BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3526_g1_i1 len=1241 path=[1219:0-1240]

Length=1241
                                                                      Score     E

ref|XP_009777022.1|  PREDICTED: zeatin O-xylosyltransferase-like        387   7e-127   
ref|XP_009614885.1|  PREDICTED: zeatin O-glucosyltransferase-like       382   8e-125   
ref|XP_009624070.1|  PREDICTED: zeatin O-xylosyltransferase-like        380   2e-124   
ref|XP_009785030.1|  PREDICTED: zeatin O-glucosyltransferase-like       377   9e-123   
ref|XP_006347256.1|  PREDICTED: zeatin O-glucosyltransferase-like       367   6e-121   
ref|XP_006356394.1|  PREDICTED: zeatin O-xylosyltransferase-like        351   2e-112   
emb|CDP14139.1|  unnamed protein product                                345   6e-111   
emb|CDP14137.1|  unnamed protein product                                340   5e-109   
ref|XP_002532137.1|  UDP-glucosyltransferase, putative                  339   2e-108   Ricinus communis
emb|CDP14135.1|  unnamed protein product                                333   1e-107   
emb|CDP14134.1|  unnamed protein product                                337   2e-107   
emb|CDP14140.1|  unnamed protein product                                336   3e-107   
ref|XP_009760629.1|  PREDICTED: zeatin O-glucosyltransferase-like       335   6e-107   
emb|CDP14136.1|  unnamed protein product                                335   4e-106   
ref|XP_011075343.1|  PREDICTED: zeatin O-glucosyltransferase-like       333   8e-106   
emb|CDP14138.1|  unnamed protein product                                333   1e-105   
dbj|BAK55742.1|  UDP-glucose glucosyltransferase                        332   2e-105   
emb|CDP14133.1|  unnamed protein product                                331   4e-105   
ref|XP_011075345.1|  PREDICTED: zeatin O-glucosyltransferase-like       330   1e-104   
ref|XP_009626493.1|  PREDICTED: zeatin O-glucosyltransferase-like       329   2e-104   
ref|XP_009600543.1|  PREDICTED: zeatin O-glucosyltransferase-like       329   2e-104   
ref|XP_011078913.1|  PREDICTED: zeatin O-glucosyltransferase-like       328   8e-104   
ref|XP_011075346.1|  PREDICTED: zeatin O-glucosyltransferase-like       327   1e-103   
ref|XP_009363193.1|  PREDICTED: zeatin O-glucosyltransferase-like...    326   3e-103   
gb|AAM09516.1|AF489876_1  putative glucosyltransferase                  324   9e-103   Phaseolus lunatus
ref|XP_002284381.1|  PREDICTED: zeatin O-glucosyltransferase-like       325   1e-102   Vitis vinifera
emb|CDP12478.1|  unnamed protein product                                324   1e-102   
gb|AIE12482.1|  UGT11                                                   324   2e-102   
gb|AIE12481.1|  UGT12                                                   322   6e-102   
ref|XP_009783803.1|  PREDICTED: zeatin O-glucosyltransferase-like       320   4e-101   
ref|XP_007145587.1|  hypothetical protein PHAVU_007G251100g             320   5e-101   
emb|CDP14132.1|  unnamed protein product                                320   5e-101   
ref|XP_009777653.1|  PREDICTED: zeatin O-glucosyltransferase-like       320   1e-100   
ref|XP_007140338.1|  hypothetical protein PHAVU_008G103900g             318   3e-100   
ref|XP_010672878.1|  PREDICTED: zeatin O-glucosyltransferase-like...    318   4e-100   
ref|XP_009796347.1|  PREDICTED: zeatin O-glucosyltransferase-like       317   7e-100   
ref|XP_009586606.1|  PREDICTED: zeatin O-glucosyltransferase-like       316   1e-99    
ref|XP_007204339.1|  hypothetical protein PRUPE_ppa005515mg             317   1e-99    
ref|XP_007162168.1|  hypothetical protein PHAVU_001G129900g             317   1e-99    
ref|XP_010672879.1|  PREDICTED: zeatin O-glucosyltransferase-like...    317   1e-99    
ref|XP_006350170.1|  PREDICTED: zeatin O-glucosyltransferase-like       317   1e-99    
ref|XP_009796345.1|  PREDICTED: zeatin O-glucosyltransferase-like       316   2e-99    
ref|XP_009782889.1|  PREDICTED: zeatin O-glucosyltransferase-like       317   2e-99    
gb|KHN41707.1|  Zeatin O-glucosyltransferase                            311   2e-99    
ref|XP_008244258.1|  PREDICTED: zeatin O-glucosyltransferase-like       316   2e-99    
ref|XP_004249252.1|  PREDICTED: zeatin O-glucosyltransferase-like       316   2e-99    
ref|XP_007145589.1|  hypothetical protein PHAVU_007G251300g             315   4e-99    
ref|XP_007145586.1|  hypothetical protein PHAVU_007G251000g             315   4e-99    
ref|XP_003521165.2|  PREDICTED: zeatin O-glucosyltransferase-like       317   4e-99    
ref|XP_009595637.1|  PREDICTED: zeatin O-glucosyltransferase-like       315   4e-99    
gb|KHN07349.1|  Zeatin O-glucosyltransferase                            317   4e-99    
sp|Q9ZSK5.1|ZOG_PHALU  RecName: Full=Zeatin O-glucosyltransferase...    315   5e-99    Phaseolus lunatus
ref|XP_010269695.1|  PREDICTED: zeatin O-glucosyltransferase-like       317   6e-99    
gb|EYU20759.1|  hypothetical protein MIMGU_mgv1a017976mg                314   7e-99    
gb|KCW90130.1|  hypothetical protein EUGRSUZ_A02321                     314   1e-98    
ref|XP_009596925.1|  PREDICTED: zeatin O-glucosyltransferase-like       314   1e-98    
ref|XP_006351402.1|  PREDICTED: zeatin O-glucosyltransferase-like       314   1e-98    
gb|AAM09514.2|AF489874_1  zeatin O-glucosyltransferase                  313   2e-98    Glycine max [soybeans]
ref|XP_009589266.1|  PREDICTED: zeatin O-glucosyltransferase-like       315   2e-98    
gb|EYU18710.1|  hypothetical protein MIMGU_mgv1a005799mg                313   3e-98    
ref|XP_003535886.2|  PREDICTED: zeatin O-glucosyltransferase            313   4e-98    
ref|XP_002308926.1|  putative glucosyltransferase family protein        313   4e-98    Populus trichocarpa [western balsam poplar]
ref|XP_004237101.1|  PREDICTED: zeatin O-glucosyltransferase-like       312   5e-98    
ref|XP_006421301.1|  hypothetical protein CICLE_v10004886mg             313   5e-98    
gb|KHN14960.1|  Zeatin O-glucosyltransferase                            313   6e-98    
gb|KCW90134.1|  hypothetical protein EUGRSUZ_A02323                     312   6e-98    
ref|XP_008346617.1|  PREDICTED: zeatin O-glucosyltransferase-like       312   8e-98    
ref|XP_009363212.1|  PREDICTED: zeatin O-glucosyltransferase-like       311   9e-98    
ref|XP_009628740.1|  PREDICTED: zeatin O-glucosyltransferase-like       312   9e-98    
ref|XP_003519079.1|  PREDICTED: zeatin O-glucosyltransferase-like       311   1e-97    
ref|XP_006605211.1|  PREDICTED: zeatin O-glucosyltransferase-like       308   1e-97    
ref|XP_010056828.1|  PREDICTED: zeatin O-glucosyltransferase-like       311   1e-97    
ref|XP_003537252.1|  PREDICTED: zeatin O-glucosyltransferase-like       311   1e-97    
ref|XP_010279538.1|  PREDICTED: zeatin O-glucosyltransferase-like       312   2e-97    
ref|XP_010279537.1|  PREDICTED: zeatin O-glucosyltransferase-like       312   2e-97    
ref|XP_006356483.1|  PREDICTED: zeatin O-glucosyltransferase-like       310   4e-97    
ref|XP_007028693.1|  UDP-glucosyltransferase, putative                  310   4e-97    
ref|XP_006367370.1|  PREDICTED: zeatin O-glucosyltransferase-like       310   6e-97    
ref|XP_006475704.1|  PREDICTED: zeatin O-glucosyltransferase-like       310   7e-97    
ref|XP_009796092.1|  PREDICTED: zeatin O-glucosyltransferase-like       310   7e-97    
ref|XP_010056863.1|  PREDICTED: zeatin O-glucosyltransferase-like       310   8e-97    
ref|XP_006350111.1|  PREDICTED: zeatin O-glucosyltransferase-like       308   2e-96    
ref|XP_010279539.1|  PREDICTED: zeatin O-glucosyltransferase-like       308   4e-96    
ref|XP_009363195.1|  PREDICTED: zeatin O-glucosyltransferase-like...    307   5e-96    
ref|XP_002532135.1|  UDP-glucosyltransferase, putative                  308   6e-96    Ricinus communis
ref|XP_010056875.1|  PREDICTED: zeatin O-xylosyltransferase-like        307   6e-96    
ref|XP_010668171.1|  PREDICTED: zeatin O-glucosyltransferase-like       307   7e-96    
ref|XP_004303646.1|  PREDICTED: zeatin O-glucosyltransferase-like       307   7e-96    
ref|XP_009598914.1|  PREDICTED: zeatin O-glucosyltransferase-like       308   8e-96    
ref|XP_006351251.1|  PREDICTED: zeatin O-glucosyltransferase-like       306   8e-96    
ref|XP_010056810.1|  PREDICTED: zeatin O-glucosyltransferase-like       307   8e-96    
gb|KCW90124.1|  hypothetical protein EUGRSUZ_A02314                     306   8e-96    
ref|XP_002322723.2|  putative glucosyltransferase family protein        306   1e-95    Populus trichocarpa [western balsam poplar]
ref|XP_010672886.1|  PREDICTED: zeatin O-xylosyltransferase-like        306   2e-95    
gb|KCW90129.1|  hypothetical protein EUGRSUZ_A02320                     305   2e-95    
ref|XP_004252081.1|  PREDICTED: zeatin O-glucosyltransferase-like       305   3e-95    
ref|XP_006351248.1|  PREDICTED: zeatin O-glucosyltransferase-like       306   3e-95    
ref|XP_010056820.1|  PREDICTED: zeatin O-xylosyltransferase-like        306   4e-95    
ref|XP_009768605.1|  PREDICTED: zeatin O-glucosyltransferase-like       305   4e-95    
gb|KEH20810.1|  zeatin O-glucosyltransferase-like protein               305   5e-95    
gb|AAM09517.1|AF489877_1  putative glucosyltransferase                  304   5e-95    Phaseolus lunatus
ref|XP_011039446.1|  PREDICTED: zeatin O-glucosyltransferase-like...    305   6e-95    
ref|XP_002278696.2|  PREDICTED: zeatin O-glucosyltransferase            305   8e-95    Vitis vinifera
ref|XP_002308931.2|  putative glucosyltransferase family protein        304   8e-95    Populus trichocarpa [western balsam poplar]
ref|XP_010024031.1|  PREDICTED: zeatin O-glucosyltransferase-like       305   9e-95    
ref|XP_009625755.1|  PREDICTED: zeatin O-glucosyltransferase-like       304   9e-95    
ref|XP_010312401.1|  PREDICTED: zeatin O-glucosyltransferase-like       302   1e-94    
ref|XP_009772115.1|  PREDICTED: zeatin O-glucosyltransferase-like       296   1e-94    
ref|XP_010056748.1|  PREDICTED: zeatin O-glucosyltransferase-like       304   1e-94    
ref|XP_006351384.1|  PREDICTED: zeatin O-glucosyltransferase-like       303   2e-94    
ref|XP_007028692.1|  UDP-glucosyltransferase, putative                  304   2e-94    
ref|XP_010056886.1|  PREDICTED: zeatin O-glucosyltransferase-like       303   3e-94    
ref|XP_007145588.1|  hypothetical protein PHAVU_007G251200g             302   3e-94    
ref|XP_010671477.1|  PREDICTED: zeatin O-glucosyltransferase-like       303   3e-94    
gb|KEH40483.1|  zeatin O-glucosyltransferase-like protein               302   4e-94    
ref|XP_004498042.1|  PREDICTED: zeatin O-glucosyltransferase-like       302   4e-94    
ref|XP_004249738.1|  PREDICTED: zeatin O-glucosyltransferase-like       303   4e-94    
ref|XP_003519074.1|  PREDICTED: zeatin O-glucosyltransferase            302   6e-94    
ref|XP_010673139.1|  PREDICTED: zeatin O-glucosyltransferase-like       301   9e-94    
dbj|BAJ53203.1|  JHL06B08.4                                             301   1e-93    
gb|KDP26082.1|  hypothetical protein JCGZ_21115                         301   1e-93    
ref|XP_006349063.1|  PREDICTED: zeatin O-glucosyltransferase-like       301   2e-93    
ref|XP_006351249.1|  PREDICTED: zeatin O-glucosyltransferase-like       301   2e-93    
ref|XP_009766032.1|  PREDICTED: zeatin O-glucosyltransferase-like       300   2e-93    
ref|XP_004251002.1|  PREDICTED: zeatin O-glucosyltransferase-like       299   8e-93    
gb|KCW90127.1|  hypothetical protein EUGRSUZ_A02318                     298   1e-92    
ref|XP_006351250.1|  PREDICTED: zeatin O-glucosyltransferase-like       299   1e-92    
ref|XP_010672888.1|  PREDICTED: zeatin O-glucosyltransferase-like       298   1e-92    
ref|XP_010056814.1|  PREDICTED: zeatin O-glucosyltransferase-like       298   2e-92    
ref|XP_011048089.1|  PREDICTED: zeatin O-glucosyltransferase-like       298   2e-92    
gb|KEH28644.1|  zeatin O-glucosyltransferase-like protein               297   3e-92    
ref|XP_010092094.1|  Zeatin O-glucosyltransferase                       298   3e-92    
ref|XP_004251001.1|  PREDICTED: zeatin O-glucosyltransferase-like       297   3e-92    
gb|EYU18711.1|  hypothetical protein MIMGU_mgv1a023637mg                297   3e-92    
gb|KDP26081.1|  hypothetical protein JCGZ_21114                         297   4e-92    
dbj|BAJ53204.1|  JHL06B08.5                                             298   5e-92    
ref|XP_004168290.1|  PREDICTED: zeatin O-glucosyltransferase-like       296   5e-92    
ref|XP_004150614.1|  PREDICTED: zeatin O-glucosyltransferase-like       296   7e-92    
ref|XP_008455786.1|  PREDICTED: zeatin O-glucosyltransferase-like...    296   7e-92    
gb|AAL92461.1|  putative glucosyltransferase                            296   8e-92    Solanum lycopersicum
ref|XP_009593501.1|  PREDICTED: zeatin O-xylosyltransferase-like        296   1e-91    
gb|KCW90135.1|  hypothetical protein EUGRSUZ_A02326                     295   2e-91    
ref|XP_010673140.1|  PREDICTED: zeatin O-glucosyltransferase-like       295   3e-91    
ref|XP_006351297.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    292   3e-91    
gb|KCW86031.1|  hypothetical protein EUGRSUZ_B02735                     293   4e-91    
ref|XP_011075344.1|  PREDICTED: zeatin O-glucosyltransferase-like       296   5e-91    
ref|XP_004249229.2|  PREDICTED: zeatin O-glucosyltransferase-like       295   6e-91    
ref|XP_010024020.1|  PREDICTED: zeatin O-glucosyltransferase-like       294   6e-91    
ref|XP_010319172.1|  PREDICTED: zeatin O-glucosyltransferase-like       297   9e-91    
ref|XP_006351296.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    293   1e-90    
ref|XP_006351295.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    293   1e-90    
ref|XP_009796343.1|  PREDICTED: zeatin O-glucosyltransferase-like       293   2e-90    
ref|XP_011078914.1|  PREDICTED: zeatin O-xylosyltransferase-like        292   4e-90    
gb|KCW90138.1|  hypothetical protein EUGRSUZ_A02330                     291   4e-90    
ref|XP_006351294.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    291   1e-89    
gb|EYU20762.1|  hypothetical protein MIMGU_mgv1a027163mg                291   1e-89    
ref|XP_010672884.1|  PREDICTED: zeatin O-glucosyltransferase-like       291   1e-89    
emb|CAN74373.1|  hypothetical protein VITISV_010199                     307   4e-89    Vitis vinifera
ref|XP_010673142.1|  PREDICTED: zeatin O-glucosyltransferase-like       285   4e-89    
ref|XP_006355036.1|  PREDICTED: zeatin O-glucosyltransferase-like       290   1e-88    
ref|XP_010673138.1|  PREDICTED: zeatin O-glucosyltransferase-like       288   1e-88    
ref|XP_010112354.1|  Zeatin O-glucosyltransferase                       291   2e-88    
gb|EYU20761.1|  hypothetical protein MIMGU_mgv1a022179mg                287   2e-88    
ref|XP_010090218.1|  Zeatin O-glucosyltransferase                       288   3e-88    
gb|KCW90137.1|  hypothetical protein EUGRSUZ_A02329                     286   3e-88    
ref|XP_010090216.1|  Zeatin O-glucosyltransferase                       287   5e-88    
gb|EPS57763.1|  hypothetical protein M569_17054                         285   1e-87    
ref|XP_009779217.1|  PREDICTED: zeatin O-glucosyltransferase-like       285   2e-87    
ref|XP_009600299.1|  PREDICTED: zeatin O-glucosyltransferase-like       284   4e-87    
ref|XP_010090211.1|  Zeatin O-xylosyltransferase                        279   4e-87    
ref|XP_004236592.1|  PREDICTED: zeatin O-xylosyltransferase-like        284   5e-87    
ref|XP_010672887.1|  PREDICTED: zeatin O-glucosyltransferase-like       285   6e-87    
gb|EPS60351.1|  hypothetical protein M569_14451                         283   9e-87    
ref|XP_004251744.1|  PREDICTED: zeatin O-glucosyltransferase-like       283   1e-86    
ref|XP_006355031.1|  PREDICTED: zeatin O-glucosyltransferase-like       282   1e-86    
ref|XP_010312121.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    280   2e-86    
ref|XP_004249235.1|  PREDICTED: zeatin O-glucosyltransferase-like       281   2e-86    
ref|XP_009792172.1|  PREDICTED: zeatin O-glucosyltransferase-like       282   3e-86    
ref|XP_010319528.1|  PREDICTED: zeatin O-xylosyltransferase-like        281   4e-86    
ref|XP_010910133.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    281   5e-86    
ref|XP_010312120.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    280   6e-86    
ref|XP_010312119.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    280   9e-86    
ref|XP_004236911.1|  PREDICTED: zeatin O-xylosyltransferase-like        281   9e-86    
ref|XP_009796346.1|  PREDICTED: zeatin O-glucosyltransferase-like       281   9e-86    
ref|XP_006357999.1|  PREDICTED: zeatin O-glucosyltransferase-like       281   1e-85    
gb|EYU37237.1|  hypothetical protein MIMGU_mgv1a026906mg                280   1e-85    
ref|XP_006351401.1|  PREDICTED: zeatin O-glucosyltransferase-like       278   1e-85    
ref|XP_004243014.1|  PREDICTED: zeatin O-glucosyltransferase-like       280   2e-85    
ref|XP_006366184.1|  PREDICTED: zeatin O-glucosyltransferase-like       280   2e-85    
ref|XP_009400942.1|  PREDICTED: zeatin O-xylosyltransferase-like        280   2e-85    
ref|XP_009586605.1|  PREDICTED: zeatin O-xylosyltransferase-like        280   3e-85    
ref|XP_010312115.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    279   3e-85    
ref|XP_008455780.1|  PREDICTED: zeatin O-glucosyltransferase-like       280   3e-85    
ref|XP_004249250.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    279   4e-85    
ref|XP_009620405.1|  PREDICTED: zeatin O-xylosyltransferase-like        275   8e-85    
ref|XP_008794220.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    278   8e-85    
gb|KGN54645.1|  UDP-glucosyltransferase                                 279   8e-85    
ref|XP_011075348.1|  PREDICTED: zeatin O-glucosyltransferase-like       278   9e-85    
ref|XP_010319171.1|  PREDICTED: zeatin O-xylosyltransferase-like        274   1e-84    
gb|KCW90136.1|  hypothetical protein EUGRSUZ_A02328                     277   1e-84    
ref|XP_009766031.1|  PREDICTED: zeatin O-glucosyltransferase-like       277   2e-84    
ref|XP_004243637.1|  PREDICTED: zeatin O-xylosyltransferase-like        276   2e-84    
ref|XP_006350268.1|  PREDICTED: zeatin O-glucosyltransferase-like       277   2e-84    
gb|KHN08928.1|  Zeatin O-glucosyltransferase                            269   3e-84    
ref|XP_004236910.1|  PREDICTED: zeatin O-glucosyltransferase-like       276   3e-84    
ref|XP_004169069.1|  PREDICTED: zeatin O-glucosyltransferase-like       277   5e-84    
gb|KCW90115.1|  hypothetical protein EUGRSUZ_A02308                     275   6e-84    
ref|XP_004236593.1|  PREDICTED: zeatin O-xylosyltransferase-like        275   2e-83    
ref|XP_009774568.1|  PREDICTED: zeatin O-glucosyltransferase-like       268   2e-83    
ref|XP_004241956.1|  PREDICTED: zeatin O-glucosyltransferase-like       275   2e-83    
ref|XP_010090213.1|  Zeatin O-xylosyltransferase                        275   3e-83    
gb|KHN43714.1|  Zeatin O-glucosyltransferase                            266   3e-83    
gb|KGN54644.1|  hypothetical protein Csa_4G415920                       275   3e-83    
ref|XP_004239467.1|  PREDICTED: zeatin O-glucosyltransferase-like       273   4e-83    
ref|XP_004150609.1|  PREDICTED: zeatin O-glucosyltransferase-like       272   2e-82    
gb|EYU18707.1|  hypothetical protein MIMGU_mgv1a005868mg                272   2e-82    
ref|XP_004169070.1|  PREDICTED: zeatin O-glucosyltransferase-like       271   4e-82    
ref|XP_009611304.1|  PREDICTED: zeatin O-glucosyltransferase-like       272   4e-82    
gb|EYU18708.1|  hypothetical protein MIMGU_mgv1a019962mg                271   5e-82    
ref|XP_009390153.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    271   6e-82    
ref|XP_010090197.1|  Zeatin O-xylosyltransferase                        264   7e-82    
ref|XP_004150612.1|  PREDICTED: zeatin O-glucosyltransferase-like       271   7e-82    
gb|KDO36524.1|  hypothetical protein CISIN_1g039436mg                   269   1e-81    
ref|XP_009796221.1|  PREDICTED: zeatin O-xylosyltransferase-like        265   1e-81    
ref|XP_008455787.1|  PREDICTED: zeatin O-glucosyltransferase-like...    268   3e-81    
ref|XP_010918854.1|  PREDICTED: zeatin O-glucosyltransferase-like       269   5e-81    
ref|XP_010918553.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    268   6e-81    
ref|XP_010322862.1|  PREDICTED: zeatin O-glucosyltransferase-like       268   1e-80    
ref|XP_006355035.1|  PREDICTED: zeatin O-glucosyltransferase-like       267   4e-80    
ref|XP_008806810.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    265   1e-79    
ref|XP_008808448.1|  PREDICTED: zeatin O-glucosyltransferase-like       265   1e-79    
ref|XP_009390437.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    265   2e-79    
gb|EYU18709.1|  hypothetical protein MIMGU_mgv1a024073mg                261   2e-78    
ref|XP_004253377.1|  PREDICTED: zeatin O-glucosyltransferase-like       259   2e-77    
ref|XP_009620160.1|  PREDICTED: zeatin O-glucosyltransferase-like...    258   3e-77    
ref|XP_009620161.1|  PREDICTED: zeatin O-glucosyltransferase-like...    258   6e-77    
ref|XP_008455779.1|  PREDICTED: zeatin O-xylosyltransferase-like        257   2e-76    
ref|XP_009762775.1|  PREDICTED: zeatin O-glucosyltransferase-like       249   1e-73    
ref|XP_004252079.1|  PREDICTED: zeatin O-glucosyltransferase-like       248   1e-73    
gb|EPS66453.1|  hypothetical protein M569_08324                         248   2e-73    
gb|EYU18712.1|  hypothetical protein MIMGU_mgv1a004882mg                249   3e-73    
ref|XP_006358040.1|  PREDICTED: zeatin O-xylosyltransferase-like        236   4e-72    
ref|XP_006854306.1|  hypothetical protein AMTR_s00039p00102080          245   6e-72    
ref|XP_004240222.1|  PREDICTED: zeatin O-glucosyltransferase-like       238   2e-70    
ref|XP_004240219.1|  PREDICTED: zeatin O-xylosyltransferase-like        237   4e-69    
ref|XP_002448305.1|  hypothetical protein SORBIDRAFT_06g024960          233   1e-67    Sorghum bicolor [broomcorn]
ref|NP_001141165.1|  uncharacterized protein LOC100273251               233   1e-67    Zea mays [maize]
tpg|DAA36500.1|  TPA: cis-zeatin O-glucosyltransferase                  233   2e-67    
ref|XP_003580302.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    231   8e-67    
ref|XP_002448302.1|  hypothetical protein SORBIDRAFT_06g024930          232   9e-67    Sorghum bicolor [broomcorn]
ref|XP_004975978.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    231   9e-67    
ref|XP_004976466.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    228   8e-66    
ref|XP_006854316.1|  hypothetical protein AMTR_s00039p00113770          228   9e-66    
ref|XP_003562518.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    228   1e-65    
ref|NP_001060532.1|  Os07g0660500                                       228   1e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004958585.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    228   1e-65    
gb|EMT20809.1|  Putative cis-zeatin O-glucosyltransferase               225   2e-64    
gb|AGT16462.1|  cis-zeatin O-glucosyltransferase                        221   5e-64    
gb|ACB88212.1|  UFGT3                                                   223   6e-64    
ref|XP_002437484.1|  hypothetical protein SORBIDRAFT_10g027940          223   6e-64    Sorghum bicolor [broomcorn]
gb|EMT11093.1|  Cis-zeatin O-glucosyltransferase 1                      219   7e-64    
ref|NP_001053527.1|  Os04g0556600                                       223   1e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009603993.1|  PREDICTED: zeatin O-xylosyltransferase-like        224   3e-63    
ref|XP_006652626.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    221   4e-63    
ref|XP_006652647.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    221   4e-63    
dbj|BAK03215.1|  predicted protein                                      221   5e-63    
ref|XP_008657045.1|  PREDICTED: cis-zeatin O-glucosyltransferase 2      221   5e-63    
gb|EMT11108.1|  Cis-zeatin O-glucosyltransferase 2                      221   6e-63    
gb|ABR17639.1|  unknown                                                 221   8e-63    Picea sitchensis
emb|CAH67401.1|  OSIGBa0137D06.2                                        220   1e-62    Oryza sativa [red rice]
gb|ACD03254.1|  UDP-glycosyltransferase UGT93B9                         220   1e-62    Avena strigosa
sp|Q6JAH0.1|CZOG_SORBI  RecName: Full=Putative cis-zeatin O-gluco...    219   2e-62    Sorghum bicolor [broomcorn]
ref|XP_002448306.1|  hypothetical protein SORBIDRAFT_06g024970          219   2e-62    Sorghum bicolor [broomcorn]
ref|XP_004976465.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    219   2e-62    
dbj|BAJ94231.1|  predicted protein                                      219   2e-62    
gb|AAT42163.1|  putative cis-zeatin O-glucosyltransferase               219   3e-62    Sorghum bicolor [broomcorn]
ref|NP_001105017.1|  cis-zeatin O-glucosyltransferase 1                 219   3e-62    Zea mays [maize]
gb|ADG56506.1|  putative cis-zeatin O-glucosyltransferase               219   4e-62    
gb|AAL75980.1|AF466203_9  putative cis-zeatin O-glucosyltransferase     219   4e-62    Zea mays [maize]
gb|KGN43909.1|  hypothetical protein Csa_7G073450                       219   5e-62    
tpg|DAA36492.1|  TPA: cis-zeatin O-glucosyltransferase 1                219   5e-62    
gb|AEV76976.1|  cis-zeatin O-glucosyltransferase 1                      218   5e-62    
ref|XP_008670630.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    218   6e-62    
emb|CAH67400.1|  OSIGBa0137D06.1                                        218   7e-62    
ref|NP_001053526.1|  Os04g0556500                                       218   7e-62    
ref|NP_001053572.1|  Os04g0565200                                       218   9e-62    
ref|XP_003580303.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    217   1e-61    
gb|EAY95124.1|  hypothetical protein OsI_16941                          217   2e-61    
ref|XP_003565056.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    217   2e-61    
emb|CAH66756.1|  OSIGBa0158F05.5                                        217   2e-61    
dbj|BAJ89478.1|  predicted protein                                      217   2e-61    
ref|XP_002448304.1|  hypothetical protein SORBIDRAFT_06g024946          217   2e-61    
gb|AGT16463.1|  cis-zeatin O-glucosyltransferase                        216   4e-61    
ref|XP_004978175.1|  PREDICTED: uncharacterized protein LOC101764819    223   4e-61    
gb|EAY95122.1|  hypothetical protein OsI_16939                          215   8e-61    
ref|XP_004976467.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    215   1e-60    
ref|XP_008454970.1|  PREDICTED: scopoletin glucosyltransferase-like     214   2e-60    
emb|CBI29809.3|  unnamed protein product                                221   2e-60    
ref|XP_004252080.1|  PREDICTED: zeatin O-glucosyltransferase-like       206   3e-60    
ref|XP_002446275.1|  hypothetical protein SORBIDRAFT_06g012280          213   5e-60    
gb|EMT30722.1|  hypothetical protein F775_52510                         212   1e-59    
gb|ACD03259.1|  UDP-glycosyltransferase UGT93B8                         211   3e-59    
ref|NP_001053574.1|  Os04g0565400                                       211   3e-59    
ref|XP_004140708.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    211   5e-59    
ref|XP_009762776.1|  PREDICTED: zeatin O-glucosyltransferase-like       205   7e-59    
ref|XP_008667332.1|  PREDICTED: hypothetical protein isoform X1         210   8e-59    
ref|NP_001136576.1|  hypothetical protein                               210   8e-59    
gb|ACD03239.1|  UDP-glycosyltransferase                                 207   1e-58    
ref|XP_011009740.1|  PREDICTED: scopoletin glucosyltransferase-like     207   1e-58    
gb|KHN12232.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7         204   1e-58    
gb|KGN43914.1|  hypothetical protein Csa_7G073500                       209   1e-58    
ref|XP_003580304.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    209   3e-58    
ref|XP_002446923.1|  hypothetical protein SORBIDRAFT_06g024950          208   3e-58    
dbj|BAJ89296.1|  predicted protein                                      208   5e-58    
ref|XP_011000136.1|  PREDICTED: scopoletin glucosyltransferase-like     207   1e-57    
ref|XP_004159901.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       207   1e-57    
ref|XP_003518714.1|  PREDICTED: scopoletin glucosyltransferase-like     207   2e-57    
ref|XP_008456146.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    206   2e-57    
ref|XP_008454968.1|  PREDICTED: scopoletin glucosyltransferase-like     206   3e-57    
emb|CDM83291.1|  unnamed protein product                                205   4e-57    
gb|KCW55167.1|  hypothetical protein EUGRSUZ_I01123                     204   5e-57    
gb|KHN12236.1|  UDP-glycosyltransferase 73B3                            204   6e-57    
ref|XP_008454967.1|  PREDICTED: scopoletin glucosyltransferase-like     205   7e-57    
ref|XP_006369755.1|  hypothetical protein POPTR_0001s31040g             205   8e-57    
ref|XP_004137108.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    205   1e-56    
ref|XP_002867135.1|  predicted protein                                  204   1e-56    
ref|XP_003518710.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      204   1e-56    
ref|XP_004137110.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    209   3e-56    
ref|XP_002463331.1|  hypothetical protein SORBIDRAFT_02g041935          203   4e-56    
ref|XP_003580300.2|  PREDICTED: cis-zeatin O-glucosyltransferase ...    204   4e-56    
gb|KGN43913.1|  hypothetical protein Csa_7G073490                       203   5e-56    
ref|XP_004137109.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       203   5e-56    
gb|EMS51286.1|  Cis-zeatin O-glucosyltransferase 1                      196   5e-56    
gb|EEE67749.1|  hypothetical protein OsJ_25448                          202   8e-56    
ref|XP_010028421.1|  PREDICTED: scopoletin glucosyltransferase-like     202   1e-55    
ref|XP_002518719.1|  UDP-glucosyltransferase, putative                  202   1e-55    
gb|ABK25199.1|  unknown                                                 201   1e-55    
ref|XP_007198987.1|  hypothetical protein PRUPE_ppa019354mg             201   1e-55    
dbj|BAA83484.1|  UDP-glucose: flavonoid 7-O-glucosyltransferase         201   2e-55    
dbj|BAF75887.1|  tetrahydroxychalcone glucosyltransferase               201   3e-55    
ref|XP_009108748.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       201   5e-55    
emb|CDY13143.1|  BnaA09g16740D                                          200   5e-55    
ref|XP_006412271.1|  hypothetical protein EUTSA_v10025048mg             200   5e-55    
emb|CDY65497.1|  BnaCnng47320D                                          200   6e-55    
ref|XP_002298734.2|  hypothetical protein POPTR_0001s31120g             200   6e-55    
gb|ABK24743.1|  unknown                                                 200   7e-55    
ref|XP_011000877.1|  PREDICTED: scopoletin glucosyltransferase-like     199   9e-55    
gb|ADV71369.1|  glycosyltransferase GT14A05                             199   1e-54    
ref|XP_006368054.1|  PREDICTED: zeatin O-glucosyltransferase-like       193   1e-54    
ref|XP_002518723.1|  UDP-glucosyltransferase, putative                  199   2e-54    
ref|XP_002518725.1|  UDP-glucosyltransferase, putative                  199   2e-54    
gb|ACJ72160.1|  UGT3                                                    198   2e-54    
emb|CDX89662.1|  BnaC03g45760D                                          198   2e-54    
ref|XP_010905295.1|  PREDICTED: scopoletin glucosyltransferase-like     198   2e-54    
ref|XP_003518715.1|  PREDICTED: scopoletin glucosyltransferase-like     198   2e-54    
gb|EYU37652.1|  hypothetical protein MIMGU_mgv1a005524mg                198   3e-54    
ref|XP_010028419.1|  PREDICTED: scopoletin glucosyltransferase-like     196   3e-54    
ref|XP_006379195.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    198   4e-54    
gb|AEV76977.1|  cis-zeatin O-glucosyltransferase 2a                     197   4e-54    
ref|XP_002518724.1|  UDP-glucosyltransferase, putative                  198   4e-54    
ref|XP_006286265.1|  hypothetical protein CARUB_v10007840mg             197   5e-54    
ref|XP_007042490.1|  Anthocyanin 3'-O-beta-glucosyltransferase          197   5e-54    
gb|AID60125.1|  UDP-glucosyl transferase 73B2                           197   5e-54    
emb|CDY65498.1|  BnaCnng47330D                                          197   5e-54    
ref|XP_008236561.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    197   6e-54    
ref|XP_007014491.1|  UDP-glucosyl transferase 73B3, putative            196   7e-54    
gb|KFK30052.1|  hypothetical protein AALP_AA7G210700                    197   8e-54    
dbj|BAJ11652.1|  glucosyltransferase                                    197   8e-54    
ref|XP_007200246.1|  hypothetical protein PRUPE_ppa015133mg             196   9e-54    
ref|XP_009108751.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      197   9e-54    
ref|XP_009136271.1|  PREDICTED: UDP-glycosyltransferase 73B5-like       197   1e-53    
gb|KFK30045.1|  hypothetical protein AALP_AA7G209900                    196   1e-53    
gb|KCW55161.1|  hypothetical protein EUGRSUZ_I01116                     196   1e-53    
ref|XP_007042483.1|  UDP-glucosyl transferase 73B3, putative            196   1e-53    
gb|KFK30050.1|  hypothetical protein AALP_AA7G210500                    196   1e-53    
ref|XP_007042482.1|  UDP-glucosyl transferase 73B3, putative            196   1e-53    
emb|CDX76261.1|  BnaA08g11390D                                          196   2e-53    
ref|XP_010107891.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    196   2e-53    
ref|XP_010048320.1|  PREDICTED: scopoletin glucosyltransferase-like     196   2e-53    
emb|CDX76263.1|  BnaA08g11370D                                          196   2e-53    
ref|XP_007153573.1|  hypothetical protein PHAVU_003G046900g             196   2e-53    
ref|XP_009108750.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      196   2e-53    
gb|KDP24998.1|  hypothetical protein JCGZ_23981                         190   2e-53    
ref|NP_567953.1|  UDP-glucosyl transferase 73B3                         195   3e-53    
gb|ACO44747.1|  UDP glycosyltransferase                                 195   4e-53    
ref|XP_011088227.1|  PREDICTED: scopoletin glucosyltransferase-like     195   4e-53    
emb|CDX69028.1|  BnaC01g04250D                                          195   5e-53    
gb|AFJ52930.1|  UDP-glycosyltransferase 1                               195   5e-53    
ref|XP_004230753.1|  PREDICTED: scopoletin glucosyltransferase-like     195   5e-53    
ref|XP_007042484.1|  UDP-glucosyl transferase 73B3                      195   6e-53    
gb|KDP24996.1|  hypothetical protein JCGZ_23979                         192   6e-53    
ref|XP_011000140.1|  PREDICTED: scopoletin glucosyltransferase-like     194   7e-53    
gb|AFJ52946.1|  UDP-glycosyltransferase 1                               194   8e-53    
ref|XP_006409549.1|  hypothetical protein EUTSA_v10022663mg             194   1e-52    
ref|XP_011013100.1|  PREDICTED: scopoletin glucosyltransferase-like     194   1e-52    
ref|XP_002518708.1|  UDP-glucosyltransferase, putative                  194   1e-52    
ref|XP_004230756.2|  PREDICTED: scopoletin glucosyltransferase-like     194   1e-52    
ref|XP_010432461.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       194   1e-52    
ref|XP_010057243.1|  PREDICTED: scopoletin glucosyltransferase-like     194   1e-52    
ref|XP_004305941.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    194   1e-52    
emb|CAA17559.1|  glucosyltransferase-like protein                       194   1e-52    
ref|XP_002883898.1|  UGT73B4                                            194   1e-52    
gb|KCW55162.1|  hypothetical protein EUGRSUZ_I01117                     194   1e-52    
ref|XP_010107899.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    193   1e-52    
gb|KGN43915.1|  hypothetical protein Csa_7G073510                       194   2e-52    
sp|Q9AT54.1|SCGT_TOBAC  RecName: Full=Scopoletin glucosyltransfer...    193   2e-52    
gb|AFJ52947.1|  UDP-glycosyltransferase 1                               194   2e-52    
ref|XP_010530755.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      193   2e-52    
ref|XP_007011136.1|  UDP-glucosyl transferase 73B3                      193   2e-52    
emb|CDX69029.1|  BnaC01g04240D                                          193   2e-52    
ref|XP_002883897.1|  UDP-glucosyl transferase 73B5                      193   2e-52    
ref|XP_010028420.1|  PREDICTED: scopoletin glucosyltransferase-like     194   2e-52    
ref|XP_010530757.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      193   2e-52    
ref|XP_010447136.1|  PREDICTED: UDP-glycosyltransferase 73B1 isof...    193   3e-52    
ref|XP_006412270.1|  hypothetical protein EUTSA_v10024935mg             193   3e-52    
emb|CDX76262.1|  BnaA08g11380D                                          192   3e-52    
ref|XP_004159929.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucose ...    192   3e-52    
gb|KFK40015.1|  hypothetical protein AALP_AA3G318900                    192   3e-52    
ref|XP_009761805.1|  PREDICTED: scopoletin glucosyltransferase          192   3e-52    
ref|XP_007019541.1|  UDP-glucosyl transferase 73B3, putative            187   3e-52    
ref|XP_011000135.1|  PREDICTED: scopoletin glucosyltransferase-like     192   4e-52    
gb|KDP25000.1|  hypothetical protein JCGZ_23983                         192   4e-52    
ref|XP_007199157.1|  hypothetical protein PRUPE_ppa019699mg             192   4e-52    
ref|XP_010437661.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       192   4e-52    
ref|XP_007201142.1|  hypothetical protein PRUPE_ppa016033mg             192   5e-52    
ref|XP_010447141.1|  PREDICTED: UDP-glycosyltransferase 73B3 isof...    192   5e-52    
ref|XP_004304025.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    192   5e-52    
ref|XP_007153575.1|  hypothetical protein PHAVU_003G047100g             192   5e-52    
dbj|BAG31952.1|  UGT73A13                                               192   5e-52    
ref|XP_007011132.1|  UDP-glucosyl transferase 73B3                      192   6e-52    
ref|XP_011088224.1|  PREDICTED: scopoletin glucosyltransferase-like     192   6e-52    
gb|KDP25001.1|  hypothetical protein JCGZ_23984                         192   6e-52    
gb|AFJ52944.1|  UDP-glycosyltransferase 1                               192   7e-52    
ref|XP_010027865.1|  PREDICTED: scopoletin glucosyltransferase-like     192   7e-52    
ref|XP_002518718.1|  UDP-glucosyltransferase, putative                  192   7e-52    
ref|XP_010488962.1|  PREDICTED: UDP-glycosyltransferase 73B4-like       192   7e-52    
dbj|BAB86926.1|  glucosyltransferase-8                                  192   8e-52    
gb|AFK79034.1|  glycosyltransferase UGT2                                191   8e-52    
ref|XP_004307464.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    192   8e-52    
dbj|BAD29722.1|  UDP-glucose glucosyltransferase                        192   9e-52    
ref|XP_009119412.1|  PREDICTED: UDP-glycosyltransferase 73B5            191   9e-52    
ref|NP_001189529.1|  UDP-glycosyltransferase 73B4                       191   9e-52    
ref|XP_010488961.1|  PREDICTED: UDP-glycosyltransferase 73B5-like       191   9e-52    
gb|AAD17393.1|  putative glucosyltransferase                            191   1e-51    
dbj|BAF75890.1|  tetrahydroxychalcone glucosyltransferase               191   1e-51    
ref|XP_010467302.1|  PREDICTED: UDP-glycosyltransferase 73B4-like       191   1e-51    
ref|XP_002298737.1|  hypothetical protein POPTR_0001s30980g             191   1e-51    
ref|XP_007029404.1|  Anthocyanin 3'-O-beta-glucosyltransferase, p...    191   1e-51    
ref|XP_010107900.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    191   1e-51    
ref|XP_009354715.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    191   1e-51    
ref|XP_004979487.1|  PREDICTED: UDP-glycosyltransferase 72B3-like       191   1e-51    
ref|XP_009792742.1|  PREDICTED: scopoletin glucosyltransferase-like     191   1e-51    
emb|CDY36633.1|  BnaA07g04240D                                          191   1e-51    
ref|XP_006346389.1|  PREDICTED: scopoletin glucosyltransferase-like     191   2e-51    
ref|XP_009622522.1|  PREDICTED: scopoletin glucosyltransferase          191   2e-51    
ref|XP_008454969.1|  PREDICTED: scopoletin glucosyltransferase-like     191   2e-51    
ref|XP_010107895.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    191   2e-51    
gb|ADO33118.1|  UDP glucosyltransferase                                 191   2e-51    
ref|XP_009116435.1|  PREDICTED: UDP-glycosyltransferase 73B1            191   2e-51    
ref|XP_011088741.1|  PREDICTED: scopoletin glucosyltransferase-like     191   2e-51    
ref|XP_010066005.1|  PREDICTED: scopoletin glucosyltransferase-like     191   2e-51    
gb|AID60126.1|  UDP-glucosyl transferase 73B1                           191   2e-51    
ref|XP_004505253.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      190   2e-51    
ref|XP_010518197.1|  PREDICTED: UDP-glycosyltransferase 73B5            190   2e-51    
ref|NP_567955.1|  UDP-glucosyl transferase 73B1                         190   2e-51    
ref|NP_179151.2|  UDP-glycosyltransferase 73B4                          190   3e-51    
ref|XP_004230759.1|  PREDICTED: scopoletin glucosyltransferase          190   3e-51    
ref|XP_010066837.1|  PREDICTED: scopoletin glucosyltransferase-like     190   3e-51    
gb|EMS67468.1|  Cis-zeatin O-glucosyltransferase 1                      189   3e-51    
ref|XP_008375155.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    190   3e-51    
ref|XP_010027867.1|  PREDICTED: scopoletin glucosyltransferase-like     190   3e-51    
ref|XP_010530759.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      190   3e-51    
ref|XP_010526965.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      190   3e-51    
ref|XP_010068743.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    186   3e-51    
gb|KCW54535.1|  hypothetical protein EUGRSUZ_I00492                     188   3e-51    
gb|AFJ52931.1|  UDP-glycosyltransferase 1                               190   3e-51    
gb|AAK28304.1|AF346432_1  phenylpropanoid:glucosyltransferase 2         190   4e-51    
ref|XP_002298733.1|  hypothetical protein POPTR_0001s31130g             190   4e-51    
ref|XP_006346519.1|  PREDICTED: scopoletin glucosyltransferase-like     193   4e-51    
gb|KCW54502.1|  hypothetical protein EUGRSUZ_I00446                     189   4e-51    
ref|XP_006384097.1|  hypothetical protein POPTR_0004s06830g             186   4e-51    
gb|ABR18451.1|  unknown                                                 189   5e-51    
ref|XP_002313131.2|  hypothetical protein POPTR_0009s10190g             189   5e-51    
ref|XP_009117049.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       189   6e-51    
ref|XP_004304714.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    189   6e-51    
gb|AID60124.1|  UDP-glucosyl transferase 73B3                           189   6e-51    
ref|XP_002867133.1|  UDP-glucosyl transferase 73B1                      189   6e-51    
ref|XP_002282463.1|  PREDICTED: scopoletin glucosyltransferase          189   7e-51    
ref|XP_011088228.1|  PREDICTED: scopoletin glucosyltransferase-like     189   7e-51    
ref|XP_010027864.1|  PREDICTED: scopoletin glucosyltransferase-like     189   7e-51    
ref|XP_010030421.1|  PREDICTED: scopoletin glucosyltransferase-like     189   7e-51    
emb|CAN65903.1|  hypothetical protein VITISV_004870                     189   7e-51    
ref|XP_008358617.1|  PREDICTED: scopoletin glucosyltransferase-like     189   8e-51    
ref|XP_003628776.1|  Glucosyltransferase                                189   8e-51    
emb|CDX75399.1|  BnaA01g03030D                                          189   8e-51    
gb|KDP24997.1|  hypothetical protein JCGZ_23980                         189   9e-51    
ref|XP_006854284.1|  hypothetical protein AMTR_s00039p00077500          181   9e-51    
emb|CAA59450.1|  twi1                                                   188   9e-51    
ref|XP_002313133.1|  hypothetical protein POPTR_0009s10120g             189   9e-51    
ref|XP_010432459.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       189   9e-51    



>ref|XP_009777022.1| PREDICTED: zeatin O-xylosyltransferase-like [Nicotiana sylvestris]
Length=479

 Score =   387 bits (994),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 177/341 (52%), Positives = 241/341 (71%), Gaps = 14/341 (4%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF  +S++WE + K  H+P FL    G+F+      +P +LP+  S + 
Sbjct  152   NVEAYCFRAVSAFTTSSILWEGIEKFFHLPKFL----GKFIATKFLKIPQQLPLLESSFT  207

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E   FI  Q + N  C GNLFD C+ IEGP+L+ L  +++L R+G  W IGPFNP+  +
Sbjct  208   QELLDFIFMQDRHNNICSGNLFDTCKVIEGPFLESLEKLHRLLRRGNQWAIGPFNPIKIQ  267

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +++K           HKCL WLDKQ P SVI VSFGT + LS  Q+ ELA GLE+S Q F
Sbjct  268   KDSKN---------CHKCLRWLDKQEPNSVILVSFGTTSSLSSEQIKELAIGLEKSNQKF  318

Query  546   IWVVKDLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSC  725
             IWVV+D+  G ++ ++N+P G+EER+EGRG+I++DW PQ EIL H STGGFL+HCGWNSC
Sbjct  319   IWVVRDVLLG-EDEEVNIPNGYEERIEGRGIIVKDWAPQFEILGHSSTGGFLSHCGWNSC  377

Query  726   MESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMA  905
             MES+  GVP+ATWP+ +DQPRNA+L+T VLK GI +KDWE  +++ +STTI N +R+LM 
Sbjct  378   MESITMGVPIATWPMSFDQPRNAVLVTNVLKIGIVVKDWEHCEDLVSSTTIENVVRKLMV  437

Query  906   SPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             S EG E+R +A E G+ V+ES+M+GGIS++EMD+FI+H+TR
Sbjct  438   SSEGNEMRKRAMEFGKKVRESMMDGGISKMEMDSFISHVTR  478



>ref|XP_009614885.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=492

 Score =   382 bits (981),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 180/342 (53%), Positives = 240/342 (70%), Gaps = 8/342 (2%)
 Frame = +3

Query  3     QNHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             +N E Y F   SAF ++SL+W++++  LH+PSFL KL  +  LP+GA +PD LP   S +
Sbjct  158   KNAEAYCFHAISAFANSSLLWDIIKYYLHLPSFLSKLAKKLFLPSGAHIPDGLPTLRSTF  217

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              PEF +F+  Q   N F  GNL+D C+ +EGPYL+ LA   +L      W +GPFNPV  
Sbjct  218   TPEFIEFMRLQHSCNKFSSGNLYDTCKVLEGPYLETLAKFSRLLGIRKQWAVGPFNPV--  275

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                   ++DS     RHKCLEWLDKQ   SVI VSFGT   LS  Q+ ELA GLE+S Q 
Sbjct  276   --TISGEKDSKV---RHKCLEWLDKQAQNSVILVSFGTTGYLSMEQIKELAIGLEKSQQK  330

Query  543   FIWVVKDLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNS  722
             FIWVV+DL  G +  ++ +P G+EERV+ RG+I++DW PQLEIL H STGGF++HCGWNS
Sbjct  331   FIWVVRDLLSGGEG-EVRIPEGYEERVKERGIIVKDWAPQLEILAHSSTGGFISHCGWNS  389

Query  723   CMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLM  902
             CMES+  GVP+ATWP+ +DQPRNA+ +T+VLK G+ +K+W+ RD++  S+TI+N +  LM
Sbjct  390   CMESITMGVPIATWPMNFDQPRNAVFVTDVLKIGVVVKNWDRRDDMIDSSTIKNVVENLM  449

Query  903   ASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             AS EG E+R +A E G+ VKESV +GG  + EMD+FIAH+TR
Sbjct  450   ASTEGHEMRMRAMELGKQVKESVKDGGDHQKEMDSFIAHVTR  491



>ref|XP_009624070.1| PREDICTED: zeatin O-xylosyltransferase-like [Nicotiana tomentosiformis]
Length=479

 Score =   380 bits (977),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/341 (51%), Positives = 241/341 (71%), Gaps = 14/341 (4%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF  +S++WE + K  H+P FL    G+F+      +P +LP   S + 
Sbjct  152   NVEAYCFRAVSAFTTSSILWEGIEKFFHLPKFL----GKFIATKLLKIPQQLPSLESSFT  207

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E   FI  Q + +  C GNLFD C+ IEG +L+ L  +++L R+G  W IGPFNP+  +
Sbjct  208   QELLHFIFMQDRHHNICSGNLFDTCKVIEGSFLESLEKLHRLLRRGNQWAIGPFNPIKIQ  267

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +++K           HKCL+WLDKQ P SVI VSFGT + LS  Q+ ELA GLE+S Q F
Sbjct  268   KDSKNC---------HKCLKWLDKQEPNSVILVSFGTTSSLSSEQIKELAIGLEKSNQKF  318

Query  546   IWVVKDLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSC  725
             IWVV+D+  G +  ++N+P G+EER+EGRG++++DW PQ EIL H STGGFL+HCGWNSC
Sbjct  319   IWVVRDVLLG-EGEEVNIPNGYEERIEGRGIVIKDWAPQFEILAHSSTGGFLSHCGWNSC  377

Query  726   MESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMA  905
             MES+  GVP+ATWP+ +DQPRNA+L+T VLK GI +KDWE  +++ TST I NA+R+LMA
Sbjct  378   MESITMGVPIATWPMSFDQPRNAVLVTNVLKIGIVVKDWEHCEDLVTSTKIENAVRKLMA  437

Query  906   SPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             S EG+E+R +A E G+ V+ES+M+GG+SR+EMD+FI+++TR
Sbjct  438   SQEGDEMRKRAMEFGKKVRESMMDGGVSRMEMDSFISYVTR  478



>ref|XP_009785030.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=481

 Score =   377 bits (967),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 179/342 (52%), Positives = 237/342 (69%), Gaps = 8/342 (2%)
 Frame = +3

Query  3     QNHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             +N E Y F   SAF ++SL+W++++  LH+PSFL KL  +  LP+G  +PD LP   S +
Sbjct  147   KNAEAYCFHAISAFANSSLLWDIIKYYLHLPSFLAKLAKKLFLPSGVHLPDGLPTLRSTF  206

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              PEF +F+  Q   N F  GNL+D C+ +EGPYL+ LA   +L      W +GPFNPV  
Sbjct  207   TPEFIEFMRLQFSCNKFSSGNLYDTCKVLEGPYLETLAKFSRLLGIRKQWAVGPFNPV--  264

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                  T +DS     RHKCLEWLDKQ   SVI VSFGT   LS  Q+ ELA GLE+S Q 
Sbjct  265   --TISTGKDSKV---RHKCLEWLDKQSQNSVILVSFGTTGYLSMEQIKELAIGLEKSQQK  319

Query  543   FIWVVKDLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNS  722
             FIWVV+D+  G +  ++ +P G+EERV+ RG+I++DW PQLEIL H STGGF++HCGWNS
Sbjct  320   FIWVVRDVLSGGEG-EVRIPEGYEERVKERGIIVKDWAPQLEILAHSSTGGFMSHCGWNS  378

Query  723   CMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLM  902
             CMES+  GVP+ATW +++DQPRNA+ +T VLK G+ +K W+  D+I  S TI+NA+  LM
Sbjct  379   CMESITMGVPIATWSMRFDQPRNAVFVTNVLKIGVVVKHWDRSDDIIDSCTIKNAVENLM  438

Query  903   ASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             AS EG E+R +A E G+ VKESV +GG  +LEMD+FI+H+TR
Sbjct  439   ASTEGHEMRMRAMELGKQVKESVKDGGDHQLEMDSFISHVTR  480



>ref|XP_006347256.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=336

 Score =   367 bits (941),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 174/339 (51%), Positives = 235/339 (69%), Gaps = 18/339 (5%)
 Frame = +3

Query  12    ETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPE  191
             E Y F   S F  +SL W+ ++  LH+PSF+ KL  +F+LP+GA +P+ LP   S + PE
Sbjct  16    EAYCFHAISVFSYSSLFWDAIKNRLHLPSFVAKLAKKFLLPSGAYIPEGLPTIKSSFTPE  75

Query  192   FFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRN  371
             F +++  Q   N F  GNL+DAC+ +EGPYL+ LA   KL R    W +GPFNPV     
Sbjct  76    FAEYLRLQHSCNKFSSGNLYDACKVLEGPYLETLA---KLLRIHKQWAVGPFNPVTI---  129

Query  372   TKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIW  551
                     S    H+CLEWLDKQ P SVI VSFGT T LS  Q+ E+A GLE+S   FIW
Sbjct  130   --------SGITHHECLEWLDKQSPNSVILVSFGTTTCLSTEQIKEIAIGLEKSQHKFIW  181

Query  552   VVKDLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCME  731
             VV+D TK  +  ++ +P G+E RV+ +G+I++D   QLEIL H STGGF++HCGWNSCME
Sbjct  182   VVRDATK--EEGQVQIPKGYENRVKEKGIIVKD--SQLEILAHTSTGGFMSHCGWNSCME  237

Query  732   SMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASP  911
             S+  GVP+ATWP+Q+DQPRNA+ +T+VLK G+ +K W+ RD+I  STTI+N +++LMAS 
Sbjct  238   SITMGVPIATWPMQFDQPRNAVFVTDVLKIGVVVKHWDRRDDIIDSTTIKNCVKKLMAST  297

Query  912   EGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             EG+E+R +A E G+ V+ES+  GG  ++EMD+FIAHITR
Sbjct  298   EGDEMRMRAIEFGKKVRESMKNGGDHQMEMDSFIAHITR  336



>ref|XP_006356394.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum tuberosum]
Length=501

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/342 (51%), Positives = 224/342 (65%), Gaps = 8/342 (2%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF  +S+  E     LH+P F+ K   R +LP+G   P+ LP   S + 
Sbjct  157   NAEAYCFNSSSAFMISSMYVEEELIRLHLPLFIGKFAARVLLPSGFEFPNNLPSYQSSFI  216

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGP-VWGIGPFNPVVT  362
             PEF  F + Q     FC GNL+  C+AIEGPY+D+LA   +L R+ P  W IGP   + T
Sbjct  217   PEFMDFSIRQDLYKKFCSGNLYYTCKAIEGPYIDVLARFNRLLRRSPKQWAIGPLLSIAT  276

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                     D  +   RH CL+WLDKQ P SVI VSFGT T LS  Q+ ELA GLE+S   
Sbjct  277   I------NDDQNNINRHGCLKWLDKQEPNSVILVSFGTTTSLSTEQIKELAIGLEKSQHK  330

Query  543   FIWVVKDLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNS  722
             FIW+V D+    +  ++ +P G+EERV+GRGL+++DW PQLEIL H +TGGFL+HCGWNS
Sbjct  331   FIWIVSDVLLK-EGEQVQIPKGYEERVQGRGLVVKDWAPQLEILGHSATGGFLSHCGWNS  389

Query  723   CMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLM  902
               ES+  GVPLATWP+ +D PR A+L+T+VLK GI +KDWE RDE+ TS TI  A+R+LM
Sbjct  390   VQESVTMGVPLATWPMIFDHPRIAVLVTKVLKIGITVKDWERRDELITSITIEIALRKLM  449

Query  903   ASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ASPEG E+R    E  + V++S+  GG S+ EMD+FIA+ITR
Sbjct  450   ASPEGNEVRKNMVELSKKVRQSITLGGDSKREMDSFIAYITR  491



>emb|CDP14139.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   345 bits (886),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 178/345 (52%), Positives = 223/345 (65%), Gaps = 24/345 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF D ++ WE   K            G        ++ D +P   SC+ 
Sbjct  129   NAESYCFESISAFTDYTIDWEDEGK-----------PGLSEPELLELLED-IPSLESCFH  176

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             P     +  Q+ T     G++++ CRAIEGPYLDLLA   K A     W IGPFNPV T 
Sbjct  177   PALIDLVNLQKNTKPISSGDIYNTCRAIEGPYLDLLAKA-KTADSNKQWAIGPFNPVET-  234

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                  +Q +S K  RH CL+WLDKQ   SVIFVSFG+ T LSD +  E+A GLEQSGQ F
Sbjct  235   ----NEQKNSKK--RHYCLDWLDKQATNSVIFVSFGSTTSLSDEEAEEIASGLEQSGQKF  288

Query  546   IWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             IWV++D  KG     +  +  LP GFEER EGRG+++RDW PQLEIL H STGGF++HCG
Sbjct  289   IWVLRDADKGDVFQGEVRRAQLPEGFEERTEGRGIVVRDWAPQLEILGHASTGGFMSHCG  348

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSCMES+  GVP+A WP+  DQPRNA+L+ +VLK G+ ++DW  +DE+ TS T+ NA+R
Sbjct  349   WNSCMESISMGVPVAAWPMHSDQPRNAVLLEKVLKIGLLVRDWSKKDELVTSMTVENAVR  408

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RLM S EGE++R  A E  +AVK SVMEGG SRLEMD+FIAHI R
Sbjct  409   RLMDSAEGEKMRQTAKELSKAVKGSVMEGGASRLEMDSFIAHIRR  453



>emb|CDP14137.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   340 bits (873),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 219/346 (63%), Gaps = 26/346 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKI-LHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             N E Y F   SAF   + VWE   K  +  P  L  L             + LP   SC+
Sbjct  129   NAEAYCFQSISAFTVYAFVWEQEGKPGISEPELLKPL-------------EDLPTLESCF  175

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             P E   F+  Q        G+LF+ CRAIEGPYLDLLA    +      W IGPFNPV  
Sbjct  176   PQELMDFVKLQHDNKPITSGSLFNTCRAIEGPYLDLLAK-SGITDSDKQWAIGPFNPVEM  234

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                    +       RH CL+WLDKQ P SVIF+SFG+ T +SD +  E+A GL++SGQ 
Sbjct  235   NEQKNLKK-------RHYCLDWLDKQAPNSVIFISFGSTTSISDEEAEEIAIGLDKSGQK  287

Query  543   FIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV++D  KG     ++ +  LP GF ER EGRG+++RDW PQLEIL H STGGF++HC
Sbjct  288   FIWVLRDADKGDVFQGEDRRAQLPEGFAERTEGRGIVVRDWAPQLEILGHSSTGGFMSHC  347

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+  GVP+A WP+  DQPRNAIL+ +VLK G+ I+DW  ++E+ TS T+ NA+
Sbjct  348   GWNSCIESISMGVPVAAWPMHSDQPRNAILLEKVLKIGLIIRDWSKQNELVTSITVENAV  407

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLM S EGEE+R +A E  +AVK SVMEGG+SRLEMD+FIAHI R
Sbjct  408   RRLMDSAEGEEMRQRARELSKAVKGSVMEGGVSRLEMDSFIAHIRR  453



>ref|XP_002532137.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30257.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=456

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/348 (48%), Positives = 220/348 (63%), Gaps = 30/348 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF               +  F W+ +G+ + P G ++P  +P    C+ 
Sbjct  130   NAESYTFHSVSAFT--------------IFLFHWERMGKHIRPNG-LIPKDVPSLEGCFT  174

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYK---LARKGPVWGIGPFNPV  356
              EF  FI  Q K   FC G +++ CR IEG Y+DLL   +K   +  K   W +GPFNPV
Sbjct  175   SEFLSFIYSQYKHQDFCSGYVYNTCRLIEGSYMDLLEKQHKETTVKEKKTHWALGPFNPV  234

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                  T +DQ       RH CL+WLDKQ   SVI+VSFGT T +++ Q+ +LA GL+QS 
Sbjct  235   SITERTDSDQ-------RHSCLDWLDKQARNSVIYVSFGTTTTMNNEQIKQLATGLKQSQ  287

Query  537   QNFIWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             Q FIWV++D  KG         ++ LP G+E+ + G GLI RDWVPQLEIL H +TGGF+
Sbjct  288   QKFIWVLRDADKGDVFNGEHGQRVELPTGYEDSLSGMGLIARDWVPQLEILGHPATGGFM  347

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+A WP+  DQPRNA+LITE LK GI +KDW  RDEI TS  I 
Sbjct  348   SHCGWNSCMESITMGVPIAAWPMHSDQPRNAVLITEFLKIGIYVKDWTCRDEIVTSKMIE  407

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
               +++LMAS EG+ +R + AE G +V+ S+ EGG+SR+EMD+FIAHI+
Sbjct  408   TCVKKLMASDEGDAVRKRVAELGGSVQRSMGEGGVSRMEMDSFIAHIS  455



>emb|CDP14135.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 221/346 (64%), Gaps = 26/346 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWE-VLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             N E+Y F   SAF   S   E   +  L  P  L  L             + LP   SC+
Sbjct  13    NAESYCFPSSSAFTIYSFFGEPEWKPELSQPELLEPL-------------EDLPTWESCF  59

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             P E   F+  Q        G LF+ CRAIEGPYLDL  +  K+      W IGPFNPV  
Sbjct  60    PQELTDFVKFQNDFKPISSGYLFNTCRAIEGPYLDL-HVKSKITDSDKQWAIGPFNPVEM  118

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                  +++       RH CL WLDKQ P SVIF+SFG+ T +SD +  E+A GL++SGQN
Sbjct  119   NGQKNSEK-------RHYCLNWLDKQAPDSVIFISFGSTTSVSDEEAKEIATGLDKSGQN  171

Query  543   FIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV++D  KG     ++ ++ LP GFEER+EGRG+++RDW PQLEIL H STGGF++HC
Sbjct  172   FIWVLRDADKGDVFQGEDRRVQLPEGFEERIEGRGIVVRDWAPQLEILGHSSTGGFMSHC  231

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+  GVP+A WP+  DQPRNAIL+ +VLK G+ I+DW  ++E+ TS T+ NA+
Sbjct  232   GWNSCIESISMGVPVAAWPMHSDQPRNAILLEKVLKIGLIIRDWSKQNELVTSITVENAV  291

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLM S EGEE+R +A E  +AVK SV+EGG+SR EMD+FI+HI R
Sbjct  292   RRLMDSAEGEEMRQRARELSKAVKGSVIEGGVSRSEMDSFISHIRR  337



>emb|CDP14134.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   337 bits (864),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 218/345 (63%), Gaps = 24/345 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF   +  WE   K             R   P      + LP   S  P
Sbjct  154   NAESYTFISISAFAIYTFSWEQEGK------------PRVFEPEILEALESLPSHESSIP  201

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E   F+  Q+++     G+L++ CR IEGPYLDLLA   K A     W +GPFNPV   
Sbjct  202   QEVTDFLKLQKESMPIISGDLYNTCRFIEGPYLDLLAKA-KTADSHKQWAVGPFNPVEIN  260

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                 T+Q       RH CLEWLDKQ P SVIFV FG+ T +S  +  ++A GLE+SGQ F
Sbjct  261   GQKNTEQ-------RHYCLEWLDKQGPNSVIFVCFGSNTSVSHEEAAQIAIGLEKSGQKF  313

Query  546   IWVVKDLTKG--YKNT--KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             IW++KD  +G  +K    +  LP GFEER EGRG+I+RDW PQLEIL H STGGF++HCG
Sbjct  314   IWILKDGDQGDIFKGEVRRAQLPGGFEERTEGRGIIVRDWAPQLEILGHSSTGGFMSHCG  373

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSCMES+  GVP+A WP+  +QPRNAI++ +VLK G+ ++DW  RDE+ TS  + NA+R
Sbjct  374   WNSCMESISMGVPVAAWPMHSEQPRNAIILEKVLKIGLSVRDWSRRDELVTSMAVENAVR  433

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RLM S EGEE+R +A E  +AVK+SVMEGG SRLEMD+FIAHI R
Sbjct  434   RLMDSAEGEEMRQRAKELSKAVKDSVMEGGTSRLEMDSFIAHIRR  478



>emb|CDP14140.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/345 (47%), Positives = 223/345 (65%), Gaps = 22/345 (6%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF     +WE +     V   + K+               LP    C+ 
Sbjct  129   NAESYTFHSVSAFSIFFFMWERMENPFPVDKEILKI---------------LPPMDGCFT  173

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF  F+  Q     F  G ++++C+ IEGPYLDLL+   +++     W +GPFNPV   
Sbjct  174   PEFSNFVKAQHNFVQFNSGRIYNSCKVIEGPYLDLLSK-EEISLNKKQWALGPFNPVNIM  232

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                   ++ +++  RHKCL+WLD Q   SVIFVSFGT T +SD Q+ ELA GLE+S Q F
Sbjct  233   HQKSGPKEQNNE--RHKCLQWLDSQSNNSVIFVSFGTTTSISDEQIRELAFGLERSAQKF  290

Query  546   IWVVKDLTKG----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             +WV++D   G     +  K+ LP GFE RVEGRGL++R+W PQLEIL H +TGGF++HCG
Sbjct  291   LWVLRDADSGDVFVQETRKLELPKGFERRVEGRGLVVRNWAPQLEILGHSATGGFMSHCG  350

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSCMES+  GVP+ATWP+  DQPRNA+LIT++LK G+ +KDW  +DE+ TS+ +  A R
Sbjct  351   WNSCMESITMGVPMATWPMHSDQPRNAVLITKILKVGLEVKDWAHKDELVTSSKVEKAAR  410

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              LMA  EG+++R ++AE G AV+ S+ EGG++R+E+D+FIAHITR
Sbjct  411   MLMAEEEGQQMRKRSAEMGAAVRTSLAEGGVTRMELDSFIAHITR  455



>ref|XP_009760629.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=472

 Score =   335 bits (860),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 165/346 (48%), Positives = 223/346 (64%), Gaps = 27/346 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF     +WE + +  ++ + + K V               P    C+ 
Sbjct  147   NAEAYAFHSVSAFTLFLFIWENMGRPFNIDANMLKDV---------------PSLEDCFS  191

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF KFI ++     F  G +++ C+ IEGP+LDLL+   +++     W +GPFNPV+ +
Sbjct  192   PEFEKFIRNEYDYLKFNSGKIYNTCKVIEGPFLDLLSK-EQISNNKKQWALGPFNPVLVQ  250

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
               TK        T RHKCL WLDKQ   SVIFVSFGT T  SD Q+ E+A GLE+S Q F
Sbjct  251   HGTK------GSTKRHKCLSWLDKQGQNSVIFVSFGTTTSFSDEQIKEMAIGLEKSEQKF  304

Query  546   IWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             +WV++D  KG      ++ KI+LP GFEERV+ +G++LRDW PQLEIL H S GGF++HC
Sbjct  305   VWVLRDADKGNVFAKDQSRKIDLPKGFEERVKEKGVVLRDWAPQLEILAHSSVGGFMSHC  364

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRN IL+T++LK GI +KDW  R E+ TS  ++ A+
Sbjct  365   GWNSCMESISMGVPIAAWPMHSDQPRNTILVTKILKVGIVVKDWTRRHEMVTSIMVQAAV  424

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +LMAS EGEE+RN+A +   A+K+SV EGGI  +E+D+FI+HITR
Sbjct  425   EKLMASKEGEEMRNRAMDLSAALKKSVAEGGIKNMELDSFISHITR  470



>emb|CDP14136.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   335 bits (858),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/291 (55%), Positives = 205/291 (70%), Gaps = 16/291 (5%)
 Frame = +3

Query  174   SCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNP  353
             SC+P E   F   Q+       G LF+ CRAIEGPYLDL  +  K+      W IGPFNP
Sbjct  227   SCFPQEMTDFAKLQQDVKPISSGYLFNTCRAIEGPYLDL-HVKSKITDSDKQWAIGPFNP  285

Query  354   VVT--KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLE  527
             V    ++N++T         RH CL+WLDKQ P SVIF+SFG+ T +SD +  E+A GL+
Sbjct  286   VEVNGQKNSET---------RHCCLDWLDKQAPNSVIFISFGSTTSVSDEEAKEIATGLD  336

Query  528   QSGQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGG  695
             +SGQ FIWV++D  KG     ++ +  LP GFEERVEGRG+++RDW PQLEIL H STGG
Sbjct  337   KSGQKFIWVLRDADKGDVFQGEDRRAQLPKGFEERVEGRGIVVRDWAPQLEILGHSSTGG  396

Query  696   FLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTT  875
             F++HCGWNSC+ES+  GVP+A WP+  DQPRNAIL+ +VLK G+ ++DW   +E+ TS T
Sbjct  397   FMSHCGWNSCIESISMGVPVAAWPMHSDQPRNAILLEKVLKIGLKVRDWSKLNELVTSIT  456

Query  876   IRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + NA+RRLM S EGEE+R +A E  +AVK SVMEGG+SRLEMD+FIAHI R
Sbjct  457   VENAVRRLMDSAEGEEMRQRARELSKAVKGSVMEGGLSRLEMDSFIAHIRR  507



>ref|XP_011075343.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=478

 Score =   333 bits (853),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 170/345 (49%), Positives = 224/345 (65%), Gaps = 26/345 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF               + SF W+  G+ VLP  A + + +P    C+P
Sbjct  156   NAESYCFQSISAFS--------------LYSFYWEATGKPVLPTEAKLVEEVPSMEGCFP  201

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF +    Q     F  G+L++  R IEG Y+DL+A   K       W +GPFNPV   
Sbjct  202   PEFAEISKLQLNARKFNSGDLYNTSRVIEGLYVDLMAK-EKTTGTERNWALGPFNPVSKP  260

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +  +TD        R  C+EWLDKQ   SVIFVSFGT + LS+ Q+ ELA GLE+S Q F
Sbjct  261   QRKETDN-------RGACMEWLDKQELNSVIFVSFGTTSSLSNEQISELALGLERSEQKF  313

Query  546   IWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             IWV++D  KG     +  +  LP  +EERVEGRG+I+RDW PQLEIL H STGGF++HCG
Sbjct  314   IWVLRDADKGDVFQGEVRRAPLPEKYEERVEGRGVIVRDWAPQLEILGHPSTGGFISHCG  373

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSC+ES+  GVP+A WP+  DQPRNA+LIT+VL+ G+ IKDW  RDE+ +STT+  ++R
Sbjct  374   WNSCIESISMGVPIAAWPMHSDQPRNAVLITKVLRIGVEIKDWSRRDEVVSSTTVEKSVR  433

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RLMAS EG+E+R +A E G AV++ VM+GGI+ +EMD+FIAHI+R
Sbjct  434   RLMASGEGDEIRRRAEELGDAVRKCVMKGGITNMEMDDFIAHISR  478



>emb|CDP14138.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 223/346 (64%), Gaps = 26/346 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKI-LHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             N E+Y F   SAF   S+VWE   K  L  P  L  L             + LP   SC+
Sbjct  161   NAESYCFPSTSAFTVYSIVWEQEGKPGLSEPELLETL-------------EDLPTWESCF  207

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             P E   F   Q+       G LF++CRAIEGPYLDL  +  K+      W IGPFNPV  
Sbjct  208   PQELTDFAKLQQDFKPISSGYLFNSCRAIEGPYLDL-HVKSKITDSDKQWAIGPFNPV--  264

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                    Q +S K  RH CL+WLDKQ P SVIF+SFG+ T +SD +  E+A GL++SGQ 
Sbjct  265   ---EMNGQKNSEK--RHYCLDWLDKQAPNSVIFISFGSTTSVSDEEAKEIATGLDKSGQK  319

Query  543   FIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV++D  KG     ++ +  LP GFEER+EGRG+++RDW PQLEIL H STGGF++HC
Sbjct  320   FIWVLRDADKGDVFQGEDRRAQLPEGFEERIEGRGIVVRDWAPQLEILGHSSTGGFMSHC  379

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+  GVP+A WP+  DQPRNA+L+ +VLK G+ ++DW  ++E  TS T+ NA+
Sbjct  380   GWNSCIESISMGVPVAAWPMHSDQPRNALLLEKVLKIGLKVRDWSKQNEPVTSITVENAV  439

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLM S EGEE+  +A    +AVK+S MEGG+SRLEMD+FIAHI R
Sbjct  440   RRLMDSAEGEEMWQRAKLLSKAVKDSGMEGGVSRLEMDSFIAHIRR  485



>dbj|BAK55742.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=479

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 219/348 (63%), Gaps = 30/348 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y+F   SAF   +  WE   K             R   P      + LP      P
Sbjct  155   NAESYSFTSISAFTMCTFSWEQEGK------------PRVFEPEILEALESLPSHEGSLP  202

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPV---WGIGPFNPV  356
                  F+  Q ++     G+L++ CR IEGPYLDLLA     AR G     W +GPFNPV
Sbjct  203   QGVIDFLKLQEESKPISSGDLYNTCRFIEGPYLDLLAK----ARAGDSHKQWAVGPFNPV  258

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                 +  T+Q       RH CLEWLDKQ P SVIFV FG+ T +SD +  ++A GLE+SG
Sbjct  259   EINEHKDTEQ-------RHYCLEWLDKQGPNSVIFVCFGSNTTVSDEEAKQIAIGLEKSG  311

Query  537   QNFIWVVKDLTKG--YKNT--KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
             Q FIW+++D  +G  +K    +  LP GFEER EGRG+I+R+W PQLEIL H STGGF++
Sbjct  312   QKFIWILRDGDQGDVFKEEVRRAQLPEGFEERTEGRGIIVRNWAPQLEILGHSSTGGFMS  371

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSCMES+  GVP+A WP+  DQPRNAIL+ +VLK G+ ++DW  R+E+ TS T+ N
Sbjct  372   HCGWNSCMESISMGVPVAAWPMHSDQPRNAILLEKVLKIGLIVRDWSRREELVTSITVEN  431

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             A+RRLM + EGEE+R +A E  + VK SVMEGGISRLEMD+FIAHI R
Sbjct  432   AVRRLMDTAEGEEIRQRAKELSKTVKASVMEGGISRLEMDSFIAHIRR  479



>emb|CDP14133.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   331 bits (849),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 219/346 (63%), Gaps = 25/346 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y+F   SAF   +  WE + K             R + P      + LP  +S  P
Sbjct  156   NAESYSFMSVSAFTAYAYSWEKIGK------------PRVLEPEILEALENLPSHASSLP  203

Query  186   PEFFKFIVDQRKTNAFCKG-NLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              E   FI  Q ++     G +L++ CR IEGPYLDLLA     A     W +GPFNPV  
Sbjct  204   QELKDFIKLQNESKPISSGGDLYNTCRFIEGPYLDLLAKA-SAADSHKQWAVGPFNPVEI  262

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                  T Q       RH CLEWLDKQ P  VIFV FG+ T +SD +  ++A GLE+SG+ 
Sbjct  263   NEQKNTGQ-------RHYCLEWLDKQGPNWVIFVCFGSNTSVSDEEATQIAIGLEKSGKK  315

Query  543   FIWVVKDLTKG--YKNT--KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIW++KD  +G  +K    ++ LP GFEER EGRG+I+RDW PQLEIL H STGGF++HC
Sbjct  316   FIWILKDGDQGDVFKGEVRRVQLPGGFEERTEGRGIIVRDWAPQLEILGHSSTGGFMSHC  375

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQ RNAIL+ +VLK G+ ++DW  +DE+ TS  + NA+
Sbjct  376   GWNSCMESISMGVPVAAWPMHTDQYRNAILLEKVLKIGLSVRDWSRQDELETSMAVENAV  435

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLM S EGEE+R +A E  +AVK+SVMEGG SRLEMD+FIAHI R
Sbjct  436   RRLMDSAEGEEMRQRAKELSKAVKDSVMEGGTSRLEMDSFIAHIGR  481



>ref|XP_011075345.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=479

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 172/349 (49%), Positives = 226/349 (65%), Gaps = 30/349 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWK-LVGRFVLPAGAVVPDRLPIPSSCY  182
             N E+Y F   SAF   S+ W           + W+ L     LP    +  ++P    C+
Sbjct  153   NAESYIFHSISAF---SVFW-----------YFWEGLEQEKPLPVEEGLEKQVPSLDDCF  198

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              PEF +FIV ++K  + C G L++ACR IEG Y+DL+  +     +   W IGPFNP+  
Sbjct  199   TPEFMEFIVSEQKYMSSCSGYLYNACRVIEGRYMDLIEKLTGNENQKH-WAIGPFNPLEL  257

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                 K D       PRH+CL+WLDKQ PKSV+FVSFGT T L D Q+ ELA GLE+S   
Sbjct  258   T-GKKPD------GPRHECLKWLDKQEPKSVLFVSFGTTTSLPDEQIKELATGLEESEVT  310

Query  543   FIWVVKD-----LTKGYKNT--KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             FIWV++D     +T G + T  K+ LP GFEERV+ RG+++RDW PQLEIL H +TGGF+
Sbjct  311   FIWVLRDADRGDMTAGDEGTMRKVELPKGFEERVKERGVVVRDWAPQLEILGHFATGGFM  370

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+A WP+  DQPRNA+L+TEVLK G+  KDW  RDE   ++TI 
Sbjct  371   SHCGWNSCMESISMGVPIAAWPMHSDQPRNAVLMTEVLKIGLVAKDWARRDETVKASTIS  430

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               ++RLM S EGEE+R +A E   AV+ +V +GGI+RLEMD+F+AHITR
Sbjct  431   RVLKRLMGSGEGEEIRQRAQELHGAVRRAVADGGITRLEMDSFVAHITR  479



>ref|XP_009626493.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=472

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/346 (47%), Positives = 219/346 (63%), Gaps = 27/346 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF     +WE + +  ++ + + K V               P    C+ 
Sbjct  147   NAEAYAFHSVSAFTLFLFIWENMGRPFNIDANMLKDV---------------PSLEGCFS  191

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF KFI ++     F  G +++ C+ IEGP+LDLL+   +++     W +GPFNPV+ +
Sbjct  192   PEFEKFIKNEYDYLKFNSGRIYNTCKVIEGPFLDLLSK-EQISNNKKQWALGPFNPVLVQ  250

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
               TK        T RHKCL WLDKQ P SVIFVSFGT T  SD Q+ E+A GLE+S Q F
Sbjct  251   HGTK------GCTQRHKCLIWLDKQEPNSVIFVSFGTTTSFSDEQIKEIAIGLEKSEQKF  304

Query  546   IWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             +WV++D  KG      ++  I LP GFEERV+ RG++LRDW PQLEIL H S GGF++HC
Sbjct  305   VWVLRDADKGNVFAKDQSRNIELPKGFEERVKERGVVLRDWAPQLEILAHSSVGGFMSHC  364

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRN IL+T++LK GI +KDW  R E+ TS  ++ A+
Sbjct  365   GWNSCMESISMGVPIAAWPMHSDQPRNTILVTKILKVGIVVKDWTRRHEVVTSLMVQAAV  424

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +LM S EGE +RN+A +   A+K SV EGGI  +E+D+FI+HITR
Sbjct  425   EKLMVSKEGEGMRNRAMDLSAALKISVAEGGIKNMELDSFISHITR  470



>ref|XP_009600543.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=472

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/346 (47%), Positives = 218/346 (63%), Gaps = 27/346 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF     +WE + +  ++ + + K V               P    C+ 
Sbjct  147   NAEAYAFHSVSAFTLFLFIWENMGRPFNIDANMLKDV---------------PSLEGCFS  191

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF KFI ++     F  G +++ C+ IEGP+LDLL+   +++     W +GPFNPV+ +
Sbjct  192   PEFEKFIKNEYDYLKFNSGRIYNTCKVIEGPFLDLLSK-EQISNNTKQWALGPFNPVLVQ  250

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
               TK          RHKCL WLDKQ   SVIFVSFGT T  SD Q+ E+A GLE+S Q F
Sbjct  251   HGTK------GSNKRHKCLSWLDKQGQNSVIFVSFGTTTSFSDEQIKEMAIGLEKSEQKF  304

Query  546   IWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             +WV++D  KG       + KI LP GFEERV+ RG++LRDW PQLEIL H S GGF++HC
Sbjct  305   VWVLRDADKGNVFAKDHSRKIELPKGFEERVKERGVVLRDWAPQLEILAHSSVGGFMSHC  364

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRN IL+T++LK GI +KDW  R E+ TS  ++ A+
Sbjct  365   GWNSCMESISMGVPIAAWPMHSDQPRNTILVTKILKVGIVVKDWTRRHEVVTSAMVQAAV  424

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +LM S EGEE+R++A +   A+K SV EGGI  +E+D+FI+HITR
Sbjct  425   EKLMVSKEGEEMRSRAMDLSAALKISVAEGGIKNMELDSFISHITR  470



>ref|XP_011078913.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=472

 Score =   328 bits (840),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 221/346 (64%), Gaps = 24/346 (7%)
 Frame = +3

Query  3     QNHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             QN E+Y F    AF   S  WE   +   VP+              A V   +P    C+
Sbjct  147   QNAESYCFRCIPAFTLYSFHWEAAGRPDDVPA------------EAAAVLKEIPDLDDCF  194

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              PEF +F   QR +     G+++++ RA+EG YLDL+A   K+     +W +GPFNPVV 
Sbjct  195   SPEFDEFSRLQRVSGKIFSGDIYNSSRAMEGFYLDLVAE-RKITGTEKLWAVGPFNPVVF  253

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                     +  S   RH+CL+WLD+Q P SVIFVSFGT ++LS+ Q+ ELA GLE+S   
Sbjct  254   P-------EKKSSRSRHECLDWLDRQSPNSVIFVSFGTTSLLSNEQVQELAFGLERSQHK  306

Query  543   FIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             F+WVV+D  KG   T    K  LP G EERV+ RG+I+RDW PQLEIL H ST GF++HC
Sbjct  307   FVWVVRDADKGDIFTGEVRKSELPEGLEERVKERGIIVRDWAPQLEILGHPSTAGFMSHC  366

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+  GVP+ATWP+  DQP NA+ +T+VL+ G+ +KDW  RDE+ +S+T+  A+
Sbjct  367   GWNSCIESISMGVPMATWPMHSDQPINAVFVTKVLRIGLEVKDWARRDEVVSSSTVECAV  426

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLMAS EG+E+R +A E G AV+ SVMEGG S  EMD+FI HITR
Sbjct  427   RRLMASEEGDEMRKRAQELGAAVRNSVMEGGSSSKEMDSFITHITR  472



>ref|XP_011075346.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=462

 Score =   327 bits (838),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/314 (49%), Positives = 214/314 (68%), Gaps = 7/314 (2%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             FLW+  GR        + + LP    C+ PEF KF+ +Q +      G +++ CR +E P
Sbjct  152   FLWEKTGR-PFAIDKEILENLPSLEGCFSPEFVKFVGNQHQYMKLNSGRIYNTCRVVESP  210

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVI  458
             +L+LLA   +++     W +GPFNPV  + + +  + SS+   RH+CL+WLD+Q P SVI
Sbjct  211   FLELLAKP-EISGNKKQWALGPFNPVGAE-SVERKKPSSNSDSRHRCLKWLDRQGPNSVI  268

Query  459   FVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTK----GYKNTKINLPAGFEERVE  626
              VSFGT T LSD QL ELA GLE+S Q F+WV++D       G +  ++ LP GFEERV+
Sbjct  269   LVSFGTTTTLSDKQLQELATGLEKSQQKFVWVLRDADGANFFGREIKRVELPKGFEERVK  328

Query  627   GRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILIT  806
              RG+++RDW PQLEIL H +TGGF++HCGWNSCMES+  GVP+A WP+  DQPRN ILIT
Sbjct  329   KRGMVVRDWAPQLEILGHSATGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNTILIT  388

Query  807   EVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGI  986
             +VLK G+ +KDW  RDE+  S+ + +A+ RLM S EG E+R +AAE   +V+++V +GG+
Sbjct  389   KVLKIGLAVKDWARRDELVKSSAVESAVARLMTSEEGAEMRKRAAELSGSVRKAVAKGGV  448

Query  987   SRLEMDNFIAHITR  1028
             + LE+D+FI HITR
Sbjct  449   THLELDSFITHITR  462



>ref|XP_009363193.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009363194.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X2 [Pyrus 
x bretschneideri]
Length=473

 Score =   326 bits (836),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 166/347 (48%), Positives = 221/347 (64%), Gaps = 26/347 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF     +WEV+ K    P  L +L           +PD +P    C+ 
Sbjct  147   NGESYTFHSVSAFTIFLYLWEVIGK----PKKLEEL--------DVKLPDGIPSLEGCFT  194

Query  186   PEFFKFIVDQRKTNAFCK-GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              EF  FI +Q K       G L +  R IEGPY+DLL    ++  +   W IGPFNP   
Sbjct  195   VEFRNFIDEQHKYQKLNNAGYLHNTSRTIEGPYMDLLN---RIGDQKKHWAIGPFNPT--  249

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                T    +++S + RH CLEWLDKQ  +SV++VSFGT T + D Q+ ELA GLE+S Q 
Sbjct  250   ---TVAYPNNNSNSSRHMCLEWLDKQEQRSVMYVSFGTTTAMKDEQIQELAIGLEESKQR  306

Query  543   FIWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
             FIWV++D  KG      +  +  LP GFEER++GRGL++RDWVPQLEIL H STGGFL+H
Sbjct  307   FIWVLRDADKGDLFNGGEVRRAELPQGFEERIKGRGLVVRDWVPQLEILSHKSTGGFLSH  366

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMES+  GVP+A WP+  DQPRN +LIT++L+ G  ++DW+ RDE+ TS  ++N 
Sbjct  367   CGWNSCMESITMGVPIAAWPMHSDQPRNTVLITKLLRVGFVMRDWDKRDELVTSQNVKNG  426

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +++ M S EGEE+R +AAE G AV++S +EG  S +E  +FIAHITR
Sbjct  427   VQKFMGSKEGEEIRKRAAELGAAVRQSRVEGEASHMEFSSFIAHITR  473



>gb|AAM09516.1|AF489876_1 putative glucosyltransferase [Phaseolus lunatus]
Length=462

 Score =   324 bits (831),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 210/316 (66%), Gaps = 17/316 (5%)
 Frame = +3

Query  96    SFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEG  275
             +F W+ +G+  L A  V     P+   C+P +F  FIV Q +   F  GN+++  R IE 
Sbjct  159   AFFWEEMGKPPLEAFRV--PEFPLLEGCFPTQFIDFIVAQYELQKFNDGNIYNTSRVIED  216

Query  276   PYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSV  455
             PYL+LL + +   +K  VW +GPFNP+  ++         S   RH C+EWLDKQ P SV
Sbjct  217   PYLELLDL-FSAGKK--VWALGPFNPLTVEKK-------DSIGFRHSCMEWLDKQEPSSV  266

Query  456   IFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEER  620
             I++SFGT T L D Q+ ++A GLEQS Q FIWV++D  KG      +  +  LP GFEER
Sbjct  267   IYISFGTTTALRDEQIQQIATGLEQSKQKFIWVLRDADKGDIFDGSEAKRYELPKGFEER  326

Query  621   VEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
             VEG GL+LRDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+ATWP+  DQPRNA+L
Sbjct  327   VEGMGLVLRDWAPQLEILSHSSTGGFMSHCGWNSCLESISMGVPIATWPMHSDQPRNAVL  386

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             +TEVLK G+ +KDW+ R+ + T++ +  A+RRLM + EG+E+R +A      +  S+ E 
Sbjct  387   VTEVLKVGLVVKDWDQRNALVTASDVEKAVRRLMETKEGDEIRERAVGLKNVIHRSMDES  446

Query  981   GISRLEMDNFIAHITR  1028
             G+S +EM +FIAHIT+
Sbjct  447   GVSHMEMGSFIAHITK  462



>ref|XP_002284381.1| PREDICTED: zeatin O-glucosyltransferase-like [Vitis vinifera]
Length=473

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/348 (45%), Positives = 221/348 (64%), Gaps = 28/348 (8%)
 Frame = +3

Query  3     QNHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             +N E+Y F   SAF               +  FLW+  G+ VL     + D +P    C+
Sbjct  148   RNAESYTFHSVSAFS--------------IFLFLWEAAGKPVLKEAKFLED-VPSLDGCF  192

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             P EF  FI  Q +      GN+++ C+++EG Y+DLL  +     K   W +GPFNP+  
Sbjct  193   PLEFLNFIASQHQFKKLNSGNIYNTCKSMEGCYVDLLDGLEIYGGKKKHWALGPFNPLTI  252

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
               + K++       P H+CL WLDKQ PKSV+ VSFGT T L+D Q+ ELA GLEQS Q 
Sbjct  253   CYDKKSN-------PGHRCLGWLDKQAPKSVLLVSFGTTTSLTDEQIKELAIGLEQSKQK  305

Query  543   FIWVVKDLTKG----YKNTKINLPAGFEERVEGRG--LILRDWVPQLEILDHVSTGGFLT  704
             FIWV++D  KG     +  +  LP G+EERV GRG  L++RDW PQLEIL H STGGF++
Sbjct  306   FIWVLRDADKGDVFSGEVRRAELPEGYEERVGGRGMGLVVRDWAPQLEILGHSSTGGFMS  365

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSC+ES+  GVP+A WP+  DQPRN +L+ +VLK G+ ++DW  R+++  ++T+  
Sbjct  366   HCGWNSCLESISMGVPIAAWPMHSDQPRNTVLVAQVLKVGLVVRDWAQREQLVAASTVEK  425

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +R LMAS EG+++R +AAE G  ++ S+ EGG+SR E+D+F+AHITR
Sbjct  426   KVRSLMASKEGDDMRKRAAELGATIQRSMDEGGVSRKELDSFVAHITR  473



>emb|CDP12478.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 214/346 (62%), Gaps = 25/346 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRK-ILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             N E+Y+F +  AF+  + +WE+  K  L  P  L  L               LP    C 
Sbjct  129   NVESYSFSIFPAFYCYAFIWELEGKPTLAEPELLDLL-------------KVLPSNERCT  175

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             PPE  +FI  Q+ +     G L + CR IEGPYLDLL     +      W +GP NPVV 
Sbjct  176   PPEMMEFIKLQQDSKPIISGYLLNTCREIEGPYLDLLTKT-SIIDNDKQWAVGPLNPVVI  234

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                 K          RH CLEWLDKQ   SVIFVSFG+ T LSD +  E+A GLE+SGQ 
Sbjct  235   IDGLKNSNK------RHYCLEWLDKQAQDSVIFVSFGSTTSLSDEEAAEVAIGLEKSGQK  288

Query  543   FIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV++D  KG     +  +  L  GFEE +EGRG+++R+W PQLE+L H STGGF++HC
Sbjct  289   FIWVLRDADKGDIFEGEVRRAKLLEGFEESIEGRGIVVREWAPQLEVLAHSSTGGFMSHC  348

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQP NA+L+ ++LK G+P++DW  RDE  TS TI NA+
Sbjct  349   GWNSCMESISMGVPVAAWPMHTDQPWNAVLMEKLLKIGLPVRDWSRRDEPVTSVTIENAV  408

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLM S EGEE+R +A E  + +K SV EGG+SRLE D+FIAHI R
Sbjct  409   RRLMNSAEGEEMRQRAKELSKIIKGSVTEGGVSRLETDSFIAHIRR  454



>gb|AIE12482.1| UGT11 [Panax ginseng]
Length=466

 Score =   324 bits (830),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/349 (49%), Positives = 218/349 (62%), Gaps = 37/349 (11%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y+F  GSAF+  +  WE + +    PS L KL               LP    C+ 
Sbjct  146   NAESYSFQSGSAFNFLAFKWESIGR----PSSL-KLE----------TLKNLPSMDGCFT  190

Query  186   PEFFKFIVDQRK-TNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPV--WGIGPFNPV  356
              EF +F   Q    + F  G + D  + IEG Y DLL    K    G +  W +GPFNPV
Sbjct  191   QEFMEFATCQIPLMDKFSSGTIHDVSKVIEGEYFDLLT---KEEFSGNIKQWALGPFNPV  247

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                        S S   RH CL WLDKQ P SVI+VSFGT T L+D Q+HELA GLE S 
Sbjct  248   -----------SISDHKRHNCLNWLDKQDPNSVIYVSFGTTTSLTDEQIHELAIGLEDSE  296

Query  537   QNFIWVVK-----DLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             Q FIWV++     D+ +G    +  LP G+E+R++G+G+ILRDWVPQLEIL+H STGGF+
Sbjct  297   QKFIWVLREADKGDIFEGNYARRAELPKGYEQRIQGKGIILRDWVPQLEILEHASTGGFM  356

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMESM  GV +A WP+  +QPRNA+LIT+VLK G  ++DWE RDE+ TS ++ 
Sbjct  357   SHCGWNSCMESMSMGVAMAAWPMHSEQPRNAMLITDVLKIGTLVRDWERRDELVTSLSVE  416

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              A+RRLM S EG E+R +AAE G  V+ SV EGG++R E D+FI+HITR
Sbjct  417   KAVRRLMVSKEGGEMRKRAAEMGGTVRRSVAEGGVTRAEFDSFISHITR  465



>gb|AIE12481.1| UGT12 [Panax ginseng]
Length=467

 Score =   322 bits (826),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 163/348 (47%), Positives = 223/348 (64%), Gaps = 30/348 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAFH  S  WE+L K    PS ++   G           D LP+  S + 
Sbjct  143   NAEAYTFHGVSAFHVFSYFWEILGK----PSSVFVDDGTI---------DELPLIESAFS  189

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLA---MVYKLARKGPVWGIGPFNPV  356
             PEF + I        F  G ++D CR++EG Y+DL A   M+  L +    W +GPFNPV
Sbjct  190   PEFVQHIDRNLAHANFMSGIIYDGCRSLEGKYIDLTATKDMMPGLKQ----WALGPFNPV  245

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                +NT           RH CL+WLD+Q P SVI+VSFGT   L + Q+ ELA GLEQSG
Sbjct  246   TLTQNT------VGPNQRHPCLKWLDQQAPNSVIYVSFGTTVCLVEQQVKELAIGLEQSG  299

Query  537   QNFIWVVKDL-TKGYKNTKIN---LPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
             Q FIW+++D  T+     ++N   LP G+EERV+G+G++++DWVPQ+EIL H STGGFL+
Sbjct  300   QKFIWLLRDADTQVLSQRELNSAELPKGYEERVKGQGMVVKDWVPQMEILGHPSTGGFLS  359

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNS MES+  GVP+  WP+  DQPRN +LIT+ LKTG+ ++DW  R+E+ TSTT+  
Sbjct  360   HCGWNSLMESLTMGVPVGAWPMHSDQPRNTLLITKGLKTGLVVRDWADRNELVTSTTVEK  419

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +R+LM S +GEE+R  AAE G  ++ S+++GG++R+E+D+FIAHI R
Sbjct  420   GVRKLMTSKQGEEMRKMAAELGSVLRGSMVKGGVTRMELDSFIAHINR  467



>ref|XP_009783803.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=464

 Score =   320 bits (820),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 221/345 (64%), Gaps = 24/345 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+YNF   SAF               +  FLW+ +G+   P  A + + LP  + C+ 
Sbjct  140   NAESYNFHSVSAFT--------------IFLFLWESMGK-PFPIEAQILENLPSLTGCFT  184

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              EF  F+  QRK +    GN+++  R IEG +++LL     + R    W IGPFNPV+T 
Sbjct  185   SEFMDFMAAQRKYSNSDSGNIYNTTRVIEGKFMNLLEK-EPIKRNKMHWAIGPFNPVMTT  243

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                 T  ++SS   RHKCL WLDKQ PKSVIF+SFGT T L+D Q+ EL  GLE+S   F
Sbjct  244   ----TSSNNSSIGQRHKCLTWLDKQSPKSVIFISFGTTTSLTDEQIKELCIGLERSDTKF  299

Query  546   IWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             IW ++D  KG     +  K  LP G+EER++ +G+I+RDW PQLEIL H S GGF+++CG
Sbjct  300   IWALRDADKGDIFSGEVRKFELPNGYEERIKNKGIIVRDWAPQLEILGHFSIGGFMSYCG  359

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSCMES   GVP+  WP+  DQPRN+IL+T+ LK GI + +WE R+E+ TS T+  A++
Sbjct  360   WNSCMESFSMGVPIIAWPMHSDQPRNSILVTKFLKVGILVNNWERRNEVVTSNTVERAVK  419

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              L++S EG E+R +AA+ G  +++S +EGG++R E+D+FI HITR
Sbjct  420   TLVSSNEGNEIRKRAADLGVTIRKSGVEGGVTRKELDSFIGHITR  464



>ref|XP_007145587.1| hypothetical protein PHAVU_007G251100g [Phaseolus vulgaris]
 gb|ESW17581.1| hypothetical protein PHAVU_007G251100g [Phaseolus vulgaris]
Length=462

 Score =   320 bits (820),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 211/316 (67%), Gaps = 17/316 (5%)
 Frame = +3

Query  96    SFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEG  275
             +F W+ +G+  L A  V     P    C+P +F  FIV Q +   F  GN+++  RAIE 
Sbjct  159   AFFWEEMGKPPLEAFRV--PEFPSLEGCFPTQFIDFIVAQYELQKFNDGNIYNTSRAIED  216

Query  276   PYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSV  455
             PYL+LL + +   +K  VW +GPFNP+  ++         S   RH C+EWLDKQ P SV
Sbjct  217   PYLELLNL-FSAGKK--VWALGPFNPLTVEKK-------DSIGLRHSCVEWLDKQEPSSV  266

Query  456   IFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEER  620
             I++SFGT T L D Q+ E+A GLEQS Q FIWV++D  KG      +  +  LP GFEER
Sbjct  267   IYISFGTTTALRDEQIQEIATGLEQSKQKFIWVLRDADKGDIFDGSEAKRYELPEGFEER  326

Query  621   VEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
             VEG GL++RDW PQ+EIL H STGGF++HCGWNSC+ES+  GVP+ATW +  DQPRNA+L
Sbjct  327   VEGMGLVVRDWAPQMEILSHGSTGGFMSHCGWNSCLESITMGVPIATWAMHSDQPRNAVL  386

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             +T+VLK G+ +KDW+ R+ + +++ +  A+RRLM + EG+E+R +A +   A+  S+ EG
Sbjct  387   VTDVLKVGLVVKDWDQRNALVSASDVEKAVRRLMETEEGDEIRERAVKLKNAIHRSMDEG  446

Query  981   GISRLEMDNFIAHITR  1028
             G S +EM +FIAHIT+
Sbjct  447   GGSHMEMASFIAHITK  462



>emb|CDP14132.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   320 bits (819),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/345 (48%), Positives = 219/345 (63%), Gaps = 26/345 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF   S VWE +              G+ VL  G  V D L  P S +P
Sbjct  129   NAESYCFQSVSAFALYSYVWEAM--------------GKPVLADGEPVNDLLSTPESVFP  174

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E  +F   Q++      GNLF++ R I+G YL+LLA + K       W IGPFNP V  
Sbjct  175   EELAEFFKVQQEARKCNWGNLFNSSRLIDGEYLNLLAEI-KFDETENNWAIGPFNPPVIT  233

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
              + K+ +        HKCLEWLDKQ PKSVIFVSFG+ T LSD ++ ++A GLE+SGQ F
Sbjct  234   EDQKSKKS-------HKCLEWLDKQAPKSVIFVSFGSTTSLSDEEVEQIAIGLERSGQKF  286

Query  546   IWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             +WV++D   G     +  K  LP G+EERV+GRG ILR+W PQLE+L H STGGF++HCG
Sbjct  287   MWVLRDADTGDVSIGEGRKAQLPEGYEERVDGRGFILREWAPQLEVLGHPSTGGFMSHCG  346

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSC+ES+  GVP+A WP+  DQPRNAIL+T++LKTG+ + D   +DE   +  + +A++
Sbjct  347   WNSCVESISMGVPMAAWPMHSDQPRNAILVTKILKTGLMVGDLAHQDESFKAEVVEDAVK  406

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RLM S EG+E+R +A E   A+K+SV++G  +  EMD FIAHITR
Sbjct  407   RLMNSTEGQEMRKRAEELSDALKQSVIKGSDNSTEMDTFIAHITR  451



>ref|XP_009777653.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=484

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 212/315 (67%), Gaps = 18/315 (6%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             ++W+ +GR   P G  +   LP    C+ PEF KF+  + + + F  G +++  +AIE  
Sbjct  183   YVWESIGR---PFGIDMIKELPSNEGCFSPEFEKFMKSEHEYSKFNSGKIYNTSQAIEHT  239

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVI  458
             +LDLL+   ++++    W +GPFNPVV +   +T Q       RHK L WLDKQ PKSVI
Sbjct  240   FLDLLSK-EQISKGKKQWALGPFNPVVIQ---ETHQQ------RHKSLVWLDKQVPKSVI  289

Query  459   FVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNTK-----INLPAGFEERV  623
             FVSFGT +  SD Q+ E+A GLE+S Q FIWV++D  K    +K     I LP GFEER 
Sbjct  290   FVSFGTTSSFSDEQIKEIAIGLEKSQQKFIWVLRDADKENVFSKDFIKKIELPKGFEERA  349

Query  624   EGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILI  803
             + +G+I+RDW PQLEIL H STGGFL+HCGWNSC+ES+  GVP+  WP+  DQPRN +LI
Sbjct  350   KEKGIIVRDWAPQLEILAHSSTGGFLSHCGWNSCIESISMGVPIVAWPMHSDQPRNTVLI  409

Query  804   TEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGG  983
             T++LK GI +KDW  RD++  ST I  A+R LMAS EGEE+R +A E G  VK++V EGG
Sbjct  410   TKILKVGIVVKDWARRDDLIVSTKIEMAVRILMASEEGEEMRKRAEELGFGVKKAVGEGG  469

Query  984   ISRLEMDNFIAHITR  1028
             ++R E D+FIAHITR
Sbjct  470   VTRKEFDSFIAHITR  484



>ref|XP_007140338.1| hypothetical protein PHAVU_008G103900g [Phaseolus vulgaris]
 gb|ABS29019.1| family 1 glycosyltransferase [Phaseolus vulgaris]
 gb|ESW12332.1| hypothetical protein PHAVU_008G103900g [Phaseolus vulgaris]
Length=464

 Score =   318 bits (815),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/348 (45%), Positives = 214/348 (61%), Gaps = 38/348 (11%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRK--ILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSC  179
             N E Y F   SAF+ + L WE + +   LHVP                     +P    C
Sbjct  148   NVENYTFLSSSAFYTSLLFWEKMERPQCLHVP---------------------VPSLEGC  186

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             +P +F  F+  QR+ + F  G++++  RAIEG  ++ L  V        VW +GPFNP+ 
Sbjct  187   FPSQFMDFVSAQREFHKFSDGSIYNTSRAIEGASIEFLEGV---GGGKKVWALGPFNPLA  243

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
              +   K D D      RH CLEWLDKQ   SVI+VSFGT T L++ Q+ E+A GLEQS Q
Sbjct  244   VE---KKDSDG----IRHSCLEWLDKQEANSVIYVSFGTTTTLTEEQIQEIASGLEQSKQ  296

Query  540   NFIWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
              FIWV++D  KG         +  LP GFEERVEG GL++RDW PQLEIL+H STGGF++
Sbjct  297   KFIWVLRDADKGDIFDCSAAKRHELPTGFEERVEGMGLVVRDWAPQLEILNHSSTGGFMS  356

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSC+E++  GVP+A WP   DQPRN IL+T+VLK G+ +KDW  R+ + +++ + N
Sbjct  357   HCGWNSCLEALTMGVPIAAWPFHSDQPRNTILMTQVLKVGLVVKDWAQRNVVVSASVVEN  416

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             A+RRLM + EG+E+R++A      +  S+ EGG++  E+D FIAHIT+
Sbjct  417   AVRRLMETKEGDEMRDRAMRFKNVIHSSMGEGGVTSTEIDFFIAHITK  464



>ref|XP_010672878.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=483

 Score =   318 bits (815),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 162/348 (47%), Positives = 216/348 (62%), Gaps = 20/348 (6%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLPAGAVVPDRLPIPSSC  179
             ++    S   D  L+   +   LH  S      + W  +          +PD +P    C
Sbjct  136   HDTLTASVVQDVKLISNAVTYALHSVSAFTIFFYTWDSITEKPFQLDFDIPDDIPSKEGC  195

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             + PEF  FI  Q K   F  G L++  R IEG Y+DLL  +   A K  ++ IGP NPV 
Sbjct  196   FTPEFEDFIAKQYKVLNFESGRLYNTSREIEGRYMDLLEKLPTNANKK-LFAIGPLNPVE  254

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
              K N        SK+ RHKC+EWLDKQ   SVI+VSFGT T +++ Q+ ELA GLE+SG 
Sbjct  255   LKSNC-------SKS-RHKCIEWLDKQEKDSVIYVSFGTATSMTEEQISELAVGLEKSGH  306

Query  540   NFIWVVK--DLTKGYKNTKIN---LPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
              F+WV++  D    +    +    LP GF +R++ RG+++ DW PQLE+L H STGGF++
Sbjct  307   KFLWVLRSADRIDPFTEDSVQRPQLPEGFRDRLQSRGMVVTDWAPQLEVLAHPSTGGFMS  366

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSCMES+  GVP+A WP+  DQPRN IL+T+VL+TGI ++DW  R E+ TSTTI +
Sbjct  367   HCGWNSCMESISMGVPIAAWPMHSDQPRNTILVTQVLRTGIHVRDWTKRTELVTSTTIES  426

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             A+R LM S EG+E+R +AAE G  V+ S +EGG SRLEMD+FIAHITR
Sbjct  427   AVRSLMESEEGKEMRRRAAELGDIVRGSTVEGGTSRLEMDSFIAHITR  474



>ref|XP_009796347.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=451

 Score =   317 bits (811),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 218/317 (69%), Gaps = 17/317 (5%)
 Frame = +3

Query  96    SFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKF--IVDQRKTNAFCKGNLFDACRAI  269
             SFLW+L G+ VLP      D +P    C+P EF+++  I +Q      C G L+++ R I
Sbjct  146   SFLWELKGKPVLPGTEYYED-IPSILDCFPTEFWEYLKIQEQFDGKIHC-GELYNSSRVI  203

Query  270   EGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPK  449
             E  YLDL++      ++   W IGPFNP+  K   +T +DS+    RH+ L WLDKQ   
Sbjct  204   ESLYLDLMSKEKDGMKQ---WAIGPFNPLEPK---ETSKDSNK---RHESLHWLDKQEQN  254

Query  450   SVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNT----KINLPAGFEE  617
             SVIFVSFGT T L D ++ ELA GLE+S Q FIWV++D  KG   T    K+ LP G+EE
Sbjct  255   SVIFVSFGTTTSLCDEEVKELAIGLEKSEQKFIWVLRDADKGDVFTSEVRKVQLPEGYEE  314

Query  618   RVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAI  797
             +++GRG+I+RDW PQLEIL H STGGF++HCGWNSCMES+  GVP+A WP+  DQPRN+ 
Sbjct  315   KIKGRGIIVRDWAPQLEILAHNSTGGFMSHCGWNSCMESISFGVPIAAWPMHSDQPRNSQ  374

Query  798   LITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVME  977
             L+T+ LK G+ ++ W  RDE+ TS  + NA++ LMASP+G+E+R +AA+   A+K+SV +
Sbjct  375   LVTKYLKLGLTVRPWTRRDELATSEMVENAVKTLMASPQGDEMRKRAADLSNAIKKSVTD  434

Query  978   GGISRLEMDNFIAHITR  1028
             GG++R EMD+FIAHITR
Sbjct  435   GGVNRAEMDSFIAHITR  451



>ref|XP_009586606.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=453

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 223/347 (64%), Gaps = 30/347 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAFH  S  WEV               G+ +LP      D +P    C+ 
Sbjct  131   NTECYCFNPISAFHRYSYFWEV--------------KGKTLLPGTEHYED-IPSVKGCFS  175

Query  186   PEFFKFIVDQRK--TNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
              +F++++  Q          G LF++ R IEG YLDL+A  +   +   +W IGPFNPVV
Sbjct  176   ADFWEYLKAQVVPFVGKISCGELFNSSRVIEGLYLDLMAKEFNNPK---LWAIGPFNPVV  232

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                 T+ ++DSS    RHK L+WLDKQ   SVIFVSFGT T LS+ ++ E+A GLE+S Q
Sbjct  233   L---TEKNKDSSE---RHKSLDWLDKQEHNSVIFVSFGTTTSLSNEEIKEIAIGLEESEQ  286

Query  540   NFIWVVKDLTKG----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
              FIWV++D  KG     ++ KI LP G+EER++GRG+I+RDW PQLEIL H STGGF++H
Sbjct  287   KFIWVLRDADKGDVFASEDRKIQLPEGYEERIKGRGIIVRDWAPQLEILAHSSTGGFMSH  346

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMES+  GVP+A WP+  DQPRN+ L+T+ LK G+ ++ W  RDE  TS  + N 
Sbjct  347   CGWNSCMESISFGVPIAAWPMHSDQPRNSQLVTKYLKIGVTVRPWTRRDEHVTSEMVENT  406

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ++ LM S EG+E+R +AA    A+K+SVM+GG++R EMD+FIAHITR
Sbjct  407   VKTLMDSTEGDEMRKRAAVLSNAIKKSVMDGGMNRAEMDSFIAHITR  453



>ref|XP_007204339.1| hypothetical protein PRUPE_ppa005515mg [Prunus persica]
 gb|EMJ05538.1| hypothetical protein PRUPE_ppa005515mg [Prunus persica]
Length=457

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 215/347 (62%), Gaps = 26/347 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF     ++  L + +  P+ L  L           +PD  P    C+ 
Sbjct  130   NGESYTFHTVSAF----ALFLYLCEAIGRPAMLEAL--------HVEIPDDTPSLEDCFT  177

Query  186   PEFFKFIVDQRKTNAFCK-GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              EF  FI  Q K       GN+++  R IEGPY+D L M+    +    W +GPFNP   
Sbjct  178   NEFLDFIAAQYKCQKLNNAGNIYNTSRTIEGPYMDFLNMIGDHQKH---WALGPFNP---  231

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
               +T     +S+   RH+CL+WLDKQ P SVI+VSFGT T + D Q+ ELA GLEQS Q 
Sbjct  232   --STILKSGNSNGGRRHRCLDWLDKQAPNSVIYVSFGTTTAMKDEQIAELAIGLEQSNQK  289

Query  543   FIWVVKDLTKG--YKNT---KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
             FIWV++D  KG  + N    +  LP G+EERV+GRGL++RDW PQLEIL H STG F++H
Sbjct  290   FIWVLRDADKGDLFSNEEERRAELPQGYEERVKGRGLVVRDWAPQLEILAHKSTGMFVSH  349

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMES+  GVP+A WP+  DQPRN +LIT +L+ G+ ++DW  RDEI TS +++N 
Sbjct  350   CGWNSCMESITMGVPIAAWPMHSDQPRNTVLITRLLRVGVVMRDWAHRDEILTSLSVKNG  409

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + + M S EG E+R +AA+ G AV+ S++ GG S +E  +FI HITR
Sbjct  410   VEKFMGSKEGNEIRKRAADLGAAVRRSMVAGGASHMEFSSFIDHITR  456



>ref|XP_007162168.1| hypothetical protein PHAVU_001G129900g [Phaseolus vulgaris]
 gb|ESW34162.1| hypothetical protein PHAVU_001G129900g [Phaseolus vulgaris]
Length=484

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 224/348 (64%), Gaps = 23/348 (7%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLPAGAVVPDRLPIPSSC  179
             Y+  + S   DA+ +        H  S      + W ++GR  +   +++   +P    C
Sbjct  149   YDSLMASVVQDATHLSNCETYTFHSVSAFTMFLYFWDVMGRPPVNRMSLLVPEVPSLEGC  208

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             +  +F  FI  Q   + F KG +++  RAIEGPY++L+  +  ++RK   W +GPFNP+ 
Sbjct  209   FTTQFLDFIASQYVFHKFSKGIIYNTTRAIEGPYMELIERI--MSRKTH-WALGPFNPLS  265

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
              +++ K          +H C+EWLD+Q  +SV++VSFGT T  S+ Q+ E+A GLE+S Q
Sbjct  266   IEKDEKG---------KHFCIEWLDRQEARSVMYVSFGTTTCFSEEQIKEVANGLEKSKQ  316

Query  540   NFIWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
              F+WVV+D  KG        +++ LP GFEERV+G GL++R+W PQLEIL H STGGF++
Sbjct  317   KFVWVVRDADKGDVFNHDGGSQLVLPKGFEERVKGIGLVVREWAPQLEILSHSSTGGFMS  376

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSCMES+  GVP+A WP+  DQPRN +L+TEVLK G+ +K+WE RDE+ T++ + N
Sbjct  377   HCGWNSCMESISTGVPIAAWPMHSDQPRNRVLVTEVLKVGVVVKEWEHRDELVTASDVEN  436

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             A+R+LMA+ EG E+R +A E    + +S  EGG SR+E D+FIAH+TR
Sbjct  437   AVRKLMATKEGNEMRERAMELKNVILKSRDEGGASRMEFDDFIAHVTR  484



>ref|XP_010672879.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=474

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/348 (46%), Positives = 216/348 (62%), Gaps = 20/348 (6%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLPAGAVVPDRLPIPSSC  179
             ++    S   D  L+   +   LH  S      + W  +          +PD +P    C
Sbjct  136   HDTLTASVVQDVKLISNAVTYALHSVSAFTIFFYTWDSITEKPFQLDFDIPDDIPSKEGC  195

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             + PEF  FI  Q K   F  G L++  R IEG Y+DLL  +   A K  ++ IGP NPV 
Sbjct  196   FTPEFEDFIAKQYKVLNFESGRLYNTSREIEGRYMDLLEKLPTNANKK-LFAIGPLNPVE  254

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
              K N        SK+ RHKC+EWLDKQ   SVI+VSFGT T +++ Q+ ELA GLE+SG 
Sbjct  255   LKSNC-------SKS-RHKCIEWLDKQEKDSVIYVSFGTATSMTEEQISELAVGLEKSGH  306

Query  540   NFIWVVK--DLTKGYKNTKIN---LPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
              F+WV++  D    +    +    LP GF +R++ RG+++ DW PQLE+L H STGGF++
Sbjct  307   KFLWVLRSADRIDPFTEDSVQRPQLPEGFRDRLQSRGMVVTDWAPQLEVLAHPSTGGFMS  366

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSCMES+  GVP+A WP+  DQPRN IL+T+VL+TGI ++DW  R E+ TSTTI +
Sbjct  367   HCGWNSCMESISMGVPIAAWPMHSDQPRNTILVTQVLRTGIHVRDWTKRTELVTSTTIES  426

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             A+R LM S EG+E+R +AAE G  V+ S +EGG SRLEMD+FIAHI+R
Sbjct  427   AVRSLMESEEGKEMRRRAAELGDIVRGSTVEGGTSRLEMDSFIAHISR  474



>ref|XP_006350170.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=476

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 212/317 (67%), Gaps = 15/317 (5%)
 Frame = +3

Query  99    FLWKLVGR-FVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEG  275
             F+W+ +GR F + A  +    +P    C+ PEF KFI  Q     F  G +++ CR IEG
Sbjct  166   FIWENMGRPFDIDANFL--KDVPSLEDCFSPEFEKFIKLQHDYMKFNSGRIYNTCRVIEG  223

Query  276   PYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSV  455
             P+LDLL+   +++     W +GPFNPV+ ++       + S   +H+CL WLD+  P SV
Sbjct  224   PFLDLLSK-EQISNNKKQWALGPFNPVLVQQ-----YGTKSCHKQHECLIWLDEHEPNSV  277

Query  456   IFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG------YKNTKINLPAGFEE  617
             +FVSFGT T  SD Q+ E+A GLE+S   F+WV++D  KG      +++ KI LP GFEE
Sbjct  278   VFVSFGTTTSFSDEQIKEIAIGLERSEVKFVWVLRDADKGNVFAKDHQSRKIELPKGFEE  337

Query  618   RVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAI  797
             RV+ +G++LRDW PQLEIL H S GGF++HCGWNSCMES+  GVP+A WP+  DQPRN +
Sbjct  338   RVKDKGIVLRDWAPQLEILAHSSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNTV  397

Query  798   LITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVME  977
             L+T++LK G+ +K+W  R E+ T   ++ A+ +LMAS EGEE+RN+A +   A+K SV E
Sbjct  398   LVTKILKVGLVVKEWTRRHEVVTRGMVQAAVEKLMASKEGEEMRNRAMDLSGALKNSVAE  457

Query  978   GGISRLEMDNFIAHITR  1028
              GI  +E+D+FI+HITR
Sbjct  458   SGIKNMELDSFISHITR  474



>ref|XP_009796345.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=465

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 170/347 (49%), Positives = 221/347 (64%), Gaps = 31/347 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y+F   SAF   S              FLW+  G+ VLP G    D +P    C+P
Sbjct  144   NTECYSFNSTSAFMSYS--------------FLWEFKGKPVLP-GTEHYDDIPSILDCFP  188

Query  186   PEFFKF--IVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
              EF+ F  I +Q      C G L+++ R IE  YLDL+A  Y   ++   W IGPFNP+ 
Sbjct  189   TEFWDFLKIQEQFDGKIHC-GKLYNSSRVIESLYLDLMAKEYDGLKQ---WAIGPFNPLE  244

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
              K  +K   DS+    RH+ L+WL KQ P SVIFVSFGT T L D ++ ELA GLE+S Q
Sbjct  245   PKEKSK---DSNK---RHESLDWLGKQEPNSVIFVSFGTTTSLCDEEVKELAIGLEKSEQ  298

Query  540   NFIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
              FIWV++D  KG   T    K+ LP G+EER++ RG+I+RDW PQLEIL H STGGF++H
Sbjct  299   KFIWVLRDADKGDVFTSEVRKVQLPEGYEERIKERGIIVRDWAPQLEILAHSSTGGFMSH  358

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMESM  GVP+A WP+  DQPRN+ L+T+ LK G+ ++ W  RDE+ TS  I N 
Sbjct  359   CGWNSCMESMSMGVPIAAWPMHSDQPRNSQLVTKYLKIGLTVRPWTRRDELVTSEIIENV  418

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ++ LMAS EG+E+R +AA+    +K+SV + GI+R EMD+FIAHITR
Sbjct  419   VKILMASTEGDEMRKRAADLSNTIKKSVKDDGINRAEMDSFIAHITR  465



>ref|XP_009782889.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=482

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 215/346 (62%), Gaps = 25/346 (7%)
 Frame = +3

Query  3     QNHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             +N E Y F   SAF               +  F+W+ +GR   P  A +   LP    C+
Sbjct  147   ENAEAYTFHSVSAFT--------------LFLFIWETMGR-PFPIDAEILKDLPSLEGCF  191

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
               +F +F+  + +   F  G +++ CR IE P+LDLL+   ++      W +GPFNPV  
Sbjct  192   SSDFERFLKTEYEYMKFNSGKIYNTCRVIESPFLDLLSK-EQINGNKKQWALGPFNPV--  248

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                T +     S    HKCL WLDKQ P SV++VSFGT T  SD Q+ E+A GLEQS Q 
Sbjct  249   ---TLSGTKKGSNIRSHKCLLWLDKQEPNSVLYVSFGTTTSFSDEQIKEMAIGLEQSKQK  305

Query  543   FIWVVKDLTKGYKNTK----INLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV++D  KG   TK    I LP GFE+RV+ + +++RDW PQLEIL H S GGF+ HC
Sbjct  306   FIWVLRDADKGNVFTKDLRQIELPKGFEDRVKEKAIVIRDWAPQLEILSHSSIGGFMCHC  365

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+  WP+  DQPRN +LIT++LK G+ +K+W  R EI TS  ++ A+
Sbjct  366   GWNSCMESISMGVPIVAWPMHSDQPRNTVLITKILKVGLVVKEWARRQEIVTSNMVQKAV  425

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +LMAS EG+E+RN+A +   A+++SV  GG+ R+E+D+FI+HITR
Sbjct  426   EKLMASKEGDEMRNRAKDLSAALRKSVAVGGVKRMELDSFISHITR  471



>gb|KHN41707.1| Zeatin O-glucosyltransferase [Glycine soja]
Length=333

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 209/316 (66%), Gaps = 18/316 (6%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             + W+++GR  +  G      +P    C+PP+F  FI ++ + + F  GN+++  RAIEGP
Sbjct  30    YYWEVMGRPPV-EGFFQATEIPSMGGCFPPQFIHFITEEYEFHQFNDGNIYNTSRAIEGP  88

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPV-VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSV  455
             Y++ L  +     K  +W +GPFNP+ + K++ KT         RH C+EWLDKQ   SV
Sbjct  89    YIEFLERIG--GSKKRLWALGPFNPLTIEKKDPKT---------RHICIEWLDKQEANSV  137

Query  456   IFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEER  620
             ++VSFGT T  +  Q  ++A GLEQS Q FIWV++D  KG      +  +  LP GFEER
Sbjct  138   MYVSFGTTTSFTVAQFEQIAIGLEQSKQKFIWVLRDADKGNIFDGSEAERYELPNGFEER  197

Query  621   VEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
             VEG GL++RDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+A WP+  DQPRN++L
Sbjct  198   VEGIGLLIRDWAPQLEILSHTSTGGFMSHCGWNSCLESITMGVPIAAWPMHSDQPRNSVL  257

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             ITEVLK G  +KDW  R+ + +++ + NA+RRLM + EG+E+R++A      +  S   G
Sbjct  258   ITEVLKVGFVVKDWAQRNALVSASVVENAVRRLMETKEGDEMRDRAVRLKNCIHRSKYGG  317

Query  981   GISRLEMDNFIAHITR  1028
             G+SR+EM +FIAHIT+
Sbjct  318   GVSRMEMGSFIAHITK  333



>ref|XP_008244258.1| PREDICTED: zeatin O-glucosyltransferase-like [Prunus mume]
Length=480

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/347 (46%), Positives = 217/347 (63%), Gaps = 26/347 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF     ++  L + +  P+ L +L           +PD  P    C+ 
Sbjct  153   NGESYTFHTVSAF----ALFLYLCEAIGRPAMLEEL--------HVEIPDDTPSLEGCFT  200

Query  186   PEFFKFIVDQRKTNAFCK-GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              EF  FI  Q K       GN+++  R IEGPY+D L    ++      W +GPFNP   
Sbjct  201   NEFLDFIAAQYKCQKLNNAGNIYNTSRTIEGPYMDFLN---RIGDHQKHWALGPFNP---  254

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
               +T     +S+   RH CL+WLDKQ P SVI+VSFGT T + D Q+ ELA GLEQS Q 
Sbjct  255   --STILKSGNSNGGRRHMCLDWLDKQAPNSVIYVSFGTTTAMKDEQIAELAIGLEQSNQK  312

Query  543   FIWVVKDLTKG--YKNT---KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
             FIWV++D  KG  + N    +  LP G+EERV+GRGL++RDW PQLEIL H STGGF++H
Sbjct  313   FIWVLRDADKGDVFSNEEERRAELPQGYEERVKGRGLVVRDWAPQLEILAHKSTGGFVSH  372

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSC+ES+  GVP+A WP+  DQPRN +LIT +L+ G+ ++DW  RDEI TS +++N 
Sbjct  373   CGWNSCIESITMGVPVAAWPMHSDQPRNTVLITRLLRVGVVMRDWAHRDEILTSLSVKNG  432

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + + M S EG+E+R +AA+ G AV+ S++EGG S +E  +F+ HITR
Sbjct  433   VEKFMGSKEGDEIRKRAADLGAAVRRSMVEGGASHMEFSSFMDHITR  479



>ref|XP_004249252.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=471

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/346 (47%), Positives = 213/346 (62%), Gaps = 28/346 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF  A L+            F+W+   R  L    ++ D LP    C+ 
Sbjct  149   NAEAYTFHSVSAF--ALLL------------FIWERKKRPFLIDSEILID-LPSLKDCFS  193

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF   +  + +   F  G +++ C+ IE P+LDLL+       +   W +GPFNPV   
Sbjct  194   PEFENLMRKEYECMNFNSGKIYNTCKVIESPFLDLLSKEVTNNNEKQ-WALGPFNPVTFP  252

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +N          T  H CL WLDKQ   SVI VSFGT T  SD Q+ E+A GLEQS Q F
Sbjct  253   KN-------GPYTKSHTCLLWLDKQEQNSVILVSFGTTTSFSDEQIKEMAIGLEQSEQKF  305

Query  546   IWVVKDLTKGYKNTK-----INLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWV++D  KG   TK     I LP GFEERV+ RG+++RDW PQLEIL H STGGFL+HC
Sbjct  306   IWVLRDADKGNVFTKDSTRKIELPKGFEERVKERGILVRDWAPQLEILSHCSTGGFLSHC  365

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRN +LIT++LK GI ++DW  R+E+  S  ++N +
Sbjct  366   GWNSCMESVSMGVPIAAWPMHSDQPRNTVLITKILKIGIVVRDWADRNELVKSNVVKNCV  425

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +LMAS EG+E+RNKA      +++SV EGGI R+E+D+FI+HITR
Sbjct  426   EKLMASKEGDEMRNKAKILSVEIRKSVAEGGIKRIELDSFISHITR  471



>ref|XP_007145589.1| hypothetical protein PHAVU_007G251300g [Phaseolus vulgaris]
 gb|ESW17583.1| hypothetical protein PHAVU_007G251300g [Phaseolus vulgaris]
Length=467

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/345 (46%), Positives = 212/345 (61%), Gaps = 31/345 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF      WE + K    PS             G  VP+  P      P
Sbjct  143   NVERYTFQSTSAFFTFVYFWEQMGK----PSL-----------QGFRVPE-FPSLEESLP  186

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              EF ++I +  + N F  G++++  RA EGPYL+LL     +     VW +GPFNP+  +
Sbjct  187   AEFIEYISENFEFNKFNDGHIYNTSRAFEGPYLELLE---NMKGTKKVWALGPFNPLAFE  243

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +         S   RH C+EWLDKQ   SVI++SFGT T L D Q+ E+A GLEQS Q F
Sbjct  244   KK-------DSVGFRHSCMEWLDKQEASSVIYISFGTTTALRDEQIQEIATGLEQSKQKF  296

Query  546   IWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWV++D  KG      +  +  LP GFE+RV+G GL++RDW PQLEIL H +TGGF++HC
Sbjct  297   IWVLRDADKGDIFDGSETKRYELPKGFEKRVDGMGLVVRDWAPQLEILSHSATGGFMSHC  356

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+  GVP+ATWP+  DQPRNA+L+TE+LK G+ +KDWE R+ + +++ I N +
Sbjct  357   GWNSCLESITMGVPMATWPMHSDQPRNAVLVTEILKVGLVVKDWEQRNSLVSASVIENGV  416

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
             RRLM S EG+E+R ++      +  S+ EGGIS  EMD+FIAHIT
Sbjct  417   RRLMESKEGDEMRKRSMRLKNGIHRSMDEGGISPKEMDSFIAHIT  461



>ref|XP_007145586.1| hypothetical protein PHAVU_007G251000g [Phaseolus vulgaris]
 sp|P56725.1|ZOX_PHAVU RecName: Full=Zeatin O-xylosyltransferase; AltName: Full=Zeatin 
O-beta-D-xylosyltransferase [Phaseolus vulgaris]
 gb|AAD51778.1|AF116858_1 zeatin O-xylosyltransferase [Phaseolus vulgaris]
 gb|ESW17580.1| hypothetical protein PHAVU_007G251000g [Phaseolus vulgaris]
Length=454

 Score =   315 bits (806),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 216/346 (62%), Gaps = 31/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F V SA + A   WE + K    P             A    PD +P    C  
Sbjct  135   NVERYCFQVFSALNTAGDFWEQMGK----PPL-----------ADFHFPD-IPSLQGCIS  178

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              +F  F+  Q +   F  G++++  R IEGPY++LL    +      VW +GPF P+  +
Sbjct  179   AQFTDFLTAQNEFRKFNNGDIYNTSRVIEGPYVELLE---RFNGGKEVWALGPFTPLAVE  235

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +     +DS   +  H C+EWLDKQ P SVI+VSFGT T L D Q+ ELA GLEQS Q F
Sbjct  236   K-----KDSIGFS--HPCMEWLDKQEPSSVIYVSFGTTTALRDEQIQELATGLEQSKQKF  288

Query  546   IWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWV++D  KG      +  +  LP GFEERVEG GL++RDW PQ+EIL H STGGF++HC
Sbjct  289   IWVLRDADKGDIFDGSEAKRYELPEGFEERVEGMGLVVRDWAPQMEILSHSSTGGFMSHC  348

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+ RGVP+ATW +  DQPRNA+L+T+VLK G+ +KDWE R  + +++ I NA+
Sbjct  349   GWNSCLESLTRGVPMATWAMHSDQPRNAVLVTDVLKVGLIVKDWEQRKSLVSASVIENAV  408

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLM + EG+E+R +A +    +  S+ EGG+SR+EM +FIAHI+R
Sbjct  409   RRLMETKEGDEIRKRAVKLKDEIHRSMDEGGVSRMEMASFIAHISR  454



>ref|XP_003521165.2| PREDICTED: zeatin O-glucosyltransferase-like [Glycine max]
Length=505

 Score =   317 bits (811),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 216/346 (62%), Gaps = 32/346 (9%)
 Frame = +3

Query  54    SLVWEVLRKILHVPS----------------FLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             SL+  V++  +HVP+                + W  +GR  +   + +   +P    C+ 
Sbjct  171   SLMASVVQDAIHVPNCESYTFHSVSAFTMFLYFWDAMGRPPVEKVSHIIPEVPSLEGCFT  230

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              +F  FI  Q + + F KG +++  RAIE PYL+L+    ++      W +GPFNP+  +
Sbjct  231   TQFIDFITSQYEFHKFSKGTIYNTTRAIESPYLELIE---RIISSKTHWALGPFNPLSIE  287

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +             RH  +EWLDKQ   SV++VSFGT T  S+ Q+ E+A GLE+S Q F
Sbjct  288   KGVYNT--------RHFSVEWLDKQEAGSVLYVSFGTTTCFSEEQIKEVANGLEKSKQKF  339

Query  546   IWVVKDLTKG--YKNTKI---NLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWVV+D  KG  +    +    LP GFEERV+G GL++RDW PQLEIL H STGGF++HC
Sbjct  340   IWVVRDADKGDVFHEDGVRTAELPKGFEERVKGTGLVVRDWAPQLEILSHSSTGGFMSHC  399

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMESM  GVP+  WP+  DQPRN +L+TEVL+ G+ +KDW+ RDE+ TS+ + NA+
Sbjct  400   GWNSCMESMTMGVPIVAWPMHSDQPRNRVLVTEVLRVGVVVKDWDHRDELVTSSDVENAV  459

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLMA+ EG+E+R +A     A++ S  EGG+SR E+D+FIAH+TR
Sbjct  460   RRLMATKEGDEMRQRAMNLKNAIRRSKDEGGVSRAELDDFIAHVTR  505



>ref|XP_009595637.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=471

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 208/317 (66%), Gaps = 17/317 (5%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             F+W+ +GR   P  A +   +P    C+ PEF +F+  + +   F  G +++ CR IE P
Sbjct  165   FIWENMGR-PFPIDAEILKDIPSLEGCFSPEFERFLKTEYEYMKFNSGKIYNTCRVIESP  223

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPVV---TKRNTKTDQDSSSKTPRHKCLEWLDKQPPK  449
             +LDLL+   +L+     W +GPFNPV    TK+ +    D        KCL WLDKQ P 
Sbjct  224   FLDLLSK-EQLSGNKKQWALGPFNPVTLSGTKKGSNIRSD--------KCLLWLDKQEPN  274

Query  450   SVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNTK----INLPAGFEE  617
             SV++VSFGT T  SD Q+ E+A GLEQS Q FIWV++D  KG   TK    I LP GFEE
Sbjct  275   SVLYVSFGTTTSFSDEQIKEMAIGLEQSKQKFIWVLRDADKGDVFTKDLRQIELPKGFEE  334

Query  618   RVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAI  797
             RV+ +G+++RDW PQLEIL H S GGF++HCGWNSCMES+  GVP+  WP+  DQPRN +
Sbjct  335   RVKEKGILVRDWAPQLEILSHSSIGGFMSHCGWNSCMESISMGVPIIAWPMHSDQPRNTV  394

Query  798   LITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVME  977
             LIT++LK G+ +K+W  R E+ TS  ++ A+  LMAS EG+E+RN+  +   A ++SV E
Sbjct  395   LITKILKVGLVVKEWARRQELVTSNMVQKAVEILMASKEGDEMRNRVKDLSAAFRKSVAE  454

Query  978   GGISRLEMDNFIAHITR  1028
             GG+  +E+D+FI+HITR
Sbjct  455   GGVKSMELDSFISHITR  471



>gb|KHN07349.1| Zeatin O-glucosyltransferase [Glycine soja]
Length=505

 Score =   317 bits (811),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 216/346 (62%), Gaps = 32/346 (9%)
 Frame = +3

Query  54    SLVWEVLRKILHVPS----------------FLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             SL+  V++  +HVP+                + W  +GR  +   + +   +P    C+ 
Sbjct  171   SLMASVVQDAIHVPNCESYTFHSVSAFTMFLYFWDAMGRPPVEKVSHIIPEVPSLEGCFT  230

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              +F  FI  Q + + F KG +++  RAIE PYL+L+    ++      W +GPFNP+  +
Sbjct  231   TQFIDFITSQYEFHKFSKGTIYNTTRAIESPYLELIE---RIISSKTHWALGPFNPLSIE  287

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +             RH  +EWLDKQ   SV++VSFGT T  S+ Q+ E+A GLE+S Q F
Sbjct  288   KGVYNT--------RHFSVEWLDKQEAGSVLYVSFGTTTCFSEEQIKEVANGLEKSKQKF  339

Query  546   IWVVKDLTKG--YKNTKI---NLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWVV+D  KG  +    +    LP GFEERV+G GL++RDW PQLEIL H STGGF++HC
Sbjct  340   IWVVRDADKGDVFDEDGVRTAELPKGFEERVKGTGLVVRDWAPQLEILSHSSTGGFMSHC  399

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMESM  GVP+  WP+  DQPRN +L+TEVL+ G+ +KDW+ RDE+ TS+ + NA+
Sbjct  400   GWNSCMESMTMGVPIVAWPMHSDQPRNRVLVTEVLRVGVVVKDWDHRDELVTSSDVENAV  459

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLMA+ EG+E+R +A     A++ S  EGG+SR E+D+FIAH+TR
Sbjct  460   RRLMATKEGDEMRQRAMNLKNAIRRSKDEGGVSRAELDDFIAHVTR  505



>sp|Q9ZSK5.1|ZOG_PHALU RecName: Full=Zeatin O-glucosyltransferase; AltName: Full=Trans-zeatin 
O-beta-D-glucosyltransferase [Phaseolus lunatus]
 gb|AAD04166.1| zeatin O-glucosyltransferase [Phaseolus lunatus]
Length=459

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/346 (45%), Positives = 214/346 (62%), Gaps = 31/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF+ +   WE + K           VG F  P         P    C  
Sbjct  140   NVENYTFHSFSAFNTSGDFWEEMGK---------PPVGDFHFP-------EFPSLEGCIA  183

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              +F  F   Q +   F  G++++  R IEGPY++LL + +   +K  VW +GPFNP+  +
Sbjct  184   AQFKGFRTAQYEFRKFNNGDIYNTSRVIEGPYVELLEL-FNGGKK--VWALGPFNPLAVE  240

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +         S   RH C+EWLDKQ P SVI++SFGT T L D Q+ ++A GLEQS Q F
Sbjct  241   KK-------DSIGFRHPCMEWLDKQEPSSVIYISFGTTTALRDEQIQQIATGLEQSKQKF  293

Query  546   IWVVK-----DLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWV++     D+  G +  +  LP GFEERVEG GL++RDW PQLEIL H STGGF++HC
Sbjct  294   IWVLREADKGDIFAGSEAKRYELPKGFEERVEGMGLVVRDWAPQLEILSHSSTGGFMSHC  353

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+  GVP+ATWP+  DQPRNA+L+TEVLK G+ +KDW  R+ + +++ + N +
Sbjct  354   GWNSCLESITMGVPIATWPMHSDQPRNAVLVTEVLKVGLVVKDWAQRNSLVSASVVENGV  413

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLM + EG+E+R +A     A+  S+ EGG+S +EM +FIAHI++
Sbjct  414   RRLMETKEGDEMRQRAVRLKNAIHRSMDEGGVSHMEMGSFIAHISK  459



>ref|XP_010269695.1| PREDICTED: zeatin O-glucosyltransferase-like [Nelumbo nucifera]
Length=525

 Score =   317 bits (811),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 230/351 (66%), Gaps = 34/351 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPS--SC  179
             N E Y F   SAF   ++V+            LW+ +GR     G ++P+ +P  S   C
Sbjct  198   NAEAYAFHPVSAF---AIVFH-----------LWESLGRPT-DEGILIPNDVPHHSLEGC  242

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             +  EF KFI  Q     F  G+L++ CRA+EG ++DLL    KL+    +W +GP NPVV
Sbjct  243   FTGEFAKFIARQYDLMNFDVGDLYNTCRAMEGRFVDLLDQ-EKLSGNKRIWAVGPLNPVV  301

Query  360   TKRNTKTDQDSSSKTP--RHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
                       ++ ++P  RHKCLEWLDKQP +SV++VSFGT T LSD Q+ ELA GLE+S
Sbjct  302   LG--------AARESPWRRHKCLEWLDKQPLRSVLYVSFGTMTSLSDDQIFELAVGLERS  353

Query  534   GQNFIWVVKDLTKG--YKNTK----INLPAGFEERVEGRGLILRDWVPQLEILDHVSTGG  695
              Q FIWV+++  +G  Y   +      LP G+EERVEG GLI+RDW PQLEIL H +TGG
Sbjct  354   KQRFIWVLREADRGDIYAEEEEARVTQLPKGYEERVEGVGLIVRDWAPQLEILAHRATGG  413

Query  696   FLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTT  875
             FL+HCGWNSC+ES+  GVP+A WP+  DQPRN +L+T+VL+ G+ +++W  R E+ +S  
Sbjct  414   FLSHCGWNSCVESISMGVPIAAWPMHSDQPRNTMLVTQVLRVGLVVREWARRHELVSSDA  473

Query  876   IRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + +A R+LMAS EG+++R KA   G AV++S+ EGGISR E+D+F+AHI+R
Sbjct  474   VEDAARKLMASEEGDDMRKKAEMLGGAVRDSMSEGGISRAELDSFVAHISR  524



>gb|EYU20759.1| hypothetical protein MIMGU_mgv1a017976mg [Erythranthe guttata]
Length=453

 Score =   314 bits (805),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 162/318 (51%), Positives = 209/318 (66%), Gaps = 17/318 (5%)
 Frame = +3

Query  96    SFLWKLVGRFVLPAGAV-VPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIE  272
             SFLW+  G+  LPAGA      +P     + PEF  F   QR +     GN++++ R IE
Sbjct  146   SFLWETAGKPDLPAGAAKFLKEIPGRDDFFTPEFSDFSTLQRSSRKKIAGNIYNSSRLIE  205

Query  273   GPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKT-PRHKCLEWLDKQPPK  449
             G YL+LL    +  +   VW IGPFNP V    T TDQ+    +  RH+CL+WLDKQ P 
Sbjct  206   GTYLNLL----EQEKGEKVWAIGPFNPTVI---TTTDQEKVLDSRNRHECLDWLDKQEPN  258

Query  450   SVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG----YKNTKINLPAGFEE  617
             SVIFVSFG+ T LSD Q+ ELA GLE+S Q FIWVV++  KG     ++ K  LP GFEE
Sbjct  259   SVIFVSFGSTTSLSDEQIQELAIGLERSSQKFIWVVREADKGDIFEGESRKAELPRGFEE  318

Query  618   RVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAI  797
             RV  RG+++R+W PQLEIL H STGGF++HCGWNSCMES+  GVP+ TWP+  DQPRN  
Sbjct  319   RVSKRGIVVREWAPQLEILGHSSTGGFMSHCGWNSCMESISMGVPMVTWPMHSDQPRNGF  378

Query  798   LITEVLKTGIPIKDWES-RDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVM  974
             L+T+VL+ G+ ++DW   RD++ +S  + NA+R LM   E EE+R +A E G AV+ S M
Sbjct  379   LVTKVLRVGVEVRDWGCFRDKVVSSVMVENAVRVLM---ESEEIRKRAEELGAAVRNSFM  435

Query  975   EGGISRLEMDNFIAHITR  1028
             EGG    EM +FIAHITR
Sbjct  436   EGGSGSNEMKSFIAHITR  453



>gb|KCW90130.1| hypothetical protein EUGRSUZ_A02321, partial [Eucalyptus grandis]
Length=460

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 215/351 (61%), Gaps = 25/351 (7%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLPAGAVVPDRLPIPSSC  179
             Y+  + S   DA+ V      +   PS      F W+ +G    P     P    I  SC
Sbjct  121   YDSLMASVVQDAASVPNAEIYLFQPPSAFMLCWFTWESIGMAPPPEVEGFPS---IVDSC  177

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
              P EF KF+  Q++   F  G + + CR +EG ++DL A           W IGPFNPV 
Sbjct  178   -PNEFLKFVESQKECQKFNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAIGPFNPVK  236

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                      + SS+   H C+EWLDKQ P SVI+VSFGT TVLSD Q+ E+A GLE+SGQ
Sbjct  237   VP-------EKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLSDEQIREIAMGLERSGQ  289

Query  540   NFIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGG  695
              FIWV+++  K      G +  KI LP GFEE    R  G+++RDW PQLEIL H +TGG
Sbjct  290   KFIWVLREADKADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGG  349

Query  696   FLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTT  875
             FL+HCGWNSCMES+  GVP+  WP+  DQP NA+LIT+VLK G+ +KDW S D++  S+ 
Sbjct  350   FLSHCGWNSCMESISMGVPILAWPMHSDQPLNAVLITQVLKIGLIVKDWMSPDDVVKSSA  409

Query  876   IRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             I  A++ LMAS EGEE R +AAE G AV+ S+ EGG+SR E+D+FIAHI+R
Sbjct  410   IEGAVKALMASEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHISR  460



>ref|XP_009596925.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=458

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 206/303 (68%), Gaps = 18/303 (6%)
 Frame = +3

Query  135   AGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCK-GNLFDACRAIEGPYLDLLAMVYKL  311
             AG  +   LP    C+  EF +F   Q +       G+L+++C  IEG YLDLLA    +
Sbjct  169   AGKSIDANLPSIQGCFTQEFLEFSRVQTEFRELVNSGDLYNSCYEIEGLYLDLLAKEKPV  228

Query  312   ARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLS  491
             + K   W +GP NPV+       D+  S+K  RHKCLEWLDKQ P SVIFVSFGT T LS
Sbjct  229   SHKQ--WAVGPLNPVIL-----YDKKDSNK--RHKCLEWLDKQEPNSVIFVSFGTTTSLS  279

Query  492   DHQLHELAEGLEQSGQNFIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVP  659
             D ++ ELA GLEQS Q FIWV++D  KG   T    K+ LP G+EERV+GRGLI+RDW P
Sbjct  280   DKEIKELAMGLEQSKQRFIWVLRDADKGDIFTGDIRKVELPKGYEERVKGRGLIVRDWAP  339

Query  660   QLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKD  839
             QLEIL H+STGGF++HCGWNSCMES+  GVP+  WP+  DQPRNA L+T+VLK GI +KD
Sbjct  340   QLEILGHLSTGGFMSHCGWNSCMESISMGVPIIAWPMHSDQPRNAFLVTDVLKIGIVLKD  399

Query  840   WESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAH  1019
             W  RDE+ TS  ++  ++RLM S EG+++R +A E    + +SV++GG S  EMD+FIAH
Sbjct  400   WALRDELVTSVIVKECVKRLMDSVEGDKMRQRAIE----LSKSVVDGGGSGKEMDSFIAH  455

Query  1020  ITR  1028
             ITR
Sbjct  456   ITR  458



>ref|XP_006351402.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=471

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/346 (46%), Positives = 213/346 (62%), Gaps = 28/346 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF     +WE  ++              F++ +  ++   LP    C+ 
Sbjct  149   NAEAYTFHSVSAFTLLLFIWERKKR-------------PFLIDSEMLID--LPSLEGCFS  193

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF K +  + +   F  G +++ CR +E P+LDLL +          W +GPFNPV   
Sbjct  194   PEFEKLMKREYECMKFNSGKIYNTCRVMESPFLDLL-LKEVTNNNEKQWALGPFNPVTFP  252

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +N          T  H CL WLDKQ P SVI VSFGT T  SD Q+ E+A GLEQS Q F
Sbjct  253   KN-------GPNTKSHTCLLWLDKQEPNSVILVSFGTTTSFSDEQIKEIAIGLEQSEQKF  305

Query  546   IWVVKDLTKGYKNTK-----INLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWV++D  KG   TK     I LP GFEERV+ +G+++RDW PQLEIL H STGGFL+HC
Sbjct  306   IWVLRDADKGNVFTKDSSRKIELPKGFEERVKEKGILVRDWAPQLEILSHCSTGGFLSHC  365

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRNA+LIT++LK GI +++W +R+E+  S  ++  +
Sbjct  366   GWNSCMESVSMGVPIAAWPMHSDQPRNAVLITKILKIGIVVREWANRNELVKSNVVKKCV  425

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +LMAS  G+E+RNKA      +++SV EGGI R+E+D+FI+HITR
Sbjct  426   EKLMASKGGDEMRNKAKYLSVEIRKSVAEGGIKRIELDSFISHITR  471



>gb|AAM09514.2|AF489874_1 zeatin O-glucosyltransferase [Glycine max]
Length=464

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 209/316 (66%), Gaps = 18/316 (6%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             + W+++GR  +  G      +P    C+PP+F  FI ++ + + F  GN+++  RAIEGP
Sbjct  161   YYWEVMGRPPV-EGFFQATEIPSMGGCFPPQFIHFITEEYEFHQFNDGNIYNTSRAIEGP  219

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPV-VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSV  455
             Y++ L  +     K  +W +GPFNP+ + K++ KT         RH C+EWLDKQ   SV
Sbjct  220   YIEFLERIG--GSKKRLWALGPFNPLTIEKKDPKT---------RHICIEWLDKQEANSV  268

Query  456   IFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEER  620
             ++VSFGT T  +  Q  ++A GLEQS Q FIWV++D  KG      +  +  LP GFEER
Sbjct  269   MYVSFGTTTSFTVAQFEQIAIGLEQSKQKFIWVLRDADKGNIFDGSEAERYELPNGFEER  328

Query  621   VEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
             VEG GL++RDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+A WP+  DQPRN++L
Sbjct  329   VEGIGLLIRDWAPQLEILSHTSTGGFMSHCGWNSCLESITMGVPIAAWPMHSDQPRNSVL  388

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             ITEVLK G  +KDW  R+ + +++ + NA+RRLM + EG+E+R++A      +  S   G
Sbjct  389   ITEVLKVGFVVKDWAQRNALVSASVVENAVRRLMETKEGDEMRDRAVRLKNCIHRSKYGG  448

Query  981   GISRLEMDNFIAHITR  1028
             G+SR+EM +FIAHIT+
Sbjct  449   GVSRMEMGSFIAHITK  464



>ref|XP_009589266.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=508

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/347 (48%), Positives = 225/347 (65%), Gaps = 31/347 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y+F   SAF   S              FLW+L G+ VLP      D +P    C+ 
Sbjct  187   NTECYSFNSTSAFFSYS--------------FLWELKGKPVLPGTEHYED-IPSVLDCFT  231

Query  186   PEFFKF--IVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
              EF+++  I +Q      C G L+++ R IE  YLDL+A  Y   ++   W IGPFNP+ 
Sbjct  232   TEFWEYLKIQEQFDGKIHC-GELYNSSRVIESLYLDLMAKEYDGLKQ---WAIGPFNPLE  287

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
              K  +K   DS+    R++ L+WLDKQ   SVIFVSFGT T L D ++ ELA GLE+S Q
Sbjct  288   PKEKSK---DSNK---RYESLDWLDKQERNSVIFVSFGTTTSLCDEEVKELAIGLEKSEQ  341

Query  540   NFIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
              FIWV++D  KG   T    K+ LP G+EE+++GRG+I+RDW PQLEIL H STGGF++H
Sbjct  342   KFIWVLRDADKGDVFTSEVRKVQLPEGYEEKIQGRGIIVRDWAPQLEILAHNSTGGFMSH  401

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMES+  GVP+ATWP+  DQPRN+ L+T+ LK G+ ++ W  RDE+ TS  + NA
Sbjct  402   CGWNSCMESISFGVPIATWPMHSDQPRNSQLVTKYLKIGLTVRPWTRRDELVTSEMVENA  461

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ++ LMASP+G+E+R +AA+   A+K+SV +GG++  EMD+FI HITR
Sbjct  462   VKTLMASPQGDEMRKRAADLSNAIKKSVTDGGVNCAEMDSFITHITR  508



>gb|EYU18710.1| hypothetical protein MIMGU_mgv1a005799mg [Erythranthe guttata]
Length=470

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 207/311 (67%), Gaps = 9/311 (3%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             FLW+ VGR     G ++ D LP    C+ PEF KF+  Q        G +++ CR +EG 
Sbjct  168   FLWENVGRPFAVDGGILED-LPSMEGCFTPEFLKFVRRQHDYMKLNSGRIYNTCRVVEGQ  226

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVI  458
             ++++L    +++     W +GPFNPVV       +    SK  RH+CL+WLD Q   SVI
Sbjct  227   FMEMLEKP-EISGNKKQWALGPFNPVVL------EYSGESKKGRHRCLKWLDGQAKDSVI  279

Query  459   FVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDL-TKGYKNTKINLPAGFEERVEGRG  635
              VSFGT T LS+ Q+ ELA GLE+SG+ FIWV++D    G    ++     FEERV  RG
Sbjct  280   LVSFGTTTTLSEKQIKELAAGLERSGKKFIWVLRDADGGGGGGGEVCKRVEFEERVRERG  339

Query  636   LILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVL  815
             +++R+W PQLEIL H STGGF++HCGWNSCMES+  GVP+A WP+  DQPRN +LIT+VL
Sbjct  340   IVVREWAPQLEILGHSSTGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNTVLITKVL  399

Query  816   KTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRL  995
             K G+ +KDW  RDEI T+  +  A+ RLM S EGEE+R +AAE G AV+++  EGG+SR+
Sbjct  400   KIGVVVKDWGRRDEIVTADDVEKAVGRLMGSEEGEEMRRRAAELGGAVRKAAGEGGLSRV  459

Query  996   EMDNFIAHITR  1028
             E+D+FI+HITR
Sbjct  460   ELDSFISHITR  470



>ref|XP_003535886.2| PREDICTED: zeatin O-glucosyltransferase [Glycine max]
Length=481

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 209/316 (66%), Gaps = 18/316 (6%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             + W+++GR  +  G      +P    C+PP+F  FI ++ + + F  GN+++  RAIEGP
Sbjct  178   YYWEVMGRPPV-EGFFQATEIPSMGGCFPPQFIHFITEEYEFHQFNDGNIYNTSRAIEGP  236

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPV-VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSV  455
             Y++ L  +     K  +W +GPFNP+ + K++ KT         RH C+EWLDKQ   SV
Sbjct  237   YIEFLERIG--GSKKRLWALGPFNPLTIEKKDPKT---------RHICIEWLDKQEANSV  285

Query  456   IFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEER  620
             ++VSFGT T  +  Q  ++A GLEQS Q FIWV++D  KG      +  +  LP GFEER
Sbjct  286   MYVSFGTTTSFTVAQFEQIAIGLEQSKQKFIWVLRDADKGNIFDGSEAERYELPNGFEER  345

Query  621   VEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
             VEG GL++RDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+A WP+  DQPRN++L
Sbjct  346   VEGIGLLIRDWAPQLEILSHTSTGGFMSHCGWNSCLESITMGVPIAAWPMHSDQPRNSVL  405

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             ITEVLK G  +KDW  R+ + +++ + NA+RRLM + EG+E+R++A      +  S   G
Sbjct  406   ITEVLKVGFVVKDWAQRNALVSASVVENAVRRLMETKEGDEMRDRAVRLKNCIHRSKYGG  465

Query  981   GISRLEMDNFIAHITR  1028
             G+SR+EM +FIAHIT+
Sbjct  466   GVSRMEMGSFIAHITK  481



>ref|XP_002308926.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE92449.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=473

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/348 (44%), Positives = 219/348 (63%), Gaps = 24/348 (7%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILH------VPSFLWKLVGRFVLPAGAVVPDRLPIPSSC  179
             ++  +GS   +A L+  V   I H      V S+ W+  G+ ++    + P  +P    C
Sbjct  137   HDSLMGSVIQEARLLPNVESYIFHSVSAFTVSSYAWEQQGKNIIEDNELFPQDIPSLEGC  196

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKG-PVWGIGPFNPV  356
             +  EF  F   Q     F  G +++ C+ +EG Y DLL    + A++G   W +GPFNPV
Sbjct  197   FTAEFADFFARQSNYQKFNTGCVYNTCKLVEGAYTDLLEK--ETAKEGIKHWALGPFNPV  254

Query  357   -VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
              + +R+ K          +  CL+WLDK    SVI+VSFGT T L D Q+ ELA GL +S
Sbjct  255   TIPERSEK----------KRFCLDWLDKHARNSVIYVSFGTTTTLDDEQIKELAIGLRES  304

Query  534   GQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
              Q FIW ++D  KG     +  +  LP G+E+ V+G GL+LRDW PQLEIL H +TGG +
Sbjct  305   KQKFIWALRDADKGDVFNGEERRAELPEGYEDSVDGIGLVLRDWAPQLEILAHPATGGIM  364

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+A WP+  DQPRNA+LIT++LK G+ +K+WE RDEI TS  + 
Sbjct  365   SHCGWNSCMESITMGVPIAAWPMHSDQPRNAVLITKILKIGVVVKEWELRDEIVTSKIVE  424

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
             +A+++LMAS EG+E+R +A E G +V+ S  EGG+SR+EM++F+AHIT
Sbjct  425   SAVKKLMASTEGDEMRRRAEEMGESVRVSAAEGGVSRMEMESFVAHIT  472



>ref|XP_004237101.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=467

 Score =   312 bits (800),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 211/317 (67%), Gaps = 15/317 (5%)
 Frame = +3

Query  99    FLWKLVGR-FVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEG  275
             F+W+ +GR F + A  +    +P    C+ PEF KFI  Q     F  G +++ CR IEG
Sbjct  157   FIWENMGRPFDIDANFL--KDVPSLEDCFSPEFEKFIKLQHDYMKFNSGRIYNTCRVIEG  214

Query  276   PYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSV  455
             P+LDLL+   +++     W +GPFNPV+ ++       + S   +HK L WLD+  P SV
Sbjct  215   PFLDLLSK-EQISNNKMQWALGPFNPVLVQQ-----YGTKSCHKQHKSLIWLDEHEPNSV  268

Query  456   IFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG------YKNTKINLPAGFEE  617
             +FVSFGT T  SD Q+ E+A GLE+S   F+WV++D  KG      +++ KI LP GFEE
Sbjct  269   VFVSFGTTTSFSDEQIKEIAIGLEESEVKFVWVLRDADKGNVFAKDHQSRKIELPKGFEE  328

Query  618   RVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAI  797
             RV+ +G++LRDW PQLEIL H S GGF++HCGWNSCMES+  GVP+A WP+  DQPRN +
Sbjct  329   RVKDKGIVLRDWAPQLEILAHSSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNTV  388

Query  798   LITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVME  977
             L+T++LK G+ +K+W  R E+ T   ++ A+ +LM S EGEE+RN+A +   A+K+SV E
Sbjct  389   LVTKILKVGLVVKEWTRRHEVVTRGMVQAAVEKLMVSKEGEEMRNRAMDLSGALKKSVAE  448

Query  978   GGISRLEMDNFIAHITR  1028
              GI  +E+D+FI+HITR
Sbjct  449   SGIKNMELDSFISHITR  465



>ref|XP_006421301.1| hypothetical protein CICLE_v10004886mg [Citrus clementina]
 gb|ESR34541.1| hypothetical protein CICLE_v10004886mg [Citrus clementina]
Length=475

 Score =   313 bits (801),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 212/346 (61%), Gaps = 27/346 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVL-PAGAVVPDRLPIPSSCY  182
             N E+Y F   SAF             L++  ++W+ +G   L  A  ++P  +P    C+
Sbjct  152   NAESYTFHSVSAF------------TLYL--YIWERMGNPTLNEASGLIPKDVPSLEGCF  197

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
               EF   I  +     F  GN+++  R IE  Y+DLL     +A     W +GPFNPV  
Sbjct  198   TSEFLDSIASEYDHMKFNSGNVYNTSRVIESAYMDLLEKA-TVAETFNHWALGPFNPV--  254

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                  T  +      RH CLEWLDKQ   SV++VSFGT T +SD Q+ ELA GL+QS Q 
Sbjct  255   -----TLPNKGGSNGRHFCLEWLDKQEKNSVLYVSFGTTTAMSDEQIKELAVGLKQSNQK  309

Query  543   FIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV++D  +G     +  +  LP  +E+ V+ +GL++RDW PQLEIL H STGGF++HC
Sbjct  310   FIWVLRDADRGDVFNGEVRRAELPKAYEDSVKDKGLVVRDWAPQLEILAHCSTGGFMSHC  369

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+  WP+  DQPRN +LIT +LK G+ + DW  RDEI TS  I NA+
Sbjct  370   GWNSCMESITMGVPIVAWPMHSDQPRNTLLITHLLKLGLVMADWARRDEIVTSNAIENAV  429

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +RLMAS EG+E+R KA E G  V+ S+ EGG+SR+E D+FIAHITR
Sbjct  430   KRLMASKEGDEIRKKAVELGGNVRRSMDEGGVSRMEFDSFIAHITR  475



>gb|KHN14960.1| Zeatin O-glucosyltransferase [Glycine soja]
Length=505

 Score =   313 bits (803),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 216/346 (62%), Gaps = 32/346 (9%)
 Frame = +3

Query  54    SLVWEVLRKILHVPS----------------FLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             SL+  V++  +HVP+                + W  +GR  +   + V   +P    C+ 
Sbjct  171   SLMASVVQDAIHVPNCESYTFHSVSAFTMFLYFWDAMGRPPVEKVSHVIPEVPSLEGCFT  230

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              +F  FI  Q + + F KG +++  R IE PYL+L+    ++      W +GPFNP+  +
Sbjct  231   TQFIDFITSQYEFHKFSKGTIYNTTRVIESPYLELIK---RIISSKTHWALGPFNPLSIE  287

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +             +H  +EWLDKQ   SV++VSFGT T  S+ Q+ E+A GLE+S Q F
Sbjct  288   KGVYNT--------KHFSVEWLDKQEAGSVLYVSFGTTTCFSEEQIKEVANGLEKSKQKF  339

Query  546   IWVVKDLTKGYKNTK-----INLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWVV+D  KG    +       LP GFEERV+G GL++RDW PQLEIL H STGGF++HC
Sbjct  340   IWVVRDADKGDVFIEDGVRTSELPKGFEERVKGTGLVVRDWAPQLEILSHSSTGGFMSHC  399

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRN +L+TEVLK G+ +KDW+ RDE+ T++ + NA+
Sbjct  400   GWNSCMESITMGVPIAAWPMHSDQPRNRVLVTEVLKIGVVVKDWDHRDELVTASDVENAV  459

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLMA+ EG+E+R +A     A++ S  EGG+SR+E+D+FIAHITR
Sbjct  460   RRLMATKEGDEMRQRAMNLKNAIRRSRDEGGVSRVELDDFIAHITR  505



>gb|KCW90134.1| hypothetical protein EUGRSUZ_A02323, partial [Eucalyptus grandis]
Length=460

 Score =   312 bits (799),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 214/351 (61%), Gaps = 25/351 (7%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLPAGAVVPDRLPIPSSC  179
             Y+  + S   DA+ V      +   PS      F W+ +G    P     P    I  SC
Sbjct  121   YDSLMASVVQDAASVPNAEIYVFQPPSAFMLCWFTWESIGMAPPPEVEGFPS---IVDSC  177

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
              P EF KF+  Q++   F  G + + CR +EG ++DL A           W IGPFNPV 
Sbjct  178   -PNEFLKFVESQKECQKFNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAIGPFNPVK  236

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                      + SS+   H C+EWLDKQ P SVI+VSFGT TVLS  Q+ E+A GLE+SGQ
Sbjct  237   VP-------EKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLSGEQIREIAMGLERSGQ  289

Query  540   NFIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGG  695
              FIWV+++  K      G +  KI LP GFEE    R  G+++RDW PQLEIL H +TGG
Sbjct  290   KFIWVLREADKADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGG  349

Query  696   FLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTT  875
             FL+HCGWNSCMES+  GVP+  WP+  DQP NA+LIT+VLK G+ +KDW S D++  S+ 
Sbjct  350   FLSHCGWNSCMESISMGVPILAWPMHSDQPLNAVLITQVLKIGLIVKDWMSPDDVVKSSA  409

Query  876   IRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             I  A++ LMAS EGEE R +AAE G AV+ S+ EGG+SR E+D+FIAHI+R
Sbjct  410   IEGAVKALMASEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHISR  460



>ref|XP_008346617.1| PREDICTED: zeatin O-glucosyltransferase-like [Malus domestica]
Length=468

 Score =   312 bits (799),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 157/349 (45%), Positives = 221/349 (63%), Gaps = 31/349 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVG--RFVLPAGAVVPDRLPIPSSC  179
             N E+Y F   SAF               +  +LW+++G  + +      +PD +P    C
Sbjct  143   NGESYTFHSVSAFT--------------IFLYLWEVIGMPKKLEKLXVKLPDGIPSLEGC  188

Query  180   YPPEFFKFIVDQRKTNAFCK-GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV  356
             +  EF  F+ +Q +       GNL +  R IEGPY+DLL  + +       W IGPFNP 
Sbjct  189   FTIEFMNFLGEQHEHQKLMNAGNLHNTSRTIEGPYIDLLNRIGQQKH----WAIGPFNPT  244

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                  T  + +++S   RHKCLEWLDKQ   SV++VSFGT T + D Q+ ELA GLE+S 
Sbjct  245   -----TVANPNNNSNGSRHKCLEWLDKQEQSSVMYVSFGTTTAMKDEQIQELAIGLEESK  299

Query  537   QNFIWVVKDLTKG--YKNTKI---NLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             Q FIWV++D  KG  + + ++    LP G+EE+V+GRGL++RDW PQL+IL H STGGFL
Sbjct  300   QKFIWVLRDADKGDLFSDGEVRRAELPRGYEEKVKGRGLVVRDWAPQLDILSHKSTGGFL  359

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSC+ES+  GVP+A WP+  DQPRN +LIT++L  G  ++ W+ RDE+ TS +I+
Sbjct  360   SHCGWNSCIESITMGVPIAAWPMHSDQPRNTVLITKLLGVGFVMRHWDKRDELVTSQSIK  419

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             N +++ M S EG+E+R +AAE G  V++S +EGG S +E  +FIAHITR
Sbjct  420   NGVQKFMWSEEGDEIRKRAAELGADVRQSRVEGGASHMEFSSFIAHITR  468



>ref|XP_009363212.1| PREDICTED: zeatin O-glucosyltransferase-like [Pyrus x bretschneideri]
Length=464

 Score =   311 bits (798),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 160/348 (46%), Positives = 217/348 (62%), Gaps = 33/348 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIP-SSCY  182
             N E+Y F   SAF               +  +LW+++G   +P               C+
Sbjct  142   NGESYTFHSVSAFT--------------IFLYLWEVIG---MPXXXXXXXXXXXXLEGCF  184

Query  183   PPEFFKFIVDQRKTNAFCK-GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
               EF  FI +Q +       GNL +  R IEGPY+DLL  + +       W IGPFNP  
Sbjct  185   TIEFMNFIGEQHEHQKLINAGNLHNTSRTIEGPYIDLLNRIGQQKH----WAIGPFNPT-  239

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                 T  + +++S   RHKCLEWLDKQ   SVI+VSFGT T + D Q+ ELA GLE+S Q
Sbjct  240   ----TVANPNNNSNGSRHKCLEWLDKQEQSSVIYVSFGTTTTMKDEQIQELAIGLEESKQ  295

Query  540   NFIWVVKDLTKG--YKNTKI---NLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
              FIWV++D  KG  + + ++    LP G+EERV+GRGL++RDW PQLEIL H STGGFL+
Sbjct  296   QFIWVLRDADKGDLFSDGEVRRAELPQGYEERVKGRGLVVRDWAPQLEILSHKSTGGFLS  355

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSC+ES+  GVP+A WP+  DQPRN +LIT++L  G  ++DW+ RDE+ TS +I+N
Sbjct  356   HCGWNSCIESITMGVPIAAWPMHSDQPRNTVLITKLLGVGFVMRDWDKRDELVTSQSIKN  415

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +++ M S EG+E+R +AAE G  V++S +EGG S +E  +FIAHITR
Sbjct  416   GVQKFMWSEEGDEIRKRAAELGADVRQSRVEGGASYMEFSSFIAHITR  463



>ref|XP_009628740.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=476

 Score =   312 bits (799),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 212/346 (61%), Gaps = 30/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF     VWE + K   + + + K                LP    C+ 
Sbjct  156   NAEAYTFHSVSAFTLFLYVWESIGKPFAIDTDMIK---------------ELPSNEGCFS  200

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF KF+  +   + F  G +++  +AIE  +LDLL+   ++++    W +GPFNP V +
Sbjct  201   PEFDKFVKSEHAYSTFSSGKIYNTSKAIEDTFLDLLSK-EQISKGKKQWALGPFNPAVIQ  259

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                       +   RHK L WLDKQ PKSVIFVSFGT    SD Q+ E+A GLE+S Q F
Sbjct  260   ---------GTHQQRHKSLIWLDKQVPKSVIFVSFGTTCSFSDEQIKEIAIGLERSQQKF  310

Query  546   IWVVKDLTKGYKNTK-----INLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWV++D  K    +K     I LP GFEERV+ +G+I+RDW PQLEIL H STGGFL+HC
Sbjct  311   IWVLRDADKENVFSKDFIKKIELPKGFEERVKEKGIIVRDWAPQLEILAHSSTGGFLSHC  370

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+  GVP+  WP+  DQPRN +LIT++LK GI +KDW  RD++  S+TI  A+
Sbjct  371   GWNSCVESISMGVPIVAWPMHSDQPRNTVLITKILKLGIVVKDWARRDDLVVSSTIEKAV  430

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               LMAS EGEE+R +A E    V ++V EGG++R E D+FIAHITR
Sbjct  431   TILMASEEGEEMRKRAQELSFGVNKAVGEGGVTRKEFDSFIAHITR  476



>ref|XP_003519079.1| PREDICTED: zeatin O-glucosyltransferase-like [Glycine max]
Length=458

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 209/314 (67%), Gaps = 20/314 (6%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             + W+++GR  +    V    +P    C+PP+F  FI  Q + + F  GN+++  RAIEGP
Sbjct  157   YYWEVMGRPSVEGFQV--SEIPSLEGCFPPQFIDFITAQYEFHQFNDGNIYNTSRAIEGP  214

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPV-VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSV  455
             Y++ L    ++     +  +GPFNP+ + K+++KT         RH CLEWL KQ P SV
Sbjct  215   YIEFLE---RIGGSKKICALGPFNPLAIEKKDSKT---------RHTCLEWLHKQEPNSV  262

Query  456   IFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNTK-INLPAGFEER  620
             ++VSFGT T L+  Q+ E+A GLEQS Q FIWV++D  KG       TK   LP GFEER
Sbjct  263   MYVSFGTTTSLTVEQIEEIATGLEQSKQKFIWVLRDADKGDIFDGNGTKWYELPNGFEER  322

Query  621   VEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
             V+G GLI+RDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+  WP+  DQPRN++L
Sbjct  323   VKGIGLIVRDWAPQLEILSHTSTGGFMSHCGWNSCLESITMGVPILAWPVHSDQPRNSVL  382

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             ITEVLK G+ +KDW  R+ + +++ + NA+RRLM + EG+++R++A     A+  S  EG
Sbjct  383   ITEVLKVGLVVKDWAQRNVLVSASVVENAVRRLMKTKEGDDMRDRAVRLKNAIHRSKDEG  442

Query  981   GISRLEMDNFIAHI  1022
             G+SR+EM +FI HI
Sbjct  443   GVSRMEMSSFIDHI  456



>ref|XP_006605211.1| PREDICTED: zeatin O-glucosyltransferase-like, partial [Glycine 
max]
Length=371

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/346 (44%), Positives = 214/346 (62%), Gaps = 32/346 (9%)
 Frame = +3

Query  54    SLVWEVLRKILHVPS----------------FLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             SL+  V++  +HVP+                + W  +GR  +   + V   +P    C+ 
Sbjct  37    SLMASVVQDAIHVPNCESYTFHSVSAFTMFLYFWDAMGRPPVEKVSHVIPEVPSLEGCFT  96

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
                  FI  Q + + F KG +++  R IE PYL+L+    ++      W +GPFNP+  +
Sbjct  97    TRCIDFITSQYEFHKFSKGTIYNTTRVIESPYLELIK---RIISSKTHWALGPFNPLSIE  153

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +             +H  +EWLDKQ   SV++VSFGT T  S+ Q+ E+A GLE+S Q F
Sbjct  154   KGVYN--------TKHFSVEWLDKQEAGSVLYVSFGTTTCFSEEQIKEVANGLEKSKQKF  205

Query  546   IWVVKDLTKGYKNTK-----INLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWVV+D  KG    +       LP GFEERV+G GL++RDW PQLEIL H STGGF++HC
Sbjct  206   IWVVRDADKGDVFIEDGVRTSELPKGFEERVKGTGLVVRDWAPQLEILSHSSTGGFMSHC  265

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRN +L+TEVLK G+ +KDW+ RDE+ T++ + NA+
Sbjct  266   GWNSCMESITMGVPIAAWPMHSDQPRNRVLVTEVLKIGVVVKDWDHRDELVTASDVENAV  325

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRL+A+ EG+E+R +A     A++ S  EGG+SR+E+D+FIAHITR
Sbjct  326   RRLIATKEGDEMRQRAMNLKNAIRRSRDEGGVSRVELDDFIAHITR  371



>ref|XP_010056828.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 167/358 (47%), Positives = 217/358 (61%), Gaps = 29/358 (8%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLP------AGAVVPDRL  161
             Y+  + S   DA+ V      +   PS      F W+ +G    P      A  +     
Sbjct  124   YDSLMASVVQDAASVPNAEIYLFQPPSAFMLCWFTWESIGMAPPPEVEVDLAELISSKGF  183

Query  162   P-IPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGI  338
             P I  SC P EF KF+  Q++   F  G + + CR +EG ++DL A           W I
Sbjct  184   PSIVDSC-PNEFLKFVESQKECQKFNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAI  242

Query  339   GPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAE  518
             GPFNPV          + SS+   H C+EWLDKQ P SVI+VSFGT TVLSD Q+ E+A 
Sbjct  243   GPFNPVKVP-------EKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLSDEQIREIAM  295

Query  519   GLEQSGQNFIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEIL  674
             GLE+SGQ FIWV+++  K      G +  KI LP GFEE    R  G+++RDW PQLEIL
Sbjct  296   GLERSGQKFIWVLREADKADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEIL  355

Query  675   DHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRD  854
              H +TGGFL+HCGWNSCMES+  GVP+  WP+  DQP NA+LIT+VLK G+ +KDW S D
Sbjct  356   GHPATGGFLSHCGWNSCMESISMGVPILAWPMHSDQPLNAVLITQVLKIGLIVKDWMSPD  415

Query  855   EITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ++  S+ I  A++ LMAS EGEE R +AAE G AV+ S+ EGG+SR E+D+FIAHI+R
Sbjct  416   DVVKSSAIEGAVKALMASEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHISR  473



>ref|XP_003537252.1| PREDICTED: zeatin O-glucosyltransferase-like [Glycine max]
Length=461

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 209/315 (66%), Gaps = 20/315 (6%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             +LW  +GR  +  G  VP+ +P    C+ P+F  FI+ QR  + F  G +++  RAIEG 
Sbjct  160   YLWDKMGRPSVE-GLHVPE-IPSMEGCFTPQFMDFIIAQRDFDKFSDGYIYNTSRAIEGA  217

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPV-VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSV  455
             Y++ +    +++    +W +GPFNP+ + K+ +K          RH C+EWLDKQ P SV
Sbjct  218   YIESME---RISGGKKIWALGPFNPLAIEKKESKG---------RHLCMEWLDKQDPNSV  265

Query  456   IFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEER  620
             I+VSFGT T   + Q+ ++A GLEQS Q FIWV++D  KG      +  +  LP GFEER
Sbjct  266   IYVSFGTTTSFKEDQIEQIATGLEQSKQKFIWVLRDADKGDIFDGNETKRYELPNGFEER  325

Query  621   VEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
             ++G GLI+RDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+A+WP+  DQPRN +L
Sbjct  326   IKGIGLIVRDWAPQLEILSHTSTGGFMSHCGWNSCLESITMGVPIASWPMHSDQPRNTVL  385

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             IT+VLK G+ +KDW  R+ + T++ +   +RRL+ + EG+E+R +A     A+  S  EG
Sbjct  386   ITQVLKVGLVVKDWAQRNALVTASVVEKVVRRLIETEEGDEIRQRAVRLKNAIHRSKDEG  445

Query  981   GISRLEMDNFIAHIT  1025
             G+S LEM++FIAHIT
Sbjct  446   GVSHLEMESFIAHIT  460



>ref|XP_010279538.1| PREDICTED: zeatin O-glucosyltransferase-like [Nelumbo nucifera]
Length=493

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 209/318 (66%), Gaps = 16/318 (5%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPS--SCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIE  272
             +LW+ +GR     G ++P  LP  S   C+  EF  FI        F  G+L++ CR +E
Sbjct  184   YLWESLGRPTPDQGIIIPKDLPDLSLEGCFTQEFANFISHHYDVMNFDVGDLYNTCRPME  243

Query  273   GPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKS  452
               ++DLLA   +L     +W +GP NP+      +          RHKCLEWLDKQP +S
Sbjct  244   ATFIDLLAQ-EQLNGNKKIWAVGPLNPLALSLAREFKH-------RHKCLEWLDKQPSQS  295

Query  453   VIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG--YKNT----KINLPAGFE  614
             V++VSFGT T +SD Q+ ELA GLE+S Q FIWV+++  +G  Y       K+ LP G+E
Sbjct  296   VLYVSFGTMTSISDDQISELAVGLERSKQRFIWVLREADRGDIYAQVEDARKVELPKGYE  355

Query  615   ERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNA  794
             ER++G GLI+RDW PQLEIL H STGGF++HCGWNSCMES+  GVP+A WP+  DQPRN 
Sbjct  356   ERMDGVGLIVRDWAPQLEILAHPSTGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNT  415

Query  795   ILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVM  974
             +L+T+VLK GI + +W+ R+E+ +S TI NAI +LMAS EG +++ +A   GRAV +SV 
Sbjct  416   MLVTKVLKVGIVVGEWQRREELVSSLTIENAITKLMASEEGNKMKKRAENLGRAVHQSVA  475

Query  975   EGGISRLEMDNFIAHITR  1028
             EGG S  E+++FIA I+R
Sbjct  476   EGGTSHAELESFIAFISR  493



>ref|XP_010279537.1| PREDICTED: zeatin O-glucosyltransferase-like [Nelumbo nucifera]
Length=507

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/357 (46%), Positives = 224/357 (63%), Gaps = 37/357 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPS--SC  179
             N E Y F   SAF     +WE+L K    P+             G V+P+ +P  S   C
Sbjct  172   NAEAYAFHSVSAFAIVFHLWEILGK----PT-----------DGGIVIPNGVPHHSLEGC  216

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             +  EF  F+  Q     F  G+L++ CR IEG ++DLL    KL  +  +W +GP NPV+
Sbjct  217   FTAEFVNFMARQYHLMKFDVGDLYNTCRPIEGRFMDLLTQ-EKLNGRKKIWAVGPLNPVI  275

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                        S +  RHKCLEWLDKQP +SV++VSFGT T L D Q++ELA GLE+S Q
Sbjct  276   LH-----SAKESPRRRRHKCLEWLDKQPAQSVLYVSFGTLTSLPDDQINELAVGLERSKQ  330

Query  540   NFIWVVKDLTK--------GYKNTKINLPAGF-----EERVEGRGLILRDWVPQLEILDH  680
              FIWV+++  +        G +  +  LP G+     E RVEGRGLILRDW PQLEIL H
Sbjct  331   RFIWVLREADRGDIYDEGLGVEARRTPLPKGYDYYEGEGRVEGRGLILRDWAPQLEILAH  390

Query  681   VSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEI  860
              STGGFL+HCGWNSCMES+  GVP+A WP+  DQPRN +L+T+VLK G+ ++DW  R E+
Sbjct  391   PSTGGFLSHCGWNSCMESLSMGVPMAAWPMHSDQPRNTMLVTQVLKVGLVVRDWSRRHEL  450

Query  861   TTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVME-GGISRLEMDNFIAHITR  1028
              +S+TI +AI++LMAS EG+++R +A + G  V++S+ E GG S  E+++FIAHI+R
Sbjct  451   VSSSTIEDAIKKLMASEEGDDMRKRAEKLGGTVRQSMSEQGGTSCAELESFIAHISR  507



>ref|XP_006356483.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=476

 Score =   310 bits (795),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/295 (52%), Positives = 193/295 (65%), Gaps = 15/295 (5%)
 Frame = +3

Query  159   LPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGI  338
             LP    C+ PEF KF+  + + + F  G +++  R IEGP+LDLL+   ++ +    W +
Sbjct  190   LPSNDGCFTPEFTKFVRSEHEYSKFNSGKIYNTLRVIEGPFLDLLSK-EQINKDKKQWAL  248

Query  339   GPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAE  518
             GPFNP+     T+          RH  L WLDKQ PKSVIFVSFGT T  S  Q+ E+A 
Sbjct  249   GPFNPITISGPTQQ---------RHYSLIWLDKQVPKSVIFVSFGTTTSFSYEQIKEIAI  299

Query  519   GLEQSGQNFIWVVKDLTKGYK-----NTKINLPAGFEERVEGRGLILRDWVPQLEILDHV  683
             GLEQS QNFIWV++D  K          KI LP GFEERV+ RG+++RDW PQLEIL H 
Sbjct  300   GLEQSQQNFIWVLRDADKENVFLDDFTKKIELPKGFEERVKERGIVVRDWAPQLEILAHN  359

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             STGGFL+HCGWNSCMES+  GVPLA WP+  DQPRN +LIT++L+ G+  KDW  RDE+ 
Sbjct  360   STGGFLSHCGWNSCMESISMGVPLAAWPMHSDQPRNTVLITKILEVGLVAKDWTQRDELV  419

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             T   I  A+R LMAS EGEE+R +A E    VK +V E G+++ E D FIAHITR
Sbjct  420   TFDRIEKAVRILMASKEGEEMRKRAKELSLGVKNAVEENGVTKNEFDAFIAHITR  474



>ref|XP_007028693.1| UDP-glucosyltransferase, putative [Theobroma cacao]
 gb|EOY09195.1| UDP-glucosyltransferase, putative [Theobroma cacao]
Length=476

 Score =   310 bits (795),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 213/316 (67%), Gaps = 16/316 (5%)
 Frame = +3

Query  102   LWKLVGR-FVLPAG-AVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEG  275
             +W+  G+ F L A  A + ++LP    C+  EF  F+  Q +   F  G L++ CR I+G
Sbjct  170   IWEARGKPFQLEAEVAEIQNKLPSLDGCFSSEFVNFVTYQYQFMNFQAGELYNTCRLIDG  229

Query  276   PYLDLLA-MVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKS  452
              Y++LLA +   + RK   W IGP NP+          + S+ T RHKCLEWLDKQ PKS
Sbjct  230   TYINLLAKLQTNVNRKQ--WAIGPLNPLKI-------HEQSNPTRRHKCLEWLDKQTPKS  280

Query  453   VIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNTKI---NLPAGFEERV  623
             V+++ FG+ T + D Q++ELA GLEQS   FIWV++D  KG  +T++    LP  FE R 
Sbjct  281   VLYICFGSSTSMPDDQINELAIGLEQSKTKFIWVLRDADKGDISTEVRQLKLPEAFEART  340

Query  624   EGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILI  803
             E  G++LRDW PQLEIL H STGGF++HCGWNSCMES+  GVP+A WP+  DQPRN +L+
Sbjct  341   ERSGMVLRDWAPQLEILGHPSTGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNTVLV  400

Query  804   TEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKE-SVMEG  980
             T+VL+ G+ +KD +  ++  TS+ I+ A+RRLMAS EGE +R +A E G AV+E S  +G
Sbjct  401   TQVLQIGLVVKDRQRMEDKVTSSDIKEAVRRLMASKEGETMRKRAEELGEAVREQSAAQG  460

Query  981   GISRLEMDNFIAHITR  1028
             G+SR+E+++FIAHITR
Sbjct  461   GVSRVELESFIAHITR  476



>ref|XP_006367370.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=492

 Score =   310 bits (795),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 163/346 (47%), Positives = 209/346 (60%), Gaps = 30/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF     VWE +              GR       ++ D LP    C+ 
Sbjct  170   NAEAYTFHSVSAFTIFLYVWETM--------------GRSSSIDVDMIKD-LPSNDGCFT  214

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF KF+  + + + F  G +++  R IEGP+LDLL+   ++ +    W +GPFNP+   
Sbjct  215   PEFTKFVRSEHEYSKFNSGKIYNTSRVIEGPFLDLLSK-EQINKGKKQWALGPFNPITIS  273

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
               T+          RH  L WLDKQ PKSVIFVSFGT T  S  Q+ E+A GLEQS Q F
Sbjct  274   GPTQQ---------RHYSLIWLDKQVPKSVIFVSFGTTTSFSYEQIKEIAIGLEQSQQKF  324

Query  546   IWVVKDLTKGYK-----NTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWV++D  K          KI LP GFEERV+ RG+++RDW PQLEIL H STGGFL+HC
Sbjct  325   IWVLRDADKENVFLDDFTKKIELPKGFEERVKERGIVVRDWAPQLEILAHNSTGGFLSHC  384

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMESM  GVPLATWP+  DQPRN +LIT++L+ G+ +KDW  R+E+ T   I   +
Sbjct  385   GWNSCMESMSMGVPLATWPMHSDQPRNTVLITKILEVGLVVKDWAQRNELVTFDRIEKVV  444

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R LMAS EGEE+R +A +    VK +V E G+++ E D FIAHIT+
Sbjct  445   RILMASKEGEEMRKRAKDLSLGVKNAVEENGVTKNEFDAFIAHITK  490



>ref|XP_006475704.1| PREDICTED: zeatin O-glucosyltransferase-like [Citrus sinensis]
 ref|XP_006492944.1| PREDICTED: zeatin O-glucosyltransferase-like [Citrus sinensis]
Length=475

 Score =   310 bits (793),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 212/345 (61%), Gaps = 25/345 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF     +WE             ++    +  A  ++P  +P    C+ 
Sbjct  152   NAESYTFHSVSAFTLYLYIWE-------------RMGNPNLNEASGLIPKDVPSLEGCFT  198

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              EF   I  +     F  GN+++  R IE  Y+DLL     +A     W +GPFNPV   
Sbjct  199   SEFLDSIASEYDHMKFNSGNVYNTSRVIESAYMDLLEKA-TVAGTFNHWALGPFNPV---  254

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
               T  ++D S+   RH CLEWLDKQ   SV++VSFGT T +SD Q+ ELA GL+QS Q F
Sbjct  255   --TLPNKDGSNG--RHFCLEWLDKQEKNSVLYVSFGTTTAMSDEQIKELAVGLKQSNQKF  310

Query  546   IWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             IWV++D  +G     +  +  LP G+E+ V+ +GL++RDW PQLEIL H S GGF++HCG
Sbjct  311   IWVLRDADRGDVFNGEVRRAELPKGYEDSVKDKGLVVRDWAPQLEILAHCSAGGFMSHCG  370

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSCMES+  GVP+  WP+  DQPRN +LIT++LK GI + D   RDEI TS  I NA++
Sbjct  371   WNSCMESITMGVPIVAWPMHSDQPRNTVLITQLLKLGIVMADCARRDEIVTSNVIENAVK  430

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RLMAS EG+E+R KA E G  V+ S+ EGG+SR+E D+FIAHITR
Sbjct  431   RLMASKEGDEIRKKAVELGGNVRRSMDEGGVSRMEFDSFIAHITR  475



>ref|XP_009796092.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=470

 Score =   310 bits (793),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 161/345 (47%), Positives = 213/345 (62%), Gaps = 25/345 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF   S +W+  R    VPS               VV  ++P    C  
Sbjct  147   NTECYCFHTVSAFLIFSYIWDAARP--PVPS------------VAEVVLKQIPSLEGCNS  192

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PE  +F   Q +   F  GN+F   R +E  YL+L+   Y    K   W +GPFNPV   
Sbjct  193   PELEEFAKKQLQVKVFGVGNIFSTSRVVEEMYLNLIEKTYVKDFKH--WALGPFNPVEIP  250

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
               T   + +     RH  LEWLDKQP  SVIFVSFG+ T LS+ ++ ELA+GLEQS Q F
Sbjct  251   VPTPDTEKN-----RHYSLEWLDKQPENSVIFVSFGSTTSLSEDEIKELAKGLEQSEQRF  305

Query  546   IWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             +WVV+D  KG   +    K  LP G+EERV  RG+++RDW PQL+IL HV+TGGF++HCG
Sbjct  306   VWVVRDADKGDIFSGDVRKYQLPEGYEERVAERGIVIRDWAPQLDILGHVATGGFMSHCG  365

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSCMES+  GVP+A WP+  DQPRNA+LIT+ LK GI +++WE R+E+  + TI N ++
Sbjct  366   WNSCMESISMGVPIAAWPMHSDQPRNAVLITKGLKIGISVREWEKRNEVVPAETIENVVK  425

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              L+  PEGEE++ +A E   AVK SVM+GG++  EM++F+AHITR
Sbjct  426   TLIVWPEGEEMKKRATELKEAVKLSVMDGGVAHKEMESFVAHITR  470



>ref|XP_010056863.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   310 bits (793),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 166/358 (46%), Positives = 216/358 (60%), Gaps = 29/358 (8%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLP------AGAVVPDRL  161
             Y+  + S   DA+ V      +   PS      F W+ +G    P      A  +     
Sbjct  124   YDSLMASVVQDAASVPNAEIYVFQPPSAFMLCWFTWESIGMAPPPEVEVDLAELISSKGF  183

Query  162   P-IPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGI  338
             P I  SC P EF KF+  Q++   F  G + + CR +EG ++DL A           W I
Sbjct  184   PSIVDSC-PNEFLKFVESQKECQKFNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAI  242

Query  339   GPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAE  518
             GPFNPV          + SS+   H C+EWLDKQ P SVI+VSFGT TVLS  Q+ E+A 
Sbjct  243   GPFNPVKVP-------EKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLSGEQIREIAM  295

Query  519   GLEQSGQNFIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEIL  674
             GLE+SGQ FIWV+++  K      G +  KI LP GFEE    R  G+++RDW PQLEIL
Sbjct  296   GLERSGQKFIWVLREADKADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEIL  355

Query  675   DHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRD  854
              H +TGGFL+HCGWNSCMES+  GVP+  WP+  DQP NA+LIT+VLK G+ +KDW S D
Sbjct  356   GHPATGGFLSHCGWNSCMESISMGVPILAWPMHSDQPLNAVLITQVLKIGLIVKDWMSPD  415

Query  855   EITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ++  S+ I  A++ LMAS EGEE R +AAE G AV+ S+ EGG+SR E+D+FIAHI+R
Sbjct  416   DVVKSSAIEGAVKALMASEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHISR  473



>ref|XP_006350111.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=460

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 160/348 (46%), Positives = 218/348 (63%), Gaps = 32/348 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y+F   SAF               + S   ++VG         V D +P    C+ 
Sbjct  138   NVECYSFHAISAFC--------------MYSTFQQVVGEVEDGVARQVFDEMPEVGDCFG  183

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             P+ F+F+  +R+ N  C G   ++CR +EG YLDLL  V    RK P++ +GPF+ +   
Sbjct  184   PDIFEFVQKERECNLNC-GEFMNSCRELEGEYLDLLVNV----RKKPLFALGPFHML---  235

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                +   +SS    RH+CLE+LD+Q   SV+FVSFGT T LS  Q++ELA GLE+S   F
Sbjct  236   ---QELPESSGNRDRHECLEFLDEQDFDSVMFVSFGTTTTLSREQVNELALGLERSNHKF  292

Query  546   IWVVKDLTK-------GYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
             IWV+++  K       G K+    LP GFEER+EGRG+++R+WVPQLEIL H STGGFL+
Sbjct  293   IWVIREADKKMETEKCGGKDWNFELPEGFEERMEGRGMVVRNWVPQLEILGHKSTGGFLS  352

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSCMES+  GVP+ATWPIQ DQP NA+ +T VLK GIP++ W  R+E+ T+TTI  
Sbjct  353   HCGWNSCMESVSMGVPIATWPIQVDQPYNAVFVTNVLKIGIPVRSWARREELVTATTIEK  412

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             A+R LM +PEGEE+R +A E    +K SV  GG+++ E ++FI  IT+
Sbjct  413   AVRTLMGTPEGEEIRQRAIELSNKIKNSVSHGGLAQKERESFITCITK  460



>ref|XP_010279539.1| PREDICTED: zeatin O-glucosyltransferase-like [Nelumbo nucifera]
Length=479

 Score =   308 bits (788),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 162/353 (46%), Positives = 226/353 (64%), Gaps = 36/353 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPA--GAVVPDRLPIPS--  173
             N E Y F   SAF   +LV+           +LW+  GR   P+  G V+P+ LP  S  
Sbjct  151   NGEAYAFHSASAF---ALVY-----------YLWESRGR---PSNGGIVLPNELPYISLE  193

Query  174   SCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNP  353
              C+  EF  FI  Q     F  G++++ CR +EG +LDLL +  +L R   +W +GP NP
Sbjct  194   GCFTTEFANFITRQYDIMNFDAGDIYNTCRPVEGRFLDLL-IKEQLNRDKRLWAVGPLNP  252

Query  354   VVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
             +  +   ++         +HKCL+WLDKQP +SV++VSFGT T L D Q+ ELA GLE+S
Sbjct  253   MALRLTRESPHR------QHKCLQWLDKQPLQSVLYVSFGTMTSLPDDQILELAVGLERS  306

Query  534   GQNFIWVVK-----DLTKGYKNTK-INLPAGFEERVEGRG--LILRDWVPQLEILDHVST  689
              Q F+WV++     D+  G K+ + I LP G+EER+EG G  LI+RDW PQLEIL H ST
Sbjct  307   KQRFVWVLREADIGDIYAGEKSGREIQLPKGYEERIEGVGVGLIVRDWAPQLEILAHPST  366

Query  690   GGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTS  869
              GFL+HCGWNSCMES+  GVP+A WP+  DQPRN +L+T+VLK G+ +++W+ R E+  S
Sbjct  367   AGFLSHCGWNSCMESISLGVPVAAWPMHSDQPRNTMLVTQVLKVGLVVQEWDRRQELVPS  426

Query  870   TTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              T+ NA++RLMAS EG  +R +A E   +++ SV +GGIS  E+D+F+AHI+R
Sbjct  427   VTVENAVKRLMASEEGNNMRKRAKELSGSIRRSVAQGGISCTELDSFVAHISR  479



>ref|XP_009363195.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X3 [Pyrus 
x bretschneideri]
Length=472

 Score =   307 bits (787),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 210/331 (63%), Gaps = 26/331 (8%)
 Frame = +3

Query  6    NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
            N E+Y F   SAF     +WEV+ K    P  L +L           +PD +P    C+ 
Sbjct  147  NGESYTFHSVSAFTIFLYLWEVIGK----PKKLEEL--------DVKLPDGIPSLEGCFT  194

Query  186  PEFFKFIVDQRKTNAFCK-GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             EF  FI +Q K       G L +  R IEGPY+DLL    ++  +   W IGPFNP   
Sbjct  195  VEFRNFIDEQHKYQKLNNAGYLHNTSRTIEGPYMDLLN---RIGDQKKHWAIGPFNPT--  249

Query  363  KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
               T    +++S + RH CLEWLDKQ  +SV++VSFGT T + D Q+ ELA GLE+S Q 
Sbjct  250  ---TVAYPNNNSNSSRHMCLEWLDKQEQRSVMYVSFGTTTAMKDEQIQELAIGLEESKQR  306

Query  543  FIWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
            FIWV++D  KG      +  +  LP GFEER++GRGL++RDWVPQLEIL H STGGFL+H
Sbjct  307  FIWVLRDADKGDLFNGGEVRRAELPQGFEERIKGRGLVVRDWVPQLEILSHKSTGGFLSH  366

Query  708  CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
            CGWNSCMES+  GVP+A WP+  DQPRN +LIT++L+ G  ++DW+ RDE+ TS  ++N 
Sbjct  367  CGWNSCMESITMGVPIAAWPMHSDQPRNTVLITKLLRVGFVMRDWDKRDELVTSQNVKNG  426

Query  888  IRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
            +++ M S EGEE+R +AAE G AV++S +EG
Sbjct  427  VQKFMGSKEGEEIRKRAAELGAAVRQSRVEG  457



>ref|XP_002532135.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30255.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=487

 Score =   308 bits (788),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 216/352 (61%), Gaps = 36/352 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF               +  F W+ +GR +   G  +P+ LP    C+ 
Sbjct  159   NAESYTFHSVSAFT--------------ICLFYWERMGRPIHQRGGGIPEELPPLDGCFT  204

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLL-------AMVYKLARKGPVWGIGP  344
              EF   +  Q + + +  G L++  R IEG +++L+        M   L +    W +GP
Sbjct  205   DEFMDLVASQYQYHRYNTGCLYNTSRLIEGTFMELIEKQEQESTMEANLRKH---WALGP  261

Query  345   FNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGL  524
             FNPV     T  +Q  S+   +H CL+WLDKQ   SVI+VSFGT T ++  Q+ +LA GL
Sbjct  262   FNPV-----TLAEQKGSNG--KHVCLDWLDKQETNSVIYVSFGTTTAMNTEQIKQLAIGL  314

Query  525   EQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVST  689
             +QS Q FIWV++D  KG         +  LP G+E  V+G GL++RDWVPQLEIL H +T
Sbjct  315   KQSNQKFIWVLRDADKGDVFNGGHERRDELPKGYENSVDGMGLVVRDWVPQLEILGHPAT  374

Query  690   GGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTS  869
             GGF++HCGWNSCMES+  GVP+A WP+  DQPRNA+LITE LK G+ +KDW  RDEI TS
Sbjct  375   GGFMSHCGWNSCMESITMGVPIAAWPMHSDQPRNAVLITECLKIGVLVKDWARRDEIATS  434

Query  870   TTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
               +   ++RLMAS EG+ +R KAAE G +++ S+ EGG+SR+EMD+FI+ I+
Sbjct  435   KMVETCVKRLMASDEGDGMRKKAAEMGHSIRRSLGEGGVSRMEMDSFISCIS  486



>ref|XP_010056875.1| PREDICTED: zeatin O-xylosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   307 bits (787),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 164/355 (46%), Positives = 209/355 (59%), Gaps = 35/355 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLP------AGAVVPDRLPI  167
             N E Y F   SAF   +L W           F W+ +G    P      A  +    LP 
Sbjct  140   NTEIYEFNPISAF---TLCW-----------FTWESIGMAPPPEVEVDIAELIASKGLPS  185

Query  168   PSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPF  347
                    EF KF   Q +   F  G +++ CR +EG ++DL A           W IGPF
Sbjct  186   LLDSSTDEFLKFYASQNECKKFHSGCIYNTCRVVEGRFVDLYASATANGTATKHWAIGPF  245

Query  348   NPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLE  527
             NPV          +  S+   H C+EWLDKQ P SV++VSFGT TVLSD Q+ E+A GLE
Sbjct  246   NPVKVP-------EKRSRRSAHGCMEWLDKQAPSSVMYVSFGTTTVLSDEQIREIAMGLE  298

Query  528   QSGQNFIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHV  683
              SGQ FIWV+++  K      G +   I LP GFEE V  R  G+++RDW PQLEIL H 
Sbjct  299   YSGQKFIWVLREADKADIFGGGGEARIIQLPQGFEEMVAARDLGVVVRDWAPQLEILGHP  358

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             +TGGFL+HCGWNSCMES+  GVP+  WP+  DQPRNA+LIT VLK G+ +KDW S+D++ 
Sbjct  359   ATGGFLSHCGWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVKDWMSQDDLV  418

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              S+TI  A++ LM S EGEE R +AAE G  V+ S+ EGG+SR E+D+FIAHI R
Sbjct  419   KSSTIEGAVKALMVSEEGEEARKRAAELGAVVRGSMDEGGVSRAELDSFIAHICR  473



>ref|XP_010668171.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=479

 Score =   307 bits (787),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/350 (44%), Positives = 215/350 (61%), Gaps = 33/350 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF               +  F+W  +        + +P  +P    C  
Sbjct  154   NVESYTFHTSSAFT--------------IFFFMWHSMVEKPFNLSSDIPHYVPSSKGCSS  199

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF KF  DQ K      G L++ CR++E  Y+DLL  +    +   ++ IGP N ++  
Sbjct  200   PEFEKFAADQYKLANLSSGRLYNTCRSLENKYMDLLTQL-PANKNKKLFAIGPVNRLI--  256

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                    ++SS T +HKCLEWLD+Q   SVI+VSFGT T ++D Q+ ELA+GL++S Q F
Sbjct  257   -------NTSSNTSKHKCLEWLDEQESDSVIYVSFGTTTSMTDEQIKELADGLDRSNQKF  309

Query  546   IWVVK--DLTKGYKNTKI-------NLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGF  698
             IWV++  D    +K            L  G+EE V GRGL+++ W PQLEIL H + GGF
Sbjct  310   IWVLREADEVNIFKKDGTAVGEHYDQLLKGYEEAVRGRGLMVKGWAPQLEILGHEAIGGF  369

Query  699   LTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTI  878
             ++HCGWNSC+ES+  GVP+A WPI  DQP+N++L+TEVLK G+ +KDW +RDE+ TS+ +
Sbjct  370   ISHCGWNSCLESLSMGVPIAAWPIHSDQPKNSMLVTEVLKVGVVVKDWANRDELITSSVV  429

Query  879   RNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +A+RRLMAS EGEELR +A E G +V+ SV +GG S LE+D+F+AHI R
Sbjct  430   ESAVRRLMASKEGEELRKRARELGASVRGSVAKGGTSCLELDSFVAHIIR  479



>ref|XP_004303646.1| PREDICTED: zeatin O-glucosyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   307 bits (786),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 219/349 (63%), Gaps = 31/349 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF     +WE +      P    +L G   +   + +PD +P    C+P
Sbjct  148   NSESYTFHSVSAFAVFLYLWEGIG----CPP---ELQG---VQVKSKIPDNVPSLEDCFP  197

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-VT  362
              EF  FIV Q +   +  GN+++A R IEG Y+DLL    KL      W +GPFNPV V 
Sbjct  198   DEFMNFIVAQYEYTGYNSGNIYNASRTIEGEYVDLLN---KLGDDKKHWAVGPFNPVSVP  254

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             ++N K          RH CLEWLD+Q P SVI+VSFGT T + D Q+ ELA GLEQ    
Sbjct  255   EKNGK----------RHACLEWLDEQEPNSVIYVSFGTTTCMKDEQIRELAIGLEQCNHK  304

Query  543   FIWVVKDLTKGY------KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
             FIWV++D  KG       +  K  LP G+EERV+ RG+++RDW PQL+IL H ST  FL+
Sbjct  305   FIWVLRDADKGDLFMDGDQVRKAELPKGYEERVKERGVVVRDWAPQLDILSHKSTAWFLS  364

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSCMES+  GVP+A WP+  DQPRN +L+T+VLK G+ ++DWE R+E+ TS+ + +
Sbjct  365   HCGWNSCMESLTLGVPIACWPMHSDQPRNTVLVTKVLKVGVVMRDWERRNELVTSSIVTD  424

Query  885   AIRRLMASP-EGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              + +LMAS  E + +R KA E G AV+ S++EGG S +E+ +F+AHITR
Sbjct  425   GVHKLMASSGEVDVIRKKARELGAAVRGSMVEGGGSHMELSSFVAHITR  473



>ref|XP_009598914.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=514

 Score =   308 bits (789),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 164/374 (44%), Positives = 224/374 (60%), Gaps = 41/374 (11%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKIL-------HVPSFLWKLVGRFV-----LPAGAVV  149
             N E Y F   SAF+  S +W+ + K+        H      +L+  F+     L   +++
Sbjct  149   NMEAYCFHGSSAFNTYSFIWDAITKLFPAYVKTNHPTMVSERLLKSFMKAFANLKVSSLI  208

Query  150   ---PD---------RLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLL  293
                P+          LP   S YPPE  + +  Q +      G++ D    IEGPYLDLL
Sbjct  209   FSSPNIRRKMKILKNLPSIESSYPPEILEVLKKQLECGKIKCGDIHDTSSVIEGPYLDLL  268

Query  294   AMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFG  473
                 K       W +GPFNP+V       ++       RH+CLEWLDK  P SVI VSFG
Sbjct  269   T---KFMGNDKQWALGPFNPMVI-----MEKKGPIIVRRHECLEWLDKHAPNSVILVSFG  320

Query  474   TQTVLSDHQLHELAEGLEQSGQNFIWVVK--DLTKGYKNTKIN-------LPAGFEERVE  626
             T   LS  Q++ELA GLE+S Q FIW+++  D  K   +T+ N       LP G E+R+E
Sbjct  321   TSVSLSHDQINELAIGLERSQQKFIWLLRTADDRKANASTEENNVLVEAQLPEGLEKRLE  380

Query  627   GRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILIT  806
             GRG+I++DW PQLEIL H STGGF++HCGWNSCMES+  GVP+A WP+Q DQPRNA+LIT
Sbjct  381   GRGIIVKDWAPQLEILAHQSTGGFMSHCGWNSCMESITMGVPIAAWPMQVDQPRNAVLIT  440

Query  807   EVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGI  986
             EVL+ G+ ++ W+S+D +T+S TI N ++RLM S EG+++R  A   G A+KES+++GG 
Sbjct  441   EVLRIGLNVRKWDSKDNLTSSMTIENVVKRLMTSLEGDDMRKNAKLLGNAIKESMVDGGA  500

Query  987   SRLEMDNFIAHITR  1028
             +R E+D FIAHI R
Sbjct  501   TRKELDTFIAHIRR  514



>ref|XP_006351251.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=450

 Score =   306 bits (784),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 160/349 (46%), Positives = 220/349 (63%), Gaps = 36/349 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAFH  S +WE   K L                AG  + + +    +C  
Sbjct  130   NAECYCFNSISAFHTFSCIWESRGKPLQ---------------AGTEIFEGISSNKNCAT  174

Query  186   PEFFKFIVDQRKTNAFCK----GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNP  353
             PE ++     RK  A  +    G L+++ R IEG YLDL+A   K       W +GPFNP
Sbjct  175   PELWEL---WRKQEALMRKVSSGELYNSSRVIEGLYLDLVA---KENDGLNQWALGPFNP  228

Query  354   VVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
             +++++N  +++        H+ L WLDKQ   SVI+VSFGT T LS+ ++ ELA GLE+S
Sbjct  229   LLSEQNKNSNK-------HHQTLYWLDKQETNSVIYVSFGTTTSLSNEEIEELAVGLEKS  281

Query  534   GQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
              Q FIWV++D  KG     +  +  LP G+EER++GRG+I+RDW PQLEIL H STGGF+
Sbjct  282   MQKFIWVLRDADKGDVFAGEERRAQLPDGYEERLKGRGIIVRDWAPQLEILAHPSTGGFM  341

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+A WP+  DQPRN+ L+T+ LK G+ ++ W  RDE+ TS  + 
Sbjct  342   SHCGWNSCMESISMGVPIAAWPMHSDQPRNSQLVTKFLKIGLIVRHWACRDELVTSEIVE  401

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             NA+R LMASPEG+E+R +A+E    VK+SV++GG++R EMD+FI HITR
Sbjct  402   NAVRTLMASPEGDEMRKRASELSNVVKQSVVDGGVNREEMDSFITHITR  450



>ref|XP_010056810.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   307 bits (786),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 208/349 (60%), Gaps = 23/349 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF      WE   K +  P  +   +   +   G       P     + 
Sbjct  140   NAEIYEFNSVSAFTLCWFTWE--SKGMAPPPEVEAEIAELISSKG------FPSILDSFT  191

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              EF KF   Q++   F  G +++ CR IEG ++DL A           W IGPFNPV   
Sbjct  192   DEFMKFRASQKECKKFNSGCIYNTCRVIEGRFVDLFASATANGTATKHWAIGPFNPVKVP  251

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                    +  S+   H C+EWLDKQ P SVI+VSFGT T LSD Q+ E+A GLE+SGQ F
Sbjct  252   -------EKRSRRSAHWCMEWLDKQAPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKF  304

Query  546   IWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGGFL  701
             IWV+++  K      G +  +I LP GFEE    R  G+ +RDW PQLEIL H +TGGFL
Sbjct  305   IWVLREADKTDIFGGGGEAREIELPQGFEEMAAARDLGVAVRDWAPQLEILGHPATGGFL  364

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+  WP+  DQPRNA+LIT VLK G+ +KDW S+ ++  ST I 
Sbjct  365   SHCGWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKMGLTVKDWTSQHDVVKSTIIE  424

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              A++ LMA+ EGEE+R +AAE G AV+ S+ EGG+SR E+D+FIAHI R
Sbjct  425   GAVKALMATEEGEEVRKRAAELGAAVRGSMDEGGVSRAELDSFIAHIAR  473



>gb|KCW90124.1| hypothetical protein EUGRSUZ_A02314 [Eucalyptus grandis]
Length=462

 Score =   306 bits (785),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 208/349 (60%), Gaps = 23/349 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF      WE   K +  P  +   +   +   G       P     + 
Sbjct  129   NAEIYEFNSVSAFTLCWFTWE--SKGMAPPPEVEAEIAELISSKG------FPSILDSFT  180

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              EF KF   Q++   F  G +++ CR IEG ++DL A           W IGPFNPV   
Sbjct  181   DEFMKFRASQKECKKFNSGCIYNTCRVIEGRFVDLFASATANGTATKHWAIGPFNPVKVP  240

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                    +  S+   H C+EWLDKQ P SVI+VSFGT T LSD Q+ E+A GLE+SGQ F
Sbjct  241   -------EKRSRRSAHWCMEWLDKQAPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKF  293

Query  546   IWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGGFL  701
             IWV+++  K      G +  +I LP GFEE    R  G+ +RDW PQLEIL H +TGGFL
Sbjct  294   IWVLREADKTDIFGGGGEAREIELPQGFEEMAAARDLGVAVRDWAPQLEILGHPATGGFL  353

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+  WP+  DQPRNA+LIT VLK G+ +KDW S+ ++  ST I 
Sbjct  354   SHCGWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKMGLTVKDWTSQHDVVKSTIIE  413

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              A++ LMA+ EGEE+R +AAE G AV+ S+ EGG+SR E+D+FIAHI R
Sbjct  414   GAVKALMATEEGEEVRKRAAELGAAVRGSMDEGGVSRAELDSFIAHIAR  462



>ref|XP_002322723.2| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEF04484.2| putative glucosyltransferase family protein [Populus trichocarpa]
Length=476

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 159/347 (46%), Positives = 210/347 (61%), Gaps = 29/347 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF  +   WE   K++                   + P   P    C+ 
Sbjct  153   NAESYTFHSVSAFAISLYEWEQEGKLIE---------------ENELFPRDTPSLEGCFT  197

Query  186   PEFFKFI-VDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKG-PVWGIGPFNPVV  359
              EF  F+     K   F  G +++ C+ +E  YLD L    +  ++G   W +GPFNPV 
Sbjct  198   DEFADFVDCHYSKYQKFNTGCVYNTCKLVESAYLDFLEK--ETIKEGIKHWALGPFNPVT  255

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                     + S S   +H CLEWLDKQ   +VI+VSFGT T   D Q+ ELA GL +S +
Sbjct  256   IP------ERSESSKKQHFCLEWLDKQAKNTVIYVSFGTTTTFDDEQIKELAIGLRESKK  309

Query  540   NFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
              FIWV++D  KG     +  +  LP G+E  V+G GL++RDW PQLEIL H +TGGF++H
Sbjct  310   KFIWVLRDGDKGDVFNGEERRAELPKGYENSVDGIGLVVRDWAPQLEILAHPATGGFMSH  369

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMES+  GVP+A WP+  DQPRN +LITEVLK GI +KDW  RDEI TS  + +A
Sbjct  370   CGWNSCMESISMGVPIAAWPMHSDQPRNTVLITEVLKIGIVVKDWAQRDEIVTSKIVGSA  429

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + RLMAS EG+E+R +AAE G +V+ SV EGG+SR+EM++FIAHITR
Sbjct  430   VNRLMASTEGDEMRKRAAEMGESVRGSVAEGGVSRMEMESFIAHITR  476



>ref|XP_010672886.1| PREDICTED: zeatin O-xylosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/348 (46%), Positives = 220/348 (63%), Gaps = 32/348 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF      W+       +P   ++L         + +P  +P    C  
Sbjct  151   NAEAYAFIPISAFTSFFNSWD------RIPDKPFQL--------DSDIPKCIPSTDGCST  196

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPV--WGIGPFNPVV  359
              E   FI +QRK   F  G L++    IEG Y++LL    KL++K  +  + +GP NPV 
Sbjct  197   QEIANFIANQRKCLGFESGRLYNTSMVIEGRYIELLK---KLSKKSEIKHFAVGPLNPV-  252

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                    + ++ S+  +H CL+WLDKQ   SVI+VSFG+ T ++D Q+ ELA GLE+S Q
Sbjct  253   -------EIENKSEKQQHMCLKWLDKQMKDSVIYVSFGSTTTMTDEQIMELATGLEKSEQ  305

Query  540   NFIWVVK-----DLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
              FIWV++     D+ KG ++ K  LP G+EER+E RG+++R+W PQLEIL H S GG+++
Sbjct  306   KFIWVLRRADIGDVFKGGEDRKPQLPEGYEERMEDRGMVVREWAPQLEILAHPSIGGYMS  365

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSCMES+  GVP+A WP+  DQP+NAIL+TEVL+ G  ++DW    E+  STTI N
Sbjct  366   HCGWNSCMESISIGVPMAAWPMHSDQPKNAILVTEVLRIGTLVRDWTQHAELVMSTTIEN  425

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             A+RRLMAS EGEE+R +AAE G  V+ SV +GG SRLE+D+FI++ITR
Sbjct  426   ALRRLMASKEGEEMRKRAAELGDVVRASVAKGGASRLEIDSFISYITR  473



>gb|KCW90129.1| hypothetical protein EUGRSUZ_A02320 [Eucalyptus grandis]
Length=462

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/357 (45%), Positives = 212/357 (59%), Gaps = 27/357 (8%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLP------AGAVVPDRL  161
             Y+  + S   DA+ V      +   PS      F W+ +G    P      A  +     
Sbjct  113   YDSLMASVVQDAASVPNAEIYVFQPPSAFTLCWFTWESIGMAPPPEVEVDLAEFISSKGF  172

Query  162   PIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIG  341
             P     YP EF KF+  Q++      G + + CR +EG ++DL A           W IG
Sbjct  173   PSLLDSYPNEFLKFMESQKECQKSNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAIG  232

Query  342   PFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEG  521
             P NPV          + SS+   H C+EWLDKQ P SVI+VSFGT TVL D Q+ E+A G
Sbjct  233   PLNPVKVP-------EKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLCDEQIREIAMG  285

Query  522   LEQSGQNFIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILD  677
             LE+SGQ FIWV+++  K      G +  KI LP GFEE    R  G+++RDW PQLEIL 
Sbjct  286   LERSGQKFIWVLREADKADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEILG  345

Query  678   HVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDE  857
             H +TGGFL+HCGWNSCMES+  GVP+  WP+  DQP NA+LIT+VLK G+ +KDW S D+
Sbjct  346   HPATGGFLSHCGWNSCMESISMGVPILAWPMHSDQPLNAVLITQVLKIGLILKDWMSPDD  405

Query  858   ITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +  S+ I  A++ LMAS EGEE R +AAE G AV+ S+ EGG+SR E+D+FIAH++R
Sbjct  406   VVKSSAIEGAVKTLMASEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHVSR  462



>ref|XP_004252081.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=460

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/299 (49%), Positives = 203/299 (68%), Gaps = 18/299 (6%)
 Frame = +3

Query  153   DRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVW  332
             D +P    C+ P+ F+F+  +R+ N  C G L ++CR +EG YLDLL  V    RK P++
Sbjct  173   DEMPEVGDCFGPDIFEFVKKERECNRNC-GELMNSCRELEGEYLDLLVNV----RKKPLF  227

Query  333   GIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHEL  512
              +GPF+ +     + +++D      RH+CLE+LD+Q   SV+FVSFGT T LS  Q++EL
Sbjct  228   ALGPFHLLQELPESMSNRD------RHECLEFLDEQDFDSVMFVSFGTTTTLSREQVNEL  281

Query  513   AEGLEQSGQNFIWVVKDLTK-------GYKNTKINLPAGFEERVEGRGLILRDWVPQLEI  671
             A GLE+S   FIWV+++  K       G K +   LP GFEERV GRG+++R+WVPQLEI
Sbjct  282   ALGLERSNHKFIWVIREADKKMETEKCGGKGSNFELPEGFEERVGGRGMVVRNWVPQLEI  341

Query  672   LDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESR  851
             L H STGGFL+HCGWNSCMES+  GVP+ATWPIQ DQP NA+ +T VLK GIP++ W  R
Sbjct  342   LGHKSTGGFLSHCGWNSCMESVSMGVPIATWPIQVDQPYNAVFVTNVLKIGIPVRSWSRR  401

Query  852   DEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +E+ T+TTI  A+R LM SPEGEE+R +A      +K S+  GG++  E ++FI+ IT+
Sbjct  402   EELVTATTIEKAVRTLMGSPEGEEIRQRAIGLSNKIKNSISHGGLAHKERESFISCITK  460



>ref|XP_006351248.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=479

 Score =   306 bits (783),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 164/352 (47%), Positives = 217/352 (62%), Gaps = 27/352 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+YNF   SAF               +  FLW+ +G+   P  A + D LP    C+ 
Sbjct  144   NVESYNFHSVSAFT--------------IFLFLWESMGK-PFPIEAEILDNLPSLEGCFT  188

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              EF  F+  QRK +    GN+++  R IEG +++LL     + R    W IGPFNP+   
Sbjct  189   SEFMDFMASQRKYSKSDSGNIYNTSRVIEGKFMNLLEK-EPIKRNKTQWAIGPFNPMKII  247

Query  366   RNTKTDQ----DSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
               T T+     D      RHKCL WLDKQ PKS IF+SFGT T L D Q+ EL  GLE+S
Sbjct  248   SKTSTNNNLSIDHHHHHHRHKCLLWLDKQSPKSAIFISFGTTTSLKDEQIEELCIGLEKS  307

Query  534   GQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             G  F+W ++D  KG     +  KI LP G+EER++ +G+I+RDW PQLEIL H+S G F+
Sbjct  308   GIKFVWALRDADKGDIFSGEMRKIELPKGYEERIKNKGIIVRDWAPQLEILGHLSIGAFM  367

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPI-KDWE-SRDEITTSTT  875
             +HCGWNSCMES+  GVP+  WP+  DQPRN+ILIT+ LK GI I  +WE SR+E+  S  
Sbjct  368   SHCGWNSCMESLSMGVPIIAWPMHSDQPRNSILITKFLKVGINIFNNWERSRNEVVKSNI  427

Query  876   IRNAIRRLMASP-EGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             I + I  +M +  EG E+R +AAE G AV+ SV+EGG++R E+D+FIAHITR
Sbjct  428   IEHVIVTIMLNNIEGNEIRRRAAELGVAVRRSVVEGGVTRKELDSFIAHITR  479



>ref|XP_010056820.1| PREDICTED: zeatin O-xylosyltransferase-like [Eucalyptus grandis]
Length=500

 Score =   306 bits (783),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 161/357 (45%), Positives = 212/357 (59%), Gaps = 27/357 (8%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLP------AGAVVPDRL  161
             Y+  + S   DA+ V      +   PS      F W+ +G    P      A  +     
Sbjct  151   YDSLMASVVQDAASVPNAEIYVFQPPSAFTLCWFTWESIGMAPPPEVEVDLAEFISSKGF  210

Query  162   PIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIG  341
             P     YP EF KF+  Q++      G + + CR +EG ++DL A           W IG
Sbjct  211   PSLLDSYPNEFLKFMESQKECQKSNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAIG  270

Query  342   PFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEG  521
             P NPV          + SS+   H C+EWLDKQ P SVI+VSFGT TVL D Q+ E+A G
Sbjct  271   PLNPVKVP-------EKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLCDEQIREIAMG  323

Query  522   LEQSGQNFIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILD  677
             LE+SGQ FIWV+++  K      G +  KI LP GFEE    R  G+++RDW PQLEIL 
Sbjct  324   LERSGQKFIWVLREADKADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEILG  383

Query  678   HVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDE  857
             H +TGGFL+HCGWNSCMES+  GVP+  WP+  DQP NA+LIT+VLK G+ +KDW S D+
Sbjct  384   HPATGGFLSHCGWNSCMESISMGVPILAWPMHSDQPLNAVLITQVLKIGLILKDWMSPDD  443

Query  858   ITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +  S+ I  A++ LMAS EGEE R +AAE G AV+ S+ EGG+SR E+D+FIAH++R
Sbjct  444   VVKSSAIEGAVKTLMASEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHVSR  500



>ref|XP_009768605.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=458

 Score =   305 bits (780),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 157/303 (52%), Positives = 201/303 (66%), Gaps = 18/303 (6%)
 Frame = +3

Query  135   AGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCK-GNLFDACRAIEGPYLDLLAMVYKL  311
             AG      LP    C+  EF +F   Q +       G+L+++C  IEG YLDLLA     
Sbjct  169   AGKSTEPNLPSIEGCFTQEFSEFSRVQTEFRELVNSGDLYNSCYEIEGLYLDLLAKEKSA  228

Query  312   ARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLS  491
             + K   W +GP NPV+       D+  S+K  RHKCLEWLDKQ P SVIFVSFGT T LS
Sbjct  229   SHKQ--WAVGPLNPVI-----PYDKKDSNK--RHKCLEWLDKQEPNSVIFVSFGTTTSLS  279

Query  492   DHQLHELAEGLEQSGQNFIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVP  659
             D+++ ELA GLEQ  Q FIWV++D  KG   T    K+ LP G+EERV GRGLI+RDW P
Sbjct  280   DNEIEELAIGLEQRQQKFIWVLRDADKGDIFTGDVRKVELPKGYEERVIGRGLIVRDWAP  339

Query  660   QLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKD  839
             QLEIL H+STGGF++HCGWNSCMES+  GVP+  WP+  DQPRNA L+T VLK G+ +KD
Sbjct  340   QLEILGHLSTGGFMSHCGWNSCMESISMGVPIIAWPMHSDQPRNAFLVTNVLKIGVVLKD  399

Query  840   WESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAH  1019
             W  R+E+ TS  +   ++RLM S EG+++R +A E    +++SV++GG S  EMD+FI H
Sbjct  400   WALREELVTSVMVEECVKRLMDSVEGDKMRERAVE----LRQSVVDGGGSHKEMDSFITH  455

Query  1020  ITR  1028
             ITR
Sbjct  456   ITR  458



>gb|KEH20810.1| zeatin O-glucosyltransferase-like protein [Medicago truncatula]
Length=481

 Score =   305 bits (781),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/353 (44%), Positives = 212/353 (60%), Gaps = 28/353 (8%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLPAGAVVPDRLPIPSSC  179
             Y+  + S   DA  +        H  S      F W ++G+ ++     +   +P    C
Sbjct  141   YDSLMASCIQDAIHIKNCESYTFHSVSAFTMFLFFWGVMGKPLVKNSTNIIPEVPSLEGC  200

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-  356
             +  +F  FI  Q + + F  G +++  R IE PY++L+     +      W +GPFNP+ 
Sbjct  201   FTTQFINFITSQYEFHKFSNGTIYNTSRVIEKPYIELIE---GMISHKTHWALGPFNPLC  257

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
             V KRN        +   RH  LEWLDKQ   SVI++SFGT T L + Q+ ELA GLEQS 
Sbjct  258   VEKRN--------NNKARHFSLEWLDKQKDNSVIYISFGTTTALKEEQIIELANGLEQSK  309

Query  537   QNFIWVVKDLTK-------GYKNTKINLPAGFEERVE--GRGLILRDWVPQLEILDHVST  689
             Q FIWV++D  +       G +   I LP GFEERVE  G GLI+RDW PQLEIL H S 
Sbjct  310   QKFIWVLRDADRSDVFNEDGVRRM-IELPKGFEERVEIEGVGLIVRDWAPQLEILSHSSI  368

Query  690   GGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTS  869
             GGF++HCGWNSCMES+  GVP+A WP+  DQPRN +L+TEVLK G+ +KDW  RDE+  +
Sbjct  369   GGFMSHCGWNSCMESITMGVPIAAWPMHSDQPRNRVLVTEVLKIGLVVKDWSQRDELVMA  428

Query  870   TTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + + N +RRLMA+ EG+E+R  A      + +S+ EGG+SR+E+D+FIAH+TR
Sbjct  429   SIVENVVRRLMATKEGDEMRQNAMNLKNEILKSMDEGGVSRMELDSFIAHVTR  481



>gb|AAM09517.1|AF489877_1 putative glucosyltransferase [Phaseolus lunatus]
Length=462

 Score =   304 bits (779),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/315 (46%), Positives = 204/315 (65%), Gaps = 20/315 (6%)
 Frame = +3

Query  102   LWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPY  281
              W  +GR  + A   +  ++P    C+P +F  F++ +R       G +++  R I+  Y
Sbjct  162   FWDKMGRPSVEAMHAL--KIPSLEGCFPTQFLDFLIAKRDFLKLSDGIVYNTSRVIDADY  219

Query  282   LDLLAMVYKLARKGPVWGIGPFNPV-VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVI  458
             +DL+ ++    +   VW +GPFNP+ V K+ +K          RH C+EWLDKQ P SVI
Sbjct  220   IDLMEVIPGGKK---VWALGPFNPLAVEKKGSKE---------RHSCMEWLDKQEPNSVI  267

Query  459   FVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEERV  623
             +VSFGT T L   Q+ ++A GLEQS Q FIWV++D  KG      +  ++ LP GFEERV
Sbjct  268   YVSFGTTTPLKVEQIEQVATGLEQSKQKFIWVLRDADKGDIFDENEAKRLELPNGFEERV  327

Query  624   EGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILI  803
             +  GL++RDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+ATWP   DQPRNA LI
Sbjct  328   KDMGLVVRDWAPQLEILSHSSTGGFMSHCGWNSCLESISMGVPIATWPFHSDQPRNAALI  387

Query  804   TEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGG  983
             TEVLK G+ +KDW  R+ + + + + +A+RRLM + EG+E+R +A     A+ +S  EGG
Sbjct  388   TEVLKVGLVVKDWSQRNSLVSGSVVEDAVRRLMQTEEGDEMRERAGRLKNAIHKSTEEGG  447

Query  984   ISRLEMDNFIAHITR  1028
             +S  EMD+FIAHIT+
Sbjct  448   VSHTEMDSFIAHITK  462



>ref|XP_011039446.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X1 [Populus 
euphratica]
 ref|XP_011039448.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X2 [Populus 
euphratica]
Length=473

 Score =   305 bits (780),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 214/347 (62%), Gaps = 32/347 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF  A+ ++E            W+  G  V+    + P   P    C+ 
Sbjct  153   NAESYTFHSVSAF--ATSLYE------------WEREG-MVIGENELFPRDTPSLEGCFS  197

Query  186   PEFFKFI-VDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKG-PVWGIGPFNPVV  359
              EF  F+     K   F  G +++ C+ +E  YLD L    +  ++G   W +GPFNPV 
Sbjct  198   DEFADFVDCHYSKYQRFNTGCVYNTCKLVEPAYLDFLEK--ETIKEGIKHWALGPFNPVT  255

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                ++K          +H CLEWLDKQ   +VI+VSFGT T   D Q+ ELA GL +S +
Sbjct  256   IPESSKK---------QHFCLEWLDKQAKNTVIYVSFGTTTTFDDEQIKELAIGLRESKK  306

Query  540   NFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
              FIWV++D  KG     + T+  LP G+E  V+G GL++RDW PQLEIL H +TGGF++H
Sbjct  307   KFIWVLRDGDKGDVFTGEGTRAELPKGYENSVDGIGLVVRDWAPQLEILAHPATGGFMSH  366

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMES+  GVP+A WP+  DQPRN +LITEVLK GI +KDW  RDEI TS  + +A
Sbjct  367   CGWNSCMESISMGVPIAAWPMHSDQPRNTVLITEVLKIGIAVKDWARRDEIVTSKIVGSA  426

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + RLMAS EG+E+R +A E G +V+ SV EGG+SR+EM++FIAHITR
Sbjct  427   VNRLMASTEGDEMRKRATEMGESVRGSVAEGGVSRMEMESFIAHITR  473



>ref|XP_002278696.2| PREDICTED: zeatin O-glucosyltransferase [Vitis vinifera]
Length=496

 Score =   305 bits (781),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 209/316 (66%), Gaps = 18/316 (6%)
 Frame = +3

Query  105   WKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYL  284
             W+ +GR  L  G  +P+ +P    C+  EFFKF+V Q +      GNL+   + IEGPY+
Sbjct  187   WESLGRPAL-EGVKIPEDVPSLDGCFTLEFFKFLVFQHEFKKLSSGNLYYTSKLIEGPYV  245

Query  285   DLL--AMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVI  458
             D+L    +  + +KG  W +GP N V T  +  ++       P  KCLEWLDKQ PKSV+
Sbjct  246   DILREEEIDGVKKKG--WALGPLNLVTTYSDKTSN-------PGDKCLEWLDKQAPKSVL  296

Query  459   FVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG----YKNTKINLPAGFEERVE  626
              VSFGT T L+D Q+ ELA GLE+SG  FIW+++D  KG     +  +  LP G+EER++
Sbjct  297   LVSFGTSTSLTDEQIKELAIGLERSGHKFIWLLRDADKGDIFSEEVRRSELPEGYEERMK  356

Query  627   --GRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
               G G+++R+W PQLEIL H STGG + HCGWNSC+ES+  GVP+A WP+  DQPRNA L
Sbjct  357   ETGMGVVVREWAPQLEILGHSSTGGLMCHCGWNSCLESISMGVPIAAWPMHSDQPRNAAL  416

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             +T+VL+ G+ +K+W  R+++  ++ I  A+RRLMAS EG  +R KA + G +++ S+ EG
Sbjct  417   VTQVLQVGLAVKEWAEREQLVAASAIEKAVRRLMASEEGNAMRKKAQQLGNSLQRSMEEG  476

Query  981   GISRLEMDNFIAHITR  1028
             G+SR E+D FIAHITR
Sbjct  477   GVSRKELDGFIAHITR  492



>ref|XP_002308931.2| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE92454.2| putative glucosyltransferase family protein [Populus trichocarpa]
Length=473

 Score =   304 bits (779),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 152/345 (44%), Positives = 208/345 (60%), Gaps = 30/345 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF  +   WE   KI+                     P  +P    C+ 
Sbjct  153   NVESYIFHSVSAFAVSLYAWEQQGKIIEDSDMF---------------PRDIPSLEGCFT  197

Query  186   PEFFKFIVDQRKT-NAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              EF  F+  Q      F  G +++ C+ +EG Y+D L     L      W +GPFNPV  
Sbjct  198   AEFADFVACQYNNYQKFNSGCVYNTCKLVEGAYMDFLEK-ETLKEGNKHWALGPFNPVTI  256

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                +K          +  CL+WLDK+   SVI+VSFGT T L D Q+ ELA GL +S QN
Sbjct  257   PERSKK---------KKFCLDWLDKKARNSVIYVSFGTTTALDDEQIKELAIGLRESKQN  307

Query  543   FIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             F+WV++D  KG     +     LP G+E+ V+G GL++RDW PQLEIL H +TGGF++HC
Sbjct  308   FVWVLRDADKGDVFGGEERSAELPEGYEDSVDGVGLVVRDWAPQLEILAHPATGGFMSHC  367

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+  GVP+A WP+  DQPRN +LIT++LK G+ +K+WE RD + TS  + +A+
Sbjct  368   GWNSCLESITMGVPIAAWPMHSDQPRNTVLITKILKIGVVVKEWELRDAVVTSNIVESAV  427

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
             +RLMAS EG+E+R +AAE G +V+ SV EGG+SR+EM++FIAHIT
Sbjct  428   KRLMASTEGDEMRKRAAEMGESVRGSVAEGGVSRMEMESFIAHIT  472



>ref|XP_010024031.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=484

 Score =   305 bits (780),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 163/350 (47%), Positives = 216/350 (62%), Gaps = 25/350 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKI-LHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             N ETY F   SAF   +L W  L    + +P      V   +   G      LP     +
Sbjct  151   NAETYIFHSVSAF---ALYWYTLEATGMGLPPEEDVDVTDLISSKG------LPTLLDIF  201

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
               EF KF+  Q +      G++++ CR +EG Y+DL A           W IGPFNPV  
Sbjct  202   TDEFLKFMASQHEFMNLSLGSIYNTCRVVEGRYVDLFASATASGTPTKHWAIGPFNPV--  259

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                 K  +  S K+  H CL WLDKQ P SVI+VSFGT TVLSD Q+ E+A GLE+SGQ 
Sbjct  260   ----KVPEKKSRKS-AHVCLGWLDKQAPNSVIYVSFGTTTVLSDEQIREIAMGLERSGQK  314

Query  543   FIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGGF  698
             FIWV+++  K      G +  KI LP GF+E VE R  G+++RDW PQLEIL H +TGGF
Sbjct  315   FIWVLREADKADIFSGGVEARKIELPQGFKETVEARDSGVVVRDWAPQLEILGHPATGGF  374

Query  699   LTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTI  878
             L+HCGWNSCMES+  GVP+  WP+  DQP NA+LIT+VLK G+ ++D  S+D++  S+ I
Sbjct  375   LSHCGWNSCMESISMGVPILAWPMHSDQPSNAVLITQVLKIGLMVQDCMSQDKVVKSSAI  434

Query  879   RNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + A+  LMAS +G+E+R  AAE G AV+ S+ EGG+SR+E+D+FI HI+R
Sbjct  435   QGAVEALMASEQGDEMRKSAAELGAAVRGSMDEGGVSRVELDSFITHISR  484



>ref|XP_009625755.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=470

 Score =   304 bits (778),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 163/345 (47%), Positives = 210/345 (61%), Gaps = 25/345 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF   S +W+  R    VPS               VV  ++P    C  
Sbjct  147   NTECYCFHTVSAFLIFSYIWDAARP--PVPS------------EAEVVLKQIPSLEGCNS  192

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PE  +F   Q +   F  GN+F   R IE  YLDL+   Y    K   W +GPFNPV   
Sbjct  193   PELEEFAKKQLQARVFGVGNIFSTSRVIEQLYLDLIEKTYVKDFKH--WALGPFNPVEIP  250

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
               T       ++  RH  LEWLDKQ   SVIFVSFG+ T LS+ ++ ELA+GLEQS Q F
Sbjct  251   IPT-----PDAEKRRHYSLEWLDKQTENSVIFVSFGSTTSLSEEEIKELAKGLEQSEQRF  305

Query  546   IWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             IWV++D  KG   +    K  LP G+EERV  RG+++RDW PQLEIL+HV+T GF++HCG
Sbjct  306   IWVLRDADKGDIFSGDVRKRQLPEGYEERVAERGIVIRDWAPQLEILEHVATSGFMSHCG  365

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSCMES+  GVP+A WP+  DQPRNA+LIT+ LK GI ++ WE R+E+  + TI   ++
Sbjct  366   WNSCMESISMGVPIAAWPMHSDQPRNALLITKGLKIGISVRVWEKRNEVVPAETIEKVVK  425

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              LMAS EGEE++ +A E   AVK SVM+GG +  EM++F+AHITR
Sbjct  426   TLMASSEGEEMKKRATELKEAVKLSVMDGGAAHKEMESFVAHITR  470



>ref|XP_010312401.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=409

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/346 (45%), Positives = 214/346 (62%), Gaps = 31/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAFH  SL WE+  K                  AG  + + +P   +C  
Sbjct  90    NAECYCFNSISAFHMYSLFWEIKGKPFQ---------------AGTELYEDIPSLENCST  134

Query  186   PEFFKFIVDQRK-TNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             PE ++    Q         G L+++ R IEG YLDL+A   K       W +GPFNP+++
Sbjct  135   PEIWELWRKQEALMGKVSSGELYNSSRVIEGLYLDLVA---KENNGLNQWALGPFNPLLS  191

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             ++N  ++        +H  L WLDKQ   SV+ VSFGT T LS+ ++ ELA GLE+S Q 
Sbjct  192   EQNKNSN--------KHHTLYWLDKQETNSVLHVSFGTTTSLSNEEIEELAVGLEKSMQK  243

Query  543   FIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV++D  KG     +     LP G+E+R++GRG+I+RDW PQLEIL H STGGF++HC
Sbjct  244   FIWVLRDADKGDVFAGEERIARLPDGYEKRLKGRGIIVRDWAPQLEILAHPSTGGFMSHC  303

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRN+ L+T+ LK G+ ++ W  RDE+ TS  + NA+
Sbjct  304   GWNSCMESISMGVPIAAWPMHSDQPRNSQLVTKFLKIGLIVRHWACRDELVTSEIVENAV  363

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R LMASPEG E+R +A++    VK+SVM+GG++R EMD+FI HITR
Sbjct  364   RTLMASPEGYEMRKRASKLSNVVKQSVMDGGVNREEMDSFITHITR  409



>ref|XP_009772115.1| PREDICTED: zeatin O-glucosyltransferase-like, partial [Nicotiana 
sylvestris]
Length=256

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 195/266 (73%), Gaps = 15/266 (6%)
 Frame = +3

Query  246   LFDACRAIEGPYLDLLAMVYKLARKG-PVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCL  422
             L+++ R IEG YLDL+A      + G  +W IGPFNP++    T+  +DS     RH+ L
Sbjct  1     LYNSSRVIEGLYLDLVAQ----EKDGLNLWSIGPFNPLLL---TEQKKDSDK---RHQTL  50

Query  423   EWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNTK  590
             +WLDKQ P SVI+VSFGT T LS+ ++ +LA GLE+S Q FIWV++D  KG     +  +
Sbjct  51    DWLDKQEPDSVIYVSFGTSTSLSNEEIEQLAIGLEKSLQKFIWVIRDADKGDVFAGEERR  110

Query  591   INLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPI  770
               +P G+EER++GRG+++RDW PQLEIL H STGGF++HCGWNSCMES+  GVP+A WP+
Sbjct  111   AQMPEGYEERIKGRGILVRDWAPQLEILAHPSTGGFMSHCGWNSCMESISMGVPIAAWPM  170

Query  771   QYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAG  950
               DQPRN+ L+T+ LK G+ ++ W  +DE+ TS  + NA+R LM SPEG+E+R +A+E  
Sbjct  171   HSDQPRNSQLVTKFLKIGLTVRHWTRQDELVTSEIVENAVRNLMDSPEGDEMRKRASELS  230

Query  951   RAVKESVMEGGISRLEMDNFIAHITR  1028
              AVK+SV++GG++R+EMD+FIAHITR
Sbjct  231   EAVKQSVIDGGVNRVEMDSFIAHITR  256



>ref|XP_010056748.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=484

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/349 (46%), Positives = 205/349 (59%), Gaps = 23/349 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF   S  WE  R  +  P  +   +   +   G       P       
Sbjct  151   NAEIYEFKTISAFTLCSFKWE--RIGMAPPPEVELDIAELISSKG------FPSIQDSST  202

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              EF KF   Q++      G +++ CR +EG ++DL A           W IGPFNPV   
Sbjct  203   DEFLKFRASQKECKKLNSGCIYNTCRVVEGRFVDLYASATANGTATKHWAIGPFNPVKVP  262

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
               T T          H C+EWLDKQ P SVI+VSFGT T LSD Q+ E+A GLE+SGQ F
Sbjct  263   EKTSTRS-------AHWCMEWLDKQAPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKF  315

Query  546   IWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGGFL  701
             IWV+++  K      G +   I LP GFEE    R  G+++RDW PQLEIL H +TGGFL
Sbjct  316   IWVLREADKADIFGGGGEARIIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGGFL  375

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+  WP+  DQPRNA+LIT VLK G+ +KDW S+D++  S+ I 
Sbjct  376   SHCGWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVKDWMSQDDVVKSSIIE  435

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              A++ LM + EGEE R +AAE G AV+ S+ EGG+SR E+D+FIAHI R
Sbjct  436   GAVKALMVTEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHIAR  484



>ref|XP_006351384.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=476

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 206/346 (60%), Gaps = 30/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF     VWE +              GR       ++ D LP    C+ 
Sbjct  154   NAEAYTFHSVSAFTIFLYVWESM--------------GRSSSIDVDMIKD-LPSNDGCFT  198

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF KF+  + + + F  G +++  R IEGP+LDLL+   ++ +    W +GPFNP+   
Sbjct  199   PEFTKFVRSEHEFSKFNSGKIYNTSRVIEGPFLDLLSK-EQINKGKKQWALGPFNPITIL  257

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
               T+          RH  L WLDKQ PKSVIFVSFGT T  S  Q+ E+A GLEQS Q F
Sbjct  258   GPTQQ---------RHYSLIWLDKQVPKSVIFVSFGTTTSFSYEQIKEIAIGLEQSQQKF  308

Query  546   IWVVKDLTKGYK-----NTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWV++D  K          KI LP GFEERV+ RG+++RDW PQLEIL H STGGFL+HC
Sbjct  309   IWVLRDADKENVFSEDFTKKIELPKGFEERVKERGIVVRDWAPQLEILAHNSTGGFLSHC  368

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVPL  WP+  DQPRN +LIT++L+ G+ +KDW  RD++     I   +
Sbjct  369   GWNSCMESISMGVPLVAWPMHSDQPRNTVLITKILEVGLVVKDWAQRDKLVMFDRIEKVV  428

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R LMAS EGEE+R +A E    VK +V E G+++ E D FIAHITR
Sbjct  429   RILMASKEGEEMRKRAKELSFGVKNAVGENGVTKNEFDAFIAHITR  474



>ref|XP_007028692.1| UDP-glucosyltransferase, putative [Theobroma cacao]
 gb|EOY09194.1| UDP-glucosyltransferase, putative [Theobroma cacao]
Length=499

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/348 (46%), Positives = 217/348 (62%), Gaps = 34/348 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPS--SC  179
             N E+Y F   SAF     VWE + K    P               A +PD   +PS   C
Sbjct  178   NAESYTFHTVSAFSLFFYVWESIGK----PE------------VNAEMPDEGDVPSLEGC  221

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-  356
             +  +F +FI  Q +      G +++  + IEGPYL+LL  + +  +    W +GPFNPV 
Sbjct  222   FTKDFLEFIALQFQYLRDNAGIIYNTSKVIEGPYLELLGGIMRGKQH---WALGPFNPVR  278

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
             +  +N        S   RH CLEWLDKQ   SV++VSFGT T + D Q+ ELA GL +S 
Sbjct  279   IPGKN--------SSASRHFCLEWLDKQATNSVLYVSFGTTTAMDDEQIKELAIGLRKSN  330

Query  537   QNFIWVVKDLTKG-YKNTKI---NLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
             Q FIWV++D  KG   N ++    LP G+E+ V+  GL++RDW PQLEIL H +TGGF++
Sbjct  331   QKFIWVLRDADKGDVFNGEVRRPELPQGYEDSVKDTGLVVRDWAPQLEILAHPATGGFVS  390

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSCMES+  GVP+  WP+  DQPRNA+LIT++LK GI +KDWE RD   T+  + +
Sbjct  391   HCGWNSCMESITMGVPIGAWPMHSDQPRNAVLITKLLKVGIAVKDWERRDGTVTAPIVED  450

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             A++RLMAS EG+E+R +AAE G AV++SV EG +S+ E D+FIAHITR
Sbjct  451   AVKRLMASKEGDEMRKRAAEVGGAVRQSVAEGEVSQKERDSFIAHITR  498



>ref|XP_010056886.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   303 bits (776),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 162/359 (45%), Positives = 216/359 (60%), Gaps = 29/359 (8%)
 Frame = +3

Query  15    TYNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLP--------AGAVVP  152
              ++  +GS   DA+ V      + H  S      F W+  G  VLP        A  V  
Sbjct  123   VHDSLMGSVVQDAASVPNAENYVFHSVSAFALYWFTWEATG-MVLPQEEEEVDIAELVSA  181

Query  153   DRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVW  332
             +  P    C+  EF KFI  Q +      G +F+ CR +EG Y+DL A     +     W
Sbjct  182   EGFPSIRVCFTDEFLKFIASQHEFKKLSSGCIFNTCRVVEGRYVDLYASATANSIATKHW  241

Query  333   GIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHEL  512
              IGPFN V T        + SS+   H C EWLDKQ   SVI+VSFGT T LS+ Q+ E+
Sbjct  242   AIGPFNMVKTP-------EKSSRRSAHACTEWLDKQASSSVIYVSFGTTTALSNEQIREI  294

Query  513   AEGLEQSGQNFIWVVK-----DLTKGYKNTKINLPAGFEERVEGR--GLILRDWVPQLEI  671
             A GLE SGQ FIWV++     D+ +G +  K+ LP GFEE V  R  G+++RDW PQLEI
Sbjct  295   AIGLESSGQKFIWVLREADKGDIFRGGEARKMELPQGFEEMVGTRDIGVVVRDWAPQLEI  354

Query  672   LDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESR  851
             L H +TGGFL+HCGWNSCMES+  GVP+  WP+  DQPRNAILIT VLK G+ + D  S+
Sbjct  355   LGHPATGGFLSHCGWNSCMESISMGVPILAWPMHSDQPRNAILITGVLKIGLIVTDCMSQ  414

Query  852   DEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +++  S  I++A++ LMAS +G+E+R KAAE G AV+ S+ +GG+SR E+D+FI HI+R
Sbjct  415   NKVVKSPAIQDAVKALMASEQGDEMRKKAAELGIAVRGSMDKGGVSRAELDSFITHISR  473



>ref|XP_007145588.1| hypothetical protein PHAVU_007G251200g [Phaseolus vulgaris]
 gb|ESW17582.1| hypothetical protein PHAVU_007G251200g [Phaseolus vulgaris]
Length=461

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/313 (46%), Positives = 200/313 (64%), Gaps = 19/313 (6%)
 Frame = +3

Query  105   WKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYL  284
             W  +GR  + A   +  ++P    C+P +F  F   Q +      G +++  R IEG Y+
Sbjct  163   WDRMGRPSVEAMHAL--KIPSLEGCFPTQFLDFRA-QSELLKLSDGIVYNTSRVIEGDYI  219

Query  285   DLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFV  464
             +L+  +    +   +W +GPFNP+  ++    +        RH C+EWLDKQ P SVI++
Sbjct  220   ELMKAITGGKK---IWALGPFNPLAVEKKGSKE--------RHSCVEWLDKQEPNSVIYI  268

Query  465   SFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY-----KNTKINLPAGFEERVEG  629
             SFGT T L D Q+ E+A GLEQS Q FIWV++D  KG      +  +  LP GFEERV+ 
Sbjct  269   SFGTTTALRDEQIQEIATGLEQSKQKFIWVLRDADKGDIFDGGEAKRYELPNGFEERVKE  328

Query  630   RGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITE  809
              GL++RDW PQLEIL H STGGFL+HCGWNSC+ES+  GVP+ATWP   DQPRNA LITE
Sbjct  329   MGLVVRDWAPQLEILSHSSTGGFLSHCGWNSCLESITMGVPIATWPFHSDQPRNATLITE  388

Query  810   VLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGIS  989
             VLK G+ +KDW  R+ + + + + + +RRLM + EG+E+R +A    R + +S  EGG+S
Sbjct  389   VLKVGLVVKDWSQRNSLVSGSVVEDGVRRLMQTEEGDEMRERAERLKRVIHKSTEEGGVS  448

Query  990   RLEMDNFIAHITR  1028
              +EMD+FIAHIT+
Sbjct  449   HMEMDSFIAHITK  461



>ref|XP_010671477.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=477

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/297 (51%), Positives = 206/297 (69%), Gaps = 19/297 (6%)
 Frame = +3

Query  165   IPSS--CYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGI  338
             IPSS  C+ PEF  +I  Q K   F  G +F+ CR IEG Y++LL+ + + A+K   + +
Sbjct  191   IPSSEGCFTPEFEAYIAKQYKVLDFESGRIFNTCREIEGRYMELLSKLPENAKKK-FFAL  249

Query  339   GPFNPVVTK-RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELA  515
             GP +PV TK R  K          RH+CLEWLD+Q   SVI+VSFGT T L++ Q+ ELA
Sbjct  250   GPLHPVETKNRFNKI---------RHRCLEWLDEQEINSVIYVSFGTATSLTEEQISELA  300

Query  516   EGLEQSGQNFIWVVKDLTKGYKNTKIN------LPAGFEERVEGRGLILRDWVPQLEILD  677
              GLE+S + F+WV++   +   +T+ +      LP G+E RV+ +G+++RDW PQL+IL 
Sbjct  301   IGLERSEKKFLWVLRSADRVDISTEDDVIIRPQLPKGYEYRVKSKGMVVRDWAPQLDILA  360

Query  678   HVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDE  857
             H S GGF++HCGWNSCMES+  GVP+A WP+  DQPRN+ILITEVLK G+ I+DWE R E
Sbjct  361   HPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNSILITEVLKIGLLIRDWEHRAE  420

Query  858   ITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + TSTT+ N + RLM S EGEE+R +AAE   AV+ SV +GG SRLE+D+F+AHI+R
Sbjct  421   VVTSTTVENVVIRLMTSKEGEEMRKRAAELSVAVRGSVEDGGSSRLEVDSFVAHISR  477



>gb|KEH40483.1| zeatin O-glucosyltransferase-like protein [Medicago truncatula]
Length=461

 Score =   302 bits (774),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 204/314 (65%), Gaps = 16/314 (5%)
 Frame = +3

Query  102   LWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPY  281
             +W+ +G+  + +  ++   +P    C+  +F  F++ Q +   F  G++++  R IEGPY
Sbjct  159   IWERMGKTPIESSHIID--VPSMEGCFTNQFVDFMIAQMEFCEFSNGSIYNTNRVIEGPY  216

Query  282   LDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIF  461
             L+L+    K+      W +GPFNP+        DQ+      RH C+EWLDKQ   SVI+
Sbjct  217   LELIE---KITCNKKHWAVGPFNPLTI------DQEKKDSKGRHSCMEWLDKQETNSVIY  267

Query  462   VSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEERVE  626
             VSFGT T L+D ++ ++A GL+QS   FIWV++D  KG      +  +  L  GFEERVE
Sbjct  268   VSFGTTTTLTDEEIEQIATGLKQSKIKFIWVLRDADKGDIFDKNEGKRGELSKGFEERVE  327

Query  627   GRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILIT  806
             G G ++RDW PQLEIL H STGGF++HCGWNS +E++  GVP+A WP+  DQPRN +LIT
Sbjct  328   GMGFVVRDWAPQLEILSHPSTGGFMSHCGWNSTLETISMGVPIAAWPMHSDQPRNCVLIT  387

Query  807   EVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGI  986
             +VLK G+ +KDW  R ++ T++ I N +RRLM + EG+E+R +A +    V  S+ EGG+
Sbjct  388   QVLKIGLVVKDWAKRHKLVTASNIENVVRRLMETTEGDEMRERAIKLKNVVGTSMDEGGV  447

Query  987   SRLEMDNFIAHITR  1028
             SR+EMD+FIAHITR
Sbjct  448   SRIEMDSFIAHITR  461



>ref|XP_004498042.1| PREDICTED: zeatin O-glucosyltransferase-like [Cicer arietinum]
 gb|AGU14112.1| UDP-glycosyltransferase [Cicer arietinum]
Length=465

 Score =   302 bits (774),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 218/348 (63%), Gaps = 24/348 (7%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILH------VPSFLWKLVGRFVLPAGAVVPDRLPIPSSC  179
             ++  + S   DA+ +  V     H      V SF W+ +G+  L    ++  + P    C
Sbjct  131   HDSLMASVVQDAANIENVENYTFHSTCAFTVFSFFWEKMGKPPLQTSHIL--QFPSLEGC  188

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             + P+   FI  Q++      GN+++  RAIE  Y++L+    K+      W +GPFNP+ 
Sbjct  189   FIPQIIDFIAAQKEFLKLNDGNIYNTSRAIESTYMELIE---KITCSKKHWAVGPFNPLT  245

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
              ++     +DS     RH C+EWLDK+ P SVI+VSFGT T L + Q+ ++A GLEQS +
Sbjct  246   IEK-----KDSKG---RHSCIEWLDKKEPNSVIYVSFGTTTTLVEEQIQQIAIGLEQSKK  297

Query  540   NFIWVVKDLTKG--YKNTKIN---LPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
             NFIWV++D  KG  ++  ++    LP GFEE V+  GLI+RDW PQLEIL+H STGGF +
Sbjct  298   NFIWVLRDADKGDIFEGNEVKRHELPKGFEESVKEMGLIVRDWAPQLEILNHPSTGGFTS  357

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSC+ES+  GVP+A WP+  DQPRN++LI +VLK G+ +K+W+ R E+ T+  I N
Sbjct  358   HCGWNSCLESISMGVPIAAWPMHSDQPRNSVLIAQVLKVGLVVKEWDKRHELVTALDIEN  417

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +RRL+ + EG+E+R KA      + +S+ EGG+SR EMD+FI HITR
Sbjct  418   VVRRLLETKEGDEMRQKALNLKNDIHKSMDEGGVSRKEMDSFIDHITR  465



>ref|XP_004249738.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=477

 Score =   303 bits (775),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 206/346 (60%), Gaps = 30/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF     VWE +              GR       ++ D LP    C+ 
Sbjct  155   NAEAYTFHSVSAFTIFLYVWESM--------------GRSSSIDVDMIKD-LPSNDGCFT  199

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             PEF  F+  + + + F  G +++  R IEGP+LDLL+   ++ +    W +GPFNP+   
Sbjct  200   PEFTTFVRREHEYSKFNSGKIYNTSRVIEGPFLDLLSK-EQINKGKKQWALGPFNPITIS  258

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
               T+          RH  L WLDKQ PKSVIFVSFGT T  S  Q++E+A GLEQS Q F
Sbjct  259   GPTQQ---------RHYSLTWLDKQVPKSVIFVSFGTTTSFSYEQINEIAIGLEQSQQKF  309

Query  546   IWVVKDLTKGYK-----NTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWV++D  K          KI  P GFEERV+ RG+++RDW PQLEIL H STGGFL+HC
Sbjct  310   IWVLRDADKENVFSQDFTKKIEPPKGFEERVKERGIVVRDWAPQLEILAHNSTGGFLSHC  369

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVPLA WP+  DQPRN +LIT++L+ G+ +KDW  RDE+ T   I   +
Sbjct  370   GWNSCMESISMGVPLAAWPMHSDQPRNTVLITKILQVGLVVKDWAQRDELVTLNRIEKVV  429

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R LMAS EGEE+R +A +    VK +V E G+++ E D FIAHI R
Sbjct  430   RILMASKEGEEMRKRAKKLSFDVKNAVGENGVTKNEFDAFIAHIAR  475



>ref|XP_003519074.1| PREDICTED: zeatin O-glucosyltransferase [Glycine max]
 gb|AAM09513.2|AF489873_1 putative glucosyltransferase [Glycine max]
Length=461

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/315 (46%), Positives = 206/315 (65%), Gaps = 18/315 (6%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             F W  +GR  L  G +VP+ +P    C+  +F  F++ QR       GN+++  RAIEG 
Sbjct  160   FYWDKMGR-PLVDGMLVPE-IPSMEGCFTTDFMNFMIAQRDFRKVNDGNIYNTSRAIEGA  217

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVI  458
             Y++ +    +      +W +GPFNP+  ++     +DS     RH CLEWLDKQ P SV+
Sbjct  218   YIEWME---RFTGGKKLWALGPFNPLAFEK-----KDSKE---RHFCLEWLDKQDPNSVL  266

Query  459   FVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNTKIN-LPAGFEERV  623
             +VSFGT T   + Q+ ++A GLEQS Q FIWV++D  KG        K N     FEERV
Sbjct  267   YVSFGTTTTFKEEQIKKIATGLEQSKQKFIWVLRDADKGDIFDGSEAKWNEFSNEFEERV  326

Query  624   EGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILI  803
             EG GL++RDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+A WP+  DQPRN++LI
Sbjct  327   EGMGLVVRDWAPQLEILSHTSTGGFMSHCGWNSCLESISMGVPIAAWPMHSDQPRNSVLI  386

Query  804   TEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGG  983
             TEVLK G+ +K+W  R+ + +++ + NA+RRLM + EG+++R +A      +  S+ EGG
Sbjct  387   TEVLKIGLVVKNWAQRNALVSASNVENAVRRLMETKEGDDMRERAVRLKNVIHRSMDEGG  446

Query  984   ISRLEMDNFIAHITR  1028
             +SR+E+D+FIAHIT+
Sbjct  447   VSRMEIDSFIAHITK  461



>ref|XP_010673139.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   301 bits (772),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 156/347 (45%), Positives = 215/347 (62%), Gaps = 28/347 (8%)
 Frame = +3

Query  3     QNHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             QN E+++FF  SAF     +WE       +P   ++L           +P  +P    C 
Sbjct  151   QNAESFSFFTVSAFTMFLNIWE------GIPEKPFQL--------DLEIPRCIPSNEGCL  196

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              P  F FI +  K   F  G L++  R IEG Y++LL  + K A +   + +GP NPV T
Sbjct  197   TPLVFSFIANLHKLLGFQAGMLYNTSRLIEGRYVELLQKLSKNA-EAKHFAVGPLNPVET  255

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             K  ++ D        RH CL WLDKQ   SVI++SFG+ T ++D Q+ ELA GLE+S Q 
Sbjct  256   KSKSEKD--------RHTCLLWLDKQEVGSVIYISFGSTTSMTDEQITELALGLERSRQK  307

Query  543   FIWVVK-----DLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
             FIWV++     D  +G +     LP  +EERV+ RG+++RDW PQL+IL H STGGF++H
Sbjct  308   FIWVLRRADTADALRGTEVRNPQLPEVYEERVKDRGIVIRDWAPQLQILAHPSTGGFMSH  367

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMES+  GVP+A WP+  DQPRNA+L+TEVL+ G  ++DW  R ++  STTI N 
Sbjct  368   CGWNSCMESISMGVPMAAWPMHSDQPRNAVLVTEVLRIGTLVRDWTDRAKLVMSTTIENV  427

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +RRL+AS EGE ++ +A   G AV+ SV E G+S LEMD+F++HITR
Sbjct  428   VRRLLASEEGEAMQKRAIGLGEAVRASVAEDGVSHLEMDSFMSHITR  474



>dbj|BAJ53203.1| JHL06B08.4 [Jatropha curcas]
Length=485

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/349 (44%), Positives = 217/349 (62%), Gaps = 30/349 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF               +  FL + +GR +    AV P +LP    C+ 
Sbjct  159   NAESYTFHSVSAFT--------------LCLFLSEKMGRNIKLNDAV-PKQLPPFEGCFT  203

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPV---WGIGPFNPV  356
              EF  F+  + + + F  G +++  R IEG Y+DL+    K + +  +   W +GPFNP+
Sbjct  204   NEFLDFVASEYQYHKFNSGCIYNTSRLIEGIYMDLIENQEKESVEKNIKKHWALGPFNPL  263

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                    T  D      +H CL+WLDKQ   SVIFVSFGT T LS+ Q+ +LA GL++S 
Sbjct  264   -------TIPDKKGLNEKHFCLKWLDKQERNSVIFVSFGTTTALSNEQVKQLAIGLKKSN  316

Query  537   QNFIWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             Q FIWV++D  KG         K  LP G+E+ ++G G+++R+WVPQLEIL H + GGF+
Sbjct  317   QKFIWVLRDADKGDVFNKDSEKKAELPKGYEDSIQGMGIVVREWVPQLEILAHQAIGGFM  376

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+A WP+  DQPRNA+LIT++LK GI IKDW  RDEI T+  + 
Sbjct  377   SHCGWNSCMESITMGVPIAAWPMHSDQPRNAVLITDLLKIGIVIKDWCRRDEIVTAKMVE  436

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               ++RLMAS EGE +R +AAE G ++  S+  GG+SRLE+D+F+A+I+R
Sbjct  437   TCVKRLMASDEGEGVRKRAAELGESLHRSMGRGGVSRLEIDSFVAYISR  485



>gb|KDP26082.1| hypothetical protein JCGZ_21115 [Jatropha curcas]
Length=460

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/349 (44%), Positives = 217/349 (62%), Gaps = 30/349 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF               +  FL + +GR +    AV P +LP    C+ 
Sbjct  134   NAESYTFHSVSAFT--------------LCLFLSEKMGRNIKLNDAV-PKQLPPFEGCFT  178

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPV---WGIGPFNPV  356
              EF  F+  + + + F  G +++  R IEG Y+DL+    K + +  +   W +GPFNP+
Sbjct  179   NEFLDFVASEYQYHKFNSGCIYNTSRLIEGIYMDLIENQEKESVEKNIKKHWALGPFNPL  238

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                    T  D      +H CL+WLDKQ   SVIFVSFGT T LS+ Q+ +LA GL++S 
Sbjct  239   -------TIPDKKGLNEKHFCLKWLDKQERNSVIFVSFGTTTALSNEQVKQLAIGLKKSN  291

Query  537   QNFIWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             Q FIWV++D  KG         K  LP G+E+ ++G G+++R+WVPQLEIL H + GGF+
Sbjct  292   QKFIWVLRDADKGDVFNKDSEKKAELPKGYEDSIQGMGIVVREWVPQLEILAHQAIGGFM  351

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+A WP+  DQPRNA+LIT++LK GI IKDW  RDEI T+  + 
Sbjct  352   SHCGWNSCMESITMGVPIAAWPMHSDQPRNAVLITDLLKIGIVIKDWCRRDEIVTAKMVE  411

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               ++RLMAS EGE +R +AAE G ++  S+  GG+SRLE+D+F+A+I+R
Sbjct  412   TCVKRLMASDEGEGVRKRAAELGESLHRSMGRGGVSRLEIDSFVAYISR  460



>ref|XP_006349063.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=467

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 200/319 (63%), Gaps = 21/319 (7%)
 Frame = +3

Query  96    SFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEG  275
             S++W      V P    V  +LP    C  PE  +F   Q        GN+F   R IEG
Sbjct  162   SYIWDAARPPVPPEAEAVLKQLPSLDGCNSPELEEFAKKQIAARVPGVGNIFSTSRVIEG  221

Query  276   PYLDLLAMVYKLARKGPV----WGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQP  443
              Y+DL+  +      GP     W +GPFNPV    N + D+    K  RH  LEWLDKQP
Sbjct  222   LYIDLMDKMM-----GPSGFKHWALGPFNPV----NLEFDK----KETRHYSLEWLDKQP  268

Query  444   PKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNTKINLPAGF  611
               SVIFVSFG+ T LS+ ++ ELA GLE S Q FIWV++D  KG     +  K  LP G+
Sbjct  269   ASSVIFVSFGSTTSLSEDEIRELAIGLEVSQQRFIWVLRDADKGDIFSGEVRKYQLPEGY  328

Query  612   EERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRN  791
             E+RV  RGL++RDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+A WP+  DQPRN
Sbjct  329   EKRVSERGLVMRDWAPQLEILGHPSTGGFMSHCGWNSCIESISMGVPIAVWPMHSDQPRN  388

Query  792   AILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESV  971
             A+ I E LK GIP+++W+ R E+  + T+   +R LMASPEGEE++ KA     AVK +V
Sbjct  389   ALFIAEGLKIGIPVREWKRRKEVVPAETVEKVVRTLMASPEGEEMKRKATALKEAVKLAV  448

Query  972   MEGGISRLEMDNFIAHITR  1028
             MEGG++  EM++F+AHITR
Sbjct  449   MEGGVTHKEMESFVAHITR  467



>ref|XP_006351249.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=479

 Score =   301 bits (771),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/346 (46%), Positives = 215/346 (62%), Gaps = 30/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF+  S  WE                G+   P   +  D +    +C  
Sbjct  153   NAECYRFNSFSAFYMFSSYWEA--------------KGKPFQPETEIFEDIIS-RENCAT  197

Query  186   PEFFKFIVDQRKTNA-FCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             PE ++    Q       C G L++  R IEG YLDL+A   K      +W IGPFNP+++
Sbjct  198   PELWELWNKQGSLEGKICSGELYNTSRVIEGSYLDLVA---KETNGLNLWAIGPFNPLLS  254

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             ++N  +++       +H+ L WLDKQ   SVI+VSFG+ T LS+ ++ ELA GLE+S Q 
Sbjct  255   EQNKDSNK-------QHQTLYWLDKQETNSVIYVSFGSTTTLSNKEIKELAIGLEKSMQK  307

Query  543   FIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV++D  KG     +  +  LP G+EER++GRG+I RDW PQLEIL H STGGF++HC
Sbjct  308   FIWVLRDADKGDVFAGEERRAQLPEGYEERIKGRGIIERDWAPQLEILAHPSTGGFMSHC  367

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRN+ L+T+VLKTG+ ++ W  RDE+  S  + NA+
Sbjct  368   GWNSCMESISMGVPIAAWPMHSDQPRNSQLVTKVLKTGLTVRHWARRDELVASEIVENAV  427

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R LMASPEG+E+R +A+E   AVK+SVM+G     EM++FIAHITR
Sbjct  428   RTLMASPEGDEMRKRASELSIAVKQSVMDGEGYGAEMNSFIAHITR  473



>ref|XP_009766032.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=453

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 213/346 (62%), Gaps = 30/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAFH  S  WEV               G+ +LP      D +P    C+ 
Sbjct  131   NTECYCFNPISAFHRFSYFWEV--------------KGKPLLPGTEHYED-IPSVKDCFS  175

Query  186   PEFFKFIVDQRK--TNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
               F++++  Q          G LF++ R IEG YLDL+A  +   +   +W IGPFNPVV
Sbjct  176   AYFWEYLKAQVVPFVGKISCGELFNSSRVIEGLYLDLMAKEFNNPK---LWAIGPFNPVV  232

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                  K          RH+ L+WLDKQ   SVIFVSFGT T LS+ ++ ++A GLE+S Q
Sbjct  233   LTEKHKNSNK------RHESLDWLDKQEHNSVIFVSFGTTTSLSNEEIKQIAIGLEKSEQ  286

Query  540   NFIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
              FIWV++D  KG   T    KI LP G+EER++GRG+I+RDW PQLEIL H STGGF++H
Sbjct  287   KFIWVLRDADKGDVFTSEVRKIQLPEGYEERIKGRGIIVRDWAPQLEILAHSSTGGFMSH  346

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMES+  GVP+A WP+  DQPRN+ L+T+ LK G+ ++ W  RDE  T   + NA
Sbjct  347   CGWNSCMESISFGVPIAAWPMHSDQPRNSQLVTKYLKIGLTVRPWMRRDEHVTPDMVENA  406

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
             ++ LM + EG+E+R +AA     +K+SVM+GG++R EMD+FIAHIT
Sbjct  407   VKTLMDTTEGDEMRKRAALLSNTIKKSVMDGGMNRAEMDSFIAHIT  452



>ref|XP_004251002.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=464

 Score =   299 bits (765),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 201/316 (64%), Gaps = 17/316 (5%)
 Frame = +3

Query  96    SFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCK-GNLFDACRAIE  272
             ++ W+     V P   VV  +LP    C  PE  +F + Q   N     GN++   RAI+
Sbjct  161   TYTWEAARPPVPPEAEVVLKQLPSQDGCTSPEVIEFAMKQ--INVLQDAGNIYSTSRAID  218

Query  273   GPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKS  452
             G YLDL   +  + +    W +GPFNPV    + K          RH  +EWLDKQP  S
Sbjct  219   GMYLDLTEKM-SVPKDFKNWALGPFNPVDLNIDKKD---------RHYSVEWLDKQPASS  268

Query  453   VIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNTKINLPAGFEER  620
             VIFVSFG+ T L++ ++ ELA GLE S Q FIWV++D  KG     +  K  LP G+E+R
Sbjct  269   VIFVSFGSTTSLTEDEIRELAIGLEASQQRFIWVLRDADKGDIFSGEVRKYQLPEGYEKR  328

Query  621   VEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
             V  RGL++RDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+A WP+  DQPRNA+ 
Sbjct  329   VSERGLVMRDWAPQLEILGHPSTGGFMSHCGWNSCIESISMGVPIAAWPMHSDQPRNALF  388

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             ITE LK GI +++WE R E+  + T+   +R LMASPEGEE++ KA E   AVK +VMEG
Sbjct  389   ITEGLKIGISVREWERRKEVVPAETVEKVVRTLMASPEGEEMKRKAMELKEAVKLAVMEG  448

Query  981   GISRLEMDNFIAHITR  1028
             G++  EM++F+AHITR
Sbjct  449   GVTHKEMESFVAHITR  464



>gb|KCW90127.1| hypothetical protein EUGRSUZ_A02318 [Eucalyptus grandis]
Length=462

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/349 (44%), Positives = 207/349 (59%), Gaps = 23/349 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF      WE  R  +  P  +   +   +   G       P     + 
Sbjct  129   NAEIYEFKAISAFTLCGFAWE--RIGMAPPPEVEVDIAELISSKG------FPSIQDSFT  180

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              EF KF   Q++      G + + CR +EG ++DL A           W +GPFNP+   
Sbjct  181   DEFSKFRASQKECKKSNSGFIHNTCRVVEGRFVDLYASAMANGTATKHWALGPFNPIKVP  240

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                    +  S+   H C+EWLDKQ P SVI+VSFGT T LSD Q+ E+A GLE+SGQ F
Sbjct  241   -------EKRSRRSAHWCMEWLDKQTPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKF  293

Query  546   IWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGGFL  701
             IWV+++  K      G +  KI LP GFEE    R  G+++RDW PQLEIL H +TGGFL
Sbjct  294   IWVLREADKTDIFGGGGEARKIELPQGFEETAAARDLGVVVRDWAPQLEILGHPATGGFL  353

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+  WP+  DQPRNA+LIT VLK G+ +++W S+D++  S+ I 
Sbjct  354   SHCGWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVRNWMSQDDVVKSSIIE  413

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              A++ LMA+ EGEE R +AA+ G AV+ S+ EGG+SR E+D+FIAHI R
Sbjct  414   GAVKALMATEEGEEARKRAAKLGAAVRGSMDEGGVSRAELDSFIAHIAR  462



>ref|XP_006351250.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=474

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 214/346 (62%), Gaps = 29/346 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAFH  S +WE   K L                AG  + + +    +C  
Sbjct  153   NAECYRFNSISAFHTFSCIWESRGKPLQ---------------AGTEIFEDISSNENCAT  197

Query  186   PEFFKFIVDQRKTNA-FCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             PE ++    Q         G L+++ R IEG YLDL+A   K      +  IGPFNP++ 
Sbjct  198   PELWELWSKQNSLEGKISSGELYNSSRVIEGLYLDLVA---KEINGLNLRAIGPFNPLLL  254

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                  T+QD+ S   RHK L+WLDKQ P SVI+VSFGT T LS+ ++ +LA GLE+S Q 
Sbjct  255   -----TEQDNDSNK-RHKTLDWLDKQEPDSVIYVSFGTSTSLSNEEIEQLAIGLEKSLQK  308

Query  543   FIWVVKDLTKG----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV++D  KG     +  +  LP G+EER++GRG+I RDW PQLEIL H STGGF++HC
Sbjct  309   FIWVLRDADKGDVFAGEERRARLPEGYEERIKGRGIIARDWAPQLEILAHPSTGGFMSHC  368

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRN+ L+T+ LK G+ ++    +DE+ TS  + NA+
Sbjct  369   GWNSCMESISMGVPIAAWPMHSDQPRNSQLVTKFLKIGLNLRHGACQDELVTSEMVENAV  428

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R LMASPEG E+R +A+E   AVK+SVM+G  +  EMD+FI HITR
Sbjct  429   RTLMASPEGGEMRKRASELSVAVKQSVMDGEGTGTEMDSFITHITR  474



>ref|XP_010672888.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/301 (50%), Positives = 200/301 (66%), Gaps = 18/301 (6%)
 Frame = +3

Query  147   VPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGP  326
             +P  +P    C PPE   F+ +Q K      G +++  R IEG Y+ LL    KL+    
Sbjct  185   IPKCIPSNEGCTPPEIDNFVANQFKFLGLESGRIYNTSRPIEGRYVQLLE---KLSTNAD  241

Query  327   V--WGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQ  500
             +  + +GPFNPV        D  S S   RH+CLEWLD+Q   SVI+VSFG+ T LSD Q
Sbjct  242   MKHFVLGPFNPV--------DIKSKSGRQRHQCLEWLDQQEQGSVIYVSFGSSTSLSDEQ  293

Query  501   LHELAEGLEQSGQNFIWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQL  665
             + ELA GLE+SGQ F+WV+++   G      +  K  +P G+EER++ RG++ RDW PQL
Sbjct  294   IRELAIGLERSGQKFVWVLRNSDTGDIFAEGEARKPQVPQGYEERLKDRGIVERDWAPQL  353

Query  666   EILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWE  845
             EIL H +TGGF++HCGWNSC+ES+  GVP+A WP+  DQPRNAIL+TEVL+ G  ++DW 
Sbjct  354   EILAHPATGGFMSHCGWNSCIESISMGVPIAAWPMHSDQPRNAILVTEVLRIGTLVRDWA  413

Query  846   SRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
              R ++ TSTTI N ++ LM + EG E+R +AAE G AV+ SV +GG +RLEMD+FIAHIT
Sbjct  414   HRAQLVTSTTIENTVKTLMDTKEGNEMRKRAAELGDAVQGSVAKGGTARLEMDDFIAHIT  473

Query  1026  R  1028
             R
Sbjct  474   R  474



>ref|XP_010056814.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=484

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/349 (44%), Positives = 207/349 (59%), Gaps = 23/349 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF      WE  R  +  P  +   +   +   G       P     + 
Sbjct  151   NAEIYEFKAISAFTLCGFAWE--RIGMAPPPEVEVDIAELISSKG------FPSIQDSFT  202

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              EF KF   Q++      G + + CR +EG ++DL A           W +GPFNP+   
Sbjct  203   DEFSKFRASQKECKKSNSGFIHNTCRVVEGRFVDLYASAMANGTATKHWALGPFNPIKVP  262

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                    +  S+   H C+EWLDKQ P SVI+VSFGT T LSD Q+ E+A GLE+SGQ F
Sbjct  263   -------EKRSRRSAHWCMEWLDKQTPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKF  315

Query  546   IWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGGFL  701
             IWV+++  K      G +  KI LP GFEE    R  G+++RDW PQLEIL H +TGGFL
Sbjct  316   IWVLREADKTDIFGGGGEARKIELPQGFEETAAARDLGVVVRDWAPQLEILGHPATGGFL  375

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+  WP+  DQPRNA+LIT VLK G+ +++W S+D++  S+ I 
Sbjct  376   SHCGWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVRNWMSQDDVVKSSIIE  435

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              A++ LMA+ EGEE R +AA+ G AV+ S+ EGG+SR E+D+FIAHI R
Sbjct  436   GAVKALMATEEGEEARKRAAKLGAAVRGSMDEGGVSRAELDSFIAHIAR  484



>ref|XP_011048089.1| PREDICTED: zeatin O-glucosyltransferase-like [Populus euphratica]
Length=473

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/350 (43%), Positives = 215/350 (61%), Gaps = 28/350 (8%)
 Frame = +3

Query  18    YNFFVGSAFHDASLVWEVLRKILH------VPSFLWKLVGRFVLPAGAVVPDRLPIPSSC  179
             ++  + S   +A L+  V   I H      V  + W+  G+ ++    + P  +P    C
Sbjct  137   HDSLMESVIQEARLLPNVESYIFHSVSAFAVSLYAWEQQGK-IIEDNELFPRDIPSLEGC  195

Query  180   YPPEFFKFIVDQ----RKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPF  347
             +  EF  F+  Q    RK N+ C   +++ C+ +EG Y+D L     L      W +GPF
Sbjct  196   FTAEFADFLSYQYNNYRKFNSGC---VYNTCKLVEGAYMDFLEK-ETLKEGNKHWALGPF  251

Query  348   NPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLE  527
             NPV     +K          +  CL+WLD +   SVI+VSFGT T L D Q+ ELA GL 
Sbjct  252   NPVTIPERSKK---------KKFCLDWLDMKARNSVIYVSFGTTTALDDEQVKELAIGLR  302

Query  528   QSGQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGG  695
             +S QNF+WV++D  KG     +     LP G+E+ V+G GL++RDW PQLEIL H +TGG
Sbjct  303   ESKQNFVWVLRDADKGDVFSGEERSAELPEGYEDSVDGIGLVVRDWAPQLEILAHPATGG  362

Query  696   FLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTT  875
             FL+HCGWNSC+ES+  GVP+A WP+  DQPRN +LIT++LK G+ +++WE RD + TS  
Sbjct  363   FLSHCGWNSCLESITMGVPIAAWPMHSDQPRNTVLITKILKIGVVVREWEQRDAVVTSNI  422

Query  876   IRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
             + +A++RLM S EG+E+R +AAE G +V+ SV EGG+SR+EM++FIAHIT
Sbjct  423   VESAVKRLMGSTEGDEMRKRAAEMGESVRGSVAEGGVSRMEMESFIAHIT  472



>gb|KEH28644.1| zeatin O-glucosyltransferase-like protein [Medicago truncatula]
Length=464

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/346 (43%), Positives = 210/346 (61%), Gaps = 31/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y+F    AF   + +WE               VG+    +  ++   +P    C+ 
Sbjct  145   NVENYSFLSTCAFSIFTSIWE--------------KVGKPPFESSHIID--VPSMEGCFT  188

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E + FI  Q +   F  G++++  R IE PYL+L+    ++      W +GPFNP+  +
Sbjct  189   TEIYDFINAQSEFYEFSDGSIYNTSRVIESPYLELIE---RITCSKKHWAVGPFNPLTIE  245

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +     +DS     RH C+EWLDKQ P SVI+VSFGT T L+D ++ ++A GLEQS   F
Sbjct  246   KK----KDSKG---RHLCMEWLDKQEPNSVIYVSFGTTTTLTDEEIEQIATGLEQSKIKF  298

Query  546   IWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             IWV++D  KG      +  +  L  GFEERVEG G ++RDW PQLEIL H STGGF++HC
Sbjct  299   IWVLRDADKGDIFDGNEGKRGELAKGFEERVEGMGFVVRDWAPQLEILSHPSTGGFMSHC  358

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNS +ES+  GVP+A WP+  DQPRN + IT+VLK G+ + DW  R E+ T++ I N +
Sbjct  359   GWNSTLESISMGVPIAAWPMHSDQPRNCVFITQVLKIGLVVMDWAKRHELVTASDIENVV  418

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R LM + EG+E+R +A +   A+  S+ EGG+SR+EMD+FIAHITR
Sbjct  419   RTLMDTMEGDEMRERAMKLKNAIGMSMDEGGVSRMEMDSFIAHITR  464



>ref|XP_010092094.1| Zeatin O-glucosyltransferase [Morus notabilis]
 gb|EXB50176.1| Zeatin O-glucosyltransferase [Morus notabilis]
Length=483

 Score =   298 bits (763),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 209/348 (60%), Gaps = 30/348 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E++ F   SAF      W+ ++K+            +  + A  ++P  +P    C  
Sbjct  159   NTESFTFHSISAFAIFLFYWDGMKKV------------QLEVDAKNIIPKDVPSLEGCLT  206

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-VT  362
              E   FI  Q + N +  GNL++  R +E PY+DLL  +    +    W +GPFNPV + 
Sbjct  207   SEMMDFIAAQYEFNKYNSGNLYNTSRVMERPYMDLLVRILPNKKH---WALGPFNPVELV  263

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             ++    D        +H CLEWLDKQ P SVI+VSFGT T  ++ Q+ ELA GLEQSGQ 
Sbjct  264   EKKVSND--------KHMCLEWLDKQAPNSVIYVSFGTTTTFTEEQIQELALGLEQSGQK  315

Query  543   FIWVVKDLTKGYKNT-----KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
             F+WV++   KG         K+ LP G+EE V  +G+++RDW PQLEIL H STGGFL+H
Sbjct  316   FMWVLRYADKGVVFDDEVIRKVELPKGYEESVRNKGIVVRDWAPQLEILGHPSTGGFLSH  375

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSC+ES+  GVP+  WP+  DQPRN +L+TE+L  G  ++DW  R+E+ T+  +   
Sbjct  376   CGWNSCIESITMGVPIGAWPMHSDQPRNTVLVTELLGVGTVVRDWNRRNEVATAAAVVEG  435

Query  888   IRRLMASPEGEELRNKAAEAGRAVKES-VMEGGISRLEMDNFIAHITR  1028
             +R+LM S EGE +R +AAE G AV++S   E G SR E+D FIAHI+R
Sbjct  436   VRKLMESKEGEHMRKRAAELGSAVRQSAAAEDGASRKELDAFIAHISR  483



>ref|XP_004251001.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=467

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 153/315 (49%), Positives = 196/315 (62%), Gaps = 13/315 (4%)
 Frame = +3

Query  96    SFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEG  275
             S++W      V P    V  +LP    C  PE  +F   Q        GN+F   R IEG
Sbjct  162   SYIWDAARPPVPPEAEAVLKQLPSLDGCNSPELEEFAKKQIAARVPGVGNIFSTSRVIEG  221

Query  276   PYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSV  455
              Y+DL+  +   A     W +GPFNPV        + +   K  RH  LEWLDKQP  SV
Sbjct  222   LYIDLMDRMMG-ASGFKHWALGPFNPV--------NLEFEKKENRHYSLEWLDKQPASSV  272

Query  456   IFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNTKINLPAGFEERV  623
             IFVSFG+ T LS+ ++ ELA GLE S Q FIWV++D  KG     +  K  LP G+E+RV
Sbjct  273   IFVSFGSTTSLSEDEIRELAIGLEASQQRFIWVLRDADKGDIFSGEVRKCQLPEGYEKRV  332

Query  624   EGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILI  803
               RGL++RDW PQLEIL H STGGF++HCGWNSCMES+  GVP+A WP+  DQPRNA+ I
Sbjct  333   SERGLVMRDWAPQLEILGHPSTGGFMSHCGWNSCMESITMGVPIAAWPMHSDQPRNALFI  392

Query  804   TEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGG  983
             TE LKTGI ++ WE R+E+  + T+   +R L+ASPEG E++  A     AVK SVMEGG
Sbjct  393   TEGLKTGIWVRKWEQRNEVIPAETVEKVVRTLIASPEGAEMKRNATAIKEAVKLSVMEGG  452

Query  984   ISRLEMDNFIAHITR  1028
             +++ EM +F+AHITR
Sbjct  453   VTQQEMKSFVAHITR  467



>gb|EYU18711.1| hypothetical protein MIMGU_mgv1a023637mg [Erythranthe guttata]
Length=452

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 216/347 (62%), Gaps = 33/347 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N ETY F   SAF      +E L KI   P+   +L             +++P    C+ 
Sbjct  133   NAETYVFHSISAFAIFWYFYETLEKIEPKPTIETEL------------QNKVPSLEDCFT  180

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              EF  FIV +        G+L+++CR++EG ++DL   + K++     W IGPFNPV + 
Sbjct  181   TEFMDFIVSEHGHVGLSSGSLYNSCRSVEGRFMDL---IEKISGNKKHWSIGPFNPVGS-  236

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKS-VIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                     +  K+  H+CL+WLD+Q  +S VI+VSFGT T  SD Q+ ELA GLE+SG  
Sbjct  237   --------TEKKSSEHRCLKWLDEQESRSSVIYVSFGTTTSFSDEQIEELANGLEESGAK  288

Query  543   FIWVVKDLTKG--YKN---TKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
             FIWV++D  KG   +N    K  LP GFEERV  RG+++R+W PQLEIL H STGGF++H
Sbjct  289   FIWVLRDADKGDSIENGGIRKAELPVGFEERVRERGIVVREWAPQLEILRHSSTGGFMSH  348

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMES+  GVP+A WP+  DQPRNA+LITEVLK G+ +KDW  RDEI T+  +  A
Sbjct  349   CGWNSCMESISMGVPIAAWPMHSDQPRNAVLITEVLKIGVVVKDWGRRDEIVTAEAVAVA  408

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ++ LM S   EE+R +A E G  V+ +V EGG++  EMD+F+AHI R
Sbjct  409   VKELMGS---EEMRRRAEELGGDVRSAVAEGGVTWSEMDSFVAHIGR  452



>gb|KDP26081.1| hypothetical protein JCGZ_21114 [Jatropha curcas]
Length=460

 Score =   297 bits (760),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/348 (43%), Positives = 213/348 (61%), Gaps = 30/348 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF               +  FL + +GR +      +P+ LP    C+ 
Sbjct  134   NAESYTFHSVSAFT--------------LCLFLSEKMGRNI-KLNETIPEELPSLEGCFT  178

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPV---WGIGPFNPV  356
              EF  F   Q   + F  G +++  R IEG Y+DL+    K + +  +   W +GPFNP+
Sbjct  179   NEFLDFTASQYDYHKFNSGCIYNTSRLIEGAYIDLIENEVKESMQKNIKKHWALGPFNPL  238

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                    T  D      +H CL+WLDK    SVI+VSFGT T L++ Q+ +LA GL++S 
Sbjct  239   -------TIPDKERLQEQHFCLKWLDKHERNSVIYVSFGTTTTLNNEQIKQLAIGLKRSN  291

Query  537   QNFIWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             + FIWV++D  KG         K  LP G+E+ ++G G+++RDWVPQLEIL H + GGF+
Sbjct  292   EKFIWVLRDADKGDVFNKDSERKAELPKGYEDSIQGMGIVVRDWVPQLEILAHQAIGGFM  351

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+A WP+  DQPRNA+LIT+VLK G+ ++DW  RDEI TS  + 
Sbjct  352   SHCGWNSCMESITMGVPIAAWPMHSDQPRNAVLITDVLKIGVIVRDWSRRDEIVTSKMVE  411

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
               ++ LMAS EG+ +R +AAE G ++K S+ EGG+SR+E+D+FIA+I+
Sbjct  412   TCVKSLMASDEGDGMRKRAAEFGDSLKRSMGEGGVSRMEIDSFIAYIS  459



>dbj|BAJ53204.1| JHL06B08.5 [Jatropha curcas]
Length=483

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/348 (43%), Positives = 213/348 (61%), Gaps = 30/348 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF               +  FL + +GR +      +P+ LP    C+ 
Sbjct  157   NAESYTFHSVSAFT--------------LCLFLSEKMGRNI-KLNETIPEELPSLEGCFT  201

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPV---WGIGPFNPV  356
              EF  F   Q   + F  G +++  R IEG Y+DL+    K + +  +   W +GPFNP+
Sbjct  202   NEFLDFTASQYDYHKFNSGCIYNTSRLIEGAYIDLIENEVKESMQKNIKKHWALGPFNPL  261

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                    T  D      +H CL+WLDK    SVI+VSFGT T L++ Q+ +LA GL++S 
Sbjct  262   -------TIPDKERLQEQHFCLKWLDKHERNSVIYVSFGTTTTLNNEQIKQLAIGLKRSN  314

Query  537   QNFIWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             + FIWV++D  KG         K  LP G+E+ ++G G+++RDWVPQLEIL H + GGF+
Sbjct  315   EKFIWVLRDADKGDVFNKDSERKAELPKGYEDSIQGMGIVVRDWVPQLEILAHQAIGGFM  374

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCMES+  GVP+A WP+  DQPRNA+LIT+VLK G+ ++DW  RDEI TS  + 
Sbjct  375   SHCGWNSCMESITMGVPIAAWPMHSDQPRNAVLITDVLKIGVIVRDWSRRDEIVTSKMVE  434

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
               ++ LMAS EG+ +R +AAE G ++K S+ EGG+SR+E+D+FIA+I+
Sbjct  435   TCVKSLMASDEGDGMRKRAAEFGDSLKRSMGEGGVSRMEIDSFIAYIS  482



>ref|XP_004168290.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
Length=464

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 156/349 (45%), Positives = 217/349 (62%), Gaps = 34/349 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPS--SC  179
             N E+YNF   SAF  A  ++E+ ++                    +++ D L IPS   C
Sbjct  140   NAESYNFHSVSAF--AMAIYELEQEDQQTKGM-----------ETSIIKD-LDIPSLDGC  185

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             +  EF++F+  Q        GNL++ C+ IE PYL++L    ++  +   W IGPFNP+ 
Sbjct  186   FTQEFWEFVELQFGVPRKFSGNLYNTCKTIEEPYLEILQ---RINHETKHWAIGPFNPL-  241

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                     + SSS    H CLEWLD+Q   SV++VSFGT T L D Q+ E+A GLE+S Q
Sbjct  242   --------ELSSSSHNIHPCLEWLDQQEANSVVYVSFGTTTALEDEQIAEIARGLERSEQ  293

Query  540   NFIWVVKDLTKGY----KNTKINLPAGFEERV--EGRGLILRDWVPQLEILDHVSTGGFL  701
              FIWV++D  KG     +  K  LP GFE+RV  EG+GL++RDW PQL IL H STGGF+
Sbjct  294   KFIWVLRDADKGDIFNGEVRKSELPEGFEKRVKTEGKGLVVRDWAPQLAILSHGSTGGFV  353

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCME++  GVP+  WP+  DQPRN++L+TEVL+ G+ I++W  RD++  +TTI 
Sbjct  354   SHCGWNSCMEAITMGVPMVAWPMHSDQPRNSVLMTEVLRVGLLIREWSQRDKLVMATTIE  413

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             NA+R+LMAS EG  +R    E    +++SV E G+SR E D+FI+HITR
Sbjct  414   NAVRKLMASEEGHGMRKTVEELAVVMRQSVEENGVSREEFDSFISHITR  462



>ref|XP_004150614.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
 gb|KGN54639.1| hypothetical protein Csa_4G414390 [Cucumis sativus]
Length=464

 Score =   296 bits (759),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 156/349 (45%), Positives = 217/349 (62%), Gaps = 34/349 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPS--SC  179
             N E+YNF   SAF  A  ++E+ ++                    +++ D L IPS   C
Sbjct  140   NAESYNFHSVSAF--AMAIYELEQEDQQTKGM-----------ETSIIKD-LDIPSLDGC  185

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             +  EF++F+  Q        GNL++ C+ IE PYL++L    ++  +   W IGPFNP+ 
Sbjct  186   FTQEFWEFVELQFGVPRKFSGNLYNTCKTIEEPYLEILQ---RINHETKHWAIGPFNPL-  241

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                     + SSS    H CLEWLD+Q   SV++VSFGT T L D Q+ E+A GLE+S Q
Sbjct  242   --------ELSSSSHNIHPCLEWLDQQEANSVVYVSFGTTTALEDEQIAEIARGLERSEQ  293

Query  540   NFIWVVKDLTKGY----KNTKINLPAGFEERV--EGRGLILRDWVPQLEILDHVSTGGFL  701
              FIWV++D  KG     +  K  LP GFE+RV  EG+GL++RDW PQL IL H STGGF+
Sbjct  294   KFIWVLRDADKGDIFNGEVRKSELPEGFEKRVKTEGKGLVVRDWAPQLAILSHGSTGGFV  353

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCME++  GVP+  WP+  DQPRN++L+TEVL+ G+ I++W  RD++  +TTI 
Sbjct  354   SHCGWNSCMEAITMGVPMVAWPMHSDQPRNSVLMTEVLRVGLLIREWSQRDKLVMATTIE  413

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             NA+R+LMAS EG  +R    E    +++SV E G+SR E D+FI+HITR
Sbjct  414   NAVRKLMASEEGHGMRKTVEELAVVMRQSVEENGVSREEFDSFISHITR  462



>ref|XP_008455786.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X1 [Cucumis 
melo]
Length=463

 Score =   296 bits (758),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 157/349 (45%), Positives = 217/349 (62%), Gaps = 35/349 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPS--SC  179
             N E+YNF   SAF  A    E  ++   + S              ++V D L IPS   C
Sbjct  140   NAESYNFHSVSAFAMAIYDLEQDQQTKGMES--------------SIVKD-LDIPSLDGC  184

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             +  EF++F+  Q        GNL++ C+ +E PYL++L    ++  +   W IGPFNP+ 
Sbjct  185   FTQEFWEFVELQFGGPRKFSGNLYNTCKTMEEPYLEILQ---RINHETKHWAIGPFNPL-  240

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                     + SSS    H CLEWLD+Q   SV++VSFGT T L D Q+ E+A GLE+S Q
Sbjct  241   --------ELSSSSHNIHPCLEWLDQQKANSVVYVSFGTTTALEDEQIAEIASGLERSEQ  292

Query  540   NFIWVVKDLTKGY----KNTKINLPAGFEERV--EGRGLILRDWVPQLEILDHVSTGGFL  701
              FIWV++D  KG     +  K  LP GFE+RV  EG+GL++RDW PQL IL H STGGF+
Sbjct  293   KFIWVLRDADKGDIFNGEVRKCELPDGFEKRVKMEGKGLVVRDWAPQLAILSHDSTGGFV  352

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSCME++  GVP+  WP+  DQPRNA+L+T+VL+ G+ I++W  RDE+  +TTI 
Sbjct  353   SHCGWNSCMETITMGVPMVAWPMHSDQPRNAVLMTKVLRVGLLIREWAQRDELVMATTIE  412

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              A+R+LMAS EG E+R    E    ++++V E G+SR+E D+FI+HITR
Sbjct  413   KAVRKLMASEEGHEMRKTVEELAVVMRQAVEENGVSRVEFDSFISHITR  461



>gb|AAL92461.1| putative glucosyltransferase [Solanum lycopersicum]
Length=451

 Score =   296 bits (757),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 215/346 (62%), Gaps = 30/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF   S  WE+  K  H                G    + +P     +P
Sbjct  131   NIECYCFNSSSAFMLYSYHWELKGKPFH---------------PGTENYEDIPTVGDSFP  175

Query  186   PEFFKFIVDQRKTNAFC-KGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             PEF++F+  Q + +     G L+++ R +E  YLDL+A  Y   ++   W IGPFNP+  
Sbjct  176   PEFWEFMKIQEQCDGRNHSGELYNSSRVVESLYLDLMAKEYDGMKQ---WAIGPFNPMEP  232

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             +  +K   DS+    RH+ L WLDKQ   SVIFVSFGT T L D ++  LA GLE+S Q 
Sbjct  233   QEKSK---DSNK---RHESLHWLDKQERNSVIFVSFGTTTSLCDEEIKVLAIGLEKSRQK  286

Query  543   FIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             F+WV++D  KG   T    K  LP G+EER + RG+I+RDW PQLEIL H STGGF++HC
Sbjct  287   FVWVLRDADKGDVFTSEVRKAQLPEGYEERTKERGIIVRDWAPQLEILAHSSTGGFMSHC  346

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ESM  GVP+A WP+  DQPRN+ L+T+ LK G+ ++ W  R+E+ TS  + NA+
Sbjct  347   GWNSCIESMSFGVPIAAWPMHSDQPRNSQLVTKYLKIGLIVRPWARRNEVVTSEIVENAV  406

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R LMAS EG+E+R +AA    A+K+S M+GG++R EMD+FIAHITR
Sbjct  407   RTLMASSEGDEMRRRAAVLSNAIKKS-MDGGMNRAEMDSFIAHITR  451



>ref|XP_009593501.1| PREDICTED: zeatin O-xylosyltransferase-like [Nicotiana tomentosiformis]
Length=466

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/349 (48%), Positives = 216/349 (62%), Gaps = 31/349 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPS--SC  179
             N ETY F V SAF   SL  +V     +   FL               P +  IPS  SC
Sbjct  141   NVETYIFHVISAFTVCSLFQQVSGSAENYDLFL---------------PLQPHIPSFQSC  185

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPF-NPV  356
             YPPE  +FI +  +   F  G +F+ CR IEG YLD LA   K + K P+WG+GP  NPV
Sbjct  186   YPPEMLEFI-EMLRDWTFKSGEIFNTCRDIEGLYLDALA---KQSEK-PLWGLGPLINPV  240

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
               + +   +  +S K   H+C+EWLDKQP  SVI+VSFGT    S  Q+ ELA GLE+S 
Sbjct  241   YLQND---EYSASPKIVSHRCIEWLDKQPKNSVIYVSFGTARTFSLEQIIELALGLERSE  297

Query  537   QNFIWVVKDLTKGYKN-----TKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             Q FIWV+++  K   +      KI LP GFE+RV  RG+I RD+VPQ+EIL H STGG+L
Sbjct  298   QKFIWVLREADKKGNDFTTDVPKIELPIGFEDRVAERGIIARDFVPQMEILAHPSTGGYL  357

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
              H GWNS +ES+  GVP+ATWPI  D P N +LIT+VLK G+ +KDWE RDE+  + TI 
Sbjct  358   FHSGWNSFLESLIMGVPMATWPIHSDNPFNDVLITKVLKVGLVVKDWEHRDELVRANTIE  417

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             N +R LM S EGEE+R +A E  +A+K SV +GG ++ + ++FIAHI R
Sbjct  418   NGVRDLMTSTEGEEMRQRAIELSQAIKMSVKDGGATKKQTESFIAHIAR  466



>gb|KCW90135.1| hypothetical protein EUGRSUZ_A02326 [Eucalyptus grandis]
Length=463

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 204/355 (57%), Gaps = 45/355 (13%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLP------AGAVVPDRLPI  167
             N E Y F   SAF   +L W           F W+ +G    P      A  +    LP 
Sbjct  140   NTEIYEFNPISAF---TLCW-----------FTWESIGMAPPPEVEVDIAELIASKGLPS  185

Query  168   PSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPF  347
                    EF KF   Q +   F  G +++ CR +EG ++DL A           W IGP 
Sbjct  186   LLDSSTDEFLKFYASQNECKKFHSGCIYNTCRVVEGRFVDLYASATANGTATKHWAIGP-  244

Query  348   NPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLE  527
                             S+   H C+EWLDKQ P SV++VSFGT TVLSD Q+ E+A GLE
Sbjct  245   ----------------SRRSAHGCMEWLDKQAPSSVMYVSFGTTTVLSDEQIREIAMGLE  288

Query  528   QSGQNFIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHV  683
              SGQ FIWV+++  K      G +   I LP GFEE V  R  G+++RDW PQLEIL H 
Sbjct  289   YSGQKFIWVLREADKADIFGGGGEARIIQLPQGFEEMVAARDLGVVVRDWAPQLEILGHP  348

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             +TGGFL+HCGWNSCMES+  GVP+  WP+  DQPRNA+LIT VLK G+ +KDW S+D++ 
Sbjct  349   ATGGFLSHCGWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVKDWMSQDDLV  408

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              S+TI  A++ LM S EGEE R +AAE G  V+ S+ EGG+SR E+D+FIAHI R
Sbjct  409   KSSTIEGAVKALMVSEEGEEARKRAAELGAVVRGSMDEGGVSRAELDSFIAHICR  463



>ref|XP_010673140.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 214/347 (62%), Gaps = 28/347 (8%)
 Frame = +3

Query  3     QNHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             QN E+Y F   SA      +WE       +P   ++L           +P  +P    C 
Sbjct  151   QNAESYAFRPFSALSIFLNIWE------GIPEKPFQL--------DLEIPRCIPSNEGCL  196

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              P  F FI +  K   F  G L++  R IEG Y++LL  + K A +   + +GP NPV T
Sbjct  197   TPLVFSFIANLHKLLGFQAGMLYNTSRLIEGRYVELLQKLSKNA-EAKHFAVGPLNPVET  255

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             K  ++ D        RH CL WLDKQ   SVI++SFG+ T ++D Q+ ELA GLE+S Q 
Sbjct  256   KSKSEKD--------RHTCLLWLDKQEVGSVIYISFGSTTSMTDEQITELALGLERSRQK  307

Query  543   FIWVVK-----DLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
             FIWV++     D  +G +     LP  +EERV+ RG+++RDW PQL+IL H STGGF++H
Sbjct  308   FIWVLRRADTADALRGTEVRNPQLPEVYEERVKDRGIVIRDWAPQLQILAHPSTGGFMSH  367

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSCMES+  GVP+A WP+  DQPRNA+L+TEVL+ G  ++DW  R ++  STTI N 
Sbjct  368   CGWNSCMESISMGVPMAAWPMHSDQPRNAVLVTEVLRIGTLVRDWTDRAKLVMSTTIENV  427

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +RRL+AS EG+ ++ +A E G AV+ SV + G+SRLEMD+F++HITR
Sbjct  428   LRRLLASEEGKAMQERAIELGDAVRASVGKDGVSRLEMDSFMSHITR  474



>ref|XP_006351297.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X4 [Solanum 
tuberosum]
 ref|XP_006351298.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X5 [Solanum 
tuberosum]
 ref|XP_006351299.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X6 [Solanum 
tuberosum]
Length=376

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/351 (44%), Positives = 211/351 (60%), Gaps = 36/351 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   S F   S   E  +K+L  PS           P   ++ + LP   + + 
Sbjct  52    NTECYCFHTISVFTALSFACETTKKLL--PS-----------PVAEIIAE-LPPRENTFD  97

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E  ++I  QR++  F    L ++C+ IEG ++DLL    ++ R+   W IGP NPV   
Sbjct  98    SETIEYIKMQRESRNFYSVGLHNSCKEIEGVFIDLL----EVQRENKQWAIGPLNPVKIS  153

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +   ++Q        H+C  WL+KQ   SVI+VSFG+ T LS  Q++ELA GLEQS Q F
Sbjct  154   KKKSSEQT-------HECFSWLNKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQKF  206

Query  546   IWVVKDLTKG--------YKNTKINLPAGFEERV--EGRGLILRDWVPQLEILDHVSTGG  695
             IWV++   K          + +  +LP GFEER+  +G G I ++W PQLEIL H S GG
Sbjct  207   IWVLRGADKKGGDNIENVERGSNFDLPEGFEERIRDKGVGFIEKNWSPQLEILAHGSIGG  266

Query  696   FLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTT  875
             F++HCGWNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+RDE+ ++  
Sbjct  267   FMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRDELVSAAK  326

Query  876   IRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             I N +R LM S EGEELR +  E   AVK+SVM G  SR EMD+F+AHITR
Sbjct  327   IENVVRNLMGSAEGEELRRRVTELSSAVKKSVMNGA-SRKEMDSFVAHITR  376



>gb|KCW86031.1| hypothetical protein EUGRSUZ_B02735, partial [Eucalyptus grandis]
Length=424

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 157/337 (47%), Positives = 202/337 (60%), Gaps = 23/337 (7%)
 Frame = +3

Query  6    NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
            N E Y F   SAF      WE +   +  P  +   +   +   G   P  L    SC P
Sbjct  102  NAEIYVFKPSSAFTFCWFTWESIG--MAPPPEVEVDIAELISSKG--FPSLL---DSC-P  153

Query  186  PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             EF KF+  Q +   F  G + + CR +EG ++DL A           W IGPFNPV   
Sbjct  154  NEFLKFVASQTECKKFNSGCILNTCRVVEGRFVDLFASATANGTAIKHWAIGPFNPVKVP  213

Query  366  RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                   + SS+   H C+EWLDKQ P SVI+VSFGT TVLSD Q+ E+A GLE+SGQ F
Sbjct  214  -------EKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLSDEQIREIAMGLERSGQKF  266

Query  546  IWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGGFL  701
            IWV+++  K      G +  KI LP GFEE    R  G+++RDW PQLEIL H +TGGFL
Sbjct  267  IWVLREADKADIFGGGGEARKIELPQGFEEMAAARELGVVVRDWAPQLEILGHPATGGFL  326

Query  702  THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
            +HCGWNSCMES+  GVP+  WP+  DQP NA+LI +VLK G+ +KDW S+D++  S+ I 
Sbjct  327  SHCGWNSCMESISMGVPILAWPMHSDQPHNAVLIAQVLKIGLIVKDWMSQDDVVKSSAIE  386

Query  882  NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISR  992
             A++ LMAS EGEE R +AAE G AV+ S+ EGG+SR
Sbjct  387  GAVKALMASEEGEEARKRAAELGAAVRGSMDEGGVSR  423



>ref|XP_011075344.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=519

 Score =   296 bits (757),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 165/347 (48%), Positives = 220/347 (63%), Gaps = 32/347 (9%)
 Frame = +3

Query  3     QNHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             QN   Y+F   SAF  +S  WE L                  LP  A +   +P     Y
Sbjct  198   QNAVCYSFRSISAFAVSS--WEALDSPDD-------------LPIEAEILKDIPSLDGYY  242

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGP--VWGIGPFNPV  356
             PPEF +F+  Q  +     G ++++CR IEG YLDLL    K  R G   +W IGPFN V
Sbjct  243   PPEFAEFLNLQSGSRKIFSGEIYNSCREIEGLYLDLLE---KRKRNGAEKLWAIGPFNLV  299

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                 +   ++D  +   RHK L+WLD+Q   SVIFVSFGT + LSD Q+ E+A GLE+SG
Sbjct  300   ----SVPEERDFRN---RHKSLQWLDRQGLNSVIFVSFGTTSSLSDEQIKEIAFGLERSG  352

Query  537   QNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
             Q FIWV++D  KG     +  +  LP GFE+RV+ RG+++RDW PQLEIL H STGGF++
Sbjct  353   QKFIWVLRDADKGDIFAGEVRESELPDGFEKRVKERGVVVRDWAPQLEILCHPSTGGFMS  412

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSC+ES+  GVP+ATWP+  DQP NA+L+T+VLK G+ +K W  +DE+ +S T+  
Sbjct  413   HCGWNSCLESISMGVPMATWPLHSDQPGNAVLMTQVLKIGVQVKCWSRQDELVSSLTVET  472

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
             A+R+LM S EG+ +R +AAE G AVK+SV EGG+ R E+D+FI HIT
Sbjct  473   AVRKLMMSEEGDWVRKRAAELGDAVKKSV-EGGVIRKEIDSFIDHIT  518



>ref|XP_004249229.2| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=483

 Score =   295 bits (754),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 212/346 (61%), Gaps = 34/346 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF+  S  WE                G+   P   +  D +    +C  
Sbjct  167   NAEGYRFNSFSAFYMCSSYWET--------------KGKPSQPETEIFDDIIS-SENCAI  211

Query  186   PEFFKFIVDQRKTNA-FCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             PE ++    Q       C G L+++ R IEG YLDL+A   K      +W IGPFNP+++
Sbjct  212   PELWELWNKQGALEGKICSGELYNSSRVIEGLYLDLVA---KEINGLNLWAIGPFNPLLS  268

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             ++N +           H+ L WLDKQ   SVI+VSFG+ T LS+ ++ ELA GLE+S Q 
Sbjct  269   QQNKQ-----------HQTLYWLDKQETNSVIYVSFGSTTTLSNEEIEELAIGLEKSMQK  317

Query  543   FIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV+++  KG     +  +  LP G+EER++GRG+I+RDW PQLEIL H STGGF++HC
Sbjct  318   FIWVLREADKGDIFAGEERRARLPEGYEERIKGRGIIVRDWAPQLEILAHPSTGGFMSHC  377

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSCMES+  GVP+A WP+  DQPRN+ LIT+VLKTG+ ++ W  RDE+  S  + N +
Sbjct  378   GWNSCMESISMGVPIAAWPMHSDQPRNSQLITKVLKTGLTVRHWARRDELVASEIVENVV  437

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R LM SPEG+E+R +A+E   AVK+SVM+G     EM++FIAHITR
Sbjct  438   RTLMTSPEGDEMRKRASELSIAVKKSVMDGEGYGAEMNSFIAHITR  483



>ref|XP_010024020.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   294 bits (753),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 159/355 (45%), Positives = 205/355 (58%), Gaps = 35/355 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLP------AGAVVPDRLPI  167
             N E Y F   SAF   +L W           F W+ +G    P         +     P 
Sbjct  140   NAEIYEFNPISAF---TLCW-----------FTWESIGMAPPPEVEIDIVELIASKGFPS  185

Query  168   PSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPF  347
             P      EF KF   Q +   F  G + + CR +EG ++DL A           W IGPF
Sbjct  186   PLDSSTDEFLKFAASQNECKKFHSGCIHNTCRVVEGRFVDLYASATANGTATKHWAIGPF  245

Query  348   NPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLE  527
             NPV          +  S+   H C+EWLDKQ   SV++VSFGT TVLSD Q+ E+A GLE
Sbjct  246   NPVKVP-------EKRSRRSAHGCMEWLDKQATSSVMYVSFGTTTVLSDEQIREIAMGLE  298

Query  528   QSGQNFIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHV  683
              SGQ FIWV+++  K      G +   I LP GFEE V  R  G+++RDW PQLEIL H 
Sbjct  299   YSGQKFIWVLREADKVDIFSGGGEARIIQLPQGFEEMVAARDLGVVVRDWAPQLEILGHP  358

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             +TGGFL+HCGWNSCMES+  GVP+  WP+  DQP NA+LIT VLK G+ +KD  S+D++ 
Sbjct  359   ATGGFLSHCGWNSCMESISMGVPILAWPMHSDQPWNAVLITRVLKIGLIVKDLMSQDDLV  418

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              S++I  A++ LM S EGEE R +AAE G AV+ S+ EGG+SR E+D+F+AHI R
Sbjct  419   KSSSIEGAVKALMVSEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFMAHICR  473



>ref|XP_010319172.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=572

 Score =   297 bits (760),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 215/346 (62%), Gaps = 30/346 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF   S  WE+  K  H                G    + +P     +P
Sbjct  252   NIECYCFNSSSAFMLYSYHWELKGKPFH---------------PGTENYEDIPTVGDSFP  296

Query  186   PEFFKFIVDQRKTNAFC-KGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
             PEF++F+  Q + +     G L+++ R +E  YLDL+A  Y   ++   W IGPFNP+  
Sbjct  297   PEFWEFMKIQEQCDGRNHSGELYNSSRVVESLYLDLMAKEYDGMKQ---WAIGPFNPMEP  353

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             +  +K   DS+    RH+ L WLDKQ   SVIFVSFGT T L D ++  LA GLE+S Q 
Sbjct  354   QEKSK---DSNK---RHESLHWLDKQERNSVIFVSFGTTTSLCDEEIKVLAIGLEKSRQK  407

Query  543   FIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             F+WV++D  KG   T    K  LP G+EER + RG+I+RDW PQLEIL H STGGF++HC
Sbjct  408   FVWVLRDADKGDVFTSEVRKAQLPEGYEERTKERGIIVRDWAPQLEILAHSSTGGFMSHC  467

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ESM  GVP+A WP+  DQPRN+ L+T+ LK G+ ++ W  R+E+ TS  + NA+
Sbjct  468   GWNSCIESMSFGVPIAAWPMHSDQPRNSQLVTKYLKIGLIVRPWARRNEVVTSEIVENAV  527

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R LMAS EG+E+R +AA    A+K+S M+GG++R EMD+FIAHITR
Sbjct  528   RTLMASSEGDEMRRRAAVLSNAIKKS-MDGGMNRAEMDSFIAHITR  572



>ref|XP_006351296.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X3 [Solanum 
tuberosum]
Length=445

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/351 (44%), Positives = 211/351 (60%), Gaps = 36/351 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   S F   S   E  +K+L  PS           P   ++ + LP   + + 
Sbjct  121   NTECYCFHTISVFTALSFACETTKKLL--PS-----------PVAEIIAE-LPPRENTFD  166

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E  ++I  QR++  F    L ++C+ IEG ++DLL    ++ R+   W IGP NPV   
Sbjct  167   SETIEYIKMQRESRNFYSVGLHNSCKEIEGVFIDLL----EVQRENKQWAIGPLNPVKIS  222

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +   ++Q        H+C  WL+KQ   SVI+VSFG+ T LS  Q++ELA GLEQS Q F
Sbjct  223   KKKSSEQT-------HECFSWLNKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQKF  275

Query  546   IWVVKDLTKG--------YKNTKINLPAGFEERV--EGRGLILRDWVPQLEILDHVSTGG  695
             IWV++   K          + +  +LP GFEER+  +G G I ++W PQLEIL H S GG
Sbjct  276   IWVLRGADKKGGDNIENVERGSNFDLPEGFEERIRDKGVGFIEKNWSPQLEILAHGSIGG  335

Query  696   FLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTT  875
             F++HCGWNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+RDE+ ++  
Sbjct  336   FMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRDELVSAAK  395

Query  876   IRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             I N +R LM S EGEELR +  E   AVK+SVM G  SR EMD+F+AHITR
Sbjct  396   IENVVRNLMGSAEGEELRRRVTELSSAVKKSVMNGA-SRKEMDSFVAHITR  445



>ref|XP_006351295.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X2 [Solanum 
tuberosum]
Length=446

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/351 (44%), Positives = 211/351 (60%), Gaps = 36/351 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   S F   S   E  +K+L  PS           P   ++ + LP   + + 
Sbjct  122   NTECYCFHTISVFTALSFACETTKKLL--PS-----------PVAEIIAE-LPPRENTFD  167

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E  ++I  QR++  F    L ++C+ IEG ++DLL    ++ R+   W IGP NPV   
Sbjct  168   SETIEYIKMQRESRNFYSVGLHNSCKEIEGVFIDLL----EVQRENKQWAIGPLNPVKIS  223

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +   ++Q        H+C  WL+KQ   SVI+VSFG+ T LS  Q++ELA GLEQS Q F
Sbjct  224   KKKSSEQT-------HECFSWLNKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQKF  276

Query  546   IWVVKDLTKG--------YKNTKINLPAGFEERV--EGRGLILRDWVPQLEILDHVSTGG  695
             IWV++   K          + +  +LP GFEER+  +G G I ++W PQLEIL H S GG
Sbjct  277   IWVLRGADKKGGDNIENVERGSNFDLPEGFEERIRDKGVGFIEKNWSPQLEILAHGSIGG  336

Query  696   FLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTT  875
             F++HCGWNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+RDE+ ++  
Sbjct  337   FMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRDELVSAAK  396

Query  876   IRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             I N +R LM S EGEELR +  E   AVK+SVM G  SR EMD+F+AHITR
Sbjct  397   IENVVRNLMGSAEGEELRRRVTELSSAVKKSVMNGA-SRKEMDSFVAHITR  446



>ref|XP_009796343.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=465

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/347 (43%), Positives = 221/347 (64%), Gaps = 29/347 (8%)
 Frame = +3

Query  45    HDASLVWEV--LRKILHVPSFLWKLVGRFVL-------PAGAVVP------DRLPIPSSC  179
             HD  + + V  +  + ++ S+++  V  F +       P G  +P      ++LP   S 
Sbjct  129   HDVLMSYNVQDVSSLHNIESYIFNCVSVFFMYCSFICIPKGMSIPLEDELLEKLPSLESD  188

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
              P E  K +  Q +      G+L+++ + +EG +LDL+A       K   W IGP  P  
Sbjct  189   SPEEINKLVTFQLQYRDIRSGDLYNSNKVLEGNFLDLMAKFASTQNKKQ-WAIGPILP--  245

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                 TK D  S+    R+ CL+WLD Q P+SV++VSFG+ T  SD ++ ELA GLE+S Q
Sbjct  246   ----TKLDHVSNK---RNICLDWLDNQFPRSVLYVSFGSSTTFSDKEVKELAMGLERSEQ  298

Query  540   NFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
              FIWV++D  +G     ++ +  LP GFEERV+G GL++R+W PQLEIL H STGGF++H
Sbjct  299   KFIWVLRDADRGDIFKGEDRRFELPEGFEERVKGVGLVVREWAPQLEILAHSSTGGFMSH  358

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSC+ES+  GVP+A WP+  +QP N+  +TE+LK G+ +++WE R+E+ +++TI N 
Sbjct  359   CGWNSCIESITMGVPIAAWPMHSEQPINSFFVTEILKIGLIVREWEKREELVSASTIENV  418

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +R+LMAS EG+E+R +A E G AV++S  +GG S+LE+D+FIAHITR
Sbjct  419   VRKLMASEEGDEIRKRAEELGAAVRQSTEKGGSSQLELDSFIAHITR  465



>ref|XP_011078914.1| PREDICTED: zeatin O-xylosyltransferase-like [Sesamum indicum]
Length=468

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 199/318 (63%), Gaps = 15/318 (5%)
 Frame = +3

Query  90    VPSFLWKL-VGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRA  266
             +P+F     +G  VL + A     L     C P +  +F+    +   +  G+LF+ CR 
Sbjct  161   IPAFSQAFFIGEGVLDSSAERLKELHSLQGCIPEKMLEFVAIHAEPLRYRAGDLFNTCRL  220

Query  267   IEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPP  446
             IE PYLDLL        +   W IGP  P      TK    SS+  P +KCLEWLD+Q P
Sbjct  221   IEAPYLDLLEKEESGGNR-KTWAIGPIVP------TKL---SSAAKPANKCLEWLDQQEP  270

Query  447   KSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNTKINLPAGFE  614
             KSVI+VSFGT   LSD Q+ ELA GLEQS   F+WV++D  KG     +  +  LP GFE
Sbjct  271   KSVIYVSFGTTVSLSDEQIKELALGLEQSKVKFLWVLRDADKGDIFDGQVRRAELPEGFE  330

Query  615   ERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNA  794
             ERV+  G ++RDW PQ EIL H STGGF++HCGWNSC+ES+  GVP+A WP+  DQPRN 
Sbjct  331   ERVKEVGKVVRDWAPQPEILAHKSTGGFMSHCGWNSCIESITMGVPIAAWPMHSDQPRNT  390

Query  795   ILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVM  974
             + +T+VLK GI + +WE R E+  ++ I NA+RRLMAS EG E+R +A +    +++++ 
Sbjct  391   LFVTQVLKMGIVVMEWEQRTELVKASAIENAVRRLMASEEGNEVRKRAEDLAATLRQAIE  450

Query  975   EGGISRLEMDNFIAHITR  1028
              GG SRLE+D+F+AHI R
Sbjct  451   PGGASRLELDSFVAHIIR  468



>gb|KCW90138.1| hypothetical protein EUGRSUZ_A02330, partial [Eucalyptus grandis]
Length=457

 Score =   291 bits (746),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 157/359 (44%), Positives = 210/359 (58%), Gaps = 39/359 (11%)
 Frame = +3

Query  15    TYNFFVGSAFHDASLVWEVLRKILHVPS------FLWKLVGRFVLP--------AGAVVP  152
              ++  +GS   DA+ V      + H  S      F W+  G  VLP        A  V  
Sbjct  117   VHDSLMGSVVQDAASVPNAENYVFHSVSAFALYWFTWEATG-MVLPQEEEEVDIAELVSA  175

Query  153   DRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVW  332
             +  P    C+  EF KFI  Q +      G +F+ CR +EG Y+DL A     +     W
Sbjct  176   EGFPSIRVCFTDEFLKFIASQHEFKKLSSGCIFNTCRVVEGRYVDLYASATANSIATKHW  235

Query  333   GIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHEL  512
              IGP                 S+   H C EWLDKQ   SVI+VSFGT T LS+ Q+ E+
Sbjct  236   AIGP-----------------SRRSAHACTEWLDKQASSSVIYVSFGTTTALSNEQIREI  278

Query  513   AEGLEQSGQNFIWVVK-----DLTKGYKNTKINLPAGFEERVEGR--GLILRDWVPQLEI  671
             A GLE SGQ FIWV++     D+ +G +  K+ LP GFEE V  R  G+++RDW PQLEI
Sbjct  279   AIGLESSGQKFIWVLREADKGDIFRGGEARKMELPQGFEEMVGTRDIGVVVRDWAPQLEI  338

Query  672   LDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESR  851
             L H +TGGFL+HCGWNSCMES+  GVP+  WP+  DQPRNAILIT VLK G+ + D  S+
Sbjct  339   LGHPATGGFLSHCGWNSCMESISMGVPILAWPMHSDQPRNAILITGVLKIGLIVTDCMSQ  398

Query  852   DEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +++  S  I++A++ LMAS +G+E+R KAAE G AV+ S+ +GG+SR E+D+FI HI+R
Sbjct  399   NKVVKSPAIQDAVKALMASEQGDEMRKKAAELGIAVRGSMDKGGVSRAELDSFITHISR  457



>ref|XP_006351294.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X1 [Solanum 
tuberosum]
Length=474

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/351 (44%), Positives = 211/351 (60%), Gaps = 36/351 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   S F   S   E  +K+L  PS           P   ++ + LP   + + 
Sbjct  150   NTECYCFHTISVFTALSFACETTKKLL--PS-----------PVAEIIAE-LPPRENTFD  195

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E  ++I  QR++  F    L ++C+ IEG ++DLL    ++ R+   W IGP NPV   
Sbjct  196   SETIEYIKMQRESRNFYSVGLHNSCKEIEGVFIDLL----EVQRENKQWAIGPLNPVKIS  251

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             +   ++Q        H+C  WL+KQ   SVI+VSFG+ T LS  Q++ELA GLEQS Q F
Sbjct  252   KKKSSEQT-------HECFSWLNKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQKF  304

Query  546   IWVVKDLTKG--------YKNTKINLPAGFEERV--EGRGLILRDWVPQLEILDHVSTGG  695
             IWV++   K          + +  +LP GFEER+  +G G I ++W PQLEIL H S GG
Sbjct  305   IWVLRGADKKGGDNIENVERGSNFDLPEGFEERIRDKGVGFIEKNWSPQLEILAHGSIGG  364

Query  696   FLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTT  875
             F++HCGWNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+RDE+ ++  
Sbjct  365   FMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRDELVSAAK  424

Query  876   IRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             I N +R LM S EGEELR +  E   AVK+SVM G  SR EMD+F+AHITR
Sbjct  425   IENVVRNLMGSAEGEELRRRVTELSSAVKKSVMNGA-SRKEMDSFVAHITR  474



>gb|EYU20762.1| hypothetical protein MIMGU_mgv1a027163mg, partial [Erythranthe 
guttata]
Length=465

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/348 (44%), Positives = 209/348 (60%), Gaps = 29/348 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF  A   W+ L K                 P     P  LP    C  
Sbjct  138   NAESYVFNCVSAFSIAGFTWDHLGK-----------------PLPTEFPKELPSLEGCVT  180

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E   F   Q +  ++  G+L++ CR IE  +++LL    ++A     W IGP  P    
Sbjct  181   DEIQYFWALQSEPLSYRAGDLYNTCRLIEPAFMELLER-EEIAGSRKSWAIGPILPA---  236

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
             + +  +Q  S    R++CLEWLDKQ P SVI+VSFGT T LSD Q+ ELA GLEQS   F
Sbjct  237   KLSSANQSES----RNRCLEWLDKQEPNSVIYVSFGTTTSLSDEQIKELAFGLEQSKVKF  292

Query  546   IWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             +WV++D  KG     +  +  LP GFEERVEG G+++R+W PQ +IL H STGGF++HCG
Sbjct  293   LWVLRDADKGDIFDGQVRRAELPDGFEERVEGLGMVVREWAPQPQILAHPSTGGFVSHCG  352

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSC+ES+  GVP+A WP+  DQP N++LITE+LK G+ +++W  R EI  ++TI N ++
Sbjct  353   WNSCIESITMGVPIAAWPMHSDQPSNSVLITEILKMGLIVREWAQRFEIVKASTIENVLK  412

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR*NN  1037
              LM S EG+E+R KA E    V+ +  +GG SRLE+D+FIAHITR N+
Sbjct  413   TLMTSKEGDEIRKKAEELAATVQHATQQGGASRLELDSFIAHITREND  460



>ref|XP_010672884.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 200/302 (66%), Gaps = 17/302 (6%)
 Frame = +3

Query  147   VPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKG-  323
             +P+ +P    C   E  +F   Q +   F  G +F+ CRAIEG Y+ LL  +    +   
Sbjct  182   IPENMPTNEGCATKEVLEFARKQIECLGFESGWIFNTCRAIEGKYVTLLDKLSSTNKSQI  241

Query  324   PVWGIGPFNPV-VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQ  500
               + IGPF+PV +  +N++          RH+CL+WLD+Q   SVI+VSFG+ T L+D Q
Sbjct  242   KHFAIGPFHPVHIENKNSEN---------RHQCLKWLDEQEKCSVIYVSFGSTTSLTDDQ  292

Query  501   LHELAEGLEQSGQNFIWVVKD------LTKGYKNTKINLPAGFEERVEGRGLILRDWVPQ  662
             + ELA GLEQS   F+WV++         +  +  K  LP G+E+RV+ RG+I++DW PQ
Sbjct  293   IEELANGLEQSEVKFLWVLRRADPNDVFEEADRVKKAQLPKGYEDRVKDRGMIVKDWAPQ  352

Query  663   LEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDW  842
             LEIL H STGGF++HCGWNSCMESM  GVP+A WP+  DQPRNA+L++EVL+ GI ++DW
Sbjct  353   LEILAHPSTGGFMSHCGWNSCMESMSMGVPVAAWPMHSDQPRNAVLLSEVLRIGILVRDW  412

Query  843   ESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHI  1022
               R E+  S+TI N ++ LMAS EG+E++ +AAE G +V+ SV EGG+S LE D+FIAHI
Sbjct  413   AHRGEVVKSSTIENVVKTLMASEEGKEMKKRAAELGESVRGSVAEGGVSCLERDSFIAHI  472

Query  1023  TR  1028
             ++
Sbjct  473   SK  474



>emb|CAN74373.1| hypothetical protein VITISV_010199 [Vitis vinifera]
Length=1843

 Score =   307 bits (786),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 209/316 (66%), Gaps = 18/316 (6%)
 Frame = +3

Query  105   WKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYL  284
             W+ +GR  L  G  +P+ +P    C+  EFFKF+V Q +      GNL+   + IEGPY+
Sbjct  1534  WESLGRPAL-EGVKIPEDVPSLDGCFTLEFFKFLVFQHEFKKLSSGNLYYTSKLIEGPYV  1592

Query  285   DLL--AMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVI  458
             D+L    +  + +KG  W +GP N V T  +  ++       P  KCLEWLDKQ PKSV+
Sbjct  1593  DILREEEIDGVKKKG--WALGPLNLVTTYSDKTSN-------PGDKCLEWLDKQAPKSVL  1643

Query  459   FVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG----YKNTKINLPAGFEERVE  626
              VSFGT T L+D Q+ ELA GLE+SG  FIW+++D  KG     +  +  LP G+EER++
Sbjct  1644  LVSFGTSTSLTDEQIKELAIGLERSGHKFIWLLRDADKGDIFSEEVRRSELPEGYEERMK  1703

Query  627   --GRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
               G G+++R+W PQLEIL H STGG + HCGWNSC+ES+  GVP+A WP+  DQPRNA L
Sbjct  1704  ETGMGVVVREWAPQLEILGHSSTGGLMCHCGWNSCLESISMGVPIAAWPMHSDQPRNAAL  1763

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             +T+VL+ G+ +K+W  R+++  ++ I  A+RRLMAS EG  +R KA + G +++ S+ EG
Sbjct  1764  VTQVLQVGLAVKEWAEREQLVAASAIEKAVRRLMASEEGNAMRKKAQQLGNSLQRSMEEG  1823

Query  981   GISRLEMDNFIAHITR  1028
             G+SR E+D FIAHITR
Sbjct  1824  GVSRKELDGFIAHITR  1839



>ref|XP_010673142.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=340

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 192/299 (64%), Gaps = 14/299 (5%)
 Frame = +3

Query  147   VPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGP  326
             +P+ +P    C   E  +F ++Q +   F  G +++  RAI+G Y+ LL  +     +  
Sbjct  49    IPENIPTGEGCATKEMVEFAINQVQCLGFESGWIYNTSRAIDGRYVTLLEKLSSTKSRIK  108

Query  327   VWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLH  506
              + +GPF+PV  K     +        RH+CL+WLD+Q   SVI+VSFG+ T L+D Q+ 
Sbjct  109   HFALGPFHPVHIKNENGEN--------RHQCLKWLDEQEKGSVIYVSFGSTTSLTDDQIE  160

Query  507   ELAEGLEQSGQNFIWVVKD------LTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLE  668
             ELA GLE S   FIWV++         +  K  K  LP G+E+RV  RG+++RDW PQLE
Sbjct  161   ELANGLETSKVKFIWVLRSADRTNIFEEADKFRKAQLPEGYEDRVRDRGMVVRDWAPQLE  220

Query  669   ILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWES  848
             IL H STGGF++HCGWNSCMES+  GVP+A WP+  DQPRNA L++EVL+ GI ++DW  
Sbjct  221   ILAHPSTGGFMSHCGWNSCMESLSMGVPIAAWPMHSDQPRNAALLSEVLRVGILVRDWAH  280

Query  849   RDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
             R EI  S+TI N ++ LMAS EG+E+  +AAE G +V+ SV EGG+  LE D+FIAH++
Sbjct  281   RGEIVKSSTIENVVKTLMASEEGKEMMKRAAELGESVRGSVAEGGVCCLERDSFIAHMS  339



>ref|XP_006355036.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=511

 Score =   290 bits (741),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/295 (49%), Positives = 196/295 (66%), Gaps = 14/295 (5%)
 Frame = +3

Query  156   RLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWG  335
             +LP        E   F   QR+      G++++  + IEG +LDLLA V     K   W 
Sbjct  227   KLPSLEGIATDEARDFSASQRRYMDIRSGDIYNTSKVIEGKFLDLLAQVASDQNKKN-WA  285

Query  336   IGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELA  515
             IGP  P      TK D+ S+ +   + CL+WL+KQPP+SV++VSFGT T  S+ ++ ELA
Sbjct  286   IGPVLP------TKLDRISNRE---NICLDWLNKQPPRSVLYVSFGTTTSFSNREIKELA  336

Query  516   EGLEQSGQNFIWVVKDLTKG----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHV  683
              GLEQS Q FIWV++D  +G     +  K+ LP GFEERV+G GL++R+W PQ EIL H 
Sbjct  337   MGLEQSKQRFIWVLRDADRGDIFTEEARKVELPEGFEERVKGVGLVVREWAPQPEILAHS  396

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             STGGF++HCGWNSCMES+  GVP+A WP+  DQP N  L+TEVLK G+ +++WE R+E+ 
Sbjct  397   STGGFMSHCGWNSCMESITMGVPIAAWPMHSDQPMNGFLVTEVLKIGLIVREWEKREELV  456

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              ++TI N +R+LMAS EG  +R +A E G AV++S  +GG SR+E D+FIAHITR
Sbjct  457   NASTIENVVRKLMASEEGNVIRKRAEEFGEAVRQSTEKGGSSRMEFDSFIAHITR  511



>ref|XP_010673138.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=466

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/302 (47%), Positives = 197/302 (65%), Gaps = 18/302 (6%)
 Frame = +3

Query  144   VVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMV--YKLAR  317
             V+P  +P    C PPE   F+ DQ +      G L++  R IEG Y++LL  +  Y   +
Sbjct  176   VLPKCIPSHEGCTPPEIDNFVADQFQYLGLESGRLYNTSRPIEGKYVELLEKISTYDGIK  235

Query  318   KGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDH  497
                 + +GPFNPV  K        S S   RH+CLEWLD+Q  KSVI+VSFG+ T LS  
Sbjct  236   H---FVLGPFNPVEIK--------SISGKERHQCLEWLDEQEQKSVIYVSFGSSTSLSYE  284

Query  498   QLHELAEGLEQSGQNFIWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQ  662
             Q+ ELA GLE+S Q F+WV+++   G      +     LP G+EERV+ RG++++DW PQ
Sbjct  285   QIEELAVGLERSEQKFVWVLRNSDTGNIFAEGQGRNPQLPEGYEERVKNRGIVVKDWAPQ  344

Query  663   LEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDW  842
             L+IL H S GGF++HCGWNSC+ES+  GV +A WP+  DQPRNA+L+T+VLK GI ++DW
Sbjct  345   LDILAHPSIGGFMSHCGWNSCIESISMGVAIAAWPMHSDQPRNAVLVTDVLKIGILVRDW  404

Query  843   ESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHI  1022
               R ++ TSTTI   ++ LM + EGE++R +AAE G AV+ SV +GG +  EM++FIAHI
Sbjct  405   ADRAQLVTSTTIEKTVKTLMDTEEGEKMRKRAAELGEAVQGSVAKGGAAHFEMNSFIAHI  464

Query  1023  TR  1028
             TR
Sbjct  465   TR  466



>ref|XP_010112354.1| Zeatin O-glucosyltransferase [Morus notabilis]
 gb|EXC60340.1| Zeatin O-glucosyltransferase [Morus notabilis]
Length=572

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/292 (48%), Positives = 187/292 (64%), Gaps = 12/292 (4%)
 Frame = +3

Query  135   AGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLA  314
             A  ++P+ +P    C PPE  +    +        GNL++   AIE PY++L+A +    
Sbjct  187   ADLIIPEDVPSMEGCVPPEIMELSFRECTFVKLSSGNLYNTSMAIERPYVNLMARILPNK  246

Query  315   RKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSD  494
             +    W IGP N V       T  +      RH CLEWLDKQ P+SVI+VSFGT T  +D
Sbjct  247   KH---WAIGPLNMV-------TLSEKKVSNGRHMCLEWLDKQAPRSVIYVSFGTTTTFTD  296

Query  495   HQLHELAEGLEQSGQNFIWVVKDLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEIL  674
              Q+ ELA GLEQSGQ FIWV++D  K  +  K+ LP GFEER +  G+++RD  PQLEIL
Sbjct  297   EQIGELALGLEQSGQKFIWVLRDAEKATR--KVELPKGFEERAKDVGIVMRDLAPQLEIL  354

Query  675   DHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRD  854
              H STGGFL+HCGWNSC+ES+  GVP+  WP+  DQPRN  LIT+VLK G  ++DW  R 
Sbjct  355   GHPSTGGFLSHCGWNSCIESIAMGVPIGAWPMHSDQPRNTSLITQVLKVGTAVRDWSRRF  414

Query  855   EITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNF  1010
             E+ T++TI + +R+LMAS EG  +R KAAE G A+++S+ EGG S  E D+F
Sbjct  415   ELATASTIADGVRKLMASTEGNAMRKKAAELGAALRDSLAEGGDSHKEFDSF  466



>gb|EYU20761.1| hypothetical protein MIMGU_mgv1a022179mg [Erythranthe guttata]
Length=462

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/348 (43%), Positives = 212/348 (61%), Gaps = 28/348 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF  A   W++L K L +                   P  LP    C  
Sbjct  138   NAESYVFNCVSAFSKAVFTWDLLGKPLPIEH-----------------PKELPSLEGCIT  180

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E   F   Q +  ++  G+L++ CR IE  +++LL    ++A     W IGP  P    
Sbjct  181   DEIRDFWALQFEPLSYRAGDLYNTCRLIEPAFMELLER-EEIAGSRKSWAIGPILP----  235

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                K    +S    R++CLEWLDKQ P SVI+VSFGT T LSD Q+ ELA GLEQS   F
Sbjct  236   --AKLSSSASQSESRYRCLEWLDKQEPNSVIYVSFGTTTSLSDEQIKELAFGLEQSKVKF  293

Query  546   IWVVKDLTKG----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             +WV++D  KG     +  +  LP GFEE+V+G G+++R+W PQ +IL H STGGF++HCG
Sbjct  294   LWVLRDADKGDIFDEQVRRAELPEGFEEKVKGVGMVVREWAPQPQILAHPSTGGFVSHCG  353

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSC+ES+  GVP+A WP+  DQP N++LITE+LK G+ +++W+ R E+  ++TI N ++
Sbjct  354   WNSCIESITMGVPIAAWPMHSDQPSNSVLITEILKMGLFVREWKQRTELVKASTIENVLK  413

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR*NN  1037
              LMAS EG+E+R +A E    V+++  +GG S+LE+D+FI+HITR N+
Sbjct  414   ILMASKEGDEIRKRAEELAATVQQATQQGGASKLELDSFISHITRGND  461



>ref|XP_010090218.1| Zeatin O-glucosyltransferase [Morus notabilis]
 gb|EXB39087.1| Zeatin O-glucosyltransferase [Morus notabilis]
Length=477

 Score =   288 bits (736),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 214/349 (61%), Gaps = 24/349 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y+F   S+F+  + + + L              G  +   G   P  +P       
Sbjct  144   NTESYHFHCVSSFYHFAKLRDTL--------------GIQIRHDGDNDPKNIPSCEKSLT  189

Query  186   PEFFKFIVDQRKTNAFCK--GNLFDACRAIEGPYLD-LLAMVYKLARKGPVWGIGPFNPV  356
             PEF  FI  Q +     K  G+L++ACR IE  +LD +L    +      +W IGP   V
Sbjct  190   PEFEAFIGYQVQFMKKMKTSGHLYNACRLIESDFLDFILEKARESDEDVKMWAIGPLETV  249

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
              + +N   ++  S    +HKCLEWLDKQ   SV+++SFGT T + D Q+ ELA GLE+SG
Sbjct  250   TSFKNRSGNRVDSQG--QHKCLEWLDKQERNSVLYISFGTTTFIKDEQIRELAIGLEKSG  307

Query  537   QNFIWVVKDLTKG--YKNTKI---NLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
               F+WV++D  KG  +   ++    LP GFEERV+ +G+++RDW PQLEIL H STGGF+
Sbjct  308   VKFLWVLRDADKGNVFDEGEVRRPQLPQGFEERVKEKGIVVRDWAPQLEILGHSSTGGFM  367

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSC+ES+  GVP+A WP+  DQP NA+ IT VLK G+ +++W  +DE+ +S+ I 
Sbjct  368   SHCGWNSCVESISLGVPIAAWPMHSDQPMNAVFITNVLKVGVLVREWAKKDELVSSSVIE  427

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               ++RLM S EG+E+R  A E G  ++++  EGG+SR+E+D+FIAH+TR
Sbjct  428   KVVKRLMKSEEGDEMRKMAEELGNELRKATDEGGVSRMELDSFIAHVTR  476



>gb|KCW90137.1| hypothetical protein EUGRSUZ_A02329, partial [Eucalyptus grandis]
Length=450

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 205/338 (61%), Gaps = 25/338 (7%)
 Frame = +3

Query  6    NHETYNFFVGSAFHDASLVWEVLRKI-LHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
            N ETY F   SAF   +L W  L    + +P      V   +   G      LP     +
Sbjct  129  NAETYIFHSVSAF---ALYWYTLEATGMGLPPEEDVDVTDLISSKG------LPTLLDIF  179

Query  183  PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
              EF KF+  Q +      G++++ CR +EG Y+DL A           W IGPFNPV  
Sbjct  180  TDEFLKFMASQHEFMNLSLGSIYNTCRVVEGRYVDLFASATASGTPTKHWAIGPFNPV--  237

Query  363  KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                K  +  S K+  H CL WLDKQ P SVI+VSFGT TVLSD Q+ E+A GLE+SGQ 
Sbjct  238  ----KVPEKKSRKS-AHVCLGWLDKQAPNSVIYVSFGTTTVLSDEQIREIAMGLERSGQK  292

Query  543  FIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGGF  698
            FIWV+++  K      G +  KI LP GF+E VE R  G+++RDW PQLEIL H +TGGF
Sbjct  293  FIWVLREADKADIFSGGVEARKIELPQGFKETVEARDSGVVVRDWAPQLEILGHPATGGF  352

Query  699  LTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTI  878
            L+HCGWNSCMES+  GVP+  WP+  DQP NA+LIT+VLK G+ ++D  S+D++  S+ I
Sbjct  353  LSHCGWNSCMESISMGVPILAWPMHSDQPSNAVLITQVLKIGLMVQDCMSQDKVVKSSAI  412

Query  879  RNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISR  992
            + A+  LMAS +G+E+R  AAE G AV+ S+ EGG+SR
Sbjct  413  QGAVEALMASEQGDEMRKSAAELGAAVRGSMDEGGVSR  450



>ref|XP_010090216.1| Zeatin O-glucosyltransferase [Morus notabilis]
 gb|EXB39085.1| Zeatin O-glucosyltransferase [Morus notabilis]
Length=485

 Score =   287 bits (735),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/349 (43%), Positives = 213/349 (61%), Gaps = 24/349 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   S+F+     +  LR  L          G  +   G   P  +P       
Sbjct  153   NTESYRFHCASSFY----YFASLRDTL----------GIQIRHDGDNDPKNIPSCEKSLT  198

Query  186   PEFFKFIVDQRKTNAFCK--GNLFDACRAIEGPYLD-LLAMVYKLARKGPVWGIGPFNPV  356
             PEF  FI  Q +     K  G+L++ACR IE  +LD +L    +      +W IGP   V
Sbjct  199   PEFGAFIGYQVQFMKKMKTSGHLYNACRLIESDFLDFILEKARESDEDVKLWAIGPLETV  258

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
              + +N   ++  S    +HKCLEWLDKQ   SV+++SFGT T + D Q+ ELA GLE+SG
Sbjct  259   TSFKNRWGNRVDSQG--QHKCLEWLDKQERNSVLYISFGTTTFMKDEQIRELAIGLEKSG  316

Query  537   QNFIWVVKDLTKG--YKNTKI---NLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
               F+WV++D  KG  +   ++    LP GFEERV+ +G+++RDW PQLEIL H STGGF+
Sbjct  317   VKFLWVLRDADKGNVFDEGEVRRPQLPQGFEERVKEKGIVVRDWAPQLEILGHSSTGGFM  376

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSC+ES+  GVP+A WP+  DQP NA+ IT VLK G+ +++W  +DE+ +S+ I 
Sbjct  377   SHCGWNSCVESISLGVPIAAWPMHSDQPMNAVFITNVLKVGVLVREWAKKDELVSSSVIE  436

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               ++RLM S EG+E+R  A E G  ++++  EGG+SR+E+D+FIAHITR
Sbjct  437   KVVKRLMKSEEGDEMRKMAEELGNELRKATDEGGVSRMELDSFIAHITR  485



>gb|EPS57763.1| hypothetical protein M569_17054, partial [Genlisea aurea]
Length=460

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 198/319 (62%), Gaps = 25/319 (8%)
 Frame = +3

Query  96    SFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEG  275
             +F W+  GR  LP  A V   +P    C+ PEF + I    +T     G ++++ R IEG
Sbjct  158   AFNWEFAGRPELPPEAEVFKEVPSAEGCFVPEFEELIAFGNETKILKSGYIYNSSRIIEG  217

Query  276   PYLDLLAMVYKLARKG----PVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQP  443
              YLDL        R G     +W  GPF+        +T ++       + CL+WLD+Q 
Sbjct  218   FYLDL--------RLGDGIDKIWAFGPFH--------RTPENPPETGRENDCLKWLDEQS  261

Query  444   PKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTK-----GYKNTKINLPAG  608
             P SVIF+SFGT   LSD Q+ E+A GLE+S Q FIWV++D  +     G +  +  LP  
Sbjct  262   PNSVIFISFGTTVSLSDEQIQEIATGLERSHQKFIWVLRDADRADIFSGGEVRRPELPPN  321

Query  609   FEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPR  788
             FEERV GRG ++RDW PQ  ILDH STGGF+THCGWNS +ES+  GVP+ATWP+  DQP+
Sbjct  322   FEERVGGRGRVIRDWAPQPAILDHPSTGGFMTHCGWNSFLESISAGVPMATWPMHSDQPK  381

Query  789   NAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKES  968
             NA LIT+VLK G+ +KDW    EI T+ T+ N++R LM S EG+ +R +AA  G+A++ES
Sbjct  382   NAALITKVLKVGVEVKDWRRWKEIVTAETVENSVRVLMGSEEGDAMRKRAAVMGKALRES  441

Query  969   VMEGGISRLEMDNFIAHIT  1025
             V E G S +E+D+F+ HIT
Sbjct  442   VKENGSSAMELDSFLEHIT  460



>ref|XP_009779217.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=460

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/349 (47%), Positives = 212/349 (61%), Gaps = 31/349 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPS--SC  179
             N ETY F V SAF   SL  +V     +   FL               P +  IPS  SC
Sbjct  135   NVETYIFHVISAFTVCSLFQQVSGSAENNDLFL---------------PLQHHIPSFQSC  179

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPF-NPV  356
             YPPE  +FI   R    F  G +F+ C  IEGPYL+ LA   K + K P+W +GP  NPV
Sbjct  180   YPPEMLEFIKMLRDW-TFKSGEIFNTCIDIEGPYLNALA---KQSEK-PLWDLGPLINPV  234

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                 +   +  +S K   H+C+EWLDKQP  SVI+VSFGT    S  Q+ ELA GLE+S 
Sbjct  235   YLHND---EYSASPKIVSHRCIEWLDKQPKNSVIYVSFGTARTFSLEQIIELALGLERSE  291

Query  537   QNFIWVVKDLTKGYKN-----TKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
             Q FIWV+++  K   +      KI LP GFEERV  RG+I RD+VPQ+EIL H STGG+L
Sbjct  292   QKFIWVLREADKKGNDFTTDVPKIELPIGFEERVAERGIIARDFVPQMEILAHPSTGGYL  351

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
              H GWNS +ES+  GVP+ATWPI  D P N +LIT+VLK G+ +KDW  +D++  +  I 
Sbjct  352   FHSGWNSFLESLTMGVPMATWPIHSDNPFNDVLITKVLKVGLVVKDWAHKDDLVKADRIE  411

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             N +R L+ SPEGEE+R +A    +A+K SV +GG ++ + ++FIAHITR
Sbjct  412   NGVRTLITSPEGEEMRQRAIALSQAIKMSVKDGGATKEQTESFIAHITR  460



>ref|XP_009600299.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=467

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 212/348 (61%), Gaps = 20/348 (6%)
 Frame = +3

Query  15    TYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVP------DRLPIPSS  176
              ++  +     D S +  V   I +  S  +       +P G  +P      ++LP   +
Sbjct  130   VHDVLMSYNVQDVSSLHNVESYIFNCVSVFFMYCSFICIPKGMPIPLEDELLEKLPSLEA  189

Query  177   CYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV  356
               P E  K +  Q +      G+L+++ + +EG +LDL+A       K   W IGP  P 
Sbjct  190   DAPEEINKLVAFQLEYRDIRSGDLYNSNKVLEGTFLDLMAKFASTQNKKQ-WAIGPILP-  247

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
                  TK D  S+    R+ CL+WLD Q P+SV++VSFG+ T  SD ++ ELA GLE+S 
Sbjct  248   -----TKLDLVSNK---RNVCLDWLDNQLPRSVLYVSFGSSTTFSDKEIMELAMGLERSE  299

Query  537   QNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
             Q FIWV++D  +G     ++ +  LP GFEERV+G GL++R+W PQLEIL H STGGF++
Sbjct  300   QKFIWVLRDADRGDIFKGEDRRFELPEGFEERVKGVGLVVREWAPQLEILAHSSTGGFMS  359

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSC+ES+  GVP+  WPI  +QP NA  +TE+LK G+ +++WE R+E+  ++TI N
Sbjct  360   HCGWNSCIESITMGVPIVAWPIHSEQPINAFFVTEILKIGVLVREWEKREELVCASTIEN  419

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              + + MAS EG++ R +A E G AV++S  +GG S+LE+D+FIAHITR
Sbjct  420   VVSKFMASEEGDDFRKRAEELGAAVRQSREKGGSSQLELDSFIAHITR  467



>ref|XP_010090211.1| Zeatin O-xylosyltransferase [Morus notabilis]
 gb|EXB39080.1| Zeatin O-xylosyltransferase [Morus notabilis]
Length=303

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 192/297 (65%), Gaps = 9/297 (3%)
 Frame = +3

Query  159   LPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLD-LLAMVYKLARKGPVWG  335
             +P    C  PEF  F+  Q        G+L++  R IE  ++D +LA   +      +W 
Sbjct  9     IPPVEGCLNPEFEAFMAYQTNLLNGKSGHLYNTSRVIESCFIDFILAKETETNEDMKIWA  68

Query  336   IGPFNPVVTKRNTKTDQDSSSKTPRH-KCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHEL  512
             IGP   V   +    +  SS +  R   CLEWLDKQ   SV+++SFGT T + D Q+ EL
Sbjct  69    IGPLETVTIFKQIVPN--SSGEHKRDCSCLEWLDKQERNSVLYISFGTTTFMEDEQIREL  126

Query  513   AEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILD  677
             A GLE+SG  F+WV++D  KG      +  ++ LP GFEERV+G+G+++RDW PQLEIL 
Sbjct  127   AIGLEKSGVKFLWVLRDADKGNVFDESEARRLQLPQGFEERVKGKGIVVRDWAPQLEILG  186

Query  678   HVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDE  857
             H STGGF++HCGWNSC ES+  GVP+A W +  DQP NA+LIT++LK G+ +++W  RDE
Sbjct  187   HSSTGGFMSHCGWNSCFESISLGVPIAAWSMHSDQPMNAVLITDLLKVGVVVREWTKRDE  246

Query  858   ITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + +S+ I    +RLM S EG+E+R KA E G  ++++V EGG+SR+E+++FIA ITR
Sbjct  247   LVSSSVIEKVAKRLMKSEEGDEIREKAEELGNELRKAVAEGGVSRMELNSFIAQITR  303



>ref|XP_004236592.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=471

 Score =   284 bits (727),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 147/347 (42%), Positives = 216/347 (62%), Gaps = 28/347 (8%)
 Frame = +3

Query  45    HDASLVWEV--LRKILHVPSFLWKLVGRFV-------LPAGAVVP------DRLPIPSSC  179
             HD  + + V  +  + +  S+++  V  F        LP G  +P       +LPI    
Sbjct  134   HDVLMSYTVQDVASLHNAESYIFNCVSVFCMYSSFICLPNGMPIPLDEHLLQKLPILEPD  193

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
              P E  K +  Q K      G+L+++ + +EG  +DL+        K   W IGP   + 
Sbjct  194   APEEINKLVEFQLKYTDIRAGDLYNSNKILEGTCIDLMERFASKQNKKQ-WAIGPIF-LA  251

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
              K +  +D+       R+KCL+WLDKQ P+SV++VSFG+ T  SD ++ ELA GLE+S Q
Sbjct  252   AKVDHVSDK-------RNKCLDWLDKQAPRSVLYVSFGSSTTFSDKEVMELAMGLERSKQ  304

Query  540   NFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTH  707
              F+WV++D  +G     +  +  LP GFEERVEG GL++R+W PQLEIL H STGGF++H
Sbjct  305   KFVWVLRDGDRGNIFSEEARRFELPDGFEERVEGVGLVVREWAPQLEILGHSSTGGFMSH  364

Query  708   CGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNA  887
             CGWNSC+E +  GVP+A W +  +QP NA  +TE+LKTG+ ++DW+  +EI T++ I N 
Sbjct  365   CGWNSCIECVTMGVPMAAWAMHSEQPLNAFFVTEILKTGLVVRDWKKHEEIVTASAIENV  424

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +R+LMAS EG+E+R +A E G AV+ES+ +GG S++E+D+FIAHITR
Sbjct  425   VRKLMASEEGDEIRKRAEELGAAVRESIEKGGASQVELDSFIAHITR  471



>ref|XP_010672887.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=496

 Score =   285 bits (728),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 146/351 (42%), Positives = 214/351 (61%), Gaps = 33/351 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVL---RKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSS  176
             N + + F   SAF   S  WE +    K+L + S                +PD +P    
Sbjct  169   NAKAFTFIPISAFSMFSYSWESIPEEVKLLQLDS--------------EEIPDNIPTHEG  214

Query  177   CYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV  356
             C   E  +F   Q +   F  G +++  RAIEG Y+ LL  +Y    +   + IGPF+PV
Sbjct  215   CATKEMLEFATKQIECLGFESGWIYNTSRAIEGRYVTLLDKLYSSKSQIKHFAIGPFHPV  274

Query  357   -VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
              +  +N++          RH+CL+WLD+Q   SVI+VSFG+ T  +D Q+ ELA GL++S
Sbjct  275   NIENKNSEN---------RHQCLKWLDEQEKCSVIYVSFGSTTSFTDDQIEELANGLDRS  325

Query  534   GQNFIWVVKD------LTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGG  695
                F+WV++         +  +  K  LP G+E+RV+ RG+I++DW PQLEIL H STGG
Sbjct  326   EVKFLWVLRRADPNNVFEEADRVKKAQLPEGYEDRVKDRGMIVKDWAPQLEILAHPSTGG  385

Query  696   FLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTT  875
             F++HCGWNSCMES+  GVP+A WP+  DQPRNA+L+T+VL+ GI ++DW  R E+  S+T
Sbjct  386   FMSHCGWNSCMESISMGVPVAAWPMHSDQPRNAVLLTKVLRIGILVRDWAHRGEVVKSST  445

Query  876   IRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             I N ++ LM + EG+E++ +AAE G +V+ SV EGG+S LE D+FIA+I++
Sbjct  446   IENVVKTLMVTEEGKEMKKRAAELGESVRGSVAEGGVSCLERDSFIAYISK  496



>gb|EPS60351.1| hypothetical protein M569_14451, partial [Genlisea aurea]
Length=445

 Score =   283 bits (723),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 139/311 (45%), Positives = 197/311 (63%), Gaps = 11/311 (4%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGP  278
             F+W+  G+       V+ D LP    C+  EFF+   +Q +   +C G +++ CR IE  
Sbjct  145   FMWENAGKPFDVDRDVLTD-LPSLDGCFATEFFRLAEEQYRFTEYCSGRIYNTCRIIEDE  203

Query  279   YLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVI  458
             +L +L    ++A     W +GPFN V    + ++         RHK L+WLD+Q  KSVI
Sbjct  204   FLKMLEKP-EIAGDKKQWALGPFNQVYYGNDCES--------WRHKSLKWLDEQSEKSVI  254

Query  459   FVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDL-TKGYKNTKINLPAGFEERVEGRG  635
              V FGT T  S  Q+ ELA GLE SG  FIWV+++   KG     + +P  +EER+ GRG
Sbjct  255   LVCFGTTTSFSSVQIWELAVGLEMSGHKFIWVLREHDAKGKLFIYLFIPKNYEERIGGRG  314

Query  636   LILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVL  815
             +++ DW PQL+IL H STGGF++HCGWNSC+ES+  GVP+A WPI  DQPRNA+LIT +L
Sbjct  315   VMVTDWAPQLDILSHSSTGGFMSHCGWNSCIESISAGVPIAAWPIHSDQPRNAVLITGIL  374

Query  816   KTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRL  995
             K G  ++DW+ R E  TS+ I N+++RLM   EG+E+R +A + G  V  +V EGG++R 
Sbjct  375   KIGFAVRDWDRRKETVTSSEIANSVKRLMEEGEGKEMRRRAEKLGGDVAAAVAEGGMTRR  434

Query  996   EMDNFIAHITR  1028
             E+D+FIAH+TR
Sbjct  435   EIDSFIAHVTR  445



>ref|XP_004251744.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=451

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 214/344 (62%), Gaps = 29/344 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N ++Y F  GS F   S + + +  ++       K +          + D  P+  +   
Sbjct  130   NVKSYMFHTGSTFSRYSSIKQTIPDLVDDDDDHVKFIKE--------MQDEFPLLEA---  178

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E + F ++    +    G + ++CR +EG Y DLLA     A+  P+W  GPF+ ++  
Sbjct  179   HEKYCFQMELDDKDIHYSGEIINSCREMEGKYPDLLAK----AKGKPLWAFGPFHMLL--  232

Query  366   RNTKTDQDSSSKTPRH-KCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
                   + +S+ TPRH +CLE+LDKQ   SVIFVSFG+ T LS  Q++E+A GLEQS   
Sbjct  233   ------ESNSNITPRHDQCLEFLDKQEASSVIFVSFGSTTTLSQEQINEIALGLEQSNHR  286

Query  543   FIWVVKDLTKGYK----NTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             FIWV++      K    + KI LP GFEERVEGRG+++ +W PQLEIL H+STGGF+THC
Sbjct  287   FIWVLRKGDNSEKLKEKDVKIELPKGFEERVEGRGIVV-NWAPQLEILGHLSTGGFMTHC  345

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+ +GVP+ATWPI YDQP NA+ +T +LK GI +K W  R+E+ T++TI  ++
Sbjct  346   GWNSCIESISKGVPVATWPISYDQPFNAVFLTNMLKIGIAVKSWSHRNELITASTIEKSV  405

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHI  1022
             + LM + EGEE+R +A +  + +K SV  GG++R +M+ FI+HI
Sbjct  406   KTLMGTVEGEEMRQRAVKLSKQMKNSVRSGGLARKDMEAFISHI  449



>ref|XP_006355031.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=449

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 185/267 (69%), Gaps = 17/267 (6%)
 Frame = +3

Query  240   GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKC  419
             G++ +  + IE  Y+DL+    +++     W IGP  P      TK D  SS       C
Sbjct  196   GDIHNTSKLIESKYIDLMEQA-EISLNKKQWAIGPILP------TKFDYISSI------C  242

Query  420   LEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNT  587
             L+WL+KQPP+SVI+VSFGT T  SD Q+ ELA GLEQS Q FIWV++D  +G+    ++ 
Sbjct  243   LDWLNKQPPRSVIYVSFGTTTSFSDRQIKELAMGLEQSKQRFIWVLRDADRGHIFKREDR  302

Query  588   KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWP  767
             K  LP GFEERVEG GL++R+W PQ EIL H STGGF++HCGWNSC+ES+  GVP+A WP
Sbjct  303   KFELPEGFEERVEGVGLVVREWAPQPEILAHSSTGGFMSHCGWNSCLESITMGVPIAAWP  362

Query  768   IQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEA  947
             I  DQP N  L+TE+LK G+ ++DW  R+E+ + +TI N +R+LMAS EG+ +R +A E 
Sbjct  363   IHTDQPINGFLVTEILKIGLLVRDWGKREEVVSESTIENVVRKLMASEEGDLIRKRAEEL  422

Query  948   GRAVKESVMEGGISRLEMDNFIAHITR  1028
             G A+++S  +GG S++E+D+FIAHITR
Sbjct  423   GEAIRQSTEKGGASQIELDSFIAHITR  449



>ref|XP_010312121.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X5 [Solanum 
lycopersicum]
 ref|XP_010312122.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X5 [Solanum 
lycopersicum]
Length=382

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 211/352 (60%), Gaps = 38/352 (11%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF   S   E  +K L  PS           P   ++ + LP   + + 
Sbjct  58    NTECYCFHTISAFTALSFACEATKKPL--PS-----------PVAEIIAE-LPPKENTFD  103

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-VT  362
              E  ++I+ Q ++  F    L ++C+ IEG +++LL    +  R+   W IGP  PV ++
Sbjct  104   SETIEYIMMQHESRDFYSVGLHNSCKEIEGVFIELL----EEQRENKQWAIGPVYPVEIS  159

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             KR         S    H+C  WLDKQ   SVI+VSFG+ T LS  Q++ELA GLEQS Q 
Sbjct  160   KRK--------SSELTHECFSWLDKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQK  211

Query  543   FIWVVKDLTKG--------YKNTKINLPAGFEERVE--GRGLILRDWVPQLEILDHVSTG  692
             FIWV++   K          + +  +LP GFEER++  G G I ++W PQLEIL H S G
Sbjct  212   FIWVLRGADKKGGDNIENVERGSNSDLPDGFEERIKEKGVGFIEKNWAPQLEILAHGSIG  271

Query  693   GFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTST  872
             GF++HCGWNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+R E+ ++ 
Sbjct  272   GFMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRYELVSAA  331

Query  873   TIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              I+NA+R LM S EGEELR +  E   +VK+SVM G  SR EMD+F+AHITR
Sbjct  332   KIKNAVRFLMDSAEGEELRRRVTELSSSVKKSVMNGA-SRKEMDSFVAHITR  382



>ref|XP_004249235.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=437

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/290 (49%), Positives = 189/290 (65%), Gaps = 18/290 (6%)
 Frame = +3

Query  174   SCYPPEFFKFIVDQRKTNAFCK-GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFN  350
             S   PEF ++   Q +       GNL+++C  IEG YLD +A   + + +   W IGP N
Sbjct  161   SSVTPEFTEYSRVQFEFREIVNSGNLYNSCYEIEGLYLDFVAK--EKSARNKQWAIGPLN  218

Query  351   PVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQ  530
             PV          D  +    HKC+ WLD+Q P SVIFVSFGT T  SD Q+ ELA GLE+
Sbjct  219   PV-------KQFDKKNSLISHKCMNWLDEQEPNSVIFVSFGTTTTFSDEQIKELAIGLEK  271

Query  531   SGQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGF  698
             S Q FIWV+++  KG     ++ ++ LP G+EERV  RG+I+RDW PQLEIL H STGGF
Sbjct  272   SEQRFIWVLREADKGDIFTGESREVELPEGYEERVGKRGVIVRDWAPQLEILGHESTGGF  331

Query  699   LTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTI  878
             ++HCGWNSCMES+  GVP+  WP+  DQPRNA+L+TEVLK G+ ++DW  RDE+ +S  +
Sbjct  332   MSHCGWNSCMESISMGVPILAWPMHSDQPRNAVLVTEVLKIGVELRDWAKRDELVSSVAV  391

Query  879   RNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
                ++RLM S EG+E+R +  E    + +SV++GG S  EM +FIAHITR
Sbjct  392   AECVKRLMDSAEGDEMRQRVME----LSKSVVDGGGSGREMASFIAHITR  437



>ref|XP_009792172.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=484

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/296 (47%), Positives = 193/296 (65%), Gaps = 12/296 (4%)
 Frame = +3

Query  171   SSCYPPEFFKFIVDQRKTNAFCKG-NLFDACRAIEGPYLDLLAMVYK-LARKGPVWGIGP  344
             S   PP   K++  Q        G N+F  C+ I+G YLDL+   +K        WG+G 
Sbjct  191   SDSPPPLMVKYVEKQMSCAVNYSGLNIFSTCKPIDGIYLDLMQQAFKSYDEHWKTWGLGL  250

Query  345   F-NPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEG  521
             F NP+  ++N +  +D++S  PRH  L+WLDKQ P SV+ VSFG+    +D Q+ ELA G
Sbjct  251   FMNPLEMEQNIR--KDTTSTLPRHHLLQWLDKQEPNSVMLVSFGSAASFTDEQIRELALG  308

Query  522   LEQSGQNFIWVVKDLTKG--YKNTKIN-----LPAGFEERVEGRGLILRDWVPQLEILDH  680
             LEQS Q FIW++K+  +   + +  IN     LP G+EERVEGRG++ R W PQLE+L H
Sbjct  309   LEQSQQKFIWILKEADRANVFADENINRTTFALPEGYEERVEGRGMVERGWAPQLEVLGH  368

Query  681   VSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEI  860
              STGG+L HCGWNS MES+  GVP+A WP+  D PR A+L+T+ LK GI ++DW  R+E+
Sbjct  369   ASTGGYLCHCGWNSVMESISMGVPIAAWPLHTDHPRTALLLTKGLKIGIYVRDWARRNEL  428

Query  861   TTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               + TI NA++ LM SPEGE LR KAAE   AVK S M+GG ++ ++++F+++ITR
Sbjct  429   VKAETIHNAVKTLMDSPEGENLRQKAAELKDAVKASFMDGGATKKDIESFMSYITR  484



>ref|XP_010319528.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=435

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 187/267 (70%), Gaps = 14/267 (5%)
 Frame = +3

Query  240   GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKC  419
             G++ +  + IEG +LDLLA V    +K   W IGP  P      TK D+ S+ +     C
Sbjct  179   GDIHNTSKVIEGKFLDLLAQVASDQKKKN-WAIGPLLP------TKIDRISNKEDI---C  228

Query  420   LEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG----YKNT  587
             L+WL+KQPP+SV++VSFGT T  SD ++ ELA GLEQS Q FIWV++D  +G     +  
Sbjct  229   LDWLNKQPPRSVLYVSFGTTTSFSDREIKELAMGLEQSKQRFIWVLRDADRGDIFTEEAR  288

Query  588   KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWP  767
             ++ LP GFEERV+G GL++R+W PQ EIL H STGGF++HCGWNSC+ES+  GVP+A WP
Sbjct  289   RVELPEGFEERVKGVGLVVREWAPQPEILAHSSTGGFMSHCGWNSCIESITMGVPIAAWP  348

Query  768   IQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEA  947
             +  DQP    L+T+VLK G+ +++WE R+E+  ++TI + +R+LMAS EG  +R +A E 
Sbjct  349   MHSDQPMTGFLVTDVLKIGLIVREWEKREELVNASTIEDVVRKLMASEEGNVIRKRAEEL  408

Query  948   GRAVKESVMEGGISRLEMDNFIAHITR  1028
             G AV++S  +GG SR+E+D+FIAHITR
Sbjct  409   GEAVRQSTEKGGASRIELDSFIAHITR  435



>ref|XP_010910133.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Elaeis 
guineensis]
Length=471

 Score =   281 bits (720),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 204/350 (58%), Gaps = 31/350 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVL-RKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             N E Y F   SAF   S  W       L  P  L  ++ +                  C+
Sbjct  144   NAEVYAFNSVSAFFHLSFRWSFQDESALPKPKHLETILNQSF--------------DDCF  189

Query  183   PPEFFKFIVDQR--KTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV  356
               EF +F    R  + +   +G+L + CR IEG  +DLLA     + K  ++ IGPFNPV
Sbjct  190   TNEFLEFATMNRVLQDSVVAEGSLINTCRPIEGELVDLLAEDSFYSGKKKLFAIGPFNPV  249

Query  357   VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSG  536
              T       Q  S +  RH CLEWLDKQPP SV++VSFGT + + D Q++ELA GL +SG
Sbjct  250   TTP------QGDSGR--RHACLEWLDKQPPASVVYVSFGTASTMPDEQINELAIGLRRSG  301

Query  537   QNFIWVVKDLTKG------YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGF  698
             Q FIWV++D   G       ++ +  L   +E  VEG G+++R W PQLEIL H +TGGF
Sbjct  302   QRFIWVLRDADVGDIYAECVESRERKLSPDYEREVEGVGMVVRGWAPQLEILAHPATGGF  361

Query  699   LTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTI  878
             ++HCGWNSCMES+  GVP+  WP+  DQP N +L+TE LK G+  ++W+ R EI  +  I
Sbjct  362   ISHCGWNSCMESLSMGVPIMAWPMHSDQPGNTVLVTEYLKVGVVAREWDRRKEILPAGEI  421

Query  879   RNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               +I+R+M S EG+E+R +A   G AV+E+  EGG SR E+D+F+AH+TR
Sbjct  422   EESIKRVMVSEEGQEIRRRAKALGNAVREAASEGGSSRAELDSFVAHVTR  471



>ref|XP_010312120.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X4 [Solanum 
lycopersicum]
Length=421

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 211/352 (60%), Gaps = 38/352 (11%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF   S   E  +K L  PS           P   ++ + LP   + + 
Sbjct  97    NTECYCFHTISAFTALSFACEATKKPL--PS-----------PVAEIIAE-LPPKENTFD  142

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-VT  362
              E  ++I+ Q ++  F    L ++C+ IEG +++LL    +  R+   W IGP  PV ++
Sbjct  143   SETIEYIMMQHESRDFYSVGLHNSCKEIEGVFIELL----EEQRENKQWAIGPVYPVEIS  198

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             KR         S    H+C  WLDKQ   SVI+VSFG+ T LS  Q++ELA GLEQS Q 
Sbjct  199   KRK--------SSELTHECFSWLDKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQK  250

Query  543   FIWVVKDLTKG--------YKNTKINLPAGFEERVE--GRGLILRDWVPQLEILDHVSTG  692
             FIWV++   K          + +  +LP GFEER++  G G I ++W PQLEIL H S G
Sbjct  251   FIWVLRGADKKGGDNIENVERGSNSDLPDGFEERIKEKGVGFIEKNWAPQLEILAHGSIG  310

Query  693   GFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTST  872
             GF++HCGWNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+R E+ ++ 
Sbjct  311   GFMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRYELVSAA  370

Query  873   TIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              I+NA+R LM S EGEELR +  E   +VK+SVM G  SR EMD+F+AHITR
Sbjct  371   KIKNAVRFLMDSAEGEELRRRVTELSSSVKKSVMNGA-SRKEMDSFVAHITR  421



>ref|XP_010312119.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X3 [Solanum 
lycopersicum]
Length=434

 Score =   280 bits (715),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 211/352 (60%), Gaps = 38/352 (11%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF   S   E  +K L  PS           P   ++ + LP   + + 
Sbjct  110   NTECYCFHTISAFTALSFACEATKKPL--PS-----------PVAEIIAE-LPPKENTFD  155

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-VT  362
              E  ++I+ Q ++  F    L ++C+ IEG +++LL    +  R+   W IGP  PV ++
Sbjct  156   SETIEYIMMQHESRDFYSVGLHNSCKEIEGVFIELL----EEQRENKQWAIGPVYPVEIS  211

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             KR         S    H+C  WLDKQ   SVI+VSFG+ T LS  Q++ELA GLEQS Q 
Sbjct  212   KRK--------SSELTHECFSWLDKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQK  263

Query  543   FIWVVKDLTKG--------YKNTKINLPAGFEERVE--GRGLILRDWVPQLEILDHVSTG  692
             FIWV++   K          + +  +LP GFEER++  G G I ++W PQLEIL H S G
Sbjct  264   FIWVLRGADKKGGDNIENVERGSNSDLPDGFEERIKEKGVGFIEKNWAPQLEILAHGSIG  323

Query  693   GFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTST  872
             GF++HCGWNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+R E+ ++ 
Sbjct  324   GFMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRYELVSAA  383

Query  873   TIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              I+NA+R LM S EGEELR +  E   +VK+SVM G  SR EMD+F+AHITR
Sbjct  384   KIKNAVRFLMDSAEGEELRRRVTELSSSVKKSVMNGA-SRKEMDSFVAHITR  434



>ref|XP_004236911.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=470

 Score =   281 bits (718),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 187/267 (70%), Gaps = 14/267 (5%)
 Frame = +3

Query  240   GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKC  419
             G++ +  + IEG +LDLLA V    +K   W IGP  P      TK D+ S+ +     C
Sbjct  214   GDIHNTSKVIEGKFLDLLAQVASDQKKKN-WAIGPLLP------TKMDRISNRED---VC  263

Query  420   LEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNT----  587
             L+WLDKQPP+SV++VSFGT T  SD ++ ELA GLEQS Q FIWV++D  +G   T    
Sbjct  264   LDWLDKQPPRSVLYVSFGTTTSFSDREIKELAMGLEQSKQRFIWVLRDADRGDIFTEEAR  323

Query  588   KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWP  767
             ++ LP GFEERV+G GL++R+W PQ EIL H STGGF++HCGWNSC+ES+  GVP+A WP
Sbjct  324   RVELPEGFEERVKGVGLVVREWAPQPEILAHSSTGGFMSHCGWNSCIESITMGVPIAAWP  383

Query  768   IQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEA  947
             +  DQP    L+T+VLK G+ +++WE R+E+  ++TI + +R+LMAS EG+ +R +A E 
Sbjct  384   MHSDQPMTGFLVTDVLKIGLIVREWEKREEMVNASTIEDVVRKLMASEEGDVIRKRAEEL  443

Query  948   GRAVKESVMEGGISRLEMDNFIAHITR  1028
             G AV+ S  +GG SR+E+D+FIAHITR
Sbjct  444   GEAVRLSTEKGGASRMELDSFIAHITR  470



>ref|XP_009796346.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=463

 Score =   281 bits (718),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 185/267 (69%), Gaps = 14/267 (5%)
 Frame = +3

Query  240   GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKC  419
             G++ +  R IEG +LDLL  V     K   W IGP  P       K D  S++    + C
Sbjct  207   GDIHNTSRVIEGKFLDLLVEVTSTQNKKQ-WAIGPVLP------AKLDHVSNTN---NIC  256

Query  420   LEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNT----  587
             LEWL+KQPP+SV+++SFGT T  SD ++ ELA GLEQS Q FIWV++D  +G   T    
Sbjct  257   LEWLNKQPPRSVLYISFGTTTSFSDREIKELAMGLEQSKQRFIWVLRDADRGDIFTGEAR  316

Query  588   KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWP  767
             K+ LP GFEERV+  GL++R+W PQLEIL H STGGF++HCGWNSC+ES+  GVP+A WP
Sbjct  317   KVELPEGFEERVKEVGLVVREWAPQLEILAHSSTGGFMSHCGWNSCIESITMGVPIAAWP  376

Query  768   IQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEA  947
             +  DQP N  L+ E+LK G+ +++WE R+E+ +++TI N +R+LMAS EG+E+R +A E 
Sbjct  377   MHSDQPINGFLVMEILKIGLIVREWEKREELVSASTIENVVRKLMASEEGDEIRKRADEL  436

Query  948   GRAVKESVMEGGISRLEMDNFIAHITR  1028
             G AV+ S  + G SR+E+D+FIAHITR
Sbjct  437   GEAVRLSTEKRGASRMELDSFIAHITR  463



>ref|XP_006357999.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=470

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/349 (42%), Positives = 217/349 (62%), Gaps = 27/349 (8%)
 Frame = +3

Query  15    TYNFFVGSAFHDA-SLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVP------DRLPIPS  173
             +YN    ++ H+A S ++  +       SF+        +P G  +P       +LPI  
Sbjct  138   SYNVQDVTSLHNAESYIFNCVSVFFMYSSFI-------CVPNGMPIPLDEDLLKKLPILE  190

Query  174   SCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNP  353
                P E  K +  Q +      G+L+++ + +EG  LDL+        K   W IGP   
Sbjct  191   PDAPEEINKLVEFQLQFRDIRVGDLYNSNKLLEGTSLDLMEKFASTQNKKQ-WAIGPIF-  248

Query  354   VVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
             +  K +  +D+       R+KCL+WLD QPP+SV++VSFG+ T  SD ++ ELA GLE+S
Sbjct  249   LAAKVDHVSDK-------RNKCLDWLDNQPPRSVLYVSFGSSTTFSDKEVMELAMGLERS  301

Query  534   GQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
              Q F+WV++D  +G     +  +  LP GFEERVEG GL++R+W PQLEIL H STGGF+
Sbjct  302   KQKFVWVLRDGDRGNIFSEEARRFELPDGFEERVEGVGLVVREWAPQLEILAHSSTGGFM  361

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             +HCGWNSC+E +  GVP+A W +  +QP NA  +TE+LKTG+ +++W+  +E+ T++ I 
Sbjct  362   SHCGWNSCIECITAGVPMAAWAMHSEQPLNAFFVTEILKTGLLVREWKKHEELVTASAIE  421

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + +R+LMAS EG+E+R +A E G AV+ES+ +GG S+LE+D+FIAHITR
Sbjct  422   DVVRKLMASEEGDEIRRRAEELGAAVRESIEKGGASQLELDSFIAHITR  470



>gb|EYU37237.1| hypothetical protein MIMGU_mgv1a026906mg, partial [Erythranthe 
guttata]
Length=471

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/348 (42%), Positives = 207/348 (59%), Gaps = 28/348 (8%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF  A    ++L K L +                   P  LP    C  
Sbjct  147   NAESYVFNCISAFTKAVFTLDLLGKPLPIEH-----------------PKELPSFEGCIT  189

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              E   F+  Q +  ++  G+L++ CR IE  Y++L+     +  +   W IGP  P    
Sbjct  190   DEIRDFLALQFEPLSYRAGDLYNTCRLIEQDYMELIEKEEIVGSRKS-WAIGPILP----  244

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                K    ++     ++CLEWLDKQ   SVI+VSFGT T LSD Q+ ELA GLEQS   F
Sbjct  245   --AKLSSSANQSEIHNRCLEWLDKQEINSVIYVSFGTTTSLSDEQIKELAYGLEQSKVKF  302

Query  546   IWVVKDLTK----GYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
             +WV++D  K      +  +  LP GFEERVEG G+++R+W PQ +IL H STGGF++HCG
Sbjct  303   LWVLRDADKRDIFDGQVRRAELPDGFEERVEGVGMVVREWAPQPQILAHPSTGGFVSHCG  362

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSC+ES+  GVP+A WP+  DQP N++LITE+LK G+ ++DW+ R E+  ++ I+N ++
Sbjct  363   WNSCIESITMGVPIAAWPMHSDQPNNSVLITEILKMGLLVRDWKQRTELVKASIIKNILK  422

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR*NN  1037
              LMAS EG+ELR +A E    V ++  +GG S+LE+D+FI+HITR N+
Sbjct  423   ILMASKEGDELRKRAEELAATVYQATQQGGASKLELDSFISHITRGND  470



>ref|XP_006351401.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=409

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 189/290 (65%), Gaps = 18/290 (6%)
 Frame = +3

Query  174   SCYPPEFFKFIVDQRKTNAFCK-GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFN  350
             S   PEF ++   Q +       GNL+++C  IEG YLD LA   + + +   W IGP N
Sbjct  133   SSVTPEFTEYTRVQFEVREIVNSGNLYNSCYEIEGLYLDWLAK--EKSSRDKQWAIGPLN  190

Query  351   PVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQ  530
             PV          + ++    HKC+ WLD+Q P SVIFVSFGT T  SD Q+ E+A GLE+
Sbjct  191   PVKL-------YEKNNSLISHKCMNWLDEQEPNSVIFVSFGTTTTFSDEQIKEIAIGLEK  243

Query  531   SGQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGF  698
             S Q FIWV+++  KG     ++ ++ LP  +EERV  RGLI+RDW PQLEIL H STGGF
Sbjct  244   SEQRFIWVLREADKGNIFTGESREVELPERYEERVGKRGLIVRDWAPQLEILGHESTGGF  303

Query  699   LTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTI  878
             ++HCGWNSCMES+  GVP+  WP+  DQPRNA+L+TEVLK G+ ++DW  RDE+ +S  +
Sbjct  304   MSHCGWNSCMESISMGVPILAWPMHSDQPRNAVLVTEVLKIGVELRDWAKRDELVSSVAV  363

Query  879   RNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
                ++RLM S EG+E+R +  E    + +SV++GG S  EM +FIAHITR
Sbjct  364   AECVKRLMDSAEGDEMRKRVME----LSKSVVDGGGSGREMASFIAHITR  409



>ref|XP_004243014.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=453

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 195/313 (62%), Gaps = 20/313 (6%)
 Frame = +3

Query  102   LWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPY  281
              W  +GR     G  +P  +P    C+  E   F+  Q +   +  G++F++CR IEG Y
Sbjct  157   FWDAIGRPFPVEG--MPKNIPSMEGCFSFEIMNFMAYQYEFMQYRTGDIFNSCRLIEGTY  214

Query  282   LDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIF  461
             +DLL+ +   A K   W IGP             + SSS   RHK LEWLDKQ PKSV++
Sbjct  215   IDLLSKLEMNANKKQ-WSIGPI----------LQKGSSS---RHKSLEWLDKQGPKSVLY  260

Query  462   VSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNTKINLPAGFEERVEG  629
             +SFG+ T ++D Q+ ELA GLE S Q F+WV++D  KG     +  K  LP G++ER EG
Sbjct  261   ISFGSSTTMTDKQIQELAMGLENSKQKFLWVLRDADKGNIFDDETRKARLPEGYQERTEG  320

Query  630   RGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITE  809
              G+++ DW PQLEIL H S GGF++HCGWNSCMES+  GVP+  WP+  +QP NA LITE
Sbjct  321   TGIVVTDWAPQLEILGHTSIGGFMSHCGWNSCMESITMGVPILAWPMHSEQPWNATLITE  380

Query  810   VLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGIS  989
             +L+ GI + +   + E+  S+TI   + RLM S EGEELR+KA + GR V +S   GG+S
Sbjct  381   ILEVGIQVTEQAHQKELVNSSTIEKVVNRLMVSKEGEELRSKAEKLGRQVWQSRDGGGVS  440

Query  990   RLEMDNFIAHITR  1028
             +LE+ +FIA++ R
Sbjct  441   QLELSSFIAYLNR  453



>ref|XP_006366184.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=461

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 196/313 (63%), Gaps = 20/313 (6%)
 Frame = +3

Query  102   LWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPY  281
              W  +GR     G  +P  +P    C+  E   F+  Q +   +  G++F++CR IEG Y
Sbjct  165   FWDAIGRPFPVEG--MPKNIPSMEGCFSFEIMNFMAYQYEFMHYRTGDIFNSCRLIEGTY  222

Query  282   LDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIF  461
             +DLL+ +   A K   W IGP    + ++ + T         RHK LEWLDKQ   SV++
Sbjct  223   VDLLSKLEMNANKKQ-WSIGP----ILQKGSST---------RHKSLEWLDKQGQNSVLY  268

Query  462   VSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNTKINLPAGFEERVEG  629
             +SFG+ T ++D Q+ ELA GLE S Q F+WV++D  KG     +  K  LP G++ER EG
Sbjct  269   ISFGSSTTMTDKQIQELAMGLENSKQKFLWVLRDADKGNVFDDETRKARLPEGYQERTEG  328

Query  630   RGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITE  809
              G+++ DW PQLEIL H S GGF++HCGWNSCMESM  GVP+  WP+  +QP NA LI+E
Sbjct  329   TGIVVTDWAPQLEILGHTSIGGFMSHCGWNSCMESMTMGVPILAWPMHSEQPWNATLISE  388

Query  810   VLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGIS  989
             +L+ GI + +   + E   S+TI N + RLM S EGEELR++A + GR V +S  EGG+S
Sbjct  389   ILEVGIQVTEQAHQMEFVNSSTIENVVNRLMVSKEGEELRSRAEKLGRQVWQSRDEGGVS  448

Query  990   RLEMDNFIAHITR  1028
             +LE+ +F+AH++R
Sbjct  449   QLELSSFMAHLSR  461



>ref|XP_009400942.1| PREDICTED: zeatin O-xylosyltransferase-like [Musa acuminata subsp. 
malaccensis]
Length=475

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/318 (46%), Positives = 196/318 (62%), Gaps = 20/318 (6%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSS--CYPPEFFKFIVDQRKTNAFCKGNLFDACRAIE  272
             F W+L G+   PA  ++   LP  S+  C   +F  F++ Q++T     G L ++CRAIE
Sbjct  166   FRWELRGKPREPAVEIL--ELPHVSNEDCISQQFCDFVLSQQQTTVADSGRLINSCRAIE  223

Query  273   GPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKS  452
             G ++DL+A   +   K   + IGP NP+       T   +S    RH  +EWLD+QPP S
Sbjct  224   GMFIDLVAREPEWQDKK-TFAIGPLNPI-------TFNQASGNGARHPSIEWLDQQPPSS  275

Query  453   VIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDL--------TKGYKNTKINLPAG  608
             VI+VSFGT +  SD Q+ ELA GLE SGQ F+WV++D         T G    K  LP  
Sbjct  276   VIYVSFGTTSTFSDEQVAELAAGLEASGQRFLWVLRDADRADIYAETGGDAVEKEKLPLD  335

Query  609   FEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPR  788
             +  RVE RG ++R W PQ EIL H STGGF++HCGWNSCMES   GVP+  WP+  DQPR
Sbjct  336   YYTRVERRGKVVRGWAPQPEILAHPSTGGFMSHCGWNSCMESFSAGVPIVAWPMHSDQPR  395

Query  789   NAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKES  968
             NA+L+T+VL+ G  + DW+ R E+  S TI + I RLMAS EGEE+R +A E G  V+ +
Sbjct  396   NAVLVTDVLRVGFHVLDWDKRAELVASATISDVIERLMASKEGEEVRRRARELGGEVRRA  455

Query  969   VMEGGISRLEMDNFIAHI  1022
             + EGG S+ ++D F+ HI
Sbjct  456   MEEGGSSKTDLDAFVTHI  473



>ref|XP_009586605.1| PREDICTED: zeatin O-xylosyltransferase-like [Nicotiana tomentosiformis]
Length=471

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 191/295 (65%), Gaps = 14/295 (5%)
 Frame = +3

Query  156   RLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWG  335
             +LP        E  +F   Q+       G++ +  + IEG +LDLLA V    +K   W 
Sbjct  187   KLPSLQGIVTDEIREFGASQKPYMEIRSGDIHNTSKVIEGKFLDLLAQVTSEQKKKQ-WA  245

Query  336   IGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELA  515
             IGP  P      TK D  S      + CL+WL+KQPP+SV+++SFGT T  S  ++ ELA
Sbjct  246   IGPILP------TKLDHISKKN---NICLDWLNKQPPRSVLYISFGTTTSFSYREIKELA  296

Query  516   EGLEQSGQNFIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHV  683
              GLEQS Q FIWV++D  +G   T    K+ LP GFEERV+  GL++RDW PQ EIL H 
Sbjct  297   MGLEQSKQKFIWVLRDADRGDIFTGEARKVELPEGFEERVKEIGLVVRDWAPQPEILAHS  356

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             S GGF++HCGWNSC+ES+  GVP+A WP+  DQP+N  L+TE+LK G+ +++W  R+E+ 
Sbjct  357   SRGGFMSHCGWNSCIESITMGVPIAAWPMHSDQPKNGFLVTEILKIGMLVREWRKREELV  416

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             T++TI N +R+LMAS EG+ +R +A E G AV+ S  +GG SR E+D+FIAHITR
Sbjct  417   TASTIENVVRKLMASEEGDVIRKRAEELGEAVRRSTEKGGASRKELDSFIAHITR  471



>ref|XP_010312115.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010312116.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010312117.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010312118.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X2 [Solanum 
lycopersicum]
Length=457

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 211/352 (60%), Gaps = 38/352 (11%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF   S   E  +K L  PS           P   ++ + LP   + + 
Sbjct  133   NTECYCFHTISAFTALSFACEATKKPL--PS-----------PVAEIIAE-LPPKENTFD  178

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-VT  362
              E  ++I+ Q ++  F    L ++C+ IEG +++LL    +  R+   W IGP  PV ++
Sbjct  179   SETIEYIMMQHESRDFYSVGLHNSCKEIEGVFIELL----EEQRENKQWAIGPVYPVEIS  234

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             KR         S    H+C  WLDKQ   SVI+VSFG+ T LS  Q++ELA GLEQS Q 
Sbjct  235   KRK--------SSELTHECFSWLDKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQK  286

Query  543   FIWVVKDLTKG--------YKNTKINLPAGFEERVE--GRGLILRDWVPQLEILDHVSTG  692
             FIWV++   K          + +  +LP GFEER++  G G I ++W PQLEIL H S G
Sbjct  287   FIWVLRGADKKGGDNIENVERGSNSDLPDGFEERIKEKGVGFIEKNWAPQLEILAHGSIG  346

Query  693   GFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTST  872
             GF++HCGWNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+R E+ ++ 
Sbjct  347   GFMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRYELVSAA  406

Query  873   TIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              I+NA+R LM S EGEELR +  E   +VK+SVM G  SR EMD+F+AHITR
Sbjct  407   KIKNAVRFLMDSAEGEELRRRVTELSSSVKKSVMNGA-SRKEMDSFVAHITR  457



>ref|XP_008455780.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis melo]
Length=487

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 192/295 (65%), Gaps = 23/295 (8%)
 Frame = +3

Query  174   SCYPPEFFKFIVDQ-----RKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGI  338
             +C+P EF  FI  Q     +KT   C G +++ CR IEG  L L   + ++  +   W +
Sbjct  206   NCFPTEFLDFIKSQFDQLPKKT---C-GKIYNTCRVIEGSSLKL---IERIENEFNHWAL  258

Query  339   GPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAE  518
             GPFNPV   +  K  + SSSK   H C+ WLD+Q P+SV+++SFGT T + D Q+ E+A 
Sbjct  259   GPFNPV---KKLKNGERSSSK---HSCMSWLDQQEPRSVMYISFGTTTTVEDKQIKEIAI  312

Query  519   GLEQSGQNFIWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHV  683
             GL +S Q FIWV++D  KG       + K  LP G+ + +  RGL++R+W PQLEIL H 
Sbjct  313   GLARSHQKFIWVIRDADKGDIFHDDNDKKPKLPEGYNDLIGDRGLVIREWAPQLEILSHW  372

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             +TGGF+THCGWNSCMESM  GVP+A WP+  DQPRN +L+T +L+ G+ +KDW+  +E+ 
Sbjct  373   ATGGFMTHCGWNSCMESMTMGVPMAAWPMHSDQPRNTVLVTAILRVGVVVKDWDQGEEVV  432

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ++ T+  A++RL+ S EG E+R  A   G AV+ S+ +GG SR E++ F+ HITR
Sbjct  433   SALTVEEAVKRLIVSEEGAEIRMNAMRVGEAVRRSIEDGGDSRKELEAFVNHITR  487



>ref|XP_004249250.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X1 [Solanum 
lycopersicum]
Length=471

 Score =   279 bits (714),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 211/352 (60%), Gaps = 38/352 (11%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E Y F   SAF   S   E  +K L  PS           P   ++ + LP   + + 
Sbjct  147   NTECYCFHTISAFTALSFACEATKKPL--PS-----------PVAEIIAE-LPPKENTFD  192

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-VT  362
              E  ++I+ Q ++  F    L ++C+ IEG +++LL    +  R+   W IGP  PV ++
Sbjct  193   SETIEYIMMQHESRDFYSVGLHNSCKEIEGVFIELL----EEQRENKQWAIGPVYPVEIS  248

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             KR         S    H+C  WLDKQ   SVI+VSFG+ T LS  Q++ELA GLEQS Q 
Sbjct  249   KRK--------SSELTHECFSWLDKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQK  300

Query  543   FIWVVKDLTKG--------YKNTKINLPAGFEERVE--GRGLILRDWVPQLEILDHVSTG  692
             FIWV++   K          + +  +LP GFEER++  G G I ++W PQLEIL H S G
Sbjct  301   FIWVLRGADKKGGDNIENVERGSNSDLPDGFEERIKEKGVGFIEKNWAPQLEILAHGSIG  360

Query  693   GFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTST  872
             GF++HCGWNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+R E+ ++ 
Sbjct  361   GFMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRYELVSAA  420

Query  873   TIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              I+NA+R LM S EGEELR +  E   +VK+SVM G  SR EMD+F+AHITR
Sbjct  421   KIKNAVRFLMDSAEGEELRRRVTELSSSVKKSVMNGA-SRKEMDSFVAHITR  471



>ref|XP_009620405.1| PREDICTED: zeatin O-xylosyltransferase-like [Nicotiana tomentosiformis]
Length=360

 Score =   275 bits (703),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 184/267 (69%), Gaps = 14/267 (5%)
 Frame = +3

Query  240   GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKC  419
             G++ +  + IEG +LDL+  V     K   W IGP  P       K D  S+S    + C
Sbjct  104   GDIHNTSKVIEGKFLDLMVEVTSTQNKKQ-WAIGPTLP------AKLDYISNSN---NIC  153

Query  420   LEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNT----  587
             LEWL+KQPP+SV++VSFGT T  SD ++ ELA GLEQS   FIWV++D  +G   T    
Sbjct  154   LEWLNKQPPRSVLYVSFGTTTSFSDREIKELAMGLEQSKHRFIWVLRDADRGDIFTGEAR  213

Query  588   KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWP  767
             K+ LP GFEERV+  GL++R+W PQ EIL H STGGF++HCGWNSC+ES+  GVP+A WP
Sbjct  214   KVELPEGFEERVKDVGLVVREWAPQPEILAHSSTGGFMSHCGWNSCIESITMGVPIAAWP  273

Query  768   IQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEA  947
             +  DQ +N  L+TE+LK  + +++WE R+E+ +++TI N +R+LMAS EG+E+R +  E 
Sbjct  274   MHSDQLKNGFLVTEILKIDMIVREWEKREELVSASTIENVVRKLMASEEGDEIRKRVKEL  333

Query  948   GRAVKESVMEGGISRLEMDNFIAHITR  1028
             G AV++S  +GG SR+++D+FIAHITR
Sbjct  334   GEAVRQSTEKGGASRIQLDSFIAHITR  360



>ref|XP_008794220.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Phoenix 
dactylifera]
Length=471

 Score =   278 bits (712),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 134/292 (46%), Positives = 185/292 (63%), Gaps = 16/292 (5%)
 Frame = +3

Query  177   CYPPEFFKFIVDQR--KTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFN  350
             C+  EF +F+   R    +    G L + CR IEG  +DLLA       K  ++ IGP N
Sbjct  188   CFTNEFLEFVTTHRVLPDSIAADGGLMNTCRPIEGELVDLLAEDPFYRGKKKLFAIGPLN  247

Query  351   PVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQ  530
             PV T +             RH CLEWLDKQPP SV++VSFGT + + D Q++ELA G ++
Sbjct  248   PVTTPKGDGGR--------RHACLEWLDKQPPASVVYVSFGTTSTMLDEQINELAIGFQR  299

Query  531   SGQNFIWVVKDLTKG------YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTG  692
             SGQ FIWV++D   G       ++ +  LP  +E +VEG G+++R W PQLEIL H +TG
Sbjct  300   SGQRFIWVLRDADIGDIYAECEESRERKLPPDYERKVEGVGMVVRGWAPQLEILAHPATG  359

Query  693   GFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTST  872
             GF++HCGWNSCMES+  GVP+  WP+  DQP NA+L+TE LK G+  ++W  R EI  + 
Sbjct  360   GFMSHCGWNSCMESLSMGVPVMAWPMHSDQPSNAVLVTEFLKVGVVAREWARRKEILPAG  419

Query  873   TIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              I  +I+R+M S EG+E+R +A   G AV+E+  EGG SR E+D+FIAH++R
Sbjct  420   EIEESIKRVMVSQEGQEIRRRAKALGNAVREAASEGGSSRAELDSFIAHVSR  471



>gb|KGN54645.1| UDP-glucosyltransferase [Cucumis sativus]
Length=490

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 207/350 (59%), Gaps = 22/350 (6%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPA-GAVVPDRLPIPS--S  176
             N E+Y F   SAF   ++   + RK L V        G    P      P  L + S   
Sbjct  154   NTESYCFHSVSAF---TVAHSLERKELFVNDGYKD--GEITTPTYQQYFPKELNVVSMEQ  208

Query  177   CYPPEFFKFIVDQ-RKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNP  353
             C+PPEF +FI  Q R       G +++ CR IEG +L+++  +    R    W +GPFNP
Sbjct  209   CFPPEFLEFIGSQFRHLPKMGAGKIYNTCRVIEGEFLEVIQRIEPEFRH---WALGPFNP  265

Query  354   VVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
             +   +N   ++ SS     H C+ WLD+Q P+SVI++SFGT T ++D Q+ E+A GL +S
Sbjct  266   LKISKNGGNNKQSSCS---HSCMAWLDQQEPRSVIYISFGTTTAMTDEQIKEIAIGLARS  322

Query  534   GQNFIWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGF  698
              Q FIWV++D  KG      +  K NLP G+   +  +GL++RDW PQLEIL H +TGGF
Sbjct  323   DQKFIWVLRDADKGDVFDVNEIRKSNLPEGYSNLIGNQGLVIRDWAPQLEILSHWATGGF  382

Query  699   LTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTI  878
             +THCGWNSCMES+  GVP+  WP+  DQPRN +L+T VL  G+ +K+W+   E+  +  +
Sbjct  383   MTHCGWNSCMESITTGVPVIAWPMHSDQPRNTVLMTMVLCVGVALKEWQ--QELVIADAV  440

Query  879   RNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
                +R+LMAS EG E+R  A   G  V++S+ EGG SR E + FIAHITR
Sbjct  441   EEVVRKLMASEEGAEVRRNAERLGNVVRQSLEEGGESRQEFEAFIAHITR  490



>ref|XP_011075348.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=454

 Score =   278 bits (710),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 155/349 (44%), Positives = 207/349 (59%), Gaps = 37/349 (11%)
 Frame = +3

Query  3     QNHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCY  182
             QN E+Y F   S F+   ++WE + K + V                   P + P P S +
Sbjct  136   QNVESYAFNCVSGFNLFFVLWEAMGKPIQVEG-----------------PLKDPPPISEF  178

Query  183   PPE-FFKFIVDQRKTNAFCK--GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNP  353
              PE   KFIV    ++ F +  G++ + CR I+G Y+DLL+         P W I P   
Sbjct  179   MPEGVIKFIV----SSIFKERDGDIHNTCRLIDGAYIDLLSREEISGSTKPQWAIRPTLQ  234

Query  354   VVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
             V    N +         PRHKCLEWLDKQ P SVI+VSFGT T  S+ +  E+A GLEQS
Sbjct  235   VDLNANNEG-------KPRHKCLEWLDKQAPGSVIYVSFGTTTSFSNEEAGEIALGLEQS  287

Query  534   GQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFL  701
              Q FI V++D  K      +  KI LP GFEERV+  G+++RDW PQL+IL H STGGF+
Sbjct  288   KQKFILVLRDADKADIFAGEERKIELPEGFEERVQENGMVVRDWAPQLQILAHKSTGGFM  347

Query  702   THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
             THCGWNSC ES+  GVP+A WP+  DQP NA+ +T VLKTG+ +++W  R E+ T++ I+
Sbjct  348   THCGWNSCFESLWTGVPVAAWPMHSDQPLNALFLTRVLKTGLVVREWAQRKELVTASVIK  407

Query  882   NAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             N + RLMAS EG+E+R +A E   A+K S+ E G    E+ +FIAHITR
Sbjct  408   NVVERLMASKEGDEIRKRAEELSAAIKVSMDEAGCP--EIQSFIAHITR  454



>ref|XP_010319171.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=360

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 210/346 (61%), Gaps = 28/346 (8%)
 Frame = +3

Query  45    HDASLVWEV--LRKILHVPSFLWKLVGRFVL------PAGAVVP------DRLPIPSSCY  182
             HD+ + + V  +  +L+  S+++  +  F L      P G  V        +LP      
Sbjct  25    HDSLMSYNVQDVSSLLNAESYVFNCISVFTLYCFLSLPMGMHVQLEEGLLKKLPSIEGTL  84

Query  183   PPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVT  362
               +       QR       G++ +  + I+G +LDLL  V  +  K   W IGP  P+  
Sbjct  85    TDKIKNLGASQRPYMDIRSGDIHNTSKVIKGEFLDLLVQVASIKEKKQ-WAIGPILPM--  141

Query  363   KRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQN  542
             K +   +++         CLEWL+KQPP+SV++ SFGT T  SD ++ ELA GLEQS Q 
Sbjct  142   KLDYVLNKNDI-------CLEWLNKQPPRSVLYASFGTTTSFSDREIKELAMGLEQSKQR  194

Query  543   FIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             F+WV++D  +G   T    ++ LP GFEERV+G GL++R+W PQ EIL H STGGF++HC
Sbjct  195   FLWVLRDADRGDIFTGGARRLELPEGFEERVKGVGLVVREWAPQPEILAHSSTGGFMSHC  254

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+  GVP+A WP+  DQP N  L+TE+LK G+ +++WE R+E+ +++TI N +
Sbjct  255   GWNSCIESITMGVPIAAWPMHSDQPNNGFLVTELLKIGLIVREWEKREELVSASTIENVV  314

Query  891   RRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             R+LMAS EG+ +R +A E    V+ S  +GG SR+E+D+FIA+ITR
Sbjct  315   RKLMASEEGDAIRKRAEELRETVRRSTEKGGASRMELDSFIAYITR  360



>gb|KCW90136.1| hypothetical protein EUGRSUZ_A02328, partial [Eucalyptus grandis]
Length=462

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 195/343 (57%), Gaps = 35/343 (10%)
 Frame = +3

Query  6    NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLP------AGAVVPDRLPI  167
            N E Y F   SAF   +L W           F W+ +G    P         +     P 
Sbjct  140  NAEIYEFNPISAF---TLCW-----------FTWESIGMAPPPEVEIDIVELIASKGFPS  185

Query  168  PSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPF  347
            P      EF KF   Q +   F  G + + CR +EG ++DL A           W IGPF
Sbjct  186  PLDSSTDEFLKFAASQNECKKFHSGCIHNTCRVVEGRFVDLYASATANGTATKHWAIGPF  245

Query  348  NPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLE  527
            NPV          +  S+   H C+EWLDKQ   SV++VSFGT TVLSD Q+ E+A GLE
Sbjct  246  NPVKVP-------EKRSRRSAHGCMEWLDKQATSSVMYVSFGTTTVLSDEQIREIAMGLE  298

Query  528  QSGQNFIWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHV  683
             SGQ FIWV+++  K      G +   I LP GFEE V  R  G+++RDW PQLEIL H 
Sbjct  299  YSGQKFIWVLREADKVDIFSGGGEARIIQLPQGFEEMVAARDLGVVVRDWAPQLEILGHP  358

Query  684  STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
            +TGGFL+HCGWNSCMES+  GVP+  WP+  DQP NA+LIT VLK G+ +KD  S+D++ 
Sbjct  359  ATGGFLSHCGWNSCMESISMGVPILAWPMHSDQPWNAVLITRVLKIGLIVKDLMSQDDLV  418

Query  864  TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISR  992
             S++I  A++ LM S EGEE R +AAE G AV+ S+ EGG+SR
Sbjct  419  KSSSIEGAVKALMVSEEGEEARKRAAELGAAVRGSMDEGGVSR  461



>ref|XP_009766031.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=472

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/295 (48%), Positives = 191/295 (65%), Gaps = 14/295 (5%)
 Frame = +3

Query  156   RLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWG  335
             +LP        E  +F   Q+       G++ +  + IEG +LDLL +V    +K   W 
Sbjct  188   KLPSLEGIMTDEVREFGASQKPYMEIRSGDIHNTSKVIEGKFLDLLTLVTSEQKKKQ-WA  246

Query  336   IGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELA  515
             IGP  P      TK D  S+     + CL+WL KQPP+SV++VSFGT T  S  ++ ELA
Sbjct  247   IGPILP------TKLDHISNRN---NICLDWLKKQPPRSVLYVSFGTTTSFSYREIKELA  297

Query  516   EGLEQSGQNFIWVVKDLTKGYKNT----KINLPAGFEERVEGRGLILRDWVPQLEILDHV  683
              GLEQS Q FIWV++D  +G   T    K+ LP GFEERV+  GL++R W PQ EIL H 
Sbjct  298   MGLEQSKQKFIWVLRDADRGDIFTGEARKVELPEGFEERVKEVGLVVRYWAPQPEILAHS  357

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             STGGF++HCGWNSC+ES+  GVP+A WP+  DQP+N  L+TE+LKTG+ +++W  R E+ 
Sbjct  358   STGGFMSHCGWNSCIESITMGVPIAAWPMHSDQPKNGFLVTEILKTGMLVREWGKRGELV  417

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             T++TI+N +R+LMAS EG+ +R +A E G AV+ S  +GG SR E+D FIAHITR
Sbjct  418   TASTIQNVVRKLMASEEGDVIRKRAEELGEAVRRSTEKGGASRKELDAFIAHITR  472



>ref|XP_004243637.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=456

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 202/316 (64%), Gaps = 27/316 (9%)
 Frame = +3

Query  123   FVLPAGAVVPDRLPIPSSCYPPE----FFKFIVDQRKTNAFCKGNLFDACRAIEG-PYLD  287
             F +P    +  RLP    CY PE      K++      NA   G++F+  + I+G   +D
Sbjct  154   FPIPLEEALLKRLPSNDGCYNPEDVEHHAKYLNHCMGKNA---GDIFNTSQVIDGTAIVD  210

Query  288   LLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVS  467
              +A +  +  K  +W +GP   ++T       QD      +H CL+WL+KQPPKSVI+VS
Sbjct  211   SMANLATMQNKK-LWALGPI--LLT-------QDHDKVQTKHFCLDWLNKQPPKSVIYVS  260

Query  468   FGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG---------YKNTKINLPAGFEER  620
             FGT T  S  Q+ ELA GLE S Q FIWV+++   G          ++  + LP GFEER
Sbjct  261   FGTSTSFSAEQIKELAIGLELSKQKFIWVLRNADVGDPVNNKCEENRSGTLELPEGFEER  320

Query  621   VEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAIL  800
             V+G GL++R+W PQ EI  H STGGF++HCGW SC+ES+  GVP+A WPIQ+DQP+NA L
Sbjct  321   VKGVGLVVREWAPQQEIFAHPSTGGFMSHCGWTSCLESIIEGVPIAAWPIQFDQPKNAFL  380

Query  801   ITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEG  980
             + EVLK G+ +++WE R+E+ T++T++N + +LMAS EG+ +R +A E   AVK S  EG
Sbjct  381   VAEVLKIGLHVREWEQRNELVTASTVQNIVCKLMASEEGDMIRKRAQELRTAVKRSTEEG  440

Query  981   GISRLEMDNFIAHITR  1028
             G+SR+E+D+FIAHITR
Sbjct  441   GVSRMELDSFIAHITR  456



>ref|XP_006350268.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=474

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 196/301 (65%), Gaps = 17/301 (6%)
 Frame = +3

Query  138   GAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLAR  317
             G  +  +LP      P EF  FI  QR       G++ +    IEG +LDLLA V    +
Sbjct  187   GEELLKKLPPLEGTLPDEFNSFIALQRLYMDIRSGDIHNTSNLIEGEFLDLLAQVDSKQQ  246

Query  318   KGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDH  497
                 W IGP  P  TK N  +++++        CLEWL+KQ P+SV+++SFGT T  SD 
Sbjct  247   ----WVIGPILP--TKLNHISNRNN-------ICLEWLNKQSPRSVLYISFGTSTTFSDR  293

Query  498   QLHELAEGLEQSGQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQL  665
             ++ ELA GLEQS Q FIW++++  +G     +  K  LP GFEERV+G GL+LR+W PQ 
Sbjct  294   EVMELAMGLEQSKQKFIWMLREADRGDIFIGEARKFELPEGFEERVKGVGLVLREWAPQP  353

Query  666   EILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWE  845
             EIL H STGGF++HCGWNS +ES+  GVP+A WP+  DQP N  L+TE+LK G+ +++W+
Sbjct  354   EILAHSSTGGFMSHCGWNSFLESITMGVPIAAWPMHGDQPNNGFLVTEMLKIGLIVREWD  413

Query  846   SRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
               +E+ +++TI N +R+LMAS EG+ +R +A E G A++ S  +GG SR+E+D+FIAHIT
Sbjct  414   KHEELVSASTIENVVRKLMASEEGDAIRKRAEELGEAIRRSTEKGGSSRIELDSFIAHIT  473

Query  1026  R  1028
             R
Sbjct  474   R  474



>gb|KHN08928.1| Zeatin O-glucosyltransferase [Glycine soja]
Length=240

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 168/239 (70%), Gaps = 15/239 (6%)
 Frame = +3

Query  327   VWGIGPFNPV-VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQL  503
             +W +GPFNP+ + K+ +K          RH C+EWLDKQ P SVI+VSFGT T   + Q+
Sbjct  10    IWALGPFNPLAIEKKESK---------GRHLCMEWLDKQDPNSVIYVSFGTTTSFKEDQI  60

Query  504   HELAEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLE  668
              ++A GLEQS Q FIWV++D  KG      +  +  LP GFEER++G GLI+RDW PQLE
Sbjct  61    EQIATGLEQSKQKFIWVLRDADKGDIFDGNETKRYELPNGFEERIKGIGLIVRDWAPQLE  120

Query  669   ILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWES  848
             IL H STGGF++HCGWNSC+ES+  GVP+A+WP+  DQPRN +LIT+VLK G+ +KDW  
Sbjct  121   ILSHTSTGGFMSHCGWNSCLESITMGVPIASWPMHSDQPRNTVLITQVLKVGLVVKDWAQ  180

Query  849   RDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
             R+ + T++ +   +RRL+ + EG+E+R +A     A+  S  EGG+S LEM++FIAHIT
Sbjct  181   RNALVTASVVEKVVRRLIETEEGDEIRQRAVRLKNAIHRSKDEGGVSHLEMESFIAHIT  239



>ref|XP_004236910.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=447

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 184/263 (70%), Gaps = 10/263 (4%)
 Frame = +3

Query  240   GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKC  419
             G++ +  + IE  Y+D +    +L+     W IGP  P      TK D  S+ +     C
Sbjct  195   GDIHNTSKVIERKYIDSMEQA-ELSLNKKQWAIGPILP------TKLDYISNKEDV---C  244

Query  420   LEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNTKINL  599
             L+WL+KQPP+SV++VSFGT T LSD Q+ ELA GLEQS Q FIWV++D  +G  + K+ L
Sbjct  245   LDWLNKQPPRSVLYVSFGTTTSLSDRQIKELAMGLEQSKQRFIWVLRDADRGDIDRKVEL  304

Query  600   PAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYD  779
             P GFEERV+G GL++R+W PQL+IL H STGGF++HC W SC+ES+  GVP+  WPI  +
Sbjct  305   PQGFEERVKGVGLVVREWTPQLQILAHSSTGGFMSHCDWTSCLESITMGVPIGVWPIHTN  364

Query  780   QPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAV  959
             QP N  L+T++LK G+ ++DW  R+E+ +++TI+N +R+LMAS EG+ +R +A E G AV
Sbjct  365   QPINGFLVTDILKVGLLVRDWGKREEVVSASTIQNVVRKLMASEEGDTIRKRAEELGEAV  424

Query  960   KESVMEGGISRLEMDNFIAHITR  1028
             ++S  +GG  ++E+D+FIAHITR
Sbjct  425   RQSTEKGGAFQIELDSFIAHITR  447



>ref|XP_004169069.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
Length=491

 Score =   277 bits (708),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/290 (45%), Positives = 185/290 (64%), Gaps = 14/290 (5%)
 Frame = +3

Query  177   CYPPEFFKFIVDQ-RKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNP  353
             C+PPEF +FI  Q R       G +++ CR IEG +L+++  +    R    W +GPFNP
Sbjct  210   CFPPEFLEFIGSQFRHLPKMGAGKIYNTCRVIEGEFLEVIQRIEPEFRH---WALGPFNP  266

Query  354   VVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
             +   +N   ++ SS     H C+ WLD+Q P+SVI++SFGT T ++D Q+ E+A GL +S
Sbjct  267   LKISKNGGNNKQSSCS---HSCMAWLDQQEPRSVIYISFGTTTAMTDEQIKEIAIGLARS  323

Query  534   GQNFIWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGF  698
              Q FIWV++D  KG      +  K NLP G+   +  +GL++RDW PQLEIL H +TGGF
Sbjct  324   DQKFIWVLRDADKGDVFDVNEIRKSNLPEGYSNLIGNQGLVIRDWAPQLEILSHWATGGF  383

Query  699   LTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTI  878
             +THCGWNSCMES+  GVP+  WP+  DQPRN +L+T VL  G+ +K+W+   E+  +  +
Sbjct  384   MTHCGWNSCMESITTGVPVIAWPMHSDQPRNTVLMTMVLCVGVALKEWQ--QELVIADAV  441

Query  879   RNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
                +R+LM S EG E+R  A   G  V++S+ EGG SR E + FIAHITR
Sbjct  442   EEVVRKLMVSEEGAEVRRNAERLGNVVRQSLEEGGESRQEFEAFIAHITR  491



>gb|KCW90115.1| hypothetical protein EUGRSUZ_A02308, partial [Eucalyptus grandis]
Length=440

 Score =   275 bits (703),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 146/327 (45%), Positives = 187/327 (57%), Gaps = 23/327 (7%)
 Frame = +3

Query  6    NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
            N E Y F   SAF   S  WE  R  +  P  +   +   +   G       P       
Sbjct  129  NAEIYEFKTISAFTLCSFKWE--RIGMAPPPEVELDIAELISSKG------FPSIQDSST  180

Query  186  PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             EF KF   Q++      G +++ CR +EG ++DL A           W IGPFNPV   
Sbjct  181  DEFLKFRASQKECKKLNSGCIYNTCRVVEGRFVDLYASATANGTATKHWAIGPFNPVKVP  240

Query  366  RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
              T T          H C+EWLDKQ P SVI+VSFGT T LSD Q+ E+A GLE+SGQ F
Sbjct  241  EKTSTRS-------AHWCMEWLDKQAPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKF  293

Query  546  IWVVKDLTK------GYKNTKINLPAGFEERVEGR--GLILRDWVPQLEILDHVSTGGFL  701
            IWV+++  K      G +   I LP GFEE    R  G+++RDW PQLEIL H +TGGFL
Sbjct  294  IWVLREADKADIFGGGGEARIIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGGFL  353

Query  702  THCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIR  881
            +HCGWNSCMES+  GVP+  WP+  DQPRNA+LIT VLK G+ +KDW S+D++  S+ I 
Sbjct  354  SHCGWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVKDWMSQDDVVKSSIIE  413

Query  882  NAIRRLMASPEGEELRNKAAEAGRAVK  962
             A++ LM + EGEE R +AAE G AV+
Sbjct  414  GAVKALMVTEEGEEARKRAAELGAAVR  440



>ref|XP_004236593.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=470

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/319 (44%), Positives = 202/319 (63%), Gaps = 19/319 (6%)
 Frame = +3

Query  84    LHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACR  263
             L++  F+ +  G+ V   G  +  +LP      P E   F   Q        G++ +  +
Sbjct  167   LNMYCFVCRFRGKPV-QLGEELLKKLPDLEGGIPDEMRDFTAIQSPHMGIRSGDILNTSK  225

Query  264   AIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQP  443
              IEG +L+LL    K       W IGP  P      TK D  S+     + CLEWL+KQP
Sbjct  226   VIEGDFLELLVEESKQQ-----WAIGPILP------TKLDHISNRN---NICLEWLNKQP  271

Query  444   PKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNT----KINLPAGF  611
             P+SV++VSFGT ++ SD ++ ELA GLEQS   FIWV+++  +G   T    K+ LP GF
Sbjct  272   PRSVLYVSFGTTSIFSDREVIELAMGLEQSRHKFIWVLREADRGDIFTGEARKLELPEGF  331

Query  612   EERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRN  791
             EERV+G GL++R+W PQ EIL H STGGF++HCGWNSC+ES+  GVP+A WP+  DQP+N
Sbjct  332   EERVKGVGLVMREWAPQPEILAHSSTGGFMSHCGWNSCIESITMGVPIAAWPMHADQPKN  391

Query  792   AILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESV  971
               L+TE+LK G+ +++W+ R E+ +++T+ N +R+LMAS EG+ +R +A E   +V+ S 
Sbjct  392   GFLVTEILKIGLTVREWDKRAELVSASTVENVVRKLMASEEGDAIRKRAEELAESVRRST  451

Query  972   MEGGISRLEMDNFIAHITR  1028
              +GG SR+E+D+FIAHITR
Sbjct  452   EKGGSSRIELDSFIAHITR  470



>ref|XP_009774568.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=275

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/282 (46%), Positives = 185/282 (66%), Gaps = 11/282 (4%)
 Frame = +3

Query  195   FKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNT  374
               F+  Q +   +  G++F++CR IEG Y+D+L  +   A K   W IGP  P +T    
Sbjct  1     MNFMAYQYEFMHYRSGDIFNSCRLIEGTYVDMLNKLEMNANKKQ-WAIGPVLPDLTMVAG  59

Query  375   KTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWV  554
             K  ++      RHK LEWLDKQ PKSV+++SFG+ T ++D Q+ ELA GLE+S Q F+WV
Sbjct  60    KDSRN------RHKSLEWLDKQAPKSVLYISFGSATTMTDEQIQELAMGLEKSKQKFLWV  113

Query  555   VKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNS  722
             ++D  KG     +  K  +P G+EER+EG G+++ DW PQLEIL H S GGF++HCGWNS
Sbjct  114   LRDADKGNVFDGETRKARIPKGYEERMEGIGMVVTDWAPQLEILGHTSIGGFMSHCGWNS  173

Query  723   CMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLM  902
             CMES+  GVP+  WP+  +QP NA LI ++L+ GIP  +   + E+  S TI   + RLM
Sbjct  174   CMESITMGVPILAWPMHSEQPWNASLIIDILEVGIPATEEAHQMELVNSLTIEKVVNRLM  233

Query  903   ASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              S +G+E+R+ A   GR V +S  EGGIS+LE+++FIAHI+R
Sbjct  234   VSKKGKEMRSGAENLGREVWQSRNEGGISQLELNSFIAHISR  275



>ref|XP_004241956.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=467

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/351 (42%), Positives = 215/351 (61%), Gaps = 32/351 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N + Y+F   S+F    + +  LR+++H+     +   + +   G    D  P   S + 
Sbjct  136   NIKCYSFHSISSF----VSYSTLRQVVHIVD---EDQDKLIQELG----DEFPTVESTFG  184

Query  186   PEFFKFIVDQR--KTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             P   ++I ++R  K N+   G + ++ R  EG YLD LA+        PVW +GPF+ ++
Sbjct  185   PHLEEYIQEEREWKLNS---GVVMNSFREFEGKYLDSLAI--HAEDNMPVWCLGPFHMLL  239

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                  ++   S +++ RH  LE+LDKQ   SVIFVSFGT T LS  Q++E+A GLEQS  
Sbjct  240   -----QSSVVSCNRSVRHVSLEFLDKQDAISVIFVSFGTTTTLSQEQVNEVALGLEQSNY  294

Query  540   NFIWVVKDL---------TKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTG  692
              FIWVV+D              K+ ++ LP GFE+RVEGRG+++R+W PQLEIL H STG
Sbjct  295   KFIWVVRDADDKRLDAENNSERKDGRVVLPEGFEKRVEGRGIVVRNWAPQLEILGHTSTG  354

Query  693   GFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTST  872
             GF++HCGWNSC+ES+  GVP+A+WP+  DQP N + IT VLK GI +  W  R+EI  + 
Sbjct  355   GFMSHCGWNSCLESISMGVPIASWPVHVDQPYNTVFITNVLKIGISVWKWSRREEIVPAA  414

Query  873   TIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
              I  A++ LM++PEGEE+R +A E    +K SV  GG++R EM++FI++IT
Sbjct  415   AIEKAVKTLMSTPEGEEMRQRAVELSNKIKNSVSHGGLARKEMESFISNIT  465



>ref|XP_010090213.1| Zeatin O-xylosyltransferase [Morus notabilis]
 gb|EXB39082.1| Zeatin O-xylosyltransferase [Morus notabilis]
Length=482

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 186/269 (69%), Gaps = 10/269 (4%)
 Frame = +3

Query  240   GNLFDACRAIEGPYLD-LLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHK  416
             G+L++ CR +E  +LD +L M  +      +W IGP   V + +N   ++ +      HK
Sbjct  217   GHLYNTCRLLESTFLDFMLEMNRESDENVKMWAIGPLKTVTSFKNRSPNRVNG----EHK  272

Query  417   CLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG--YKNTK  590
             CLEWLDKQ   SV+++SFGT T + D Q+ ELA GLE+SG  F+WV++D  KG  +   +
Sbjct  273   CLEWLDKQESNSVLYISFGTTTFMKDEQIRELAVGLEKSGVKFLWVLRDADKGNVFDEGE  332

Query  591   I---NLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLAT  761
             +    LP GFE+RV+ +G+++RDW PQLEIL H STGGF++HCGWNSC+ES+  GVP+A 
Sbjct  333   VRRPQLPQGFEDRVKEKGIVVRDWAPQLEILGHSSTGGFMSHCGWNSCLESISLGVPIAA  392

Query  762   WPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAA  941
             W +  DQP NA+L+T++LK G+ I++W  +DE+ +S+ +   ++RLM S EG E+R +A 
Sbjct  393   WSMHSDQPINAVLMTDLLKIGVVIREWAKKDELVSSSVVEEFVKRLMKSEEGNEVRKRAE  452

Query  942   EAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             E G  ++++  +GG+SRLE+D+FIAHITR
Sbjct  453   ELGYELRKATAQGGVSRLELDSFIAHITR  481



>gb|KHN43714.1| Zeatin O-glucosyltransferase [Glycine soja]
Length=240

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 169/239 (71%), Gaps = 13/239 (5%)
 Frame = +3

Query  327   VWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLH  506
             +W +GPFNP+  ++     +DS     RH CLEWLDKQ P SV++VSFGT T   + Q+ 
Sbjct  10    LWALGPFNPLAFEK-----KDSKE---RHFCLEWLDKQDPNSVLYVSFGTTTTFKEEQIK  61

Query  507   ELAEGLEQSGQNFIWVVKDLTKGY----KNTKIN-LPAGFEERVEGRGLILRDWVPQLEI  671
             ++A GLEQS Q FIWV++D  KG        K N     FEERVEG GL++RDW PQLEI
Sbjct  62    KIATGLEQSKQKFIWVLRDADKGDIFDGSEAKWNEFSNEFEERVEGMGLVVRDWAPQLEI  121

Query  672   LDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESR  851
             L H STGGF++HCGWNSC+ES+  GVP+A WP+  DQPRN++LITEVLK G+ +K+W  R
Sbjct  122   LSHTSTGGFMSHCGWNSCLESISMGVPIAAWPMHSDQPRNSVLITEVLKIGLVVKNWAQR  181

Query  852   DEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             + + +++ + NA+RRLM + EG+++R +A      +  S+ EGG+SR+E+D+FIAHIT+
Sbjct  182   NALVSASNVENAVRRLMETKEGDDMRERAVRLKNVIHRSMDEGGVSRMEIDSFIAHITK  240



>gb|KGN54644.1| hypothetical protein Csa_4G415920 [Cucumis sativus]
Length=489

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 191/295 (65%), Gaps = 23/295 (8%)
 Frame = +3

Query  174   SCYPPEFFKFIVDQ-----RKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGI  338
             S +  EF+  I  Q     +KT   C G +++ CR IEG  L L+    ++  K   W +
Sbjct  208   SWFSVEFWDLIKSQFGQLPKKT---C-GQIYNTCRVIEGSSLKLIE---RIESKLNNWAL  260

Query  339   GPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAE  518
             GPFNPV   +  K  + SSSK   H C+ WLD+Q P+SVI++SFGT T + D Q++E+A 
Sbjct  261   GPFNPV---KKLKNGERSSSK---HSCMSWLDQQEPRSVIYISFGTTTTMEDKQINEIAI  314

Query  519   GLEQSGQNFIWVVKDLTK-----GYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHV  683
             GL +S Q FIWV++D  K        N +  LP G+ + +  RGLI+R+W PQLEIL H 
Sbjct  315   GLARSHQKFIWVIRDADKVDIFHEDNNKRSKLPEGYNDLIGDRGLIIREWAPQLEILSHW  374

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             +TGGF+THCGWNSC+ES+  GVP+A WP+  DQPRN +L+TE+L+ G+ +KDWE ++E+ 
Sbjct  375   ATGGFMTHCGWNSCLESITMGVPMAAWPMHSDQPRNMVLVTEILRVGLVVKDWELKEEVV  434

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ++ T+   +RRLM S +G E+R  A   G AV+ S+ +GG SR E++ F+ HITR
Sbjct  435   SALTVEETVRRLMVSEDGAEIRMNAMRVGEAVRRSIEDGGDSRKELEAFVNHITR  489



>ref|XP_004239467.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=444

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 145/298 (49%), Positives = 190/298 (64%), Gaps = 28/298 (9%)
 Frame = +3

Query  159   LPIPSSCYPP---EFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPV  329
             +P   SC+ P   E  K + D +    F  G + ++CR IEG Y+D L          P 
Sbjct  165   IPSIESCFKPGMEELTKMLRDCK----FKCGEILNSCREIEGRYIDELCK----QSATPF  216

Query  330   WGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHE  509
             WG+GPFNPV   RN       S KT  H+C++WLDKQP  SVIFVSFGT    S  Q+HE
Sbjct  217   WGLGPFNPVNIVRN-------SDKT--HRCIDWLDKQPVNSVIFVSFGTANSFSIEQIHE  267

Query  510   LAEGLEQSGQNFIWVVKDLTK-----GYKNTKINLPAGFEERVEGRGLILRDWVPQLEIL  674
             +A GLE+S Q FIWV++   K     G    K++LP GFE+RVE RG+I R+WVPQLEIL
Sbjct  268   IAIGLERSEQRFIWVLRGKDKKGEKVGDSIEKMDLPNGFEQRVENRGIIAREWVPQLEIL  327

Query  675   DHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRD  854
              H STGG+L H GWNS +ES   GVP+ATWP+  D P N +LIT+VLK G+ ++DW +++
Sbjct  328   AHRSTGGYLFHSGWNSFLESASMGVPMATWPLNSDNPYNDVLITKVLKVGLVVRDWVNKN  387

Query  855   EITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             E+     I + +R LM S EG+E+RN+A E  RA+K+SV +GG    +MD FIAHIT+
Sbjct  388   ELIKHEIIESGVRTLMDSAEGKEMRNRAIELSRAIKKSVGDGG---SQMDTFIAHITQ  442



>ref|XP_004150609.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
Length=465

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 190/295 (64%), Gaps = 26/295 (9%)
 Frame = +3

Query  174   SCYPPEFFKFIVDQ-----RKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGI  338
             S +  EF+  I  Q     +KT   C G +++ CR IEG  L L+    ++  K   W +
Sbjct  187   SWFSVEFWDLIKSQFGQLPKKT---C-GQIYNTCRVIEGSSLKLIE---RIESKLNNWAL  239

Query  339   GPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAE  518
             GPFNPV      K  + SSSK   H C+ WLD+Q P+SVI++SFGT T + D Q++E+A 
Sbjct  240   GPFNPV------KKLKRSSSK---HSCMSWLDQQEPRSVIYISFGTTTTMEDKQINEIAI  290

Query  519   GLEQSGQNFIWVVKDLTK-----GYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHV  683
             GL +S Q FIWV++D  K        N +  LP G+ + +  RGLI+R+W PQLEIL H 
Sbjct  291   GLARSHQKFIWVIRDADKVDIFHEDNNKRSKLPEGYNDLIGDRGLIIREWAPQLEILSHW  350

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             +TGGF+THCGWNSC+ES+  GVP+A WP+  DQPRN +L+TE+L+ G+ +KDWE ++E+ 
Sbjct  351   ATGGFMTHCGWNSCLESITMGVPMAAWPMHSDQPRNMVLVTEILRVGLVVKDWELKEEVV  410

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ++ T+   +RRLM S +G E+R  A   G AV+ S+ +GG SR E++ F+ HITR
Sbjct  411   SALTVEETVRRLMVSEDGAEIRMNAMRVGEAVRRSIEDGGDSRKELEAFVNHITR  465



>gb|EYU18707.1| hypothetical protein MIMGU_mgv1a005868mg [Erythranthe guttata]
Length=467

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 203/347 (59%), Gaps = 33/347 (10%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   S F     V E++ K   + S                 P  LP  +SC  
Sbjct  148   NAESYAFNCLSGFFQVFFVHELMGKKCSLKS-----------------PKELPTVASCIT  190

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
              +  +FI  Q +   + KG+L++ CR +E P+LD+L    ++A     W IGP  P    
Sbjct  191   KDLMRFIFSQNQALGYRKGDLYNTCRLLEAPFLDILES-EEVAGNRKSWAIGPLIPATK-  248

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                      SS   +H CL WLDKQ PKSV++V+FGT T L+D ++  LA GLEQS   F
Sbjct  249   --------FSSSEKKHNCLTWLDKQEPKSVMYVTFGTTTTLTDEEIEVLANGLEQSKHKF  300

Query  546   IWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             +WV+++  KG      +  +I LP+GF  RV+G GL++RDW PQ EIL H S GGF++HC
Sbjct  301   LWVLREADKGNVFDGEERREIQLPSGFVRRVDGVGLVVRDWAPQPEILAHESVGGFMSHC  360

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAI  890
             GWNSC+ES+  GVP+A WP+  DQP NA+ +TE+LK G+ +++W +  E   ++T+ N +
Sbjct  361   GWNSCIESITMGVPMAAWPMHSDQPTNAVFVTEILKMGLAVREWTNGGEEVEASTVENVV  420

Query  891   RRLM-ASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             RRLM  S EG  +R +A E    V+ +V EGG SRLE D+FIAH+TR
Sbjct  421   RRLMGGSEEGGRIRKRAEELAAVVRGAVEEGGASRLEFDSFIAHVTR  467



>ref|XP_004169070.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
Length=468

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 178/268 (66%), Gaps = 14/268 (5%)
 Frame = +3

Query  240   GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKC  419
             G +++ CR IEG  L L+    ++  K   W +GPFNPV   +  K  + SSSK   H C
Sbjct  210   GQIYNTCRVIEGSSLKLIE---RIESKFNNWALGPFNPV---KKLKNGERSSSK---HSC  260

Query  420   LEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTK-----GYKN  584
             + WLD+Q P+SVI++SFGT T + D Q++E+A GL +S Q FIWV++D  K        N
Sbjct  261   MSWLDQQEPRSVIYISFGTTTTMEDKQINEIAIGLARSHQKFIWVIRDADKVDIFHEDNN  320

Query  585   TKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATW  764
              +  LP G+ + +  RGLI+R+W PQLEIL H +TGGF+THCGWNSC+ES+  GVP+A W
Sbjct  321   KRSKLPEGYNDLIGDRGLIIREWAPQLEILSHWATGGFMTHCGWNSCLESITMGVPMAAW  380

Query  765   PIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAE  944
             P+  DQPRN + +TE+L+ G+ +K WE R+E+ ++ T+   +RRLM S +G E+R  A  
Sbjct  381   PMHSDQPRNMVFVTEILRVGLVVKGWELREEVVSALTVEEVVRRLMVSEDGAEIRMNAMR  440

Query  945   AGRAVKESVMEGGISRLEMDNFIAHITR  1028
              G AV+ S+ +GG SR E++ F+ HITR
Sbjct  441   VGEAVRRSIEDGGDSRKELEAFVNHITR  468



>ref|XP_009611304.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=487

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/301 (46%), Positives = 189/301 (63%), Gaps = 16/301 (5%)
 Frame = +3

Query  168   PSSCYPPEFFKFIVDQRKTNAFCKG--NLFDACRAIEGPYLDLLAMVYK-LARKGPVWGI  338
             P S  PP      V+++ + A   G  N+F  CR I+G YLDL+   +K        WG+
Sbjct  189   PGSDSPPPLMVKYVEKQMSCAVNYGGRNIFSTCRPIDGIYLDLMQQAFKSYDEHWKTWGL  248

Query  339   GPF-NPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELA  515
             G F NP+   +N K  +D++S  PRH  L+WLDKQ P SV+ VSFG+    +D Q+ ELA
Sbjct  249   GLFMNPLEMDQNIK--KDTTSTPPRHHLLQWLDKQEPNSVLLVSFGSAASFTDEQIRELA  306

Query  516   EGLEQSGQNFIWVVKD----------LTKGYKNTKINLPAGFEERVEGRGLILRDWVPQL  665
              GLEQS Q FIWV+K+          +  G       LP G+E+R EGRG++ R W PQL
Sbjct  307   LGLEQSQQKFIWVLKEADRANVFAENINGGSSTRAFVLPEGYEKRAEGRGIVERGWAPQL  366

Query  666   EILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWE  845
             E+L H STGG+L HCGWNS MES+  GVP+A WP+  D PR A+L+ + LK GI ++DW 
Sbjct  367   EVLGHASTGGYLCHCGWNSVMESISMGVPIAAWPLHTDHPRTALLLIKGLKIGIYVRDWA  426

Query  846   SRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
              R+E+  + TI NA++ LM S EGE+LR KAAE    VK S M+GG ++ ++++F+++IT
Sbjct  427   HRNELVKAETIHNAVKILMDSTEGEKLRQKAAELKDTVKASFMDGGATKKDIESFMSYIT  486

Query  1026  R  1028
             R
Sbjct  487   R  487



>gb|EYU18708.1| hypothetical protein MIMGU_mgv1a019962mg [Erythranthe guttata]
Length=484

 Score =   271 bits (694),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 148/349 (42%), Positives = 208/349 (60%), Gaps = 32/349 (9%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N E+Y F   SAF D   ++E++ K   VP                     LP    C  
Sbjct  161   NAESYAFNCISAFCDVKYLFEMMGKPCPVPRL-----------------QELPTIEECIT  203

Query  186   PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
                 +FI  Q +      G+L + CR +E PYLD+L    ++A     W IGP  P   K
Sbjct  204   DGVLRFIALQNEGLQLRNGDLHNTCRLLEDPYLDILES-EEIAGGRKSWAIGPLIP--AK  260

Query  366   RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                KTD        RH CL WLDKQ PKSV++V+FGT T L+D ++  +A GLEQS   F
Sbjct  261   LPEKTDGR------RHDCLTWLDKQEPKSVMYVTFGTTTTLTDEEIEVVANGLEQSKHKF  314

Query  546   IWVVKDLTKGY-----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHC  710
             +WV+++  KG      +  +I LP+GFE RV+G G++ R+W PQ EIL H S GGF++HC
Sbjct  315   LWVLREADKGNVFDGEERREIQLPSGFERRVDGVGMVFREWAPQPEILAHESVGGFMSHC  374

Query  711   GWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDW-ESRDEITTSTTIRNA  887
             GWNSC+ES+  GVP+ATWP+  DQP NA+L+TE+L+TG+ +K+W + R+ +  ++T+ + 
Sbjct  375   GWNSCIESITMGVPIATWPMHSDQPTNAVLVTEILRTGLCVKEWTKEREMVVIASTVESI  434

Query  888   IRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR*N  1034
             +RRLM S EG E+R +A +    V+ +  EGG SRLE+D+F+AHITR N
Sbjct  435   VRRLMGSEEGAEVRKRAEDLAAVVRRATEEGGASRLELDSFVAHITRQN  483



>ref|XP_009390153.1| PREDICTED: cis-zeatin O-glucosyltransferase 2-like [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   271 bits (692),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/347 (41%), Positives = 209/347 (60%), Gaps = 31/347 (9%)
 Frame = +3

Query  12    ETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPE  191
             E ++F   SAF     +WE   K L        +VG+  L   AVV +       C+  E
Sbjct  146   EAFSFHSVSAFAVLLYLWESCGKQLED-----LVVGKLNL---AVVTN-----DGCFTDE  192

Query  192   FFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRN  371
             F  F+  Q +      G L + CR+IEGP++DLL    +  R+   + +GP N  V   +
Sbjct  193   FLGFLQSQHQMTGADSGRLLNTCRSIEGPFIDLLKEEPRW-REQKTFAVGPLNQTVVADD  251

Query  372   TKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIW  551
                       + RH+CLEWLD+QPP SV++VSFGT + LSD Q+ ELA GL+ SGQ FIW
Sbjct  252   --------GTSCRHECLEWLDQQPPSSVVYVSFGTTSSLSDEQVAELAAGLQASGQRFIW  303

Query  552   VVKDLTKG--YKNTKINLPAG-------FEERVEGRGLILRDWVPQLEILDHVSTGGFLT  704
             V++D  +   Y +  I+  A        +++ V   G ++R W PQL+IL H STGGF++
Sbjct  304   VLRDADRADIYADEGISDHASGDKQLPNYDKAVHRTGRVVRGWAPQLDILAHRSTGGFMS  363

Query  705   HCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRN  884
             HCGWNSCMES+  GVP+  WP+  DQPRN +L+T +L TG+ ++DW  R+E+T +  IR+
Sbjct  364   HCGWNSCMESLSMGVPILAWPMHSDQPRNTLLVTHILGTGVLVRDWAKRNELTPAMAIRD  423

Query  885   AIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
             +I RLM S EG++++ +A   G+AV++++ EGG S+ ++D FIA+IT
Sbjct  424   SILRLMISEEGKDVQRRANAVGQAVRKAMAEGGSSKADLDAFIAYIT  470



>ref|XP_010090197.1| Zeatin O-xylosyltransferase [Morus notabilis]
 gb|EXB39066.1| Zeatin O-xylosyltransferase [Morus notabilis]
Length=264

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 179/265 (68%), Gaps = 12/265 (5%)
 Frame = +3

Query  240   GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKC  419
             G + ++CR+IE  +LDLL    +L     +W +GP NPV  +      +D        KC
Sbjct  7     GYISNSCRSIEAAFLDLLENDKELLGGKKIWAVGPLNPVTLELVNYRQED--------KC  58

Query  420   LEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDL--TKGYKNTKI  593
             LEWLD+Q   S +++SFGT   L D ++ ++A GLEQSG  FIWV++     +  K  ++
Sbjct  59    LEWLDQQEVNSALYISFGTTITLKDEEIKQMALGLEQSGIKFIWVLRAAGDQEDVKRAQL  118

Query  594   NLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQ  773
              LP GFEERV+G G+++RDW PQ++IL H STGGFL+HCGWNSCMES+  GVP+A WP++
Sbjct  119   -LPNGFEERVKGMGMVVRDWAPQMKILGHSSTGGFLSHCGWNSCMESISMGVPMAVWPMK  177

Query  774   YDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGR  953
              DQPRNA+LIT VLK G  +++WE R+E+ +S+ I + +  LM S EG E+R +A E G 
Sbjct  178   SDQPRNAVLITLVLKVGFVVREWEKREELVSSSRISDVVEILMKSEEGNEVRKRAEELGY  237

Query  954   AVKESVMEGGISRLEMDNFIAHITR  1028
              V++SV E G++R E D+FIAHITR
Sbjct  238   EVRKSVEE-GVTRKEWDSFIAHITR  261



>ref|XP_004150612.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
Length=486

 Score =   271 bits (693),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 206/350 (59%), Gaps = 26/350 (7%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPA-GAVVPDRLPIPS--S  176
             N E+Y F   SAF   ++   + RK L V        G    P      P  L + S   
Sbjct  154   NTESYCFHSVSAF---TVAHSLERKELFVNDGYKD--GEITTPTYQQYFPKELNVVSMEQ  208

Query  177   CYPPEFFKFIVDQ-RKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNP  353
             C+PPEF +FI  Q R       G +++ CR IEG +L+++  +    R    W +GPFNP
Sbjct  209   CFPPEFLEFIGSQFRHLPKMGAGKIYNTCRVIEGEFLEVIQRIEPEFRH---WALGPFNP  265

Query  354   VVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQS  533
             +   + +K    S S    H C+ WLD+Q P+SVI++SFGT T ++D Q+ E+A GL +S
Sbjct  266   L---KISKVRFSSCS----HSCMAWLDQQEPRSVIYISFGTTTAMTDEQIKEIAIGLARS  318

Query  534   GQNFIWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGF  698
              Q FIWV++D  KG      +  K NLP G+   +  +GL++RDW PQLEIL H +TGGF
Sbjct  319   DQKFIWVLRDADKGDVFDVNEIRKSNLPEGYSNLIGNQGLVIRDWAPQLEILSHWATGGF  378

Query  699   LTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTI  878
             +THCGWNSCMES+  GVP+  WP+  DQPRN +L+T VL  G+ +K+W+   E+  +  +
Sbjct  379   MTHCGWNSCMESITTGVPVIAWPMHSDQPRNTVLMTMVLCVGVALKEWQ--QELVIADAV  436

Query  879   RNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
                +R+LMAS EG E+R  A   G  V++S+ EGG SR E + FIAHITR
Sbjct  437   EEVVRKLMASEEGAEVRRNAERLGNVVRQSLEEGGESRQEFEAFIAHITR  486



>gb|KDO36524.1| hypothetical protein CISIN_1g039436mg, partial [Citrus sinensis]
Length=422

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/311 (44%), Positives = 182/311 (59%), Gaps = 25/311 (8%)
 Frame = +3

Query  6    NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
            N E+Y F   SAF     +WE             ++    +  A  ++P  +P    C+ 
Sbjct  133  NAESYTFHSVSAFTLYLYIWE-------------RMGNPNLNEASGLIPKDVPSLEGCFT  179

Query  186  PEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTK  365
             EF   I  +     F  GN+++  R IE  Y+DLL     +A     W +GPFNPV   
Sbjct  180  SEFLDSIASEYDHMKFNSGNVYNTSRVIESAYMDLLEKA-TVAETFNHWALGPFNPV---  235

Query  366  RNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNF  545
                T  +      RH CLEWLDKQ   SV++VSFGT T +SD Q+ ELA GL+QS Q F
Sbjct  236  ----TLPNKGGSNGRHFCLEWLDKQEKNSVLYVSFGTTTAMSDEQIKELAVGLKQSNQKF  291

Query  546  IWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
            IWV++D  +G     +  +  LP  +E+ V+ +GL++RDW PQLEIL H STGGF++HCG
Sbjct  292  IWVLRDADRGDVFNGEVRRAELPKAYEDSVKDKGLVVRDWAPQLEILAHCSTGGFMSHCG  351

Query  714  WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
            WNSCMES+  GVP+  WP+  DQPRN +LIT +LK G+ + DW  RDEI TS  I NA++
Sbjct  352  WNSCMESITMGVPIVAWPMHSDQPRNTLLITHLLKLGLVMADWARRDEIVTSNVIENAVK  411

Query  894  RLMASPEGEEL  926
            RLMAS EG+E+
Sbjct  412  RLMASKEGDEI  422



>ref|XP_009796221.1| PREDICTED: zeatin O-xylosyltransferase-like [Nicotiana sylvestris]
Length=311

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = +3

Query  375   KTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWV  554
             KT  +  S      CL+WL+KQPPKSV++VSFGT T  S  Q+ ELA GLE S QNFIWV
Sbjct  91    KTRNNGQSDLQNEYCLDWLNKQPPKSVLYVSFGTTTSFSGEQIKELAMGLELSKQNFIWV  150

Query  555   VKD---LTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSC  725
             ++D   +    K+ K+ LP GFEER +G GL++R+W PQ EIL H STG FL+HCGWNSC
Sbjct  151   LRDADEVDNSGKSKKLKLPEGFEERAKGVGLVVREWAPQPEILAHPSTGRFLSHCGWNSC  210

Query  726   MESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMA  905
             +ES+   VP+ATWP+ YDQP+N  L+TE+LK G+ +++WE RDE+ T++ I N +R+LM 
Sbjct  211   IESITLVVPIATWPMHYDQPKNGFLVTEILKIGLAVREWEKRDELITASAIENVVRKLMT  270

Query  906   SPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             S EG+ +RNKA E G AV++S  +GG +R+E+++FIAHITR
Sbjct  271   SEEGDVIRNKAKELGEAVRQSTQKGGAARMELESFIAHITR  311



>ref|XP_008455787.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X2 [Cucumis 
melo]
Length=446

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 148/345 (43%), Positives = 205/345 (59%), Gaps = 44/345 (13%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPS--SC  179
             N E+YNF   SAF  A    E  ++   + S              ++V D L IPS   C
Sbjct  140   NAESYNFHSVSAFAMAIYDLEQDQQTKGMES--------------SIVKD-LDIPSLDGC  184

Query  180   YPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             +  EF++F+  Q        GNL++ C+ +E PYL++L    ++  +   W IGPFNP+ 
Sbjct  185   FTQEFWEFVELQFGGPRKFSGNLYNTCKTMEEPYLEILQ---RINHETKHWAIGPFNPL-  240

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                     + SSS    H CLEWLD+Q   SV++VSFGT T L D Q+ E+A      G 
Sbjct  241   --------ELSSSSHNIHPCLEWLDQQKANSVVYVSFGTTTALEDEQIAEIA----NKGD  288

Query  540   NFIWVVKDLTKGYKNTKINLPAGFEERV--EGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
              F   V+         K  LP GFE+RV  EG+GL++RDW PQL IL H STGGF++HCG
Sbjct  289   IFNGEVR---------KCELPDGFEKRVKMEGKGLVVRDWAPQLAILSHDSTGGFVSHCG  339

Query  714   WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
             WNSCME++  GVP+  WP+  DQPRNA+L+T+VL+ G+ I++W  RDE+  +TTI  A+R
Sbjct  340   WNSCMETITMGVPMVAWPMHSDQPRNAVLMTKVLRVGLLIREWAQRDELVMATTIEKAVR  399

Query  894   RLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +LMAS EG E+R    E    ++++V E G+SR+E D+FI+HITR
Sbjct  400   KLMASEEGHEMRKTVEELAVVMRQAVEENGVSRVEFDSFISHITR  444



>ref|XP_010918854.1| PREDICTED: zeatin O-glucosyltransferase-like [Elaeis guineensis]
Length=479

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 202/354 (57%), Gaps = 37/354 (10%)
 Frame = +3

Query  12    ETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPE  191
             E ++F   SAF       E  RK    PS     + +  LP    +P+     ++C+  +
Sbjct  148   EAFSFHSVSAFALLLFYCESRRKYPDDPS-----IAKLNLPH---IPN-----NACFTQQ  194

Query  192   FFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRN  371
             F  F+  Q ++ A   G LF+ CR IEG ++DLLA   +  R    + IGP NPV   + 
Sbjct  195   FLDFLRRQHESTAADSGRLFNTCRGIEGRFIDLLAREPEW-RNQKTFAIGPLNPVSITKM  253

Query  372   TKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIW  551
             T           RH CL+WLD+QPP SV++VSFGT + LSD QL ELA GLE S Q FIW
Sbjct  254   TGYGT-------RHPCLDWLDRQPPASVMYVSFGTTSALSDEQLLELAWGLEASRQRFIW  306

Query  552   VVKDLTKGYKNTKINLPA---------------GFEERVEGRGLILRDWVPQLEILDHVS  686
             V++D  +    T+                     ++ RVE  G ++ +W PQLEIL H S
Sbjct  307   VLRDADRADIYTEEGAEGKQKAKKRREEWLGRLDYDRRVERVGRLV-EWAPQLEILAHPS  365

Query  687   TGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITT  866
             TGGF++HCGWNSCMESM  GVPL TWP+  DQPRNA+L+T VL+ GI  +DW  R+E+  
Sbjct  366   TGGFMSHCGWNSCMESMSMGVPLLTWPMHSDQPRNALLVTRVLRVGITARDWARRNEVVP  425

Query  867   STTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +  IR++I RLM S EG+E+R +A   G  V+ +  EGG SR + D FI HIT+
Sbjct  426   AAEIRDSIVRLMVSEEGKEVRVRAKAVGGVVRHATTEGGTSRADFDAFITHITQ  479



>ref|XP_010918553.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Elaeis 
guineensis]
Length=464

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/310 (43%), Positives = 192/310 (62%), Gaps = 15/310 (5%)
 Frame = +3

Query  123   FVLPAGAVVPDRLPIPSS---CYPPEFFKFIVDQRKTNAFCK--GNLFDACRAIEGPYLD  287
             F+  +  V P +  I +S   C+ P    F++   +  A     G L + CR +EG  +D
Sbjct  162   FISASSQVKPSKDAILASFEGCFTPALVDFVITNHRLRASVAEAGILINTCRPVEGESID  221

Query  288   LLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVS  467
              LA       K  ++ IGP NP +  R     QD   + P H CLEWLDKQP  SV++VS
Sbjct  222   RLARQPSFQGKS-LFAIGPLNPTILSR-----QDILGRRP-HDCLEWLDKQPAASVVYVS  274

Query  468   FGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNTKIN---LPAGFEERVEGRGL  638
             FGT + + D Q+ ELA  L++SGQ FIWV ++  +G+ + +     LPA +E  VEG G+
Sbjct  275   FGTLSTVPDEQIEELATALQRSGQRFIWVCREADRGFAHGECQQRKLPAEYERMVEGVGM  334

Query  639   ILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLK  818
             ++R W PQLEIL H +TG F++HCGWNSCMES+  GVP+  WP+Q DQP NA+L+T  LK
Sbjct  335   VVRGWAPQLEILAHPATGAFMSHCGWNSCMESISLGVPILAWPMQSDQPSNAVLVTRHLK  394

Query  819   TGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLE  998
              GI +++W+ R+EI +S+ I  +I+R+M    G+E+R +A   G AV+ ++ EGG SR E
Sbjct  395   VGIMVREWDRREEIVSSSGIEESIKRVMVDDGGKEIRTRAKALGEAVRGAMAEGGSSRAE  454

Query  999   MDNFIAHITR  1028
             +D+ +A I+R
Sbjct  455   LDSLVARISR  464



>ref|XP_010322862.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=473

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/299 (45%), Positives = 190/299 (64%), Gaps = 11/299 (4%)
 Frame = +3

Query  153   DRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVW  332
             D  P   S + P   ++ V++  T     G++ ++CR +EG ++D LA   K+    P+W
Sbjct  178   DEFPTAESTFGPNMAEY-VEEELTWKHNSGDIINSCRELEGKFIDSLA---KVKENTPLW  233

Query  333   GIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHEL  512
               GPFN +    ++ ++  S +K+ RH CLE+LDKQ   SVIFVSFGT T LS  Q+ EL
Sbjct  234   AFGPFNMLPESLDSFSNSSSGNKSTRHNCLEFLDKQDVNSVIFVSFGTTTTLSQEQVKEL  293

Query  513   AEGLEQSGQNFIWVVK------DLTKGY-KNTKINLPAGFEERVEGRGLILRDWVPQLEI  671
             A GLEQS   FIWV++      D+  G  ++ KI LP GFEERVEGRG+++R W PQLEI
Sbjct  294   ALGLEQSNHKFIWVIREADKRVDMENGEERHEKIVLPEGFEERVEGRGMVVRSWAPQLEI  353

Query  672   LDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESR  851
             L H STGGFL+HCGWNS MES+  GVP+A  P+  DQP + +L++ V K G+ +  W  R
Sbjct  354   LGHPSTGGFLSHCGWNSSMESISMGVPMAAMPMTVDQPYHTLLVSNVWKIGVSVWSWARR  413

Query  852   DEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              EI  +  I  A++ LM +PEGEE+R +  E    +K+SV  GG++  EM++FI++I +
Sbjct  414   KEIVPAVAIEKAVKTLMGTPEGEEMRQRVVELRDNIKKSVSHGGLAYKEMESFISYIIK  472



>ref|XP_006355035.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=494

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/295 (45%), Positives = 188/295 (64%), Gaps = 14/295 (5%)
 Frame = +3

Query  156   RLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWG  335
             +LP        E       Q+       G+L +  R IEG YLDLL    +L      W 
Sbjct  210   KLPSLEGIMTDEIRDLSASQQHYLDIRSGDLNNTSRVIEGKYLDLLEQA-ELNLNKKQWA  268

Query  336   IGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELA  515
             IGP  P      TK D  S+ +   + CL+WL+KQPP+SV+++SFGT T  SD ++ ELA
Sbjct  269   IGPILP------TKFDHISNRE---NICLDWLNKQPPRSVLYISFGTTTSFSDREIKELA  319

Query  516   EGLEQSGQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHV  683
              GLEQS Q FIWV++D  +G     ++ ++ LP GFEER++  GL++R+W PQ EIL H 
Sbjct  320   MGLEQSKQKFIWVLRDADRGDIFKGEDRRVELPEGFEERLKDVGLVVREWAPQPEILAHS  379

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             ST GF++HC WNSC+ES+  GV +A WP+  DQP N  L+T++LK G+ ++DW  R+++ 
Sbjct  380   STSGFMSHCDWNSCLESITMGVSIAAWPMHSDQPINGFLVTDILKIGLLVRDWGKREDVV  439

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             ++ TI N +R+LMAS EG  +R +A E G AV++S  +GG S++E+D+FIAHITR
Sbjct  440   SAFTIENVVRKLMASEEGNLIRKRAEELGEAVRQSTEKGGASQIELDSFIAHITR  494



>ref|XP_008806810.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Phoenix 
dactylifera]
Length=462

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/290 (43%), Positives = 181/290 (62%), Gaps = 14/290 (5%)
 Frame = +3

Query  177   CYPPEFFKFIVDQRKTNAFCK--GNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFN  350
             C+PP    FI+   +        G L + CR +EG ++D LA       K  ++ IGP N
Sbjct  181   CFPPALVDFIITNHRLRESVAEAGILINTCRPVEGEFIDRLAREPSFQGKT-LFAIGPLN  239

Query  351   PVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQ  530
             P +  R     +       +H CLEWLDKQPP SV++VSFGT + + D Q+ ELA GL++
Sbjct  240   PTILSREDLGRR-------QHGCLEWLDKQPPASVVYVSFGTLSTVPDEQIEELAVGLQR  292

Query  531   SGQNFIWVVKDLTKGY----KNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGF  698
             S Q FIWV ++  +G+       +  LPA +E  VEG G+++R W PQLEIL H +TG F
Sbjct  293   SRQRFIWVCREADRGFVHGESQLQRKLPAEYERMVEGVGMVVRGWAPQLEILAHPATGAF  352

Query  699   LTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTI  878
             ++HCGWNSCMES+  GVP+  WP+Q DQP NA+L+T+ LK GI  ++W  R+EI +S  I
Sbjct  353   MSHCGWNSCMESISMGVPILAWPMQSDQPSNAVLVTQHLKVGIMAREWARREEIVSSAGI  412

Query  879   RNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               +I+++M    G+ELR +A     AV+E++ +GG SR E+D+FIA ++R
Sbjct  413   EESIKKVMVYDGGKELRKRAKALAEAVREAMAKGGSSRAELDSFIARVSR  462



>ref|XP_008808448.1| PREDICTED: zeatin O-glucosyltransferase-like [Phoenix dactylifera]
Length=490

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 208/361 (58%), Gaps = 41/361 (11%)
 Frame = +3

Query  42    FHDASLVW--EVLRKILHVPSFLWKLVGRFVL-----PAGAVVPD-----RLPIP----S  173
              HD+++ +   V   + HV +F +  V  F L      +    PD     +L IP    +
Sbjct  139   IHDSTMAFAVSVAASVPHVEAFSFHSVSAFSLLLYYCESRGKPPDDPSIAKLNIPDIPNN  198

Query  174   SCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNP  353
             +C+  +F  F+  Q ++ A   G LF+ CR IEG ++DLLA   +  R    + IGP NP
Sbjct  199   ACFTEQFLDFLRRQHESTAADSGRLFNTCRGIEGRFIDLLAREPQW-RTQKTFAIGPLNP  257

Query  354   V-VTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQ  530
             + +TKR        +   PRH CLEWLDKQPP SV++VSFGT + LSD Q+ ELA GLE 
Sbjct  258   LSITKR--------TGCGPRHPCLEWLDKQPPASVLYVSFGTASALSDDQVVELAWGLEA  309

Query  531   SGQNFIWVVKDLTKGYKNTK-----INLPAGFEERVEGR----------GLILRDWVPQL  665
             S Q FIWV++D  +    T+        P   +E   GR          G ++R W PQL
Sbjct  310   SRQRFIWVLRDADRADIYTEEGDEGKQKPKKSQEERLGRLDYDRRVERVGRVVRGWAPQL  369

Query  666   EILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWE  845
             EIL H STGGF++HCGWNSCMESM  GVPL  WP+  DQPRN +L+T VL+ GI  +DW 
Sbjct  370   EILAHPSTGGFMSHCGWNSCMESMSMGVPLLAWPMHSDQPRNTLLLTRVLRVGITARDWA  429

Query  846   SRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
              R+E+  +  IR++I RLM S EG+E+R +A   G   +++  EGG SR + D FI HIT
Sbjct  430   RRNEVVPAAAIRDSIVRLMVSEEGKEVRARATAVGGVARQATTEGGTSRADFDAFITHIT  489

Query  1026  R  1028
             +
Sbjct  490   K  490



>ref|XP_009390437.1| PREDICTED: cis-zeatin O-glucosyltransferase 2-like [Musa acuminata 
subsp. malaccensis]
Length=468

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 180/299 (60%), Gaps = 17/299 (6%)
 Frame = +3

Query  159   LPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGI  338
             LP        EF  F   +   N    G L + CR IEG ++DLLA   K  R   ++ +
Sbjct  178   LPPLDGIITEEFGAFARRRMDENTSSAGRLLNTCRPIEGEFIDLLAREPK-HRDRKIFTL  236

Query  339   GPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAE  518
             GP +P+          D   +   H+CL WLDKQPP SV++VSFGT T ++D Q+ ELA 
Sbjct  237   GPLSPMAVI-------DGGRRRQPHECLYWLDKQPPASVVYVSFGTTTAMADEQVEELAN  289

Query  519   GLEQSGQNFIWVVKDLTKGY--------KNTKINLPAGFEERVEGRGLILRDWVPQLEIL  674
             GL  SGQ F+WVV+D  +G            ++ LP  FE++V G GL++R W PQL+IL
Sbjct  290   GLLLSGQRFVWVVRDADRGDIFAAEDNGHVRRMELPPEFEQKVAGTGLVVRGWAPQLDIL  349

Query  675   DHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESR-  851
              H +TG F++HCGWNSCMES+C GVP+  WP+  DQP  A L+T  LK G+ + +W  R 
Sbjct  350   SHPATGAFVSHCGWNSCMESLCMGVPVIAWPMHSDQPTIAALVTGHLKAGVTVGEWTPRA  409

Query  852   DEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             D++TT   I  AI+R+M   EG E+R +A   G AV+E++ EGG SR E+D F+AHITR
Sbjct  410   DKVTTRAVIEEAIKRVMVYDEGREIRERARVIGEAVREAIAEGGASRAELDAFVAHITR  468



>gb|EYU18709.1| hypothetical protein MIMGU_mgv1a024073mg [Erythranthe guttata]
Length=456

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 192/322 (60%), Gaps = 28/322 (9%)
 Frame = +3

Query  99    FLWKLVGRFVLPAGAVVPDRLPIPSSC--YPPEFFKFIVDQRKTNAFCKGNLFDACRAIE  272
              LW+  G+    AG   P+ L +PS    +P E   FI  + +      G++F+  R IE
Sbjct  151   ILWETAGKPFSLAGE--PNELVVPSVTEFFPEEIINFIAVKPEHFKKRDGDIFNTTRLIE  208

Query  273   GPYLDLLAMVYKLARKGPVWGIGPF------NPVVTKRNTKTDQDSSSKTPRHKCLEWLD  434
             G Y++ L    ++      W I P       NP   + N +          RHKC+EWLD
Sbjct  209   GRYIEYLGR-REIGGVEKQWAIRPTLLLRSRNPAAGELNLR----------RHKCMEWLD  257

Query  435   KQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGY----KNTKINLP  602
             KQ PKSV++V FGT   LS+ +  E+A GLE+S Q F+WV++D  K      ++ KI LP
Sbjct  258   KQAPKSVVYVCFGTSVSLSEEEAKEIALGLEESKQKFLWVLRDADKADIFAGESRKIELP  317

Query  603   AGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQ  782
              GFEERV+  G+++RDW PQ+EIL H S GGF++HCGWNSC ES+  GVP+A WP+  DQ
Sbjct  318   LGFEERVKEDGMVVRDWAPQVEILAHESVGGFMSHCGWNSCFESLVMGVPVAAWPMHSDQ  377

Query  783   PRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVK  962
             P NA+ +TEVLK G+ +++W  R+E+  +  I   + RLMAS   EE+R  A E   AVK
Sbjct  378   PLNAVFLTEVLKVGVVVREWARREEVVEAAVIGKVVERLMAS---EEIRRTAVELSAAVK  434

Query  963   ESVMEGGISRLEMDNFIAHITR  1028
             +S+ +GG    EMD+FIAHITR
Sbjct  435   KSMEDGGECSREMDSFIAHITR  456



>ref|XP_004253377.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=460

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/352 (41%), Positives = 205/352 (58%), Gaps = 37/352 (11%)
 Frame = +3

Query  6     NHETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYP  185
             N + Y+F   S+F    + +   R++LH+     +   + +   G    D  P   S + 
Sbjct  132   NIKCYSFHCFSSF----VRYSTTRQVLHIVD---EDQDKLIQELG----DEFPTVESTFG  180

Query  186   PEFFKFIVDQR--KTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPVV  359
             P   ++I ++R  K N+   G + ++ R  E  YL   A+        PVW +GPF+ ++
Sbjct  181   PHMEEYIQEEREWKLNS---GAVLNSFREFEDKYLHSFAI--HTEDNSPVWCLGPFHMLL  235

Query  360   TKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQ  539
                     + S     +   LE+LDKQ   SVIFVSFGT T  S  Q +ELA GLEQS  
Sbjct  236   --------ESSVDLYNKSASLEFLDKQEVNSVIFVSFGTTTTFSQEQANELALGLEQSNH  287

Query  540   NFIWVVK----------DLTKGYKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVST  689
              FIWV++          D ++G K+ K+ LP GFEERVEGRG+++R+W PQLEIL H ST
Sbjct  288   KFIWVIREADDKRLDAEDNSEG-KDGKVVLPEGFEERVEGRGMVVRNWAPQLEILGHRST  346

Query  690   GGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTS  869
             GGF++HCGWNSC+ES+  GVP+A+WP+  DQP N + IT VLK GI +  W  R+E   +
Sbjct  347   GGFMSHCGWNSCLESISMGVPIASWPVHVDQPYNRVFITNVLKIGISVWKWSRREETVPA  406

Query  870   TTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHIT  1025
               I  A++ LM +PEGEE+R +A E    +K SV  GG++R EM++FI++IT
Sbjct  407   AAIEKAVKTLMGTPEGEEMRQRAVELSNKIKNSVSHGGLARKEMESFISNIT  458



>ref|XP_009620160.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=459

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/317 (44%), Positives = 187/317 (59%), Gaps = 31/317 (10%)
 Frame = +3

Query  12   ETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPE  191
            E Y F   S F   S  WE  RK   VPS           P   ++ + LP   + +  E
Sbjct  153  ECYCFHSISVFTALSFAWETTRK--PVPS-----------PEAEIIAE-LPPRENTFDSE  198

Query  192  FFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-VTKR  368
              ++I  QR+   F    L ++C+ IEG ++DLL    +  R+   W IGP NPV ++K+
Sbjct  199  TLEYIKLQREARDFYSIGLHNSCKEIEGVFIDLL----EKQRENKQWAIGPLNPVEISKK  254

Query  369  NTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFI  548
                D+       +     WLDKQ   SVI+VSFG+ T LS+ Q+ ELA GLEQSGQ FI
Sbjct  255  KAGLDK-------KDDLFSWLDKQDLNSVIYVSFGSTTTLSNEQIKELALGLEQSGQKFI  307

Query  549  WVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
            WV+++  K       K +   LP G+EE ++G+G I +DW PQLEIL H S GGF++HCG
Sbjct  308  WVLREADKKGGDNVKKGSNFELPKGYEEIIKGKGYIEKDWAPQLEILAHQSIGGFMSHCG  367

Query  714  WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
            WNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+R E+ ++  I NA+R
Sbjct  368  WNSCIESISMGVPIAAWPIHSDQPRNTVLITKVLKIGIVVRDWENRHELVSAEKIENAVR  427

Query  894  RLMASPEGEELRNKAAE  944
             LM S EGEE R +  E
Sbjct  428  NLMGSAEGEEQRRRVKE  444



>ref|XP_009620161.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=459

 Score =   258 bits (658),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 139/317 (44%), Positives = 187/317 (59%), Gaps = 31/317 (10%)
 Frame = +3

Query  12   ETYNFFVGSAFHDASLVWEVLRKILHVPSFLWKLVGRFVLPAGAVVPDRLPIPSSCYPPE  191
            E Y F   S F   S  WE  RK   VPS           P   ++ + LP   + +  E
Sbjct  153  ECYCFHSISVFTALSFAWETTRK--PVPS-----------PEAEIIAE-LPPRENTFDSE  198

Query  192  FFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGIGPFNPV-VTKR  368
              ++I  QR+   F    L ++C+ IEG ++DLL    +  R+   W IGP NPV ++K+
Sbjct  199  TLEYIKLQREARDFYSIGLHNSCKEIEGVFIDLL----EKQRENKQWAIGPLNPVEISKK  254

Query  369  NTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFI  548
                D+       +     WLDKQ   SVI+VSFG+ T LS+ Q+ ELA GLEQSGQ FI
Sbjct  255  KAGLDK-------KDDLFSWLDKQDLNSVIYVSFGSTTTLSNEQIKELALGLEQSGQKFI  307

Query  549  WVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCG  713
            WV+++  K       K +   LP G+EE ++G+G I +DW PQLEIL H S GGF++HCG
Sbjct  308  WVLREADKKGGDNVKKGSNFELPKGYEEIIKGKGYIEKDWAPQLEILAHPSIGGFMSHCG  367

Query  714  WNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIR  893
            WNSC+ES+  GVP+A WPI  DQPRN +LIT+VLK GI ++DWE+R E+ ++  I NA+R
Sbjct  368  WNSCIESISMGVPIAAWPIHSDQPRNTVLITKVLKIGIVVRDWENRHELVSAEKIENAVR  427

Query  894  RLMASPEGEELRNKAAE  944
             LM S EGEE R +  E
Sbjct  428  NLMGSAEGEEQRRRVKE  444



>ref|XP_008455779.1| PREDICTED: zeatin O-xylosyltransferase-like [Cucumis melo]
Length=481

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 185/302 (61%), Gaps = 25/302 (8%)
 Frame = +3

Query  150   PDRLPIPSS--CYPPEFFKFIVDQ-RKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARK  320
             P  L + S+  C+P EF +FI  Q R       G +++ C+ IEG +L+++  +    R 
Sbjct  196   PKELNVVSTEECFPTEFLEFIGSQFRHLPKMGAGKIYNTCKFIEGEFLEVIQRIEPEFRH  255

Query  321   GPVWGIGPFNPVVTKRNTKTDQDSSSKTP-RHKCLEWLDKQPPKSVIFVSFGTQTVLSDH  497
                W +GPFNP+             SK P  H C+ WLD+Q P+SVI++SFGT T + D 
Sbjct  256   ---WALGPFNPL-----------KISKPPCSHSCMAWLDQQEPRSVIYISFGTTTTMKDE  301

Query  498   QLHELAEGLEQSGQNFIWVVKDLTKG-----YKNTKINLPAGFEERVEGRGLILRDWVPQ  662
             Q+ E+A GL +S Q FIWV++D  KG      +  K NLP G+   +  +GL+++DW PQ
Sbjct  302   QIKEIAIGLARSDQKFIWVLRDADKGDVFDVNEIRKSNLPEGYNNLIGDQGLVIKDWAPQ  361

Query  663   LEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDW  842
             LEIL H +TGGF+THCGWNSC+ES+  GVP+  WP+  DQPRN +L+T VL  G+ +K+W
Sbjct  362   LEILGHWATGGFMTHCGWNSCIESITTGVPVIAWPMHSDQPRNTVLMTRVLCVGVGLKEW  421

Query  843   ESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHI  1022
             +   E+  +  I   +R+LM S EG ++R  A   G  V++S+ EGG SR E + F+AHI
Sbjct  422   Q--QELIMAGAIEEVVRKLMVSEEGAKVRRNAERLGNVVRQSLEEGGESRKEFEAFVAHI  479

Query  1023  TR  1028
             TR
Sbjct  480   TR  481



>ref|XP_009762775.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=461

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 184/302 (61%), Gaps = 25/302 (8%)
 Frame = +3

Query  147   VPDRLPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGP  326
             + D  P+  S    +F   ++ +        G + ++CR +EG YLDLLA     A+   
Sbjct  177   MQDEFPLLESS-GAQFATMLLRKEHEWKLNSGEIMNSCRELEGKYLDLLAN----AKDNK  231

Query  327   VW-GIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQL  503
              W  +GP + ++         DSS+++ RH+CLE+LDKQ   SVI VSFGT T  S  Q+
Sbjct  232   PWLAVGPLHMLLES------HDSSNRS-RHECLEFLDKQDVNSVILVSFGTTTTFSQEQV  284

Query  504   HELAEGLEQSGQNFIWVVKDLTKGYKN-------TKINLPAGFEERVEGRGLILRDWVPQ  662
             +ELA GL QS    IWV+++  K  +N        KI LP GFEER     +++R+W PQ
Sbjct  285   NELAVGLVQSDHGLIWVLREADKKMENEKFEEKDKKIELPKGFEER-----MMVRNWAPQ  339

Query  663   LEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDW  842
             LEIL+H STG FL+HCGWNSC+ES+  GVPLA WPIQYDQP NAIL+T V K G  +K W
Sbjct  340   LEILEHPSTGVFLSHCGWNSCIESISMGVPLAIWPIQYDQPYNAILVTNVPKIGTSVKSW  399

Query  843   ESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHI  1022
               ++E+ T+  +  A++ LM + EGEE R +A E    +K S+  GG++R EM++FI+ I
Sbjct  400   AHQEELVTAKAVEKAVKTLMDTTEGEEKRQRAMELSNKIKNSLSHGGVARKEMESFISCI  459

Query  1023  TR  1028
              R
Sbjct  460   IR  461



>ref|XP_004252079.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=413

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/260 (46%), Positives = 170/260 (65%), Gaps = 15/260 (6%)
 Frame = +3

Query  270   EGPYLDLLAMVYKLARKGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPK  449
             E P LD     Y  A +   W +GP + ++  R+       SS   +++C+E+LDKQ   
Sbjct  162   EFPLLDRCCGPYAAANR-QYWAVGPVHMLLESRD-------SSNMTKNECIEFLDKQDVN  213

Query  450   SVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYK-------NTKINLPAG  608
             SVI+VSFGT T L+  Q++ELA GLEQS +NFIWV++   K  +       + KI LP G
Sbjct  214   SVIYVSFGTTTTLTQEQVNELAFGLEQSNRNFIWVLRQADKKMETENFEENDEKIELPKG  273

Query  609   FEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPR  788
             FE+RV+GRGL++++W PQLEIL H S+ GFL+HCGWNSC+ES+  GVPLA WPI YDQP 
Sbjct  274   FEDRVDGRGLVVKNWAPQLEILGHTSSSGFLSHCGWNSCLESISMGVPLAAWPINYDQPF  333

Query  789   NAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKES  968
             NA+ +T +LK    ++ W  R+E+ T++TI  A+ +LM + EG E+R +A E    ++ S
Sbjct  334   NAVFVTNLLKIATSVRSWARREELVTASTIEKAVNKLMGTTEGIEMRQRAVELSNKIRNS  393

Query  969   VMEGGISRLEMDNFIAHITR  1028
             V  GG +R E+ +FI+ IT+
Sbjct  394   VSRGGDARKEIGSFISCITK  413



>gb|EPS66453.1| hypothetical protein M569_08324, partial [Genlisea aurea]
Length=447

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 179/296 (60%), Gaps = 17/296 (6%)
 Frame = +3

Query  159   LPIPSSCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVWGI  338
             LP    C P E  +F+  + +      G++ + CR IE PYL+++     L R+   W I
Sbjct  163   LPSLQECVPEEMLRFVAQRGEALLLRDGDIHNTCRPIEAPYLEVVEREEILGRRKS-WAI  221

Query  339   GPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAE  518
             GP  P  T +NT+ D         H+C  WLD Q P SV++VSFGT T L+D Q+ E+A 
Sbjct  222   GPTFPS-TLKNTRHD---------HECFRWLDGQEPNSVVYVSFGTTTSLTDEQIGEIAF  271

Query  519   GLEQSGQNFIWVVKDLTKG----YKNTKINLP--AGFEERVEGRGLILRDWVPQLEILDH  680
             GL +SG  F+WV++D  K      +  +  LP     EE  EG G+++RDWVPQ+++L H
Sbjct  272   GLRRSGAKFLWVLRDADKADIFDRETRRAELPREFEEEEEAEGVGVVVRDWVPQIDVLRH  331

Query  681   VSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEI  860
              STGGFL+HCGWNSCMESM  GVP+  WP+  DQP NA+ I  VL  G+ ++DW  R E 
Sbjct  332   PSTGGFLSHCGWNSCMESMFAGVPMGAWPMHSDQPTNAVFICGVLGMGLMVRDWSRRTET  391

Query  861   TTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               ++ + + +RRLM + EG ELR KA E G  V ++   GG S LEMD+FIAHITR
Sbjct  392   VKASVVESCVRRLMTTSEGAELRRKAEELGGIVAQATRPGGASSLEMDSFIAHITR  447



>gb|EYU18712.1| hypothetical protein MIMGU_mgv1a004882mg [Erythranthe guttata]
Length=506

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 165/247 (67%), Gaps = 21/247 (9%)
 Frame = +3

Query  324   PVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQL  503
             P+W +GPFNP+ +           S  P +KCL WLDK  P SVI VSFGT T  S+ Q+
Sbjct  269   PIWALGPFNPLSS---------LPSSNPNNKCLSWLDKHGPNSVILVSFGTTTSFSNKQI  319

Query  504   HELAEGLEQSGQNFIWVVKDLTKG---------YKNTKINLPAGFEERVEGRGLIL-RDW  653
              E+A GLE+S Q FIWV+++  KG          K T++ LP GFEERV+ RGL+L  +W
Sbjct  320   EEIALGLERSEQKFIWVLREADKGDIFTTTKEIKKFTELPLPEGFEERVKERGLVLVNEW  379

Query  654   VPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPI  833
              PQLEIL HVSTGGFL+HCGWNSC+E +  GVP+ATWP+  DQP NA L+T+ LK G+  
Sbjct  380   APQLEILGHVSTGGFLSHCGWNSCLEGISMGVPMATWPLHSDQPANAALVTKGLKIGVEA  439

Query  834   KDW--ESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDN  1007
             K W  E  + +T++  +   +R+LM S EG  +R +AAE G AV++S MEGG +R EM+ 
Sbjct  440   KKWCVEEGEVVTSADVVEEVVRKLMVSEEGGLMRKRAAELGGAVRDSWMEGGAAREEMEA  499

Query  1008  FIAHITR  1028
             FI+HITR
Sbjct  500   FISHITR  506



>ref|XP_006358040.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum tuberosum]
Length=204

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 150/204 (74%), Gaps = 4/204 (2%)
 Frame = +3

Query  429   LDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKGYKNT----KIN  596
             + KQP +SV+++S GT T  SD Q+ EL  GLEQS Q FIWV+++  +G   T    +  
Sbjct  1     MTKQPSRSVLYISIGTSTTFSDRQVIELTIGLEQSKQKFIWVLREADRGDAFTGEARRFE  60

Query  597   LPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQY  776
             LP  FEERV+  GL++R+W PQLEIL H STGGF++H GWNSC+ES+  GVP+A+WP+  
Sbjct  61    LPERFEERVKEVGLMVREWAPQLEILAHSSTGGFMSHYGWNSCIESITMGVPIASWPMHS  120

Query  777   DQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRA  956
             DQPRN  L+TE+LK G+ +++WE R+E+ +++TI   +R+LMAS EG+ +R ++ E G A
Sbjct  121   DQPRNGFLVTEILKIGLAVREWEKREELVSASTIEKVVRKLMASEEGDAIRKRSEELGEA  180

Query  957   VKESVMEGGISRLEMDNFIAHITR  1028
             V+ S  +GG SR+E+D+FIAHITR
Sbjct  181   VRRSTEKGGSSRIELDSFIAHITR  204



>ref|XP_006854306.1| hypothetical protein AMTR_s00039p00102080 [Amborella trichopoda]
 gb|ERN15773.1| hypothetical protein AMTR_s00039p00102080 [Amborella trichopoda]
Length=488

 Score =   245 bits (626),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 186/303 (61%), Gaps = 23/303 (8%)
 Frame = +3

Query  144   VVPDRLPIPS--SCYPPEFFKFIVDQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLAR  317
             +VP  LP PS   C    F  F+    K     +G  F++  AIEG +L  +A  +    
Sbjct  200   IVPG-LPPPSFRGCVNDSFIDFLPRAVKFRHLDRGVFFNSFHAIEGQFLSRIASSH----  254

Query  318   KGPVWGIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDH  497
                VW IGP     T    K  Q+   K   H+C++WLDKQ P+SV++VSFGT   +S  
Sbjct  255   ---VWAIGP-----TVLLQKKPQEPPHKL--HECMQWLDKQAPRSVLYVSFGTVVSMSAA  304

Query  498   QLHELAEGLEQSGQNFIWVVKDLTKG------YKNTKINLPAGFEERVEGRGLILRDWVP  659
             ++ ELA+GLE SGQ F+WV++   KG        ++   LP G+EERV+GRGLI+RDW P
Sbjct  305   EVRELAQGLEASGQPFLWVLRYADKGDIFAGREADSPRGLPDGYEERVQGRGLIVRDWAP  364

Query  660   QLEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKD  839
             QLEIL H STGGFLTHCGWNSCMES+  GVP+  WP+  DQP NA L+T VL  G+ + +
Sbjct  365   QLEILHHPSTGGFLTHCGWNSCMESIAMGVPMVAWPMHSDQPVNAQLVTGVLGVGVAVGE  424

Query  840   WESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAH  1019
             W  RD+I  + ++  A+R+LMAS EG E+  KAAE   A +++V EGG S   +D F+A 
Sbjct  425   WHERDDIVRAESVERAVRKLMASEEGAEMGRKAAELRDAAQQAVGEGGTSGAALDTFLAL  484

Query  1020  ITR  1028
             I+R
Sbjct  485   ISR  487



>ref|XP_004240222.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=388

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 171/273 (63%), Gaps = 26/273 (10%)
 Frame = +3

Query  240   GNLFDACRAIEGP--YLDLLAMVYKLARKGPVWGIGP-FNPVVTKRNTKTDQDSSSKTPR  410
             G++ +  + +EG   ++DLL     + +    W IGP   P+  ++N             
Sbjct  132   GDIHNTSKVMEGSNTFIDLLG----IGQDKKQWAIGPVLRPIKNEKNG------------  175

Query  411   HKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKD--LTKGYKN  584
               CL+WLDKQPP SV++VS+   T  SD Q+ ELA GLE S Q FIW++KD   T  Y  
Sbjct  176   FPCLDWLDKQPPNSVLYVSYDMLTSFSDEQIKELAMGLELSKQKFIWLLKDPDNTDIYLG  235

Query  585   TKIN----LPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVP  752
               +N      AGFEER+ G GL++RDW PQ EIL H S GGFL+ C W SC+E++  GVP
Sbjct  236   ANLNREFEFHAGFEERLNGVGLLVRDWAPQTEILAHSSIGGFLSACDWTSCVETITMGVP  295

Query  753   LATWPIQYDQPRNAILITEVLKTGIPIKDWE-SRDEITTSTTIRNAIRRLMASPEGEELR  929
             +  WP   D P+N  L+TE+LK G+ I +W+  RDE+ T++TI N +R+LMAS EG+E+R
Sbjct  296   IIAWPTHSDHPKNGFLLTEMLKIGLVITEWDKKRDEMVTASTIDNVVRKLMASEEGDEVR  355

Query  930   NKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +A E G AV++S  +GG SR+E+D FIAHITR
Sbjct  356   KRAKELGEAVRKSTEKGGASRMELDYFIAHITR  388



>ref|XP_004240219.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=469

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 171/273 (63%), Gaps = 26/273 (10%)
 Frame = +3

Query  240   GNLFDACRAIEGP--YLDLLAMVYKLARKGPVWGIGP-FNPVVTKRNTKTDQDSSSKTPR  410
             G++ +  + +EG   ++DLL     + +    W IGP   P+  ++N             
Sbjct  213   GDIHNTSKVMEGSNTFIDLLG----IGQDKKQWAIGPVLRPIKNEKNG------------  256

Query  411   HKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKD--LTKGYKN  584
               CL+WLD+QPP SV+++S+   T  SD Q+ ELA GLE S Q FIW++KD   T  Y  
Sbjct  257   FPCLDWLDEQPPNSVLYISYDMLTSFSDEQIKELAMGLELSKQKFIWLLKDPDNTDIYLG  316

Query  585   TKIN----LPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVP  752
               +N      AGFEER+ G GL++RDW PQ EIL H S GGFL+ C W SC+E++  GVP
Sbjct  317   ANLNREFEFHAGFEERLNGVGLLVRDWAPQTEILAHSSIGGFLSACDWTSCVETVTMGVP  376

Query  753   LATWPIQYDQPRNAILITEVLKTGIPIKDWE-SRDEITTSTTIRNAIRRLMASPEGEELR  929
             +  WP   D P+N  L+TE+LK G+ I +W+  RDE+ T++TI N +R+LMAS EG+E+R
Sbjct  377   IIAWPTHSDHPKNGFLLTELLKIGLVITEWDKKRDEMVTASTIDNVVRKLMASEEGDEVR  436

Query  930   NKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
              +A E G AV++S  +GG SR+E+D FIAHITR
Sbjct  437   KRAKELGEAVRKSTEKGGASRMELDYFIAHITR  469



>ref|XP_002448305.1| hypothetical protein SORBIDRAFT_06g024960 [Sorghum bicolor]
 gb|AAT42161.1| putative cis-zeatin O-glucosyltransferase [Sorghum bicolor]
 gb|EES12633.1| hypothetical protein SORBIDRAFT_06g024960 [Sorghum bicolor]
Length=464

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/272 (43%), Positives = 168/272 (62%), Gaps = 15/272 (6%)
 Frame = +3

Query  240   GNLFDACRAIEGPYLDLLAMVYKLARKGPVW-GIGPFNPVVTKRNTKTDQDSSSKTPRHK  416
             G L ++CRA+EG ++D++A    LA  G  +  +GPFNP++   + + D  + SK PRH+
Sbjct  199   GILVNSCRALEGEFIDVVAG--DLAADGKKYFAVGPFNPLL---DLRADAQTQSK-PRHE  252

Query  417   CLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEGLEQSGQNFIWVVKDLTKG-------  575
             CL+WLDKQPP SV++VSFGT + L   Q+ ELA  L  S Q FIWV++D  +G       
Sbjct  253   CLDWLDKQPPASVLYVSFGTTSSLRTEQIAELAAALRDSDQRFIWVLRDADRGNESADDG  312

Query  576   -YKNTKINLPAGFEERVEGRGLILRDWVPQLEILDHVSTGGFLTHCGWNSCMESMCRGVP  752
               +N    L + F ++ EGRG ++  W PQLEIL H +T  F++HCGWNS MES+  G P
Sbjct  313   ESQNRHAELLSKFTDQTEGRGRVITGWAPQLEILAHGATAAFMSHCGWNSTMESLSNGKP  372

Query  753   LATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEITTSTTIRNAIRRLMASPEGEELRN  932
             +  WP+  DQP +A L+ + L  GI ++ WE   E+  +  IR  I   M S +G  +R 
Sbjct  373   ILAWPMHSDQPWDAELVCKYLNAGILVRPWEKHGEVIPAEVIRQVIEDAMLSDQGVAVRQ  432

Query  933   KAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
             +A   G AV+  + +GG SR ++D+FIAHIT+
Sbjct  433   RAKVLGEAVRACLADGGSSRKDLDDFIAHITK  464



>ref|NP_001141165.1| uncharacterized protein LOC100273251 [Zea mays]
 gb|ACF85602.1| unknown [Zea mays]
 gb|ACG34623.1| cis-zeatin O-glucosyltransferase [Zea mays]
Length=465

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 178/299 (60%), Gaps = 17/299 (6%)
 Frame = +3

Query  162   PIPSSCYPPEFFKFIV---DQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVW  332
             P P +C P EF ++IV   +  ++ AF  G + + CRAIE  ++D++A   +  R   V+
Sbjct  174   PHPGACMPREFVEYIVRTQEDSRSPAFA-GVVANTCRAIESEFIDVVAGDPE-NRGKRVF  231

Query  333   GIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHEL  512
              +GP NP++          ++ ++ RH+CL+WLDKQPP SV++VSFGT + L   Q+ EL
Sbjct  232   AVGPMNPLLN-----VTAPTAGQSARHECLDWLDKQPPASVLYVSFGTTSSLRAEQIAEL  286

Query  513   AEGLEQSGQNFIWVVKDLTKGY-------KNTKINLPAGFEERVEGRGLILRDWVPQLEI  671
             A  L  S Q F+WV++D  +G        ++      + F E  +G GL++  W PQLEI
Sbjct  287   AAALRDSKQRFVWVLRDADRGVVHEEEAVESRHARFLSEFTEETQGIGLVITGWAPQLEI  346

Query  672   LDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESR  851
             L H +T  F++HCGWNS MES+  G P+  WP+  DQP  A L+ + LK G+ ++ WE  
Sbjct  347   LAHGATAAFMSHCGWNSTMESLSHGKPMLAWPMHSDQPLVAELVCKCLKAGLLVRPWEQH  406

Query  852   DEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               +T + TIR  I ++MA  EG  +R +A E    ++ SV EGG SR ++D+F+A+I R
Sbjct  407   SAVTPAETIREVIEKVMARDEGLAVRERAKELMEFIRRSVAEGGSSRKDLDDFVAYIAR  465



>tpg|DAA36500.1| TPA: cis-zeatin O-glucosyltransferase [Zea mays]
Length=480

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 178/299 (60%), Gaps = 17/299 (6%)
 Frame = +3

Query  162   PIPSSCYPPEFFKFIV---DQRKTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVW  332
             P P +C P EF ++IV   +  ++ AF  G + + CRAIE  ++D++A   +  R   V+
Sbjct  189   PHPGACMPREFVEYIVRTQEDSRSPAFA-GVVANTCRAIESEFIDVVAGDPE-NRGKRVF  246

Query  333   GIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHEL  512
              +GP NP++          ++ ++ RH+CL+WLDKQPP SV++VSFGT + L   Q+ EL
Sbjct  247   AVGPMNPLLN-----VTAPTAGQSARHECLDWLDKQPPASVLYVSFGTTSSLRAEQIAEL  301

Query  513   AEGLEQSGQNFIWVVKDLTKGY-------KNTKINLPAGFEERVEGRGLILRDWVPQLEI  671
             A  L  S Q F+WV++D  +G        ++      + F E  +G GL++  W PQLEI
Sbjct  302   AAALRDSKQRFVWVLRDADRGVVHEEEAVESRHARFLSEFTEETQGIGLVITGWAPQLEI  361

Query  672   LDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESR  851
             L H +T  F++HCGWNS MES+  G P+  WP+  DQP  A L+ + LK G+ ++ WE  
Sbjct  362   LAHGATAAFMSHCGWNSTMESLSHGKPMLAWPMHSDQPLVAELVCKCLKAGLLVRPWEQH  421

Query  852   DEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
               +T + TIR  I ++MA  EG  +R +A E    ++ SV EGG SR ++D+F+A+I R
Sbjct  422   SAVTPAETIREVIEKVMARDEGLAVRERAKELMEFIRRSVAEGGSSRKDLDDFVAYIAR  480



>ref|XP_003580302.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Brachypodium 
distachyon]
Length=471

 Score =   231 bits (589),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 175/295 (59%), Gaps = 15/295 (5%)
 Frame = +3

Query  174   SCYPPEFFKFIVDQRK---TNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGP-VWGIG  341
             +C P E  ++I+ + +   + A C G + + CRA+EG ++D  A    LA  G  ++ +G
Sbjct  182   ACVPGEVMEYIMKRARVAESMASCVGIVCNTCRALEGEFID--AAAESLAAGGKKIFAVG  239

Query  342   PFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHELAEG  521
             P NP++    T  ++    +  RH+CL+WLDKQP  SV++VSFG+ + L + Q+ ELA  
Sbjct  240   PLNPLLDAHATAGEKQGKEQRQRHECLDWLDKQPAASVLYVSFGSTSSLREEQVAELAAA  299

Query  522   LEQSGQNFIWVVKDLTKG--YKNTK----INLPAGFEERVEGRGLILRDWVPQLEILDHV  683
             L  S Q FIWV++D  +G  Y + +      L + F  R EG GL++  W PQLEIL H 
Sbjct  300   LHGSKQRFIWVLRDADRGNIYTDDRDDRHAKLLSEFTRRTEGTGLVITGWAPQLEILAHG  359

Query  684   STGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDWESRDEIT  863
             +T  F++HCGWNS MESM  G P+  WP+  DQP +A L+   LK G+ ++ WE  +E+ 
Sbjct  360   ATAAFMSHCGWNSTMESMSHGKPILAWPMHSDQPWDAELVCGYLKAGLLVRPWEKHNEVI  419

Query  864   TSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHITR  1028
                 I+  I  +M + EG  +R +A   G AV+    EGG SR E+++FIA++TR
Sbjct  420   PVAAIQEVIETMMVAEEGLAVRQRAKALGEAVRS---EGGSSRKELEDFIAYMTR  471



>ref|XP_002448302.1| hypothetical protein SORBIDRAFT_06g024930 [Sorghum bicolor]
 gb|AAT42165.1| putative cis-zeatin O-glucosyltransferase [Sorghum bicolor]
 gb|EES12630.1| hypothetical protein SORBIDRAFT_06g024930 [Sorghum bicolor]
Length=490

 Score =   232 bits (591),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 179/302 (59%), Gaps = 18/302 (6%)
 Frame = +3

Query  162   PIPSSCYPPEFFKFIVDQR---KTNAFCKGNLFDACRAIEGPYLDLLAMVYKLARKGPVW  332
             P P++C P EF ++IV  +   ++ AF  G + +  RAIE  ++DL+A   +  R   V+
Sbjct  194   PHPAACMPREFVEYIVGTQEDGQSPAFA-GVVANTSRAIESEFIDLVAGDPQY-RGKRVF  251

Query  333   GIGPFNPVVTKRNTKTDQDSSSKTPRHKCLEWLDKQPPKSVIFVSFGTQTVLSDHQLHEL  512
              +GP NP++   +  T   ++ ++ RH+CL+WLD+QPP SV++VSFGT T L   Q+ EL
Sbjct  252   AVGPMNPLL---DVMTAPAAAGRSARHECLDWLDRQPPASVLYVSFGTTTSLPAEQIAEL  308

Query  513   AEGLEQSGQNFIWVVKDLTKGY----------KNTKINLPAGFEERVEGRGLILRDWVPQ  662
             A  L  S Q F+WV++D  +G           ++      + F E   G GL++  W PQ
Sbjct  309   AAALRDSKQRFVWVLRDADRGVVHEEEEEAAEESRHARFLSEFTEETRGIGLVITGWAPQ  368

Query  663   LEILDHVSTGGFLTHCGWNSCMESMCRGVPLATWPIQYDQPRNAILITEVLKTGIPIKDW  842
             L+I  H +T  F++HCGWNS MES+  G P+  WP+  DQP  A L+ + LK GI ++ W
Sbjct  369   LQIQAHGATAAFMSHCGWNSTMESLSHGNPMLAWPMHSDQPLVAELVCKFLKAGILVRPW  428

Query  843   ESRDEITTSTTIRNAIRRLMASPEGEELRNKAAEAGRAVKESVMEGGISRLEMDNFIAHI  1022
             E    +T +  IR AI ++MA  EG  LR +A E   +++ SV EGG SR ++D+F+A+I
Sbjct  429   EQHGAVTPADAIREAIEKVMARDEGLALRERAKELMESIRASVAEGGSSRKDLDDFVAYI  488

Query  1023  TR  1028
              R
Sbjct  489   AR  490



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3145178720708