CARUB_v10024170mg [Capsella rubella]
Length=175

 Score =   138 bits (347),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = +3

Query  36   SVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAH  215
            ++   G   M +++EEE+++ A   F+A+E+EIE+RKMEVK +V+++L  AE+ T+ LA 
Sbjct  24   NISINGSSPMVDDKEEELSQSAFALFKAKEDEIERRKMEVKDRVQTKLGLAEEATRRLAE  83

Query  216  IWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQ  395
            I EELE LTDPMRKE+  +RK++DT+NRELK L Q+CQ+KE+E+KEALEA+ EKN EK+ 
Sbjct  84   IREELEALTDPMRKEISAIRKRVDTINRELKPLGQSCQRKEREFKEALEAYNEKNKEKSM  143

Query  396  LTSTLIELVNESEKFRLGKLEELSKIVDPTHR  491
              S L+ELV ESEK R+ KLEELSK ++ + R
Sbjct  144  FVSKLVELVTESEKLRMTKLEELSKSIEVSLR  175



>ref|XP_010912242.1| PREDICTED: PERQ amino acid-rich with GYF domain-containing protein 
2-like [Elaeis guineensis]
Length=171

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IEK+KMEV+ KV +QL R E++TK LA I EELE + DP RKEV  
Sbjct  39   SRSALSEFRAKEEQIEKKKMEVREKVFAQLGRVEEETKRLAEIREELEAMADPKRKEVAA  98

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            VRKKID VNR+LK L Q+C KKEKEYKEALEAF EKN EK QL + L+ELV+ESE+ R+ 
Sbjct  99   VRKKIDAVNRDLKPLGQSCLKKEKEYKEALEAFNEKNKEKAQLINKLMELVSESERLRMK  158

Query  450  KLEELSKIVD  479
            KLEELSK +D
Sbjct  159  KLEELSKTID  168



>ref|XP_006851564.1| hypothetical protein AMTR_s00040p00190890 [Amborella trichopoda]
 gb|ERN13145.1| hypothetical protein AMTR_s00040p00190890 [Amborella trichopoda]
Length=167

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
             R A+ +F+A+EE+IE++K+EV+ KV +QL R E++TK LA I EELE L DPMRK+V  
Sbjct  35   ARSALIAFRAKEEQIERKKIEVREKVHAQLGRVEEETKRLAEIREELEALADPMRKDVAG  94

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RK+ID VN+ELK L  +CQ+KE+EY+EA+EAF E+N EK+QL + L+ELV+ESE+ R+ 
Sbjct  95   LRKRIDAVNKELKPLGYSCQRKEREYREAVEAFNERNKEKSQLIAKLMELVSESERLRMK  154

Query  450  KLEELSKIVDPTH  488
            KLEELSK +D  H
Sbjct  155  KLEELSKHIDSLH  167



>ref|XP_010504044.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-79 specific-like 
isoform X2 [Camelina sativa]
Length=261

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R EQ+T+ LA+I EELE + DPMRKEV 
Sbjct  129  MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEQETRRLANIREELESMADPMRKEVN  188

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK RL
Sbjct  189  WVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRL  248

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  249  KKLEELSKSID  259



>ref|XP_009140819.1| PREDICTED: uncharacterized protein LOC103864798 [Brassica rapa]
 emb|CDY30533.1| BnaA04g16000D [Brassica napus]
Length=174

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 117/155 (75%), Gaps = 5/155 (3%)
 Frame = +3

Query  30   ITSVGSGGRLS-----MeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            I  + S G +S     M +++EE+ +R ++  F+A+E+EIE+RKMEV+ +V+++L  AE+
Sbjct  16   IQRIKSSGTISINGSPMNDDKEEDFSRSSLALFKAKEDEIERRKMEVRDRVQTKLGLAEE  75

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
             T+ LA I EELE LTDPMRKE+  +RK++D +NRELK L Q+CQKKEKE+KEALEA+ E
Sbjct  76   ATRRLAEIREELESLTDPMRKEISAIRKRVDAINRELKPLGQSCQKKEKEFKEALEAYNE  135

Query  375  KNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
            KN EK    S L+ELV ESEK R+ KLE+LSKI+D
Sbjct  136  KNKEKAMFVSKLVELVTESEKLRMTKLEKLSKIID  170



>ref|XP_010417923.1| PREDICTED: uncharacterized protein LOC104703587 [Camelina sativa]
 ref|XP_010473166.1| PREDICTED: uncharacterized protein LOC104752670 [Camelina sativa]
Length=174

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 120/159 (75%), Gaps = 5/159 (3%)
 Frame = +3

Query  30   ITSVGSGGRLS-----MeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            I  + S G +S     M +++EEE+++ A   F+A+E+EIE+RKMEVK +V+++L  AE+
Sbjct  16   IQRIKSSGNMSINGSPMIDDKEEELSQSAFALFKAKEDEIERRKMEVKDRVQTKLGLAEE  75

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
             T+ LA I EELE LTDPMRKE+  +RK++DT+NRELK L Q+CQ+KE+E+KEALEA+ E
Sbjct  76   ATRRLAEIREELEALTDPMRKEISAIRKRVDTINRELKPLGQSCQRKEREFKEALEAYNE  135

Query  375  KNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTHR  491
            KN EK+   S L+ELV ESEK R+ KLEELSK ++ + R
Sbjct  136  KNKEKSIFVSKLVELVTESEKLRMTKLEELSKSIEVSLR  174



>ref|XP_010516863.1| PREDICTED: uncharacterized protein LOC104792419 isoform X2 [Camelina 
sativa]
Length=184

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  52   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVEQETKRLSSIREELESMADPMRKEVS  111

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK R+
Sbjct  112  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRM  171

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  172  IKLEELSKSIE  182



>ref|XP_006295030.1| hypothetical protein CARUB_v10024099mg [Capsella rubella]
 gb|EOA27928.1| hypothetical protein CARUB_v10024099mg [Capsella rubella]
Length=193

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+EEEIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  61   MTRSALSAFRAKEEEIEKRRMEVRERIQAQLGRVEQETKRLSTIREELESMADPMRKEVS  120

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK R+
Sbjct  121  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRM  180

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  181  IKLEELSKSIE  191



>emb|CDY13335.1| BnaC06g14220D [Brassica napus]
Length=165

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = +3

Query  48   GGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEE  227
             G+L MEENEEEE+ ++ ++ FQAREEEIE++KM VK KV+ +L  AE+ T+ L    EE
Sbjct  19   NGKLPMEENEEEEMWKVTVSRFQAREEEIERKKMTVKEKVQQRLGFAEEATRCLTQTLEE  78

Query  228  LEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTST  407
            LE++ DPMRKEVGMVRKKID  NR++KSL Q+CQKKEKEYKE LEAF EKN EKT L S 
Sbjct  79   LEIMGDPMRKEVGMVRKKIDMANRDIKSLAQSCQKKEKEYKETLEAFNEKNKEKTHLVSM  138

Query  408  LIELVNESEKFRLGKLEELSKIV  476
            L+EL+ ESE+ R+ KLEE++K V
Sbjct  139  LMELLAESERLRMKKLEEINKTV  161



>gb|KFK34539.1| hypothetical protein AALP_AA5G159300 [Arabis alpina]
Length=173

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 116/156 (74%), Gaps = 6/156 (4%)
 Frame = +3

Query  9    SQKMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRA  188
            +Q  MMS++      R      E+EE+ R A+++F+A+E+EI+KRKMEV+ +V +QL R 
Sbjct  13   AQNQMMSLSFSSQMSR------EDEEMARSALSAFRAKEDEIDKRKMEVRERVRAQLGRV  66

Query  189  EQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaF  368
            E++T+ LA+I EELE + DPMRKEV MVRKKID+VN+ELK L    QKKE+EYKEAL+ F
Sbjct  67   EEETRRLANIREELESMADPMRKEVSMVRKKIDSVNKELKPLGATVQKKEREYKEALDTF  126

Query  369  QEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIV  476
             EKN EK QL + L+ELV ESEK RL KLEELS+ +
Sbjct  127  NEKNREKVQLITKLMELVGESEKLRLKKLEELSESI  162



>ref|NP_850688.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB86896.1| putative protein [Arabidopsis thaliana]
 gb|AAM97095.1| putative protein [Arabidopsis thaliana]
 gb|AEE79011.1| uncharacterized protein AT3G52920 [Arabidopsis thaliana]
Length=177

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LA I EELE + DPMRKEV 
Sbjct  31   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLASIREELETMADPMRKEVN  90

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK RL
Sbjct  91   WVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRL  150

Query  447  GKLEELSKIVD  479
             KL+ELS+ +D
Sbjct  151  KKLDELSRSID  161



>ref|XP_008783982.1| PREDICTED: uncharacterized protein PF11_0207-like [Phoenix dactylifera]
Length=169

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE++KMEV+ KV +QL + E++TK LA I EELE + DP RKEV  
Sbjct  37   SRSALSEFRAKEEQIERKKMEVREKVFAQLGKVEEETKRLAEIREELEAMADPRRKEVAA  96

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            VRKKID VNRELK L Q+C KKEKEYKEALEAF EKN EK QL + L+ELV+ESE+ R+ 
Sbjct  97   VRKKIDAVNRELKPLGQSCLKKEKEYKEALEAFNEKNKEKAQLINKLMELVSESERLRMK  156

Query  450  KLEELSKIVD  479
            KLEELSK +D
Sbjct  157  KLEELSKTID  166



>ref|XP_010505188.1| PREDICTED: uncharacterized protein LOC104782062 isoform X2 [Camelina 
sativa]
Length=182

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  50   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVEQETKRLSTIREELESMADPMRKEVS  109

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK R+
Sbjct  110  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRM  169

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  170  IKLEELSKSIE  180



>ref|NP_001031494.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09251.1| uncharacterized protein AT2G36410 [Arabidopsis thaliana]
Length=192

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  60   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVEQETKRLSTIREELESMADPMRKEVS  119

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKK  EYKEAL+ F EKN EK QL + L+ELV ESEK R+
Sbjct  120  VVRKKIDSVNKELKPLGSTVQKKVMEYKEALDTFNEKNREKVQLITKLMELVGESEKLRM  179

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  180  IKLEELSKSIE  190



>ref|NP_850265.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAF00267.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09249.1| uncharacterized protein AT2G36410 [Arabidopsis thaliana]
Length=192

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  60   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVEQETKRLSTIREELESMADPMRKEVS  119

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK R+
Sbjct  120  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRM  179

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  180  IKLEELSKSIE  190



>ref|XP_009125238.1| PREDICTED: uncharacterized protein LOC103850269 [Brassica rapa]
 emb|CDX67543.1| BnaA07g15830D [Brassica napus]
Length=165

 Score =   135 bits (341),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  42   GSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIW  221
             + G+L +EENEEEE+ ++ ++ FQAREEEIE++KM VK KV+ +L  AE+ T+ L    
Sbjct  17   NTNGKLPVEENEEEEMWKVTVSRFQAREEEIERKKMTVKEKVQQRLGFAEEATRCLTQTL  76

Query  222  EELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLT  401
            EELE++ DPMRKEVGMVRKKID  NR++KSL Q+CQKKEKEYKE LEAF EKN EKT L 
Sbjct  77   EELEIMGDPMRKEVGMVRKKIDMANRDIKSLAQSCQKKEKEYKETLEAFNEKNKEKTHLV  136

Query  402  STLIELVNESEKFRLGKLEELSKIV  476
            S L+EL+ ESE+ R+ KLEE++K V
Sbjct  137  SMLMELLAESERLRMKKLEEINKTV  161



>ref|XP_010515770.1| PREDICTED: uncharacterized protein LOC104791551 isoform X1 [Camelina 
sativa]
Length=152

 Score =   135 bits (340),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R EQ+T+ LA+I EELE + DPMRKEV 
Sbjct  17   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEQETRRLANIREELESMADPMRKEVN  76

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  77   WVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMGQLVGESEK  136

Query  438  FRLGKLEELSKIVD  479
             RL KLEELSK +D
Sbjct  137  LRLKKLEELSKSID  150



>ref|XP_009133083.1| PREDICTED: uncharacterized protein LOC103857623 isoform X2 [Brassica 
rapa]
Length=176

 Score =   135 bits (341),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EI+KR+MEV+ ++++QL R E++T+ L+ I EELE + DPMRKEV 
Sbjct  44   MTRSALSAFKAKEDEIDKRRMEVRERIQAQLGRVEEETRRLSTIREELESMADPMRKEVS  103

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            MVRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK R+
Sbjct  104  MVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRM  163

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  164  KKLEELSKSIE  174



>ref|XP_006410818.1| hypothetical protein EUTSA_v10017290mg [Eutrema salsugineum]
 gb|ESQ52271.1| hypothetical protein EUTSA_v10017290mg [Eutrema salsugineum]
Length=180

 Score =   135 bits (341),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R E++TK L+ I EELE + DPMRKEV 
Sbjct  48   MTRSALSAFRAKEDEIEKRRMEVRQRIQAQLGRVEEETKRLSTIREELESMADPMRKEVS  107

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK R+
Sbjct  108  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRM  167

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  168  LKLEELSKSIE  178



>gb|KHG12092.1| RAB6-interacting golgin [Gossypium arboreum]
Length=175

 Score =   135 bits (341),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +3

Query  99   AITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRK  278
            A+  F+A+EEEIE++KMEV+ +V++ + R E+ T+ LA I EEL+ L DPMRK+V ++RK
Sbjct  46   ALALFRAKEEEIERKKMEVRDRVQAYMGRVEEATRRLADIREELDDLVDPMRKDVAILRK  105

Query  279  KIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLGKLE  458
            +IDT+NRE+K L Q CQKKEKEYKEALEAF +KN EK QL S L+ELV+ESEK R+ KLE
Sbjct  106  RIDTINREMKPLGQTCQKKEKEYKEALEAFNDKNKEKAQLVSKLMELVSESEKLRMKKLE  165

Query  459  ELSKIVDPTH  488
            ELSK ++  H
Sbjct  166  ELSKNIETLH  175



>ref|XP_010426923.1| PREDICTED: uncharacterized protein LOC104711851 isoform X1 [Camelina 
sativa]
Length=173

 Score =   135 bits (340),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R EQ+T+ LA+I EELE + DPMRKEV 
Sbjct  38   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEQETRRLANIREELESMADPMRKEVN  97

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  98   WVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMGQLVGESEK  157

Query  438  FRLGKLEELSKIVD  479
             RL KLEELSK +D
Sbjct  158  LRLKKLEELSKSID  171



>ref|XP_007206014.1| hypothetical protein PRUPE_ppa012383mg [Prunus persica]
 ref|XP_008227278.1| PREDICTED: RAB6-interacting golgin [Prunus mume]
 gb|EMJ07213.1| hypothetical protein PRUPE_ppa012383mg [Prunus persica]
Length=172

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F A+EEEIE++K EVK KV++Q+ R E+ TK LA I EELE LTDPMRKEV 
Sbjct  39   MSRSAVALFLAKEEEIERKKSEVKDKVQAQMGRVEETTKRLAEIQEELEALTDPMRKEVA  98

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRK+ID VN+ELK L Q+CQ+KEKEYKEALEA  EKN EK QL S L ELV ESEK R+
Sbjct  99   NVRKRIDIVNKELKPLGQSCQRKEKEYKEALEALNEKNKEKAQLVSRLKELVGESEKLRM  158

Query  447  GKLEELSKIVD  479
             KLEEL+K V+
Sbjct  159  KKLEELNKHVE  169



>ref|XP_010509474.1| PREDICTED: uncharacterized protein LOC104785883 isoform X2 [Camelina 
sativa]
Length=185

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ + ++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  53   MTRSALSAFRAKEDEIEKRRMEVRERTQAQLGRVEQETKRLSTIREELESMADPMRKEVS  112

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK R+
Sbjct  113  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRM  172

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  173  IKLEELSKSIE  183



>ref|XP_009393830.1| PREDICTED: uncharacterized protein LOC103979414 [Musa acuminata 
subsp. malaccensis]
Length=159

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
             R A++SFQAREEEIE++KMEVK KV +QL R E++ KHLA I  ELE + DP R E   
Sbjct  27   PRSALSSFQAREEEIERKKMEVKEKVFAQLCRVEEEAKHLAMIRGELEAMVDPTRNEAAA  86

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RKKID VNR LK L Q+C +KEKEYKEALEAF EKN EK+QL + L+ELV+ESE+ R+ 
Sbjct  87   LRKKIDAVNRALKPLGQSCLRKEKEYKEALEAFNEKNKEKSQLVAKLMELVSESERLRMR  146

Query  450  KLEELSKIVD  479
            KLEEL+K +D
Sbjct  147  KLEELNKSID  156



>ref|XP_006403751.1| hypothetical protein EUTSA_v10010775mg [Eutrema salsugineum]
 gb|ESQ45204.1| hypothetical protein EUTSA_v10010775mg [Eutrema salsugineum]
Length=164

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LAHI EELE + DPMRKEV 
Sbjct  29   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLAHIREELETMADPMRKEVS  88

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  89   WVRKKIDSVNKELKPLGATVQKKEREYKEALDTFNEKNREKVQLITKLMEMGQLVGESEK  148

Query  438  FRLGKLEELSKIVD  479
             RL KLEELSK ++
Sbjct  149  LRLKKLEELSKSIE  162



>gb|KFK25207.1| hypothetical protein AALP_AA8G081100 [Arabis alpina]
Length=174

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 117/159 (74%), Gaps = 5/159 (3%)
 Frame = +3

Query  30   ITSVGSGGRLSMe-----eneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            I  V S G +SM      ++ EEE++R A+  F+A+E+EIE+RKMEVK KVE++L  AE+
Sbjct  16   IQRVKSSGIISMNGSPMIDDREEELSRSALALFKAKEDEIERRKMEVKNKVETKLGLAEE  75

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
             T+ LA I EELE LTDPMRKE+  +RK++D +NRELK L Q+ Q+KE+E KEALEA+ E
Sbjct  76   ATRRLAEIREELEALTDPMRKEISAIRKRVDAINRELKPLGQSWQRKERELKEALEAYNE  135

Query  375  KNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTHR  491
            KN EK    + L+ELV ESEK R+ KL+ELSKIV+ + R
Sbjct  136  KNKEKAMFVTKLVELVTESEKQRMTKLDELSKIVESSLR  174



>ref|XP_008807487.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-79 specific 
[Phoenix dactylifera]
Length=172

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A+++F+A+EE+IE++K+EV+ KV +QL R E++TK LA I EELE + DP RKEV  
Sbjct  40   SRSAVSAFRAKEEQIERKKVEVRDKVFAQLGRVEEETKRLAEIREELEEMGDPTRKEVAA  99

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RKKID VNRELK L Q+C +KEKEYKEALEAF EKN EK QL + L+ELV+ESE+ R+ 
Sbjct  100  IRKKIDAVNRELKPLGQSCLRKEKEYKEALEAFNEKNKEKAQLINKLMELVSESERLRMK  159

Query  450  KLEELSKIVD  479
            KLEELSK +D
Sbjct  160  KLEELSKTID  169



>ref|XP_010049773.1| PREDICTED: uncharacterized protein LOC104438347 [Eucalyptus grandis]
 gb|KCW89235.1| hypothetical protein EUGRSUZ_A01535 [Eucalyptus grandis]
Length=173

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIE++K+EV+ KV S L R E++TK LA I EELE L+DPMRKEV 
Sbjct  40   MSRSALSTFRAKEEEIERKKLEVREKVMSHLGRVEEETKRLATIREELEALSDPMRKEVA  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VN+ELK L   CQKKE+EYKEALEA+ EKN EK  L + L+ELV ESEK R+
Sbjct  100  LVRKKIDAVNKELKPLGHTCQKKEREYKEALEAYNEKNKEKVLLVNKLMELVGESEKSRM  159

Query  447  GKLEELSKIVD  479
             KLEEL+K ++
Sbjct  160  KKLEELAKSIE  170



>ref|XP_002880971.1| hypothetical protein ARALYDRAFT_481739 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57230.1| hypothetical protein ARALYDRAFT_481739 [Arabidopsis lyrata subsp. 
lyrata]
Length=174

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 118/159 (74%), Gaps = 5/159 (3%)
 Frame = +3

Query  30   ITSVGSGGRLS-----MeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            I  + S G +S     M +++EEE+++ A   F+A+E+EIE+RKMEVK +V+++L  AE+
Sbjct  16   IQRIKSSGNISINGSSMIDDKEEELSQSAFALFKAKEDEIERRKMEVKDRVQTKLGLAEE  75

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
             T+ LA I EELE LTDPMRKE+  +RK++D +NRELK L Q+CQ+KE+E+KEALEA+ E
Sbjct  76   ATRRLAEIREELEALTDPMRKEISAIRKRVDAINRELKPLGQSCQRKEREFKEALEAYNE  135

Query  375  KNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTHR  491
            KN EK    S L+ELV ESEK R+ KLEELSK ++ + R
Sbjct  136  KNKEKAIFVSKLVELVTESEKLRMTKLEELSKSIEISLR  174



>ref|XP_006471397.1| PREDICTED: RAB6-interacting golgin-like [Citrus sinensis]
Length=169

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE++K+EV+ KV +QL R E+ TK L+ I EELE L DP+RK+V 
Sbjct  36   MSRSALALFRAKEEEIERKKVEVRDKVFAQLGRVEEATKRLSEIREELETLADPLRKDVS  95

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKIDT+N+ELK L  +CQ+KE+EYKEALEAF +KN EK QL S L+ELV+ESEK R+
Sbjct  96   VVRKKIDTINKELKPLGLSCQRKEREYKEALEAFNDKNKEKAQLVSKLMELVSESEKMRM  155

Query  447  GKLEELSKIVD  479
             KLEELSK V+
Sbjct  156  KKLEELSKNVE  166



>gb|KHG17413.1| RAB6-interacting golgin [Gossypium arboreum]
Length=216

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + + A+  F+A+EEEIE++KMEV+ KV++ + R E+ T+ L+ I EEL+ L DPMRK++ 
Sbjct  83   MAKSALALFRAKEEEIERKKMEVRDKVQAYMGRVEEATRRLSDIREELDALIDPMRKDIA  142

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             +RKKIDTVNRELK L Q+CQKKE+EYKEALEAF +KN EKTQL S L+ELV+ESE+ R+
Sbjct  143  FLRKKIDTVNRELKPLGQSCQKKEREYKEALEAFNDKNKEKTQLVSKLMELVSESERLRM  202

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  203  KKLEELSKSIE  213



>ref|NP_180342.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC73026.1| unknown protein [Arabidopsis thaliana]
 gb|AAS99669.1| At2g27740 [Arabidopsis thaliana]
 gb|AAT41807.1| At2g27740 [Arabidopsis thaliana]
 dbj|BAF00776.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08037.1| uncharacterized protein AT2G27740 [Arabidopsis thaliana]
Length=174

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 116/159 (73%), Gaps = 5/159 (3%)
 Frame = +3

Query  30   ITSVGSGGRLSMe-----eneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQ  194
            I  + S G +SM      + +EEE+++ A   F+A+E+EIE+RKMEVK +V+ +L  AE+
Sbjct  16   IQRIKSSGNISMNGSPMIDEKEEELSQSAFALFKAKEDEIERRKMEVKDRVQKKLGLAEE  75

Query  195  QTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQE  374
             T+ LA I EELE LTDPMRKE+  +RK++D +NRELK L Q+CQ+KE+E+KEALEA+ E
Sbjct  76   ATRRLAEIREELEALTDPMRKEISAIRKRVDAINRELKPLGQSCQRKEREFKEALEAYNE  135

Query  375  KNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTHR  491
            KN EK    S L+ELV ESEK R+ KLEELSK ++ + R
Sbjct  136  KNKEKAIFVSKLVELVTESEKLRMTKLEELSKSIEISLR  174



>ref|XP_006291949.1| hypothetical protein CARUB_v10018137mg [Capsella rubella]
 gb|EOA24847.1| hypothetical protein CARUB_v10018137mg [Capsella rubella]
Length=168

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LA+I EELE + DPMRKEV 
Sbjct  33   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLANIREELESMADPMRKEVN  92

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
             VRKKID+VN+ELK L    QKKE+EYKEAL++F EKN EK QL + L+E   LV ESEK
Sbjct  93   WVRKKIDSVNKELKPLGSTVQKKEREYKEALDSFNEKNREKVQLITKLMEMGQLVGESEK  152

Query  438  FRLGKLEELSKIVD  479
             RL KLEELSK +D
Sbjct  153  LRLKKLEELSKSID  166



>ref|XP_010553337.1| PREDICTED: uncharacterized protein LOC104823463 isoform X1 [Tarenaya 
hassleriana]
Length=188

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 116/155 (75%), Gaps = 3/155 (2%)
 Frame = +3

Query  24   MSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTK  203
            M + + GS    S    E+EE+ R A+++F+A+E+EIEK+KMEV+ +V++QL R E++T+
Sbjct  32   MVLHTSGSLSFSSQMSREDEEMARSALSAFRAKEDEIEKKKMEVRERVQAQLGRVEEETR  91

Query  204  HLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNN  383
             LA I EELE L DPMRKEV MVRKKIDTVN+ELK L    QKKE+EYKE+L++F EKN 
Sbjct  92   RLALIREELESLADPMRKEVSMVRKKIDTVNKELKPLGATVQKKEREYKESLDSFNEKNR  151

Query  384  EKTQLTSTLIE---LVNESEKFRLGKLEELSKIVD  479
            EK QL + L+E   LV ESEK RL KLEELSK ++
Sbjct  152  EKVQLITKLMEMEQLVGESEKLRLKKLEELSKSIE  186



>ref|XP_009103619.1| PREDICTED: uncharacterized protein LOC103829683 [Brassica rapa]
Length=169

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  ++ +E+EIE+RKMEV+ +V+ +L  AE+ T+ LA I EELE LTDPMRKEV 
Sbjct  35   LSRSALALYKEKEDEIERRKMEVRDRVQKKLGLAEEATRRLAEIREELEALTDPMRKEVS  94

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             +RK++D +NRELK L Q+CQ+KE+E+KEALEA+ EKN EK    S L+ELV ESEK R+
Sbjct  95   AIRKRVDAINRELKPLGQSCQRKEREFKEALEAYNEKNKEKAMFVSKLVELVTESEKLRM  154

Query  447  GKLEELSKIVDPTHR  491
             KL+ELSK +D + R
Sbjct  155  TKLDELSKSIDVSLR  169



>gb|KDO51356.1| hypothetical protein CISIN_1g030894mg [Citrus sinensis]
Length=169

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE++K+EV+ KV +QL R E+ TK L+ I EELE L DP+RK+V 
Sbjct  36   MSRSALALFRAKEEEIERKKVEVRDKVFAQLGRVEEATKRLSEIREELETLADPLRKDVS  95

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKIDT+N+ELK L   CQ+KE+EYKEALEAF +KN EK QL S L+ELV+ESEK R+
Sbjct  96   VVRKKIDTLNKELKPLGLTCQRKEREYKEALEAFNDKNKEKAQLVSKLMELVSESEKMRM  155

Query  447  GKLEELSKIVD  479
             KLEELSK V+
Sbjct  156  KKLEELSKNVE  166



>ref|XP_009364862.1| PREDICTED: centlein [Pyrus x bretschneideri]
Length=172

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE++K+EVK KV++QL R E+ TK L+ I EELE L DPMRKEV 
Sbjct  39   MSRSALALFKAKEEEIERKKLEVKDKVQAQLGRVEEATKRLSEIQEELETLIDPMRKEVA  98

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            ++RK+ID +N+ELK L Q+CQ+KEKEYKEALEA  EK+ EK+QL S L+ELV ESE+ R+
Sbjct  99   IIRKRIDIINKELKPLGQSCQRKEKEYKEALEALNEKSREKSQLVSKLMELVGESERMRI  158

Query  447  GKLEELSKIVD  479
             KLEEL+K V+
Sbjct  159  KKLEELNKHVE  169



>ref|XP_010558988.1| PREDICTED: uncharacterized protein LOC104827507 isoform X2 [Tarenaya 
hassleriana]
Length=173

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A++++  +E+EIE++KMEV+ +V++QL R E++T+ LA I EELE L DPMRKEV 
Sbjct  41   MTRAALSAYTEKEDEIERKKMEVRERVQAQLGRVEEETRRLALIREELESLADPMRKEVS  100

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKIDT+N+ELK L    QKKE+EYKEAL+AF EKN EK QL + L+ELV ESEK RL
Sbjct  101  VVRKKIDTMNKELKPLGATVQKKEREYKEALDAFNEKNREKAQLITKLMELVGESEKLRL  160

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  161  KKLEELSKSIE  171



>emb|CDX78131.1| BnaA09g33260D [Brassica napus]
Length=1010

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  33    TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
             ++V + G+L MEENE+EEI ++A++ FQAREEEIE++KM VK KV+ +L  AE+ T+ L 
Sbjct  859   SAVNTNGKLPMEENEDEEIWKVAVSRFQAREEEIERKKMTVKEKVQQRLGFAEEATRCLT  918

Query  213   HIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKT  392
                EELE++ DPMRKEVGMVRKKID  NR++KSL Q+CQKKEKEYKE LEAF EKN EKT
Sbjct  919   QTLEELEIMGDPMRKEVGMVRKKIDMANRDIKSLAQSCQKKEKEYKETLEAFNEKNKEKT  978

Query  393   QLTSTLIELVNESEKFRLGKLEELSKIV  476
              L S L+EL+ ESE+ R+ KLEE++K V
Sbjct  979   HLVSMLMELLAESERVRMKKLEEINKTV  1006



>ref|XP_009125240.1| PREDICTED: uncharacterized protein LOC103850271 isoform X1 [Brassica 
rapa]
Length=161

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LA+I EELE + DPMRKEV 
Sbjct  26   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLANIREELENMADPMRKEVS  85

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  86   LVRKKIDSVNKELKPLGATVQKKEREYKEALDTFNEKNREKVQLITKLMEMGQLVGESEK  145

Query  438  FRLGKLEELSKIVD  479
             RL KLEELSK ++
Sbjct  146  LRLKKLEELSKSIE  159



>ref|XP_008360373.1| PREDICTED: RAB6-interacting golgin [Malus domestica]
 ref|XP_008355222.1| PREDICTED: RAB6-interacting golgin-like [Malus domestica]
Length=172

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE++K+EVK KV++QL R E+ TK L+ I EELE L DPMRKEV 
Sbjct  39   MSRSALALFRAKEEEIERKKLEVKDKVQAQLGRVEEATKRLSEIQEELETLIDPMRKEVA  98

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            ++RK+ID +N+ELK L Q+CQ+KEKEYKEALEA  EK+ EK+QL S L+ELV ESE+ R+
Sbjct  99   IIRKRIDIINKELKPLGQSCQRKEKEYKEALEALNEKSREKSQLVSKLMELVGESERMRI  158

Query  447  GKLEELSKIVD  479
             KLEEL+K V+
Sbjct  159  KKLEELNKHVE  169



>ref|XP_002876174.1| hypothetical protein ARALYDRAFT_323836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52433.1| hypothetical protein ARALYDRAFT_323836 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LA I EELE + DPMRKEV 
Sbjct  17   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLASIREELETMADPMRKEVN  76

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  77   WVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMGQLVGESEK  136

Query  438  FRLGKLEELSKIVD  479
             RL KL+ELSK +D
Sbjct  137  LRLKKLDELSKSID  150



>ref|XP_004291548.1| PREDICTED: uncharacterized protein LOC101315115 [Fragaria vesca 
subsp. vesca]
Length=173

 Score =   133 bits (334),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+ +EEEIE++K+EV+ KV++QL RAE+ ++ L  I EELE LTDPMRKEV 
Sbjct  40   MSRSALAIFRVKEEEIERKKLEVRDKVQAQLGRAEEASRRLTEIREELEALTDPMRKEVA  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             +RK+ID VNR+LK L Q+CQ+KEKEYKEA+EA  EKN EK QL S L+ELV ESE+ R+
Sbjct  100  NIRKRIDLVNRDLKPLGQSCQRKEKEYKEAVEALNEKNREKAQLLSRLMELVGESERLRM  159

Query  447  GKLEELSKIVD  479
             KLEEL+K V+
Sbjct  160  KKLEELNKHVE  170



>emb|CDX71428.1| BnaC04g16630D [Brassica napus]
Length=169

 Score =   133 bits (334),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  ++ +E+EIE+RKMEV+ +V+ +L  AE+ T+ LA I EELE LTDPMRKEV 
Sbjct  35   LSRSALALYKEKEDEIERRKMEVRDRVQKKLGLAEEATRRLAEIREELEALTDPMRKEVS  94

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             +RK++D +NRELK L Q+CQ+KE+E+KEALEA+ EKN EK    S L+ELV ESEK R+
Sbjct  95   AIRKRVDAINRELKPLGQSCQRKEREFKEALEAYNEKNKEKAIFVSKLVELVTESEKLRM  154

Query  447  GKLEELSKIVDPTHR  491
             KL+ELSK +D + R
Sbjct  155  TKLDELSKSIDVSLR  169



>emb|CDX73596.1| BnaC08g24070D [Brassica napus]
Length=1005

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  33    TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
             ++V + G+L MEENEEEEI ++A++ FQAREEEIE++KM VK KV+ +L  AE+ T+ L 
Sbjct  854   SAVNTNGKLPMEENEEEEIWKVAVSRFQAREEEIERKKMTVKEKVQQRLGFAEEATRCLT  913

Query  213   HIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKT  392
                EELE++ DPMRKEVGMVRKKID  NR++KSL Q CQKKEKEYKE LEAF EKN EKT
Sbjct  914   QTLEELEIMGDPMRKEVGMVRKKIDMANRDIKSLAQICQKKEKEYKETLEAFNEKNKEKT  973

Query  393   QLTSTLIELVNESEKFRLGKLEELSKIV  476
              L S L+EL+ ESE+ R+ KLEE++K V
Sbjct  974   HLVSMLMELLAESERVRMKKLEEINKTV  1001



>emb|CDY04510.1| BnaA07g13360D [Brassica napus]
Length=169

 Score =   132 bits (333),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  ++ +E+EIE+RKMEV+ +V+ +L  AE+ T+ LA I EELE LTDPMRKEV 
Sbjct  35   LSRSALALYKEKEDEIERRKMEVRDRVQKKLGLAEEATRRLAEIREELEALTDPMRKEVT  94

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             +RK++D +NRELK L Q+CQ+KE+E+KEALEA+ EKN EK    S L+ELV ESEK R+
Sbjct  95   AIRKRVDAINRELKPLGQSCQRKEREFKEALEAYNEKNKEKAMFVSKLLELVTESEKLRM  154

Query  447  GKLEELSKIVDPTHR  491
             KL+ELSK +D + R
Sbjct  155  TKLDELSKSIDVSLR  169



>ref|XP_007143819.1| hypothetical protein PHAVU_007G104200g [Phaseolus vulgaris]
 gb|ESW15813.1| hypothetical protein PHAVU_007G104200g [Phaseolus vulgaris]
Length=145

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 104/153 (68%), Gaps = 27/153 (18%)
 Frame = +3

Query  21   MMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQT  200
            M ++ S+GS GRLS EE E+EEI+++AI++FQ++EEEIE++KMEV+ KVE QL RAE++T
Sbjct  14   MKNLGSIGSSGRLSAEEYEDEEISKLAISTFQSKEEEIERKKMEVREKVELQLGRAEEET  73

Query  201  KHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKN  380
            + LAHIWEELEVL DP+RKEV MVRKKID  NR+LK L                     N
Sbjct  74   RRLAHIWEELEVLDDPLRKEVAMVRKKIDLANRDLKPLGL-------------------N  114

Query  381  NEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
             +K  LT        ESE+ R+ KL+EL KI++
Sbjct  115  YQKKMLT--------ESERMRMKKLDELCKIIE  139



>gb|KFK36526.1| hypothetical protein AALP_AA4G135800 [Arabis alpina]
Length=178

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL + E++TK L+ I EELE + DPMRKEV 
Sbjct  44   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGKVEEETKRLSTIREELESMADPMRKEVS  103

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEAL++F EKN EK QL + L+ELV ESEK R+
Sbjct  104  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDSFNEKNREKVQLITKLMELVGESEKLRM  163

Query  447  GKLEELS  467
             KLEELS
Sbjct  164  KKLEELS  170



>ref|XP_010504043.1| PREDICTED: uncharacterized protein LOC104781145 isoform X1 [Camelina 
sativa]
Length=264

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R EQ+T+ LA+I EELE + DPMRKEV 
Sbjct  129  MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEQETRRLANIREELESMADPMRKEVN  188

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  189  WVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMGQLVGESEK  248

Query  438  FRLGKLEELSKIVD  479
             RL KLEELSK +D
Sbjct  249  LRLKKLEELSKSID  262



>ref|XP_010940357.1| PREDICTED: DNA repair protein RAD50-like [Elaeis guineensis]
Length=172

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A+++F+A+EE+IE++K+EV+ KV  QL R E++TK LA I EELE + DP  KEV  
Sbjct  40   SRSALSAFRAKEEQIERKKLEVRDKVFVQLGRVEEETKRLAEIREELESMADPTGKEVAA  99

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RKKID VNRELK L Q+C +KEKEYKEALEAF EKN EK QL + L+ELV+ESE+ R+ 
Sbjct  100  IRKKIDAVNRELKPLGQSCLRKEKEYKEALEAFNEKNKEKAQLINKLMELVSESERLRMK  159

Query  450  KLEELSKIVD  479
            KLEELSK VD
Sbjct  160  KLEELSKTVD  169



>ref|XP_006295031.1| hypothetical protein CARUB_v10024099mg [Capsella rubella]
 gb|EOA27929.1| hypothetical protein CARUB_v10024099mg [Capsella rubella]
Length=196

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+EEEIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  61   MTRSALSAFRAKEEEIEKRRMEVRERIQAQLGRVEQETKRLSTIREELESMADPMRKEVS  120

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  121  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMEQLVGESEK  180

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK ++
Sbjct  181  LRMIKLEELSKSIE  194



>gb|KFK34540.1| hypothetical protein AALP_AA5G159300 [Arabis alpina]
Length=176

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 116/159 (73%), Gaps = 9/159 (6%)
 Frame = +3

Query  9    SQKMMMSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRA  188
            +Q  MMS++      R      E+EE+ R A+++F+A+E+EI+KRKMEV+ +V +QL R 
Sbjct  13   AQNQMMSLSFSSQMSR------EDEEMARSALSAFRAKEDEIDKRKMEVRERVRAQLGRV  66

Query  189  EQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaF  368
            E++T+ LA+I EELE + DPMRKEV MVRKKID+VN+ELK L    QKKE+EYKEAL+ F
Sbjct  67   EEETRRLANIREELESMADPMRKEVSMVRKKIDSVNKELKPLGATVQKKEREYKEALDTF  126

Query  369  QEKNNEKTQLTSTLIE---LVNESEKFRLGKLEELSKIV  476
             EKN EK QL + L+E   LV ESEK RL KLEELS+ +
Sbjct  127  NEKNREKVQLITKLMEMSQLVGESEKLRLKKLEELSESI  165



>ref|XP_010516862.1| PREDICTED: uncharacterized protein LOC104792419 isoform X1 [Camelina 
sativa]
Length=187

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  52   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVEQETKRLSSIREELESMADPMRKEVS  111

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  112  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMEQLVGESEK  171

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK ++
Sbjct  172  LRMIKLEELSKSIE  185



>emb|CDX67549.1| BnaA07g15890D [Brassica napus]
Length=159

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LA+I EELE + DPMRKEV 
Sbjct  30   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLANIREELENMADPMRKEVS  89

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  90   LVRKKIDSVNKELKPLGATVQKKEREYKEALDTFNEKNREKVQLITKLMEMGQLVGESEK  149

Query  438  FRLGKLEELS  467
             RL KLEELS
Sbjct  150  LRLKKLEELS  159



>ref|NP_566974.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65792.1| unknown [Arabidopsis thaliana]
 gb|AEE79010.1| uncharacterized protein AT3G52920 [Arabidopsis thaliana]
Length=180

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++T+ LA I EELE + DPMRKEV 
Sbjct  31   MARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLASIREELETMADPMRKEVN  90

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  91   WVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMGQLVGESEK  150

Query  438  FRLGKLEELSKIVD  479
             RL KL+ELS+ +D
Sbjct  151  LRLKKLDELSRSID  164



>gb|EYU19794.1| hypothetical protein MIMGU_mgv1a015500mg [Erythranthe guttata]
Length=156

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 118/148 (80%), Gaps = 4/148 (3%)
 Frame = +3

Query  33   TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
             ++GS GR S  +++E+E ++MA+    A+EEEIEKRK+EV+ +VE QL RA+++ K L 
Sbjct  8    ATLGSSGRFSAGDDDEDETSKMAL----AKEEEIEKRKIEVRQRVECQLTRAQEEAKRLT  63

Query  213  HIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKT  392
             +WEELEV TDPMRKEV  VR+++D  NR+LKSL Q CQKKEKEYKE LEAFQEK+ EK 
Sbjct  64   QVWEELEVFTDPMRKEVTSVRRRLDLANRDLKSLAQICQKKEKEYKEVLEAFQEKSKEKA  123

Query  393  QLTSTLIELVNESEKFRLGKLEELSKIV  476
            QLT+ L+E+VN+SE FR+ KLEELSKI+
Sbjct  124  QLTTALVEMVNQSESFRMRKLEELSKIL  151



>ref|XP_010683857.1| PREDICTED: uncharacterized protein LOC104898467 [Beta vulgaris 
subsp. vulgaris]
Length=179

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ITR A+++F+A+EEEIE++KMEV+ +V+ QL R E++TK LA I EELE + DPMRK+V 
Sbjct  46   ITRSALSNFKAKEEEIERKKMEVRERVQLQLGRVEEETKRLALIREELEGMADPMRKDVS  105

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRK+ID VN+EL+ L    QKKEKEYK+AL+AF EKN EK QL + L+ELV ESE+ R+
Sbjct  106  VVRKRIDVVNKELRPLGTNVQKKEKEYKDALDAFNEKNKEKVQLINKLVELVGESERLRM  165

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  166  KKLEELSKSIE  176



>ref|XP_009141591.1| PREDICTED: uncharacterized protein LOC103865544 isoform X2 [Brassica 
rapa]
Length=187

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+ EV+ ++++QL R E++T+ L+ + EE+E + DPMRKEV 
Sbjct  54   MTRSALSAFRAKEDEIEKRRAEVRERIQAQLGRVEEETRRLSTLREEIESMADPMRKEVS  113

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK R+
Sbjct  114  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRM  173

Query  447  GKLEELSKIVDPT  485
             KLEELSK ++ T
Sbjct  174  KKLEELSKSIEET  186



>ref|XP_010505187.1| PREDICTED: uncharacterized protein LOC104782062 isoform X1 [Camelina 
sativa]
Length=185

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  50   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVEQETKRLSTIREELESMADPMRKEVS  109

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  110  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMEQLVGESEK  169

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK ++
Sbjct  170  LRMIKLEELSKSIE  183



>ref|XP_002879610.1| hypothetical protein ARALYDRAFT_482617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55869.1| hypothetical protein ARALYDRAFT_482617 [Arabidopsis lyrata subsp. 
lyrata]
Length=191

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  56   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVEQETKRLSTIREELESMADPMRKEVS  115

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  116  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMEQLVGESEK  175

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK ++
Sbjct  176  LRMIKLEELSKSIE  189



>ref|NP_565846.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD24625.2| expressed protein [Arabidopsis thaliana]
 gb|AAM91566.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15661.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09250.1| uncharacterized protein AT2G36410 [Arabidopsis thaliana]
Length=195

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  60   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVEQETKRLSTIREELESMADPMRKEVS  119

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  120  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMEQLVGESEK  179

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK ++
Sbjct  180  LRMIKLEELSKSIE  193



>ref|XP_009115991.1| PREDICTED: uncharacterized protein LOC103841224 isoform X2 [Brassica 
rapa]
Length=162

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V+ QL R E++ + LA+I EELE + DPMRKEV 
Sbjct  30   MARSALSAFRAKEDEIEKRKMEVRERVKIQLGRVEEENRRLANIREELESMADPMRKEVS  89

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+ELV ESEK RL
Sbjct  90   WVRKKIDSVNKELKPLGATVQKKEREYKEALDTFNEKNREKVQLLTKLMELVGESEKLRL  149

Query  447  GKLEELS  467
             KLEELS
Sbjct  150  KKLEELS  156



>gb|AAM64459.1| unknown [Arabidopsis thaliana]
Length=195

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  60   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVEQETKRLSTIREELESMADPMRKEVS  119

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  120  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDXFNEKNREKVQLITKLMEMEQLVGESEK  179

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK ++
Sbjct  180  LRMIKLEELSKSIE  193



>ref|XP_009133082.1| PREDICTED: uncharacterized protein LOC103857623 isoform X1 [Brassica 
rapa]
Length=179

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EI+KR+MEV+ ++++QL R E++T+ L+ I EELE + DPMRKEV 
Sbjct  44   MTRSALSAFKAKEDEIDKRRMEVRERIQAQLGRVEEETRRLSTIREELESMADPMRKEVS  103

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            MVRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  104  MVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMEQLVGESEK  163

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK ++
Sbjct  164  LRMKKLEELSKSIE  177



>ref|XP_006410819.1| hypothetical protein EUTSA_v10017290mg [Eutrema salsugineum]
 gb|ESQ52272.1| hypothetical protein EUTSA_v10017290mg [Eutrema salsugineum]
Length=183

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL R E++TK L+ I EELE + DPMRKEV 
Sbjct  48   MTRSALSAFRAKEDEIEKRRMEVRQRIQAQLGRVEEETKRLSTIREELESMADPMRKEVS  107

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  108  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMEQLVGESEK  167

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK ++
Sbjct  168  LRMLKLEELSKSIE  181



>ref|XP_010509472.1| PREDICTED: uncharacterized protein LOC104785883 isoform X1 [Camelina 
sativa]
Length=188

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ + ++QL R EQ+TK L+ I EELE + DPMRKEV 
Sbjct  53   MTRSALSAFRAKEDEIEKRRMEVRERTQAQLGRVEQETKRLSTIREELESMADPMRKEVS  112

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  113  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMEQLVGESEK  172

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK ++
Sbjct  173  LRMIKLEELSKSIE  186



>emb|CDY43720.1| BnaAnng07350D [Brassica napus]
Length=175

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E EIEKRK+EV+ +V++QL R E++T+ LA I EELE L DPMRKEV 
Sbjct  46   MTRTALSAFRAKESEIEKRKLEVRERVQAQLGRVEEETRRLATIREELESLADPMRKEVL  105

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+V +ELK L+ + QKK++EYKEA++AF EKN EK QL + L+EL  ESE  RL
Sbjct  106  IVRKKIDSVYKELKPLSYSVQKKQREYKEAVDAFNEKNLEKIQLITKLMELAGESENLRL  165

Query  447  GKLEELSKIV  476
             KLE+LSK +
Sbjct  166  KKLEDLSKSI  175



>ref|XP_006384649.1| hypothetical protein POPTR_0004s19810g [Populus trichocarpa]
 gb|ERP62446.1| hypothetical protein POPTR_0004s19810g [Populus trichocarpa]
Length=176

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIEK+KMEV+ KV + L RAE+ TK LA I EELE LTDPMRKEV 
Sbjct  43   MSRSAVAMFRAKEEEIEKKKMEVRDKVHAHLGRAEEATKRLAEIREELEALTDPMRKEVS  102

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            MVRK+IDTVNRELK L  +CQKKE+EYKEALEAF EKN EK QL S L+EL +ESEK R+
Sbjct  103  MVRKRIDTVNRELKPLGLSCQKKEREYKEALEAFNEKNKEKAQLVSKLVELASESEKLRM  162

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  163  KKLEELSKNIE  173



>ref|XP_009413401.1| PREDICTED: harmonin-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=175

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  99   AITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRK  278
            A+++F+A+EEEIE++KMEV+ KV +QL R E+++K LA I +ELE + DP RKEV  +RK
Sbjct  46   ALSTFRAKEEEIERKKMEVREKVFAQLGRVEEESKRLAVIQKELEAIADPTRKEVSAIRK  105

Query  279  KIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLGKLE  458
            KID VNRELK L   C KKEKEYKEALEAF  KN EK QL + LIELV+ESE+ R+ KLE
Sbjct  106  KIDAVNRELKPLGHNCLKKEKEYKEALEAFNGKNREKAQLVNRLIELVSESERLRMKKLE  165

Query  459  ELSKIVD  479
            EL K VD
Sbjct  166  ELGKTVD  172



>emb|CBI30259.3| unnamed protein product [Vitis vinifera]
Length=134

 Score =   127 bits (318),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+K+EV+ KV+ QL R E++T+ LA I EELE L DPMRKEV 
Sbjct  1    MSKSALSTFRAKEEEIEKKKLEVREKVQVQLGRVEEETRRLATIREELEALADPMRKEVA  60

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID+VNR+LK L Q+CQKKEKEYK+ALEA+ EKN EK QL S L+ELV+ESE+ R+
Sbjct  61   QVRKKIDSVNRDLKPLGQSCQKKEKEYKDALEAYNEKNKEKVQLISKLMELVSESERLRM  120

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  121  KKLEELSKNIDSMH  134



>ref|XP_006295106.1| hypothetical protein CARUB_v10024181mg [Capsella rubella]
 gb|EOA28004.1| hypothetical protein CARUB_v10024181mg [Capsella rubella]
Length=170

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR  +++F+A+E EI+KRKMEV+ +V++QL R E++T+ LA I EELE L DPMRKEV 
Sbjct  40   MTRTVLSAFKAKESEIDKRKMEVRERVQAQLGRVEEETRRLAAIREELESLGDPMRKEVL  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            M+RKKID+V +ELK L+ + QKK++EYKEA++ F +KN EK QL + L+EL  ESE  RL
Sbjct  100  MIRKKIDSVYKELKPLSYSVQKKQREYKEAVDVFNDKNLEKIQLITKLMELAGESENLRL  159

Query  447  GKLEELSKIV  476
             KLEELSK +
Sbjct  160  KKLEELSKSI  169



>ref|XP_010558987.1| PREDICTED: uncharacterized protein LOC104827507 isoform X1 [Tarenaya 
hassleriana]
Length=176

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A++++  +E+EIE++KMEV+ +V++QL R E++T+ LA I EELE L DPMRKEV 
Sbjct  41   MTRAALSAYTEKEDEIERKKMEVRERVQAQLGRVEEETRRLALIREELESLADPMRKEVS  100

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKIDT+N+ELK L    QKKE+EYKEAL+AF EKN EK QL + L+E   LV ESEK
Sbjct  101  VVRKKIDTMNKELKPLGATVQKKEREYKEALDAFNEKNREKAQLITKLMEMEQLVGESEK  160

Query  438  FRLGKLEELSKIVD  479
             RL KLEELSK ++
Sbjct  161  LRLKKLEELSKSIE  174



>ref|XP_006652248.1| PREDICTED: RAB6-interacting golgin-like [Oryza brachyantha]
Length=169

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE++KMEV+ KV +QL R E+++K LA I +ELE + DP RKEV +
Sbjct  37   SRSALSVFKAKEEQIERKKMEVREKVFAQLGRVEEESKRLAFIRQELEAMADPTRKEVEV  96

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RK+ID VNR+LK L + C KKEKEYKE LE++ EKN EK  L S LIELV+ESE+ R+ 
Sbjct  97   IRKRIDVVNRQLKPLGKTCVKKEKEYKEILESYNEKNKEKALLVSRLIELVSESERMRMK  156

Query  450  KLEELSKIVDPTH  488
            KLEEL+K VD  +
Sbjct  157  KLEELNKTVDSLY  169



>gb|KFK36527.1| hypothetical protein AALP_AA4G135800 [Arabis alpina]
Length=181

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+MEV+ ++++QL + E++TK L+ I EELE + DPMRKEV 
Sbjct  44   MTRSALSAFRAKEDEIEKRRMEVRERIQAQLGKVEEETKRLSTIREELESMADPMRKEVS  103

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL++F EKN EK QL + L+E   LV ESEK
Sbjct  104  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDSFNEKNREKVQLITKLMEMGQLVGESEK  163

Query  438  FRLGKLEELS  467
             R+ KLEELS
Sbjct  164  LRMKKLEELS  173



>ref|XP_002283313.1| PREDICTED: uncharacterized protein LOC100256294 [Vitis vinifera]
Length=166

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+K+EV+ KV+ QL R E++T+ LA I EELE L DPMRKEV 
Sbjct  33   MSKSALSTFRAKEEEIEKKKLEVREKVQVQLGRVEEETRRLATIREELEALADPMRKEVA  92

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID+VNR+LK L Q+CQKKEKEYK+ALEA+ EKN EK QL S L+ELV+ESE+ R+
Sbjct  93   QVRKKIDSVNRDLKPLGQSCQKKEKEYKDALEAYNEKNKEKVQLISKLMELVSESERLRM  152

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  153  KKLEELSKNIDSMH  166



>emb|CDX77133.1| BnaC04g39280D [Brassica napus]
Length=710

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
             +R ++  F+A+E+EIE+RKMEV+ +V+S+L  AE+ T+ LA I EELE LTDPMRKE+ 
Sbjct  40   FSRSSLALFKAKEDEIERRKMEVRDRVQSKLGLAEEATRRLADIREELESLTDPMRKEIS  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             +RK++D +NRELK L Q+CQKKEKE+KEALEA+ +KN EK    S L+ELV ESEK R+
Sbjct  100  AIRKRVDAINRELKPLGQSCQKKEKEFKEALEAYNDKNKEKAMFVSKLVELVTESEKLRM  159

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  160  TKLEELSKSID  170



>ref|XP_010521677.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-79 specific 
[Tarenaya hassleriana]
Length=177

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIE++K E+K KV+++L  AE+ T+ LA I EELE LTDPMRK++ 
Sbjct  43   LSRSALALFKAKEEEIERKKTEMKDKVQTKLGLAEETTRRLAEIREELEALTDPMRKDIS  102

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             +RK+ID +NRELK L Q C +KE+EYKEALEA+ +KN EK  L   L+E+V+ESE+ R+
Sbjct  103  TIRKRIDVINRELKPLGQTCHRKEREYKEALEAYNDKNKEKALLVGKLVEMVSESERIRM  162

Query  447  GKLEELSKIVDPTHR  491
             KLEELSK ++ + R
Sbjct  163  KKLEELSKSIEISPR  177



>ref|XP_010242636.1| PREDICTED: RAB6-interacting golgin-like [Nelumbo nucifera]
Length=174

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+TSF+ +EEEIE++KMEV+ KV++QL R E+++K LA I +ELE L DPM+KE+G
Sbjct  41   MSRSALTSFREKEEEIERKKMEVREKVQAQLGRVEEESKRLAEIRQELEALADPMKKEIG  100

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            ++RKKID VNRELK L Q CQKKEKEYKEALEAF EKN EK QL + L+EL++ESEK R+
Sbjct  101  LLRKKIDGVNRELKPLGQTCQKKEKEYKEALEAFNEKNREKAQLITKLMELLSESEKLRM  160

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  161  KKLEELSKNIDSLH  174



>ref|XP_009133084.1| PREDICTED: uncharacterized protein LOC103857624 [Brassica rapa]
Length=172

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A++ F+A+E EIE+RKME++ +V++QL+R E++T+ LA I EELE L DP RKEV 
Sbjct  43   MTRTALSEFKAKESEIERRKMEIRERVQAQLDRVEEETRRLATIREELESLADPTRKEVL  102

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            M+RKKID+V +EL+ L+ + QKK++EYKEA++AF EKN EK QL + L+EL  ESE  RL
Sbjct  103  MIRKKIDSVYKELRPLSYSVQKKQREYKEAVDAFNEKNLEKIQLITKLMELAGESENLRL  162

Query  447  GKLEELSKIV  476
             KLE+LSK +
Sbjct  163  KKLEDLSKSI  172



>emb|CDX73594.1| BnaC08g24090D [Brassica napus]
Length=166

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V++QL R E++ + LA+I EELE + DPMRKEV 
Sbjct  30   MARSALSAFRAKEDEIEKRKMEVRERVKTQLGRVEEENRRLANIREELESMADPMRKEVS  89

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE----LVNESE  434
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E    LV ESE
Sbjct  90   WVRKKIDSVNKELKPLGATVQKKEREYKEALDTFNEKNREKVQLLTKLMEEMGQLVGESE  149

Query  435  KFRLGKLEELS  467
            K RL KLEELS
Sbjct  150  KLRLKKLEELS  160



>ref|XP_002879606.1| hypothetical protein ARALYDRAFT_482609 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55865.1| hypothetical protein ARALYDRAFT_482609 [Arabidopsis lyrata subsp. 
lyrata]
Length=155

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  111  FQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDT  290
            FQAREEEIE++KM VK K++ +L  AE+ T+ L    E LE++ DPMRKEVGMVRKKI+ 
Sbjct  30   FQAREEEIERKKMAVKDKIQQRLGFAEEATRSLTQTLEGLEIMGDPMRKEVGMVRKKIEM  89

Query  291  VNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSK  470
             NRE+KSL+Q+CQKKEKEYKE  EAF EKN EK+ L S L+EL+ ESE+ R+ KLE+++K
Sbjct  90   ANREIKSLSQSCQKKEKEYKEIQEAFDEKNKEKSHLVSILMELLAESERVRVKKLEDINK  149

Query  471  IV  476
             V
Sbjct  150  TV  151



>ref|XP_006381309.1| hypothetical protein POPTR_0006s11650g [Populus trichocarpa]
 ref|XP_011018893.1| PREDICTED: ankyrin repeat domain-containing protein 30A-like 
isoform X2 [Populus euphratica]
 gb|ERP59106.1| hypothetical protein POPTR_0006s11650g [Populus trichocarpa]
Length=168

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  24   MSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTK  203
            +++ + GS    S    E+EE++R A+++F+A+EEEIEK+KMEV+ KV++QL R E++TK
Sbjct  14   LTVQNSGSLSFSSQMSKEDEEMSRSALSTFRAKEEEIEKKKMEVREKVQAQLGRVEEETK  73

Query  204  HLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNN  383
             LA I EELE L DPMRKEV +VRKKIDTVN+ELK L    QKKEKEYK+ALEAF +KN 
Sbjct  74   RLAMIREELEALADPMRKEVAVVRKKIDTVNKELKPLGHTVQKKEKEYKDALEAFNDKNK  133

Query  384  EKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
            EK QL + L+ELV+ESE+ RL KLEELSK +D  H
Sbjct  134  EKVQLITKLMELVSESERLRLKKLEELSKNIDSMH  168



>ref|NP_001031492.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABF59214.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09237.1| uncharacterized protein AT2G36355 [Arabidopsis thaliana]
Length=155

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +3

Query  108  SFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKID  287
            +FQAREEEIE++KM VK K++ +L  AE+ T+ L    E LE++ DPMRKEVGMVRKKI+
Sbjct  29   NFQAREEEIERKKMAVKDKIQQRLGFAEEATRSLTQTLEGLEIMGDPMRKEVGMVRKKIE  88

Query  288  TVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLGKLEELS  467
              NRE+KSL+Q+CQKKE+EYKE  EAF EKN EK  L S L+EL+ ESE+ R+ KLEE++
Sbjct  89   MANREIKSLSQSCQKKEREYKEIHEAFDEKNKEKAHLVSILMELLAESERVRVKKLEEIN  148

Query  468  KIV  476
            K +
Sbjct  149  KTI  151



>ref|XP_009141590.1| PREDICTED: uncharacterized protein LOC103865544 isoform X1 [Brassica 
rapa]
Length=190

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+ EV+ ++++QL R E++T+ L+ + EE+E + DPMRKEV 
Sbjct  54   MTRSALSAFRAKEDEIEKRRAEVRERIQAQLGRVEEETRRLSTLREEIESMADPMRKEVS  113

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  114  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMEQLVGESEK  173

Query  438  FRLGKLEELSKIVDPT  485
             R+ KLEELSK ++ T
Sbjct  174  LRMKKLEELSKSIEET  189



>emb|CDY43719.1| BnaAnng07340D [Brassica napus]
Length=191

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+E+EIEKR+ EV+ ++++QL R E++T+ L+ + EE+E + DPMRKEV 
Sbjct  55   MTRSALSAFRAKEDEIEKRRAEVRERIQAQLGRVEEETRRLSTLREEIESMADPMRKEVS  114

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  115  VVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMEMEQLVGESEK  174

Query  438  FRLGKLEELSKIVDPT  485
             R+ KLEELSK ++ T
Sbjct  175  LRMKKLEELSKSIEET  190



>ref|XP_011044659.1| PREDICTED: uncharacterized protein LOC105139760 isoform X2 [Populus 
euphratica]
Length=175

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            I+R A+  F+A+EEEIEK+KMEV+ KV + L R E+ TK LA I EELE LTDPMRKEV 
Sbjct  42   ISRSALAMFRAKEEEIEKKKMEVRDKVHAHLGRVEEATKRLAEIREELEALTDPMRKEVS  101

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            MVRK+IDTVNRELK L  +CQKKE+EYKEALEAF +KN EK QL S L+ELV ESEK R+
Sbjct  102  MVRKRIDTVNRELKPLGLSCQKKEREYKEALEAFNDKNKEKAQLVSKLVELVGESEKLRM  161

Query  447  GKLEELSKIVD  479
             KLEELS+ ++
Sbjct  162  KKLEELSRNIE  172



>emb|CDX78133.1| BnaA09g33280D [Brassica napus]
Length=165

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V+ QL R E++ + LA+I EELE + DPMRKEV 
Sbjct  30   MARSALSAFRAKEDEIEKRKMEVRERVKIQLGRVEEENRRLANIREELESMADPMRKEVS  89

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  90   WVRKKIDSVNKELKPLGATVQKKEREYKEALDTFNEKNREKVQLLTKLMEMGQLVGESEK  149

Query  438  FRLGKLEELS  467
             RL KLEELS
Sbjct  150  LRLKKLEELS  159



>ref|XP_009115990.1| PREDICTED: uncharacterized protein LOC103841224 isoform X1 [Brassica 
rapa]
Length=165

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            + R A+++F+A+E+EIEKRKMEV+ +V+ QL R E++ + LA+I EELE + DPMRKEV 
Sbjct  30   MARSALSAFRAKEDEIEKRKMEVRERVKIQLGRVEEENRRLANIREELESMADPMRKEVS  89

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
             VRKKID+VN+ELK L    QKKE+EYKEAL+ F EKN EK QL + L+E   LV ESEK
Sbjct  90   WVRKKIDSVNKELKPLGATVQKKEREYKEALDTFNEKNREKVQLLTKLMEMGQLVGESEK  149

Query  438  FRLGKLEELS  467
             RL KLEELS
Sbjct  150  LRLKKLEELS  159



>ref|XP_006296389.1| hypothetical protein CARUB_v10025562mg [Capsella rubella]
 gb|EOA29287.1| hypothetical protein CARUB_v10025562mg [Capsella rubella]
Length=155

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = +3

Query  27   SITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKH  206
            S  ++ +  +L M+EN+EEEI R     FQAREEEIE++KM VK K++ +L  AE+ T+ 
Sbjct  6    SGATISTKSKLPMDENQEEEIWR----KFQAREEEIERKKMAVKDKIQQRLGFAEEATRS  61

Query  207  LAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNE  386
            L    E LE++ DPMRKEVGMVRKKI+  NR++KSL+Q+CQKKEKEYKE LEAF EKN E
Sbjct  62   LTQTLEGLEIMGDPMRKEVGMVRKKIEMANRDIKSLSQSCQKKEKEYKEVLEAFDEKNKE  121

Query  387  KTQLTSTLIELVNESEKFRLGKLEELSKIV  476
            K  L S L+EL+ ESE+ R+ KL+E++K V
Sbjct  122  KAHLVSILMELLAESERVRVKKLDEINKTV  151



>ref|XP_006430278.1| hypothetical protein CICLE_v10012928mg [Citrus clementina]
 ref|XP_006481830.1| PREDICTED: RAB6-interacting golgin-like [Citrus sinensis]
 gb|ESR43518.1| hypothetical protein CICLE_v10012928mg [Citrus clementina]
 gb|KDO61050.1| hypothetical protein CISIN_1g029490mg [Citrus sinensis]
Length=172

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+T+F+A+EEEIEK+K+EV+ KV++ L R E++TK LA I EELE L DPMRKEV 
Sbjct  38   MSRSALTTFRAKEEEIEKKKLEVREKVQAHLGRVEEETKRLATIREELEALADPMRKEVA  97

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L   CQKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  98   VVRKKIDSVNKELKPLGHTCQKKEREYKEALEAFNEKNKEKVQLITKLMELVGESEKLRM  157

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  158  KKLEELSKSID  168



>ref|XP_010509479.1| PREDICTED: uncharacterized protein LOC104785891 [Camelina sativa]
Length=155

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  111  FQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDT  290
            FQAREEEIE++KM VK K++ +L  AE+ T+ L    E LE++ DPMRKEVGMVRKKI+ 
Sbjct  30   FQAREEEIERKKMAVKDKIQQRLGFAEEATRSLTQTLEGLEIMGDPMRKEVGMVRKKIEM  89

Query  291  VNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSK  470
             NR++KSL+Q+CQKKEKEYKE LEAF+EKN EK  L S L+EL+ ESE+ R+ KL+E++K
Sbjct  90   ANRDIKSLSQSCQKKEKEYKEVLEAFEEKNKEKAHLVSILMELLAESERVRVKKLDEINK  149

Query  471  IV  476
             V
Sbjct  150  TV  151



>ref|XP_010505172.1| PREDICTED: uncharacterized protein LOC104782054 [Camelina sativa]
 ref|XP_010516850.1| PREDICTED: uncharacterized protein LOC104792412 [Camelina sativa]
Length=155

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = +3

Query  27   SITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKH  206
            S+ +  +  +L M+E++EEEI R     FQAREEEIE++KM VK K++ +L  AE+ T+ 
Sbjct  6    SVATTSTKSKLPMDEHQEEEIWR----KFQAREEEIERKKMAVKDKIQQRLGFAEEATRS  61

Query  207  LAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNE  386
            L    E LE++ DPMRKEVGMVRKKI+  NR++KSL+Q+CQKKEKEYKE LEAF EKN E
Sbjct  62   LTQTLEGLEIMGDPMRKEVGMVRKKIEMANRDIKSLSQSCQKKEKEYKEVLEAFDEKNKE  121

Query  387  KTQLTSTLIELVNESEKFRLGKLEELSKIV  476
            K  L S L+EL+ ESE+ R+ KL+E+++ V
Sbjct  122  KAHLVSILMELLAESERVRVKKLDEINQTV  151



>gb|AGT16904.1| hypothetical protein SHCRBa_082_J13_F_170 [Saccharum hybrid cultivar 
R570]
Length=169

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE+RKMEV+ KV + L R E+++K LA I +ELE + DP RKEV  
Sbjct  37   SRSALSVFKAKEEQIERRKMEVREKVFAHLGRVEEESKRLAFIRQELEGMADPTRKEVES  96

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RK+IDTVNR+LK L+++C KKEKEYKE LEA+ EK+ EK  L + LIELV+ESE+ R+ 
Sbjct  97   IRKRIDTVNRQLKPLSKSCVKKEKEYKEVLEAYNEKSKEKALLVNRLIELVSESERMRMK  156

Query  450  KLEELSKIVDPTH  488
            KLEEL+K VD  +
Sbjct  157  KLEELNKTVDSLY  169



>ref|XP_002447770.1| hypothetical protein SORBIDRAFT_06g015330 [Sorghum bicolor]
 gb|EES12098.1| hypothetical protein SORBIDRAFT_06g015330 [Sorghum bicolor]
Length=169

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE+RKMEV+ KV + L R E+++K LA I +ELE + DP RKEV  
Sbjct  37   SRSALSVFKAKEEQIERRKMEVREKVFAHLGRVEEESKRLAFIRQELEGMADPTRKEVES  96

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RK+IDTVNR+LK L+++C KKEKEYKE LEA+ EK+ EK  L + LIELV+ESE+ R+ 
Sbjct  97   IRKRIDTVNRQLKPLSKSCVKKEKEYKEVLEAYNEKSKEKALLVNRLIELVSESERMRMK  156

Query  450  KLEELSKIVDPTH  488
            KLEEL+K VD  +
Sbjct  157  KLEELNKTVDSLY  169



>ref|NP_001144188.1| uncharacterized protein LOC100277048 [Zea mays]
 gb|ACF87950.1| unknown [Zea mays]
 gb|ACG38566.1| hypothetical protein [Zea mays]
 gb|AFW58172.1| hypothetical protein ZEAMMB73_759192 [Zea mays]
Length=170

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE+RKMEV+ KV + L R E+++K LA I +ELE + DP RKEV  
Sbjct  38   SRSALSVFKAKEEQIERRKMEVREKVFAHLGRVEEESKRLAFIRQELEGMADPTRKEVES  97

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RK+IDTVNR+LK L+++C KKEKEYKE LEA+ EK+ EK  L + LIELV+ESE+ R+ 
Sbjct  98   IRKRIDTVNRQLKPLSKSCVKKEKEYKEVLEAYNEKSKEKALLVNRLIELVSESERMRMK  157

Query  450  KLEELSKIVDPTH  488
            KLEEL+K VD  +
Sbjct  158  KLEELNKTVDSLY  170



>emb|CAE04893.2| OSJNBa0042I15.15 [Oryza sativa Japonica Group]
 emb|CAH66496.1| H0321H01.5 [Oryza sativa Indica Group]
 emb|CAH66520.1| OSIGBa0142C11.8 [Oryza sativa Indica Group]
Length=161

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE++KMEV+ KV +QL R E+++K LA I +ELE + DP RKEV +
Sbjct  29   SRSALSVFKAKEEQIERKKMEVREKVFAQLGRVEEESKRLAFIRQELEGMADPTRKEVEV  88

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RK+ID VNR+LK L + C KKEKEYKE LEA+ EKN EK  L + LIELV+ESE+ R+ 
Sbjct  89   IRKRIDVVNRQLKPLGKTCVKKEKEYKEILEAYNEKNKEKALLVNRLIELVSESERMRMK  148

Query  450  KLEELSKIVDPTH  488
            KLEEL+K VD  +
Sbjct  149  KLEELNKTVDSLY  161



>ref|XP_004975534.1| PREDICTED: RAB6-interacting golgin-like [Setaria italica]
Length=169

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE+RKMEV+ KV + L R E+++K LA I +ELE + DP RKEV  
Sbjct  37   SRSALSVFKAKEEQIERRKMEVREKVFAHLGRVEEESKRLAFIRQELEGMADPTRKEVES  96

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RK+IDTVNR+LK L+++C KKEKEYKE LEA+ EK+ EK  L + LIELV+ESE+ R+ 
Sbjct  97   IRKRIDTVNRQLKPLSKSCIKKEKEYKEVLEAYNEKSKEKALLVNRLIELVSESERMRMK  156

Query  450  KLEELSKIVDPTH  488
            KLEEL+K VD  +
Sbjct  157  KLEELNKTVDSLY  169



>ref|XP_009413402.1| PREDICTED: uncharacterized protein LOC103994710 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=173

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 2/127 (2%)
 Frame = +3

Query  99   AITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRK  278
            A+++F+A+EEEIE++KMEV+ KV +QL R E+++K LA I +ELE + DP RKEV  +RK
Sbjct  46   ALSTFRAKEEEIERKKMEVREKVFAQLGRVEEESKRLAVIQKELEAIADPTRKEVSAIRK  105

Query  279  KIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLGKLE  458
            KID VNRELK L   C   +KEYKEALEAF  KN EK QL + LIELV+ESE+ R+ KLE
Sbjct  106  KIDAVNRELKPLGHNC--LKKEYKEALEAFNGKNREKAQLVNRLIELVSESERLRMKKLE  163

Query  459  ELSKIVD  479
            EL K VD
Sbjct  164  ELGKTVD  170



>ref|XP_011005398.1| PREDICTED: uncharacterized protein LOC105111662 [Populus euphratica]
Length=176

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIEK+KMEV+ KV + L RAE+ TK LA I EELE LTDPMRKEV 
Sbjct  43   MSRSAVAMFRAKEEEIEKKKMEVRDKVHAHLGRAEEATKRLAEIREELEALTDPMRKEVS  102

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            MVRK+IDTV RELK L  +CQKKE+EYKEALEAF EKN EK QL S L+EL +ESEK R+
Sbjct  103  MVRKRIDTVIRELKPLGLSCQKKEREYKEALEAFNEKNKEKAQLVSKLVELASESEKLRM  162

Query  447  GKLEELSKIVD  479
             KLEELSK V+
Sbjct  163  KKLEELSKNVE  173



>ref|NP_001052720.1| Os04g0408600 [Oryza sativa Japonica Group]
 gb|AAO72703.1| unknown [Oryza sativa Japonica Group]
 dbj|BAF14634.1| Os04g0408600 [Oryza sativa Japonica Group]
 dbj|BAH00487.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77235.1| hypothetical protein OsI_15786 [Oryza sativa Indica Group]
 gb|EEE60948.1| hypothetical protein OsJ_14703 [Oryza sativa Japonica Group]
Length=169

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE++KMEV+ KV +QL R E+++K LA I +ELE + DP RKEV +
Sbjct  37   SRSALSVFKAKEEQIERKKMEVREKVFAQLGRVEEESKRLAFIRQELEGMADPTRKEVEV  96

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            +RK+ID VNR+LK L + C KKEKEYKE LEA+ EKN EK  L + LIELV+ESE+ R+ 
Sbjct  97   IRKRIDVVNRQLKPLGKTCVKKEKEYKEILEAYNEKNKEKALLVNRLIELVSESERMRMK  156

Query  450  KLEELSKIVDPTH  488
            KLEEL+K VD  +
Sbjct  157  KLEELNKTVDSLY  169



>ref|XP_008462544.1| PREDICTED: septin-11-like [Cucumis melo]
Length=165

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 113/152 (74%), Gaps = 1/152 (1%)
 Frame = +3

Query  33   TSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLA  212
            T + + G LS    E++E+++ A+ +F+ +EEEI++ + E+  K++ +L R +++++ L+
Sbjct  13   TMLENSGNLSFSSKEDDEMSKSALAAFREKEEEIDRMRTELHNKLQVRLGRVQEESRRLS  72

Query  213  HIWEELEVLT-DPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEK  389
             + EELE +  DPMRKE+G +RKKID +N+ELK L   CQKKEKEYK+AL++F EKNNEK
Sbjct  73   SLREELEAIGGDPMRKEIGQIRKKIDALNKELKPLGVTCQKKEKEYKDALDSFNEKNNEK  132

Query  390  TQLTSTLIELVNESEKFRLGKLEELSKIVDPT  485
             QL S L+E+V ESEK RL +LEELSK VD T
Sbjct  133  VQLISKLMEMVGESEKLRLKRLEELSKHVDNT  164



>gb|KFK36346.1| hypothetical protein AALP_AA4G110600 [Arabis alpina]
Length=155

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +3

Query  111  FQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDT  290
            FQAREEEIE++K  VK KV+ +L   E+ T+ L+   EELE++ DPMRKEVG++RKKID 
Sbjct  30   FQAREEEIERKKTTVKEKVQQRLGFVEEATRSLSQTLEELEIMADPMRKEVGVLRKKIDM  89

Query  291  VNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSK  470
             NR++KSL+Q CQKKEKEYKE  EAF EKN EK  L S L+EL+ ESE+ R+ KLEE++K
Sbjct  90   ANRDIKSLSQNCQKKEKEYKEIQEAFDEKNKEKAHLVSILMELLTESERLRVTKLEEINK  149

Query  471  IV  476
             V
Sbjct  150  TV  151



>ref|XP_003625765.1| hypothetical protein MTR_7g104020 [Medicago truncatula]
 gb|AES81983.1| transcriptional activator [Medicago truncatula]
 gb|AFK35479.1| unknown [Medicago truncatula]
Length=168

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KMEV+ KV+ QL R E++TK LA I EELE L DPMRKEV 
Sbjct  33   MSRSALSTFRAKEEEIEKKKMEVRDKVQFQLGRVEEETKRLATIREELEALADPMRKEVS  92

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRK+ID+VN+ELK L   CQKKEKEYK+ALEAF EKN EK QL + L+ELV ESE+ R+
Sbjct  93   LVRKRIDSVNKELKPLGHTCQKKEKEYKDALEAFNEKNREKVQLITKLMELVGESERLRM  152

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  153  KKLEELSKNID  163



>ref|XP_009122685.1| PREDICTED: myosin-9 [Brassica rapa]
 ref|XP_009122686.1| PREDICTED: myosin-9 [Brassica rapa]
 emb|CDY10366.1| BnaCnng02670D [Brassica napus]
 emb|CDX70295.1| BnaA10g26440D [Brassica napus]
Length=173

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +3

Query  99   AITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRK  278
            A+++F+A+E+EIEK+KME++ +V +QL R E +TK LA I EELE   DPMRKEV ++RK
Sbjct  43   ALSAFKAKEDEIEKKKMEIRERVLAQLGRVEDETKRLALIREELEGFADPMRKEVTLIRK  102

Query  279  KIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLGKLE  458
            KID++++E+K L    QKKE EYK+ALEAF EKN EK +L + L EL  ESEK RL KLE
Sbjct  103  KIDSLDKEIKPLGNTVQKKEVEYKDALEAFNEKNKEKVELITKLQELEGESEKMRLKKLE  162

Query  459  ELSKIVDPT  485
            ELSK +D T
Sbjct  163  ELSKNIDQT  171



>gb|AEI28610.1| hypothetical protein [Triticum aestivum]
 gb|EMT15905.1| hypothetical protein F775_07023 [Aegilops tauschii]
Length=169

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE++KMEV+ KV +QL R E+++K LA I +ELE + DP RKEV  
Sbjct  37   SRSALSVFKAKEEQIERKKMEVRDKVFAQLGRVEEESKRLAFIRQELEGMADPTRKEVES  96

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            ++++IDTVNR+LK L+++C KKEKEYKE LEA+ EK+ EK  L + LIELV+ESE+ R+ 
Sbjct  97   IQRRIDTVNRQLKPLSKSCVKKEKEYKEILEAYNEKSKEKAILVNRLIELVSESERMRMK  156

Query  450  KLEELSKIVDPTH  488
            KLEEL+K VD  +
Sbjct  157  KLEELNKTVDSLY  169



>gb|ABG75754.1| salt response protein [Triticum aestivum]
 gb|ACR43428.1| salt response protein [Triticum aestivum]
 gb|ACR43429.1| salt response protein [Triticum aestivum]
Length=169

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE++KMEV+ KV +QL R E+++K LA I +ELE + DP RKEV  
Sbjct  37   SRSALSVFKAKEEQIERKKMEVRDKVFAQLGRVEEESKRLAFIRQELEGMADPTRKEVES  96

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            ++++IDTVNR+LK L+++C KKEKEYKE LEA+ EK+ EK  L + LIELV+ESE+ R+ 
Sbjct  97   IQRRIDTVNRQLKPLSKSCVKKEKEYKEILEAYNEKSKEKAILVNRLIELVSESERMRMK  156

Query  450  KLEELSKIVDPTH  488
            KLEEL+K VD  +
Sbjct  157  KLEELNKTVDSLY  169



>ref|NP_187609.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL85004.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51267.1| unknown protein [Arabidopsis thaliana]
 gb|AAZ23929.1| At3g09980 [Arabidopsis thaliana]
 dbj|BAE98646.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74844.1| uncharacterized protein AT3G09980 [Arabidopsis thaliana]
Length=178

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  45   MSRTALSAFRAKEEEIEKKKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  104

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            MVRKKID+VN+ELK L    QKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  105  MVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITRLMELVGESEKMRM  164

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  165  KKLEELSKNIDSIH  178



>ref|XP_007010287.1| Family of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
 gb|EOY19097.1| Family of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
Length=147

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            I+R+AI++FQAREEEIE++KMEVK KVE QL RAE++T+ L+ IWEELEVL+DP+RKEV 
Sbjct  27   ISRLAISTFQAREEEIERKKMEVKEKVEIQLGRAEEETRRLSMIWEELEVLSDPLRKEVA  86

Query  267  MVRKKIDTVNRELKSLTQACQ  329
            MVRKKID  NRELK L Q+CQ
Sbjct  87   MVRKKIDMANRELKPLGQSCQ  107



>ref|XP_004494149.1| PREDICTED: RAB6-interacting golgin-like isoform X2 [Cicer arietinum]
Length=167

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+KMEV+ KV+ QL R E++TK LA I EELE L DPMRK+V 
Sbjct  32   MSKSALSTFRAKEEEIEKKKMEVREKVQLQLGRVEEETKRLATIREELEALADPMRKDVS  91

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID++N+ELK L   CQKKEKEYK+ALEAF EKN EK QL + L+ELV+ESEK R+
Sbjct  92   IVRKKIDSINKELKPLGHTCQKKEKEYKDALEAFNEKNREKVQLITKLMELVSESEKLRM  151

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  152  KKLEELSKNID  162



>ref|XP_006398823.1| hypothetical protein EUTSA_v10014828mg [Eutrema salsugineum]
 gb|ESQ40276.1| hypothetical protein EUTSA_v10014828mg [Eutrema salsugineum]
Length=173

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +3

Query  99   AITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRK  278
            A+++F+A+E+EIEK+KME++ +V +QL R E +TK LA I EELE   DPMRKEV +VRK
Sbjct  43   ALSAFKAKEDEIEKKKMEIRERVLAQLGRVEGETKRLALIREELEGFADPMRKEVTLVRK  102

Query  279  KIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLGKLE  458
            KID++++E+K L    QKKE EYK+ALEAF EKN EK +L + L EL  ESEK R  KLE
Sbjct  103  KIDSLDKEIKPLGHTVQKKETEYKDALEAFNEKNKEKVELITKLQELEGESEKMRFKKLE  162

Query  459  ELSKIVDPT  485
            ELSK +D T
Sbjct  163  ELSKNIDQT  171



>ref|XP_004143305.1| PREDICTED: uncharacterized protein LOC101209289 [Cucumis sativus]
 gb|KGN48239.1| hypothetical protein Csa_6G450440 [Cucumis sativus]
Length=165

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = +3

Query  45   SGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWE  224
            +   LS    E++E+++ A+ +F+ +EEEI++ + E+  K++ +L R +++++ L+ + E
Sbjct  17   NSANLSFSSKEDDEMSKSALAAFREKEEEIDRMRTELNNKLQLRLGRVQEESRRLSSLRE  76

Query  225  ELEVLT-DPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLT  401
            ELE +  DPMRKE+G +RKKID +N+ELK L   CQKKEKEYK+AL++F EKNNEK QL 
Sbjct  77   ELEAIGGDPMRKEIGQIRKKIDALNKELKPLGVTCQKKEKEYKDALDSFNEKNNEKVQLI  136

Query  402  STLIELVNESEKFRLGKLEELSKIVDPT  485
            S L+E+V ESEK RL +LEELSK VD T
Sbjct  137  SKLMEMVGESEKLRLKRLEELSKHVDNT  164



>ref|XP_006381310.1| hypothetical protein POPTR_0006s11650g [Populus trichocarpa]
 ref|XP_011018892.1| PREDICTED: ankyrin repeat domain-containing protein 30A-like 
isoform X1 [Populus euphratica]
 gb|ABK93998.1| unknown [Populus trichocarpa]
 gb|ERP59107.1| hypothetical protein POPTR_0006s11650g [Populus trichocarpa]
Length=171

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 120/158 (76%), Gaps = 3/158 (2%)
 Frame = +3

Query  24   MSITSVGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTK  203
            +++ + GS    S    E+EE++R A+++F+A+EEEIEK+KMEV+ KV++QL R E++TK
Sbjct  14   LTVQNSGSLSFSSQMSKEDEEMSRSALSTFRAKEEEIEKKKMEVREKVQAQLGRVEEETK  73

Query  204  HLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNN  383
             LA I EELE L DPMRKEV +VRKKIDTVN+ELK L    QKKEKEYK+ALEAF +KN 
Sbjct  74   RLAMIREELEALADPMRKEVAVVRKKIDTVNKELKPLGHTVQKKEKEYKDALEAFNDKNK  133

Query  384  EKTQLTSTLIE---LVNESEKFRLGKLEELSKIVDPTH  488
            EK QL + L+E   LV+ESE+ RL KLEELSK +D  H
Sbjct  134  EKVQLITKLMEFEQLVSESERLRLKKLEELSKNIDSMH  171



>ref|XP_011044649.1| PREDICTED: uncharacterized protein LOC105139760 isoform X1 [Populus 
euphratica]
Length=178

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            I+R A+  F+A+EEEIEK+KMEV+ KV + L R E+ TK LA I EELE LTDPMRKEV 
Sbjct  42   ISRSALAMFRAKEEEIEKKKMEVRDKVHAHLGRVEEATKRLAEIREELEALTDPMRKEVS  101

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            MVRK+IDTVNRELK L  +CQKKE+EYKEALEAF +KN EK QL S L+E   LV ESEK
Sbjct  102  MVRKRIDTVNRELKPLGLSCQKKEREYKEALEAFNDKNKEKAQLVSKLVEVGQLVGESEK  161

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELS+ ++
Sbjct  162  LRMKKLEELSRNIE  175



>emb|CDX84559.1| BnaA03g16710D [Brassica napus]
Length=176

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 103/134 (77%), Gaps = 4/134 (3%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A++ F+A+E EIE+RKME++ +V++QL+R E++T+ LA I EELE L DP RKEV 
Sbjct  43   MTRTALSEFKAKESEIERRKMEIRERVQAQLDRVEEETRRLATIREELESLADPTRKEVL  102

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE----LVNESE  434
            M+RKKID+V +EL+ L+ + QKK++EYKEA++AF EKN EK QL + L+E    L  ESE
Sbjct  103  MIRKKIDSVYKELRPLSYSVQKKQREYKEAVDAFNEKNLEKIQLITKLMEEIGQLAGESE  162

Query  435  KFRLGKLEELSKIV  476
              RL KLE+LSK +
Sbjct  163  NLRLKKLEDLSKSI  176



>emb|CDY57618.1| BnaCnng32210D [Brassica napus]
 emb|CDX79677.1| BnaC03g20130D [Brassica napus]
Length=176

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 103/134 (77%), Gaps = 4/134 (3%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A++ F+A+E EIE+RKME++ +V++QL+R E++T+ LA I EELE L DP RKEV 
Sbjct  43   MTRTALSEFKAKESEIERRKMEIRERVQAQLDRVEEETRRLATIREELESLADPTRKEVL  102

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE----LVNESE  434
            M+RKKID+V +EL+ L+ + QKK++EYKEA++AF EKN EK QL + L+E    L  ESE
Sbjct  103  MIRKKIDSVYKELRPLSYSVQKKQREYKEAVDAFNEKNLEKIQLITKLMEEIGQLAGESE  162

Query  435  KFRLGKLEELSKIV  476
              RL KLE+LSK +
Sbjct  163  NLRLKKLEDLSKSI  176



>ref|XP_006407618.1| hypothetical protein EUTSA_v10021627mg [Eutrema salsugineum]
 gb|ESQ49071.1| hypothetical protein EUTSA_v10021627mg [Eutrema salsugineum]
Length=177

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  44   MSRTALSAFRAKEEEIEKKKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  103

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  104  LVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITKLMELVGESEKMRM  163

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  164  KKLEELSKNIDSIH  177



>ref|XP_003579676.1| PREDICTED: uncharacterized protein LOC100830167 [Brachypodium 
distachyon]
Length=175

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  90   TRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGM  269
            +R A++ F+A+EE+IE++KMEV+ KV +QL R E+++K LA I +ELE + DP RKEV  
Sbjct  43   SRSALSVFKAKEEQIERKKMEVREKVFAQLGRVEEESKRLAFIRQELEGMADPTRKEVES  102

Query  270  VRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLG  449
            ++++IDTVNR+LK L++ C KKEKEYKE LEA+ EK+ EK  L + LIELV+ESE+ R+ 
Sbjct  103  IQRRIDTVNRQLKPLSKNCVKKEKEYKEILEAYNEKSKEKALLVNRLIELVSESERMRMK  162

Query  450  KLEELSKIVDPTH  488
            KLEEL+K VD  +
Sbjct  163  KLEELNKTVDSLY  175



>ref|XP_002882648.1| hypothetical protein ARALYDRAFT_478325 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58907.1| hypothetical protein ARALYDRAFT_478325 [Arabidopsis lyrata subsp. 
lyrata]
Length=178

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  45   MSRTALSAFRAKEEEIEKKKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  104

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  105  LVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITRLMELVGESEKMRM  164

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  165  KKLEELSKNIDSIH  178



>emb|CDY60156.1| BnaAnng16520D [Brassica napus]
Length=178

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  45   MSRTALSAFRAKEEEIEKKKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  104

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  105  LVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITKLMELVGESEKVRM  164

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  165  KKLEELSKNIDSIH  178



>gb|ABK95581.1| unknown [Populus trichocarpa]
Length=144

 Score =   119 bits (298),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KMEV+ KV++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  8    MSRSALSTFRAKEEEIEKKKMEVREKVQAQLGRVEEETKRLAMIREELEALADPMRKEVA  67

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIE---LVNESEK  437
            +VRKKIDTVN+ELK L    QKKEKEYK+ALEAF +KN EK QL + L+E   LV+ESE+
Sbjct  68   VVRKKIDTVNKELKPLGHTVQKKEKEYKDALEAFNDKNKEKVQLITKLMEFEQLVSESER  127

Query  438  FRLGKLEELSKIVDPTH  488
             RL KLEELSK +D  H
Sbjct  128  LRLKKLEELSKNIDSMH  144



>emb|CDY66899.1| BnaC03g73270D [Brassica napus]
Length=172

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  37   MSRNALSAFRAKEEEIEKKKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  96

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKK+D+VN+ELK L+   QKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  97   LVRKKVDSVNKELKPLSLTVQKKEREYKEALEAFNEKNREKVQLITKLMELVGESEKMRM  156

Query  447  GKLEELSKIVDPTH  488
             KL+ELSK VD  H
Sbjct  157  KKLDELSKNVDSVH  170



>emb|CDP15376.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+K+EVK KV++QL R E++TK LA I EELE L DPM+KEV 
Sbjct  1    MSKSALSTFRAKEEEIEKKKLEVKEKVQAQLGRIEEETKRLATIREELEALADPMKKEVS  60

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VN+ELK L Q CQKKEKEYKEALEAF EKN EK QL S L+ELV ESEK R+
Sbjct  61   VVRKKIDAVNKELKPLGQTCQKKEKEYKEALEAFNEKNKEKVQLISRLMELVGESEKLRM  120

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  121  KKLEELSKSIE  131



>ref|XP_006298664.1| hypothetical protein CARUB_v10014755mg [Capsella rubella]
 gb|EOA31562.1| hypothetical protein CARUB_v10014755mg [Capsella rubella]
Length=178

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  45   MSRTALSAFRAKEEEIEKKKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  104

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEALEAF +KN EK QL + L+ELV ESEK R+
Sbjct  105  LVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNDKNREKVQLITKLMELVGESEKMRM  164

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  165  KKLEELSKNIDSIH  178



>ref|XP_010486580.1| PREDICTED: uncharacterized protein LOC104764695 isoform X2 [Camelina 
sativa]
Length=114

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  147  MEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQAC  326
            ME++ +V++QL R E++TK LA I EELE L DPMRKEV +VRKKID+VN+ELK L    
Sbjct  1    MEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVALVRKKIDSVNKELKPLGHTV  60

Query  327  QkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVDPTH  488
            QKKE+EYKEALEAF +KN EK QL + L+ELV ESEK R+ KLEELSK +D  H
Sbjct  61   QKKEREYKEALEAFNDKNREKVQLITKLMELVGESEKMRMKKLEELSKNIDSIH  114



>ref|XP_003625766.1| hypothetical protein MTR_7g104020 [Medicago truncatula]
 gb|AES81984.1| transcriptional activator [Medicago truncatula]
Length=171

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 108/134 (81%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHI---WEELEVLTDPMRK  257
            ++R A+++F+A+EEEIEK+KMEV+ KV+ QL R E++TK LA I   ++ELE L DPMRK
Sbjct  33   MSRSALSTFRAKEEEIEKKKMEVRDKVQFQLGRVEEETKRLATIREEYQELEALADPMRK  92

Query  258  EVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEK  437
            EV +VRK+ID+VN+ELK L   CQKKEKEYK+ALEAF EKN EK QL + L+ELV ESE+
Sbjct  93   EVSLVRKRIDSVNKELKPLGHTCQKKEKEYKDALEAFNEKNREKVQLITKLMELVGESER  152

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK +D
Sbjct  153  LRMKKLEELSKNID  166



>ref|XP_009146879.1| PREDICTED: syncoilin [Brassica rapa]
Length=178

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++  V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  45   MSRTALSAFRAKEEEIEKKKMEIREMVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  104

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  105  LVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITKLMELVGESEKVRM  164

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  165  KKLEELSKNIDSIH  178



>ref|XP_007162862.1| hypothetical protein PHAVU_001G187400g [Phaseolus vulgaris]
 gb|ESW34856.1| hypothetical protein PHAVU_001G187400g [Phaseolus vulgaris]
Length=140

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 87/131 (66%), Gaps = 27/131 (21%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIE++KMEV+ KV+ QL R E++TK LA I EELE L DPMRKEV 
Sbjct  34   MSRSALSTFRAKEEEIERKKMEVREKVQLQLGRVEEETKRLATIREELEALADPMRKEVA  93

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRK+ID+VN+ELK L  ACQK                           +LV+ESE+ R+
Sbjct  94   LVRKRIDSVNKELKPLGHACQK---------------------------KLVSESERLRM  126

Query  447  GKLEELSKIVD  479
             KLEELSK VD
Sbjct  127  KKLEELSKNVD  137



>gb|KFK35874.1| hypothetical protein AALP_AA4G048100 [Arabis alpina]
Length=179

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++ +V+ QL R E++TK LA I EELE L DPMRKEV 
Sbjct  46   MSRTALSAFRAKEEEIEKKKMEIRERVQLQLGRVEEETKRLALIREELEGLADPMRKEVA  105

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  106  LVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITKLMELVGESEKMRM  165

Query  447  GKLEELSKIVDPTH  488
             KLEELSK +D  H
Sbjct  166  KKLEELSKNIDSIH  179



>ref|XP_011094404.1| PREDICTED: structural maintenance of chromosomes protein 1A [Sesamum 
indicum]
Length=172

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+KMEVK KV++QL R E++TK LA I EELE L DPM+KEV 
Sbjct  37   MSKSALSTFRAKEEEIEKKKMEVKEKVQAQLGRIEEETKRLATIREELEALADPMKKEVS  96

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VN+ELK L Q CQKKE+EYKEALEAF EKN EK QL + L+ELV+ESE+ RL
Sbjct  97   LVRKKIDAVNKELKPLGQTCQKKEREYKEALEAFNEKNKEKVQLITRLMELVSESERLRL  156

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  157  KKLEELSKNIE  167



>ref|XP_009135033.1| PREDICTED: syncoilin-like [Brassica rapa]
Length=180

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  37   MSRNALSAFRAKEEEIEKKKMEIRERVQAQLGRVEEETKRLASIREELEGLADPMRKEVA  96

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKK+D+VN+ELK L+   QKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  97   LVRKKVDSVNKELKPLSLTVQKKEREYKEALEAFNEKNREKVQLITKLMELVGESEKMRM  156

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  157  KKLEELSKNID  167



>ref|XP_004494148.1| PREDICTED: RAB6-interacting golgin-like isoform X1 [Cicer arietinum]
Length=170

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 109/134 (81%), Gaps = 3/134 (2%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHI---WEELEVLTDPMRK  257
            +++ A+++F+A+EEEIEK+KMEV+ KV+ QL R E++TK LA I   ++ELE L DPMRK
Sbjct  32   MSKSALSTFRAKEEEIEKKKMEVREKVQLQLGRVEEETKRLATIREEYQELEALADPMRK  91

Query  258  EVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEK  437
            +V +VRKKID++N+ELK L   CQKKEKEYK+ALEAF EKN EK QL + L+ELV+ESEK
Sbjct  92   DVSIVRKKIDSINKELKPLGHTCQKKEKEYKDALEAFNEKNREKVQLITKLMELVSESEK  151

Query  438  FRLGKLEELSKIVD  479
             R+ KLEELSK +D
Sbjct  152  LRMKKLEELSKNID  165



>ref|XP_010552993.1| PREDICTED: ankyrin repeat domain-containing protein 30A-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010552995.1| PREDICTED: ankyrin repeat domain-containing protein 30A-like 
isoform X2 [Tarenaya hassleriana]
Length=174

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  41   MSRSALSAFRAKEEEIEKKKMEIRERVQAQLGRVEEETKRLAMIREELEALADPMRKEVA  100

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKK+D+VN+ELK L    QKKE+EYKEALEAF EKN EK QL + L+ELV ESE+ R+
Sbjct  101  LVRKKVDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITKLMELVGESERLRM  160

Query  447  GKLEELSKIVDPTH  488
             KL+ELSK ++  H
Sbjct  161  KKLDELSKNIESIH  174



>ref|XP_010558206.1| PREDICTED: syncoilin-like [Tarenaya hassleriana]
Length=173

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  40   MSKSALSAFRAKEEEIEKKKMEIRERVQAQLGRVEEETKRLAMIREELEALADPMRKEVA  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L    QKKE+EYKEALE F EKN EK QL + L+ELV ESE+ RL
Sbjct  100  LVRKKIDSVNKELKPLGNTVQKKEREYKEALEVFNEKNREKVQLITKLMELVGESERHRL  159

Query  447  GKLEELSKIVDPTH  488
             KL+ELSK ++  H
Sbjct  160  KKLDELSKSIESIH  173



>emb|CDX74002.1| BnaA03g30450D [Brassica napus]
Length=180

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  37   MSRNALSAFRAKEEEIEKKKMEIRERVQAQLGRVEEETKRLALIREELEGLGDPMRKEVA  96

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKK+D+VN+ELK L+   QKKE+EYKEALEAF EKN EK QL + L+ELV ESEK R+
Sbjct  97   LVRKKVDSVNKELKPLSLTVQKKEREYKEALEAFNEKNREKVQLITKLMELVGESEKMRM  156

Query  447  GKLEELSKIVD  479
             KLEELSK +D
Sbjct  157  KKLEELSKNID  167



>ref|XP_004167776.1| PREDICTED: uncharacterized LOC101217540 [Cucumis sativus]
Length=134

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 12/107 (11%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++++ +++ QAREEEIE++KMEVK KVE QL RAE++ K LA IWEELEV+ DPM KEVG
Sbjct  28   VSKLTVSTLQAREEEIERKKMEVKEKVELQLTRAEEEAKRLAQIWEELEVMGDPMGKEVG  87

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTST  407
             VRK+IDTV RELKSL Q CQK            +EKN  K+++ ST
Sbjct  88   NVRKRIDTVKRELKSLGQICQK------------KEKNTRKSRIYST  122



>gb|AFK38778.1| unknown [Medicago truncatula]
 gb|KEH38961.1| transcriptional activator [Medicago truncatula]
Length=174

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R  +  F+ +EEEIE+RK+EV+ KV + L R E++TK LA I EE+E  TDP RK+V 
Sbjct  41   MSRSVLAMFREKEEEIERRKLEVRDKVHAHLGRVEKETKRLAEIREEIEGFTDPKRKDVA  100

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRK+ID VN+ELK L Q CQKKE+EY EALEAF EKN EK QL + L+ELV ESE+ R+
Sbjct  101  IVRKRIDMVNKELKPLGQTCQKKEREYNEALEAFNEKNKEKAQLVTKLVELVTESERIRM  160

Query  447  GKLEELSKIVDPTH  488
             KLE+LSK +D  H
Sbjct  161  KKLEDLSKNIDSLH  174



>emb|CDY70153.1| BnaC05g50700D [Brassica napus]
Length=175

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK KME++ +V++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  45   MSRTALSAFRAKEEEIEKNKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVA  104

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIEL  419
            +VRKKID+VN+ELK L    QKKE+EYKEALEAF EKN EK QL + L+EL
Sbjct  105  LVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITKLMEL  155



>ref|XP_004251024.1| PREDICTED: uncharacterized protein LOC101249789 [Solanum lycopersicum]
Length=172

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+EEEIE+++ EV  KV++QL R E++TK LA I E+LE   DP  KEV 
Sbjct  39   MTRSALSAFRAKEEEIERKRKEVSDKVQAQLGRVEEETKRLAEIREKLETFVDPAGKEVT  98

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VNRELK + Q CQ+KEKEYKEAL+AF  K+ EK QL + L+ELV+ESEK R+
Sbjct  99   IVRKKIDLVNRELKPMGQNCQRKEKEYKEALDAFNAKSKEKAQLVTKLMELVSESEKLRM  158

Query  447  GKLEELSKIVDPTH  488
             KLEELSK ++  H
Sbjct  159  KKLEELSKHIEALH  172



>ref|XP_002313658.2| hypothetical protein POPTR_0009s14970g [Populus trichocarpa]
 gb|EEE87613.2| hypothetical protein POPTR_0009s14970g [Populus trichocarpa]
Length=188

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 105/144 (73%), Gaps = 13/144 (9%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWE-------------E  227
            ++R A+  F+A+EEEIEK+KMEV+ KV + L R E+ TK LA I E             E
Sbjct  42   MSRSALAMFRAKEEEIEKKKMEVRDKVHAHLGRVEEATKRLAEIREVSLNIIIIYIFFLE  101

Query  228  LEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTST  407
            LE LTDPMRKEV MVRK+IDTVNRELK L  +CQKKE+EYKEALEAF +KN EK QL S 
Sbjct  102  LEALTDPMRKEVSMVRKRIDTVNRELKPLGLSCQKKEREYKEALEAFNDKNKEKAQLVSK  161

Query  408  LIELVNESEKFRLGKLEELSKIVD  479
            L+ELV ESEK R+ KLEELS+ ++
Sbjct  162  LVELVGESEKLRMKKLEELSRNIE  185



>ref|XP_006349090.1| PREDICTED: RAB6-interacting golgin-like [Solanum tuberosum]
Length=173

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+EEEIE+++ EV  KV +QL R E++TK LA I E+LE   DP  KEV 
Sbjct  40   MTRSALSAFRAKEEEIERKRKEVSDKVHAQLGRVEEETKRLAEIREKLETFVDPAGKEVT  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VNRELK + Q CQ+KEKEYKE L+AF  K+ EK QL + L+ELV+ESEK R+
Sbjct  100  IVRKKIDLVNRELKGMGQNCQRKEKEYKETLDAFNAKSKEKAQLVTKLMELVSESEKLRM  159

Query  447  GKLEELSKIVDPTH  488
             KLEELSK ++  H
Sbjct  160  KKLEELSKHIEALH  173



>ref|XP_002536212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26171.1| conserved hypothetical protein [Ricinus communis]
Length=149

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIE++K+EV+ KV++QL R E++TK LA I EELE L DPMRKEV 
Sbjct  33   MSRSALSTFRAKEEEIERKKLEVREKVQAQLGRVEEETKRLAMIREELEALADPMRKEVA  92

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIEL  419
            +VRKKID VN+ELK L    QKKEKEYKEALEAF +KN EK QL + L+E+
Sbjct  93   LVRKKIDAVNKELKPLGHTVQKKEKEYKEALEAFNDKNKEKVQLITKLMEV  143



>ref|XP_009795227.1| PREDICTED: uncharacterized protein LOC104241951 [Nicotiana sylvestris]
Length=167

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+K+EV+ KV++QL R E++T+ LA I EELE L DPM+KEV 
Sbjct  34   MSKSALSTFKAKEEEIEKKKLEVREKVQAQLGRIEEETRRLAIIREELEALADPMKKEVS  93

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRK+ID VN+ELK L Q CQKKE+EYKEALEAF EK+ EK QL S L+ELV ESEK R+
Sbjct  94   TVRKRIDAVNKELKPLGQTCQKKEREYKEALEAFNEKHKEKVQLISRLMELVGESEKMRM  153

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  154  KKLEELSKSIE  164



>ref|XP_009390019.1| PREDICTED: RAB6-interacting golgin-like [Musa acuminata subsp. 
malaccensis]
Length=173

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = +3

Query  12   QKMMMSITSVGSGGRLSMeeneeee--ITRMAITSFQAREEEIEKRKMEVKIKVESQLNR  185
            Q ++ +  SV S  R S  E E  +   +R A++SF+ +EE+IE++K+EV+ KV +QL R
Sbjct  13   QHILRARNSVRSSHRDSPSEEERADEEASRTALSSFRMKEEQIERKKIEVREKVFAQLGR  72

Query  186  AEQQTKHLAHIWEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealea  365
             E+++K LA I +ELE + DP  K+V  +RKKID VN ELK L Q C KKEKEY+EALEA
Sbjct  73   VEEESKRLAVIRKELEAMADPTSKQVSDLRKKIDAVNSELKPLGQNCLKKEKEYREALEA  132

Query  366  FQEKNNEKTQLTSTLIELVNESEKFRLGKLEELSKIVD  479
            F  KN EK QL + L+ELV+ESE  R+ KLE+LSK +D
Sbjct  133  FDGKNREKAQLVNKLMELVSESEWQRMRKLEQLSKTID  170



>gb|EYU35141.1| hypothetical protein MIMGU_mgv1a014901mg [Erythranthe guttata]
Length=174

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+KMEVK KV++QL R E++TK LA I EELE L+DPMRKEV 
Sbjct  39   MSKSALSTFRAKEEEIEKKKMEVKEKVQAQLGRIEEETKRLATIREELEGLSDPMRKEVS  98

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID+VN+ELK L   CQKKEKEYK+ALEAF +KN EK QL + L+ELV+ESE+ R+
Sbjct  99   VVRKKIDSVNKELKPLGLTCQKKEKEYKDALEAFNDKNKEKVQLITRLMELVSESERLRM  158

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  159  KKLEELSKNIE  169



>ref|XP_004246559.1| PREDICTED: uncharacterized protein LOC101267639 [Solanum lycopersicum]
Length=166

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+K+EVK KV++QL R E++T+ LA I EELE L DPM+KEV 
Sbjct  33   MSKSALSTFKAKEEEIEKKKLEVKEKVQAQLGRIEEETRRLAIIREELEALADPMKKEVS  92

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRK+ID VN+ELK L Q CQKKE+EYKEALEAF EK+ EK QL S L+ELV ESEK R+
Sbjct  93   TVRKRIDIVNKELKPLGQTCQKKEREYKEALEAFNEKHKEKVQLISRLMELVGESEKMRM  152

Query  447  GKLEELSKIVDPTH  488
             KLEELSK V+  H
Sbjct  153  KKLEELSKSVETIH  166



>ref|XP_009590693.1| PREDICTED: uncharacterized protein LOC104087837 [Nicotiana tomentosiformis]
Length=171

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+EEEIEK++ EV  KV++QL R E++TK LA I E+LE   DP  KEV 
Sbjct  38   MTRSALSAFRAKEEEIEKKRKEVSDKVQAQLGRVEEETKRLAEIREKLESFVDPAGKEVT  97

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VNRELK L Q+CQ+KEKEYKEAL+AF  K+ EK QL + L+ELV+ESEK R+
Sbjct  98   IVRKKIDLVNRELKPLGQSCQRKEKEYKEALDAFNAKSKEKAQLLTKLMELVSESEKLRM  157

Query  447  GKLEELSKIVD  479
             KLEEL+K ++
Sbjct  158  KKLEELNKHIE  168



>ref|XP_011088854.1| PREDICTED: uncharacterized protein LOC105169987 [Sesamum indicum]
Length=155

 Score =   111 bits (277),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +T  A+T+F+A EEEIE+RK+EV+ KV +QL R E++TK LA I  E+E L DPMRKEV 
Sbjct  26   MTNSALTTFRAMEEEIERRKIEVRGKVLAQLGRMEEETKRLAEIRGEIEALADPMRKEVA  85

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            ++RK+ID +NR+LK L Q+C+KKEKEYKEA+EAF EKN EK QL   L+ELV ESEK RL
Sbjct  86   VIRKRIDLINRDLKPLGQSCRKKEKEYKEAIEAFNEKNKEKGQLIGKLLELVTESEKLRL  145

Query  447  GKLEELS  467
             KLEEL 
Sbjct  146  EKLEELC  152



>gb|KCW89236.1| hypothetical protein EUGRSUZ_A01535 [Eucalyptus grandis]
Length=194

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIE++K+EV+ KV S L R E++TK LA I EELE L+DPMRKEV 
Sbjct  40   MSRSALSTFRAKEEEIERKKLEVREKVMSHLGRVEEETKRLATIREELEALSDPMRKEVA  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIEL  419
            +VRKKID VN+ELK L   CQKKE+EYKEALEA+ EKN EK  L + L+E+
Sbjct  100  LVRKKIDAVNKELKPLGHTCQKKEREYKEALEAYNEKNKEKVLLVNKLMEV  150



>ref|XP_009798512.1| PREDICTED: uncharacterized protein LOC104244734 [Nicotiana sylvestris]
Length=168

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +TR A+++F+A+EEEIEK++ EV  KV++QL R E++TK LA I E+LE   DP  KEV 
Sbjct  35   MTRSALSAFRAKEEEIEKKRKEVSDKVQAQLGRVEEETKRLAEIREKLESFVDPAGKEVT  94

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VNRELK L Q+CQ+KEKEYKEAL+AF  K+ EK QL + L+ELV+ESEK R+
Sbjct  95   IVRKKIDLVNRELKPLGQSCQRKEKEYKEALDAFNTKSKEKAQLLTKLMELVSESEKLRM  154

Query  447  GKLEELSKIVD  479
             KLEEL+K ++
Sbjct  155  KKLEELNKHIE  165



>gb|EPS60393.1| hypothetical protein M569_14410, partial [Genlisea aurea]
Length=174

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+ +F+A+EEEIEK+K+EVK KV+ QL R E++TK LA I EEL+ L DPM+KEV 
Sbjct  40   MSKSALLTFRAKEEEIEKKKLEVKEKVQVQLGRIEEETKRLATIREELDALADPMKKEVS  99

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKIDTVN++LK L   CQKKEKEYKEALEAF EKN EK QL + L+ELV+ESE+ RL
Sbjct  100  LVRKKIDTVNKDLKPLGLTCQKKEKEYKEALEAFNEKNKEKVQLITRLMELVSESERLRL  159

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  160  KKLEELSKNIE  170



>ref|XP_009804289.1| PREDICTED: uncharacterized protein LOC104249548 [Nicotiana sylvestris]
Length=170

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KMEVK +V++QL R E++T+ LA I EELE L DP +K+V 
Sbjct  37   MSRSALSTFKAKEEEIEKKKMEVKERVQAQLGRVEEETRRLAIIREELEALADPKKKDVQ  96

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKID VN+ELK L Q CQKKEKEYKEALEAF EK+ EK QL + L+ELV ESEK RL
Sbjct  97   IVRKKIDAVNKELKPLGQTCQKKEKEYKEALEAFNEKHKEKVQLITRLMELVGESEKLRL  156

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  157  KKLEELSKSIE  167



>ref|XP_009624494.1| PREDICTED: uncharacterized protein LOC104115534 [Nicotiana tomentosiformis]
Length=170

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+++F+A+EEEIEK+KMEVK +V++QL R E++T+ LA I EELE L DP +K+V 
Sbjct  37   MSRSALSTFKAKEEEIEKKKMEVKERVQAQLGRVEEETRRLAIIREELEALADPKKKDVQ  96

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRKKID VN+ELK L Q CQKKEKEYKEALEAF EK+ EK QL + L+ELV ESEK RL
Sbjct  97   FVRKKIDAVNKELKPLGQTCQKKEKEYKEALEAFNEKHKEKVQLITRLMELVGESEKLRL  156

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  157  KKLEELSKSIE  167



>ref|XP_009628857.1| PREDICTED: uncharacterized protein LOC104119140 [Nicotiana tomentosiformis]
Length=169

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+K+EVK KV++QL R E++T+ LA I EELE L DPM+KEV 
Sbjct  36   MSKSALSTFKAKEEEIEKKKLEVKEKVQAQLGRIEEETRRLAIIREELEALADPMKKEVS  95

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRK+ID VN+ELK L Q CQKKE+EYKEALEAF EK+ EK QL S L+ELV ESEK R+
Sbjct  96   TVRKRIDAVNKELKPLGQTCQKKEREYKEALEAFNEKHKEKVQLISRLMELVGESEKMRM  155

Query  447  GKLEELSKIVD  479
             KLEELSK ++
Sbjct  156  KKLEELSKSIE  166



>ref|XP_006424311.1| hypothetical protein CICLE_v10029402mg [Citrus clementina]
 gb|ESR37551.1| hypothetical protein CICLE_v10029402mg [Citrus clementina]
Length=169

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            ++R A+  F+A+EEEIEK+K+EV+ KV +QL R E+ T+ L+ I EELE L DP+RK+V 
Sbjct  36   MSRSALALFRAKEEEIEKKKVEVRDKVFAQLGRVEEATRRLSEIREELETLADPLRKDVS  95

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
            +VRKKIDT+N+ELK L   CQ+KE+EYKEALEAF +KN EK Q  S L+ELV+ESEK R+
Sbjct  96   VVRKKIDTLNKELKPLGLTCQRKEREYKEALEAFNDKNKEKAQWVSKLMELVSESEKMRM  155

Query  447  GKLEELSKIVD  479
             KLEELSK V+
Sbjct  156  KKLEELSKNVE  166



>ref|XP_006341155.1| PREDICTED: uncharacterized protein PF11_0207-like [Solanum tuberosum]
Length=166

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  87   ITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHIWEELEVLTDPMRKEVG  266
            +++ A+++F+A+EEEIEK+K+EVK KV++QL R E++T+ LA I EELE L DPM+KEV 
Sbjct  33   MSKSALSTFKAKEEEIEKKKLEVKEKVQAQLGRIEEETRRLAIIREELEALGDPMKKEVS  92

Query  267  MVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQLTSTLIELVNESEKFRL  446
             VRK+ID VN+ELK L Q CQKKE+EYKEALEAF EK+ EK QL + L+ELV ESEK R+
Sbjct  93   TVRKRIDIVNKELKPLGQTCQKKEREYKEALEAFNEKHKEKVQLITRLMELVGESEKMRM  152

Query  447  GKLEELSKIVD  479
             KLEELSK V+
Sbjct  153  KKLEELSKSVE  163



>gb|AAS79606.1| hypothetical protein [Ipomoea trifida]
 dbj|BAF37794.1| hypothetical protein [Ipomoea trifida]
Length=177

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  39   VGSGGRLSMeeneeeeITRMAITSFQAREEEIEKRKMEVKIKVESQLNRAEQQTKHLAHI  218
            +   G   M +++ EE+TR A+++F+A+EEEIE+R+ EV  +V++QL R E+++K LA I
Sbjct  28   ISYSGNNPMGDDKAEEMTRTALSTFRAKEEEIERRRKEVTDRVQAQLGRMEEESKRLAEI  87

Query  219  WEELEVLTDPMRKEVGMVRKKIDTVNRELKSLTQACQkkekeykealeaFQEKNNEKTQL  398
             E LE   DP  KE  MVRKKID V RELKSL Q CQ+KEKEYKE L+AF  K+ EK QL
Sbjct  88   REALEGFVDPAGKEAAMVRKKIDVVTRELKSLGQTCQRKEKEYKETLDAFNGKSKEKAQL  147

Query  399  TSTLIELVNESEKFRLGKLEELSKIVD  479
             + L+ELV+ESE+ R+ KLEELSK V+
Sbjct  148  ITKLMELVSESERMRMKKLEELSKNVE  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1022319201388